(data stored in ACNUC7421 zone)

EMBL: CP001630

ID   CP001630; SV 1; circular; genomic DNA; STD; PRO; 8248144 BP.
XX
AC   CP001630; ABTA01000000-ABTA01000100;
XX
PR   Project:PRJNA19705;
XX
DT   15-AUG-2009 (Rel. 101, Created)
DT   02-JAN-2014 (Rel. 119, Last updated, Version 4)
XX
DE   Actinosynnema mirum DSM 43827, complete genome.
XX
KW   .
XX
OS   Actinosynnema mirum DSM 43827
OC   Bacteria; Actinobacteria; Pseudonocardiales; Pseudonocardiaceae;
OC   Actinosynnema.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-8248144
RX   DOI; 10.4056/sigs.21137.
RX   PUBMED; 21304636.
RA   Land M., Lapidus A., Mayilraj S., Chen F., Copeland A., Del Rio T.G.,
RA   Nolan M., Lucas S., Tice H., Cheng J.F., Chertkov O., Bruce D., Goodwin L.,
RA   Pitluck S., Rohde M., Goker M., Pati A., Ivanova N., Mavromatis K.,
RA   Chen A., Palaniappan K., Hauser L., Chang Y.J., Jeffries C.C., Brettin T.,
RA   Detter J.C., Han C., Chain P., Tindall B.J., Bristow J., Eisen J.A.,
RA   Markowitz V., Hugenholtz P., Kyrpides N.C., Klenk H.P.;
RT   "Complete genome sequence of Actinosynnema mirum type strain (101)";
RL   Stand Genomic Sci 1(1):46-53(2009).
XX
RN   [2]
RP   1-8248144
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Chertkov O., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Klenk H.-P., Eisen J.A.;
RT   "The complete genome of Actinosynnema mirum DSM 43827";
RL   Unpublished.
XX
RN   [3]
RP   1-8248144
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Kyrpides N., Mavromatis K., Ivanova N.,
RA   Chertkov O., Brettin T., Detter J.C., Han C., Larimer F., Land M.,
RA   Hauser L., Markowitz V., Cheng J.-F., Hugenholtz P., Woyke T., Wu D.,
RA   Klenk H.-P., Eisen J.A.;
RT   ;
RL   Submitted (29-MAY-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 9132b6938190a43e8c2a35ba13dcbd98.
DR   BioSample; SAMN00001904.
DR   CABRI; DSM 43827.
DR   EnsemblGenomes-Gn; Amir_R0001.
DR   EnsemblGenomes-Gn; Amir_R0002.
DR   EnsemblGenomes-Gn; Amir_R0003.
DR   EnsemblGenomes-Gn; Amir_R0004.
DR   EnsemblGenomes-Gn; Amir_R0005.
DR   EnsemblGenomes-Gn; Amir_R0006.
DR   EnsemblGenomes-Gn; Amir_R0007.
DR   EnsemblGenomes-Gn; Amir_R0008.
DR   EnsemblGenomes-Gn; Amir_R0009.
DR   EnsemblGenomes-Gn; Amir_R0010.
DR   EnsemblGenomes-Gn; Amir_R0011.
DR   EnsemblGenomes-Gn; Amir_R0012.
DR   EnsemblGenomes-Gn; Amir_R0013.
DR   EnsemblGenomes-Gn; Amir_R0014.
DR   EnsemblGenomes-Gn; Amir_R0015.
DR   EnsemblGenomes-Gn; Amir_R0016.
DR   EnsemblGenomes-Gn; Amir_R0017.
DR   EnsemblGenomes-Gn; Amir_R0018.
DR   EnsemblGenomes-Gn; Amir_R0019.
DR   EnsemblGenomes-Gn; Amir_R0020.
DR   EnsemblGenomes-Gn; Amir_R0021.
DR   EnsemblGenomes-Gn; Amir_R0022.
DR   EnsemblGenomes-Gn; Amir_R0023.
DR   EnsemblGenomes-Gn; Amir_R0024.
DR   EnsemblGenomes-Gn; Amir_R0025.
DR   EnsemblGenomes-Gn; Amir_R0026.
DR   EnsemblGenomes-Gn; Amir_R0027.
DR   EnsemblGenomes-Gn; Amir_R0028.
DR   EnsemblGenomes-Gn; Amir_R0029.
DR   EnsemblGenomes-Gn; Amir_R0030.
DR   EnsemblGenomes-Gn; Amir_R0031.
DR   EnsemblGenomes-Gn; Amir_R0032.
DR   EnsemblGenomes-Gn; Amir_R0033.
DR   EnsemblGenomes-Gn; Amir_R0034.
DR   EnsemblGenomes-Gn; Amir_R0035.
DR   EnsemblGenomes-Gn; Amir_R0036.
DR   EnsemblGenomes-Gn; Amir_R0037.
DR   EnsemblGenomes-Gn; Amir_R0038.
DR   EnsemblGenomes-Gn; Amir_R0039.
DR   EnsemblGenomes-Gn; Amir_R0040.
DR   EnsemblGenomes-Gn; Amir_R0041.
DR   EnsemblGenomes-Gn; Amir_R0042.
DR   EnsemblGenomes-Gn; Amir_R0043.
DR   EnsemblGenomes-Gn; Amir_R0044.
DR   EnsemblGenomes-Gn; Amir_R0045.
DR   EnsemblGenomes-Gn; Amir_R0046.
DR   EnsemblGenomes-Gn; Amir_R0047.
DR   EnsemblGenomes-Gn; Amir_R0048.
DR   EnsemblGenomes-Gn; Amir_R0049.
DR   EnsemblGenomes-Gn; Amir_R0050.
DR   EnsemblGenomes-Gn; Amir_R0051.
DR   EnsemblGenomes-Gn; Amir_R0052.
DR   EnsemblGenomes-Gn; Amir_R0053.
DR   EnsemblGenomes-Gn; Amir_R0054.
DR   EnsemblGenomes-Gn; Amir_R0055.
DR   EnsemblGenomes-Gn; Amir_R0056.
DR   EnsemblGenomes-Gn; Amir_R0057.
DR   EnsemblGenomes-Gn; Amir_R0058.
DR   EnsemblGenomes-Gn; Amir_R0059.
DR   EnsemblGenomes-Gn; Amir_R0060.
DR   EnsemblGenomes-Gn; Amir_R0061.
DR   EnsemblGenomes-Gn; Amir_R0062.
DR   EnsemblGenomes-Gn; Amir_R0063.
DR   EnsemblGenomes-Gn; Amir_R0064.
DR   EnsemblGenomes-Gn; Amir_R0065.
DR   EnsemblGenomes-Gn; Amir_R0066.
DR   EnsemblGenomes-Gn; Amir_R0067.
DR   EnsemblGenomes-Gn; Amir_R0068.
DR   EnsemblGenomes-Gn; Amir_R0069.
DR   EnsemblGenomes-Gn; Amir_R0070.
DR   EnsemblGenomes-Gn; Amir_R0071.
DR   EnsemblGenomes-Gn; Amir_R0072.
DR   EnsemblGenomes-Gn; Amir_R0073.
DR   EnsemblGenomes-Gn; Amir_R0074.
DR   EnsemblGenomes-Gn; Amir_R0075.
DR   EnsemblGenomes-Gn; Amir_R0076.
DR   EnsemblGenomes-Gn; Amir_R0077.
DR   EnsemblGenomes-Gn; Amir_R0078.
DR   EnsemblGenomes-Gn; Amir_R0079.
DR   EnsemblGenomes-Gn; EBG00001451521.
DR   EnsemblGenomes-Gn; EBG00001451522.
DR   EnsemblGenomes-Gn; EBG00001451523.
DR   EnsemblGenomes-Gn; EBG00001451524.
DR   EnsemblGenomes-Gn; EBG00001451525.
DR   EnsemblGenomes-Gn; EBG00001451526.
DR   EnsemblGenomes-Gn; EBG00001451527.
DR   EnsemblGenomes-Gn; EBG00001451528.
DR   EnsemblGenomes-Gn; EBG00001451529.
DR   EnsemblGenomes-Gn; EBG00001451530.
DR   EnsemblGenomes-Gn; EBG00001451531.
DR   EnsemblGenomes-Gn; EBG00001451532.
DR   EnsemblGenomes-Gn; EBG00001451533.
DR   EnsemblGenomes-Gn; EBG00001451534.
DR   EnsemblGenomes-Gn; EBG00001451535.
DR   EnsemblGenomes-Gn; EBG00001451536.
DR   EnsemblGenomes-Gn; EBG00001451537.
DR   EnsemblGenomes-Gn; EBG00001451538.
DR   EnsemblGenomes-Gn; EBG00001451539.
DR   EnsemblGenomes-Gn; EBG00001451540.
DR   EnsemblGenomes-Gn; EBG00001451541.
DR   EnsemblGenomes-Gn; EBG00001451542.
DR   EnsemblGenomes-Gn; EBG00001451543.
DR   EnsemblGenomes-Gn; EBG00001451544.
DR   EnsemblGenomes-Gn; EBG00001451546.
DR   EnsemblGenomes-Gn; EBG00001451548.
DR   EnsemblGenomes-Gn; EBG00001451550.
DR   EnsemblGenomes-Gn; EBG00001451552.
DR   EnsemblGenomes-Gn; EBG00001451554.
DR   EnsemblGenomes-Gn; EBG00001451556.
DR   EnsemblGenomes-Gn; EBG00001451558.
DR   EnsemblGenomes-Gn; EBG00001451561.
DR   EnsemblGenomes-Gn; EBG00001451562.
DR   EnsemblGenomes-Gn; EBG00001451564.
DR   EnsemblGenomes-Gn; EBG00001451565.
DR   EnsemblGenomes-Gn; EBG00001451567.
DR   EnsemblGenomes-Gn; EBG00001451569.
DR   EnsemblGenomes-Gn; EBG00001451572.
DR   EnsemblGenomes-Gn; EBG00001451574.
DR   EnsemblGenomes-Gn; EBG00001451575.
DR   EnsemblGenomes-Gn; EBG00001451578.
DR   EnsemblGenomes-Gn; EBG00001451580.
DR   EnsemblGenomes-Gn; EBG00001451582.
DR   EnsemblGenomes-Gn; EBG00001451583.
DR   EnsemblGenomes-Gn; EBG00001451585.
DR   EnsemblGenomes-Gn; EBG00001451587.
DR   EnsemblGenomes-Gn; EBG00001451589.
DR   EnsemblGenomes-Gn; EBG00001451592.
DR   EnsemblGenomes-Gn; EBG00001451594.
DR   EnsemblGenomes-Gn; EBG00001451596.
DR   EnsemblGenomes-Gn; EBG00001451598.
DR   EnsemblGenomes-Gn; EBG00001451600.
DR   EnsemblGenomes-Gn; EBG00001451602.
DR   EnsemblGenomes-Gn; EBG00001451604.
DR   EnsemblGenomes-Gn; EBG00001451606.
DR   EnsemblGenomes-Gn; EBG00001451608.
DR   EnsemblGenomes-Gn; EBG00001451610.
DR   EnsemblGenomes-Gn; EBG00001451612.
DR   EnsemblGenomes-Gn; EBG00001451614.
DR   EnsemblGenomes-Gn; EBG00001451617.
DR   EnsemblGenomes-Gn; EBG00001451620.
DR   EnsemblGenomes-Gn; EBG00001451624.
DR   EnsemblGenomes-Gn; EBG00001451626.
DR   EnsemblGenomes-Gn; EBG00001451628.
DR   EnsemblGenomes-Gn; EBG00001451630.
DR   EnsemblGenomes-Gn; EBG00001451632.
DR   EnsemblGenomes-Gn; EBG00001451634.
DR   EnsemblGenomes-Gn; EBG00001451636.
DR   EnsemblGenomes-Gn; EBG00001451638.
DR   EnsemblGenomes-Gn; EBG00001451640.
DR   EnsemblGenomes-Gn; EBG00001451642.
DR   EnsemblGenomes-Gn; EBG00001451643.
DR   EnsemblGenomes-Gn; EBG00001451645.
DR   EnsemblGenomes-Gn; EBG00001451647.
DR   EnsemblGenomes-Gn; EBG00001451648.
DR   EnsemblGenomes-Gn; EBG00001451650.
DR   EnsemblGenomes-Gn; EBG00001451652.
DR   EnsemblGenomes-Gn; EBG00001451655.
DR   EnsemblGenomes-Gn; EBG00001451657.
DR   EnsemblGenomes-Gn; EBG00001451658.
DR   EnsemblGenomes-Gn; EBG00001451660.
DR   EnsemblGenomes-Gn; EBG00001451662.
DR   EnsemblGenomes-Gn; EBG00001451663.
DR   EnsemblGenomes-Gn; EBG00001451664.
DR   EnsemblGenomes-Gn; EBG00001451665.
DR   EnsemblGenomes-Gn; EBG00001451666.
DR   EnsemblGenomes-Gn; EBG00001451667.
DR   EnsemblGenomes-Gn; EBG00001451668.
DR   EnsemblGenomes-Gn; EBG00001451669.
DR   EnsemblGenomes-Gn; EBG00001451670.
DR   EnsemblGenomes-Gn; EBG00001451671.
DR   EnsemblGenomes-Gn; EBG00001451672.
DR   EnsemblGenomes-Gn; EBG00001451673.
DR   EnsemblGenomes-Gn; EBG00001451674.
DR   EnsemblGenomes-Gn; EBG00001451675.
DR   EnsemblGenomes-Gn; EBG00001451676.
DR   EnsemblGenomes-Gn; EBG00001451677.
DR   EnsemblGenomes-Gn; EBG00001451678.
DR   EnsemblGenomes-Gn; EBG00001451679.
DR   EnsemblGenomes-Gn; EBG00001451680.
DR   EnsemblGenomes-Gn; EBG00001451681.
DR   EnsemblGenomes-Gn; EBG00001451682.
DR   EnsemblGenomes-Gn; EBG00001451683.
DR   EnsemblGenomes-Gn; EBG00001451684.
DR   EnsemblGenomes-Gn; EBG00001451685.
DR   EnsemblGenomes-Gn; EBG00001451686.
DR   EnsemblGenomes-Gn; EBG00001451687.
DR   EnsemblGenomes-Gn; EBG00001451688.
DR   EnsemblGenomes-Gn; EBG00001451689.
DR   EnsemblGenomes-Gn; EBG00001451690.
DR   EnsemblGenomes-Gn; EBG00001451691.
DR   EnsemblGenomes-Gn; EBG00001451692.
DR   EnsemblGenomes-Gn; EBG00001451693.
DR   EnsemblGenomes-Gn; EBG00001451694.
DR   EnsemblGenomes-Gn; EBG00001451695.
DR   EnsemblGenomes-Gn; EBG00001451696.
DR   EnsemblGenomes-Gn; EBG00001451697.
DR   EnsemblGenomes-Gn; EBG00001451698.
DR   EnsemblGenomes-Gn; EBG00001451699.
DR   EnsemblGenomes-Gn; EBG00001451700.
DR   EnsemblGenomes-Gn; EBG00001451701.
DR   EnsemblGenomes-Tr; Amir_R0001-1.
DR   EnsemblGenomes-Tr; Amir_R0002-1.
DR   EnsemblGenomes-Tr; Amir_R0003-1.
DR   EnsemblGenomes-Tr; Amir_R0004-1.
DR   EnsemblGenomes-Tr; Amir_R0005-1.
DR   EnsemblGenomes-Tr; Amir_R0006-1.
DR   EnsemblGenomes-Tr; Amir_R0007-1.
DR   EnsemblGenomes-Tr; Amir_R0008-1.
DR   EnsemblGenomes-Tr; Amir_R0009-1.
DR   EnsemblGenomes-Tr; Amir_R0010-1.
DR   EnsemblGenomes-Tr; Amir_R0011-1.
DR   EnsemblGenomes-Tr; Amir_R0012-1.
DR   EnsemblGenomes-Tr; Amir_R0013-1.
DR   EnsemblGenomes-Tr; Amir_R0014-1.
DR   EnsemblGenomes-Tr; Amir_R0015-1.
DR   EnsemblGenomes-Tr; Amir_R0016-1.
DR   EnsemblGenomes-Tr; Amir_R0017-1.
DR   EnsemblGenomes-Tr; Amir_R0018-1.
DR   EnsemblGenomes-Tr; Amir_R0019-1.
DR   EnsemblGenomes-Tr; Amir_R0020-1.
DR   EnsemblGenomes-Tr; Amir_R0021-1.
DR   EnsemblGenomes-Tr; Amir_R0022-1.
DR   EnsemblGenomes-Tr; Amir_R0023-1.
DR   EnsemblGenomes-Tr; Amir_R0024-1.
DR   EnsemblGenomes-Tr; Amir_R0025-1.
DR   EnsemblGenomes-Tr; Amir_R0026-1.
DR   EnsemblGenomes-Tr; Amir_R0027-1.
DR   EnsemblGenomes-Tr; Amir_R0028-1.
DR   EnsemblGenomes-Tr; Amir_R0029-1.
DR   EnsemblGenomes-Tr; Amir_R0030-1.
DR   EnsemblGenomes-Tr; Amir_R0031-1.
DR   EnsemblGenomes-Tr; Amir_R0032-1.
DR   EnsemblGenomes-Tr; Amir_R0033-1.
DR   EnsemblGenomes-Tr; Amir_R0034-1.
DR   EnsemblGenomes-Tr; Amir_R0035-1.
DR   EnsemblGenomes-Tr; Amir_R0036-1.
DR   EnsemblGenomes-Tr; Amir_R0037-1.
DR   EnsemblGenomes-Tr; Amir_R0038-1.
DR   EnsemblGenomes-Tr; Amir_R0039-1.
DR   EnsemblGenomes-Tr; Amir_R0040-1.
DR   EnsemblGenomes-Tr; Amir_R0041-1.
DR   EnsemblGenomes-Tr; Amir_R0042-1.
DR   EnsemblGenomes-Tr; Amir_R0043-1.
DR   EnsemblGenomes-Tr; Amir_R0044-1.
DR   EnsemblGenomes-Tr; Amir_R0045-1.
DR   EnsemblGenomes-Tr; Amir_R0046-1.
DR   EnsemblGenomes-Tr; Amir_R0047-1.
DR   EnsemblGenomes-Tr; Amir_R0048-1.
DR   EnsemblGenomes-Tr; Amir_R0049-1.
DR   EnsemblGenomes-Tr; Amir_R0050-1.
DR   EnsemblGenomes-Tr; Amir_R0051-1.
DR   EnsemblGenomes-Tr; Amir_R0052-1.
DR   EnsemblGenomes-Tr; Amir_R0053-1.
DR   EnsemblGenomes-Tr; Amir_R0054-1.
DR   EnsemblGenomes-Tr; Amir_R0055-1.
DR   EnsemblGenomes-Tr; Amir_R0056-1.
DR   EnsemblGenomes-Tr; Amir_R0057-1.
DR   EnsemblGenomes-Tr; Amir_R0058-1.
DR   EnsemblGenomes-Tr; Amir_R0059-1.
DR   EnsemblGenomes-Tr; Amir_R0060-1.
DR   EnsemblGenomes-Tr; Amir_R0061-1.
DR   EnsemblGenomes-Tr; Amir_R0062-1.
DR   EnsemblGenomes-Tr; Amir_R0063-1.
DR   EnsemblGenomes-Tr; Amir_R0064-1.
DR   EnsemblGenomes-Tr; Amir_R0065-1.
DR   EnsemblGenomes-Tr; Amir_R0066-1.
DR   EnsemblGenomes-Tr; Amir_R0067-1.
DR   EnsemblGenomes-Tr; Amir_R0068-1.
DR   EnsemblGenomes-Tr; Amir_R0069-1.
DR   EnsemblGenomes-Tr; Amir_R0070-1.
DR   EnsemblGenomes-Tr; Amir_R0071-1.
DR   EnsemblGenomes-Tr; Amir_R0072-1.
DR   EnsemblGenomes-Tr; Amir_R0073-1.
DR   EnsemblGenomes-Tr; Amir_R0074-1.
DR   EnsemblGenomes-Tr; Amir_R0075-1.
DR   EnsemblGenomes-Tr; Amir_R0076-1.
DR   EnsemblGenomes-Tr; Amir_R0077-1.
DR   EnsemblGenomes-Tr; Amir_R0078-1.
DR   EnsemblGenomes-Tr; Amir_R0079-1.
DR   EnsemblGenomes-Tr; EBT00001604938.
DR   EnsemblGenomes-Tr; EBT00001604939.
DR   EnsemblGenomes-Tr; EBT00001604940.
DR   EnsemblGenomes-Tr; EBT00001604941.
DR   EnsemblGenomes-Tr; EBT00001604942.
DR   EnsemblGenomes-Tr; EBT00001604943.
DR   EnsemblGenomes-Tr; EBT00001604944.
DR   EnsemblGenomes-Tr; EBT00001604945.
DR   EnsemblGenomes-Tr; EBT00001604946.
DR   EnsemblGenomes-Tr; EBT00001604947.
DR   EnsemblGenomes-Tr; EBT00001604948.
DR   EnsemblGenomes-Tr; EBT00001604949.
DR   EnsemblGenomes-Tr; EBT00001604950.
DR   EnsemblGenomes-Tr; EBT00001604951.
DR   EnsemblGenomes-Tr; EBT00001604952.
DR   EnsemblGenomes-Tr; EBT00001604953.
DR   EnsemblGenomes-Tr; EBT00001604954.
DR   EnsemblGenomes-Tr; EBT00001604955.
DR   EnsemblGenomes-Tr; EBT00001604956.
DR   EnsemblGenomes-Tr; EBT00001604957.
DR   EnsemblGenomes-Tr; EBT00001604958.
DR   EnsemblGenomes-Tr; EBT00001604959.
DR   EnsemblGenomes-Tr; EBT00001604960.
DR   EnsemblGenomes-Tr; EBT00001604961.
DR   EnsemblGenomes-Tr; EBT00001604962.
DR   EnsemblGenomes-Tr; EBT00001604963.
DR   EnsemblGenomes-Tr; EBT00001604964.
DR   EnsemblGenomes-Tr; EBT00001604965.
DR   EnsemblGenomes-Tr; EBT00001604966.
DR   EnsemblGenomes-Tr; EBT00001604967.
DR   EnsemblGenomes-Tr; EBT00001604968.
DR   EnsemblGenomes-Tr; EBT00001604969.
DR   EnsemblGenomes-Tr; EBT00001604970.
DR   EnsemblGenomes-Tr; EBT00001604971.
DR   EnsemblGenomes-Tr; EBT00001604972.
DR   EnsemblGenomes-Tr; EBT00001604973.
DR   EnsemblGenomes-Tr; EBT00001604974.
DR   EnsemblGenomes-Tr; EBT00001604975.
DR   EnsemblGenomes-Tr; EBT00001604976.
DR   EnsemblGenomes-Tr; EBT00001604977.
DR   EnsemblGenomes-Tr; EBT00001604978.
DR   EnsemblGenomes-Tr; EBT00001604979.
DR   EnsemblGenomes-Tr; EBT00001604980.
DR   EnsemblGenomes-Tr; EBT00001604981.
DR   EnsemblGenomes-Tr; EBT00001604982.
DR   EnsemblGenomes-Tr; EBT00001604983.
DR   EnsemblGenomes-Tr; EBT00001604984.
DR   EnsemblGenomes-Tr; EBT00001604985.
DR   EnsemblGenomes-Tr; EBT00001604986.
DR   EnsemblGenomes-Tr; EBT00001604987.
DR   EnsemblGenomes-Tr; EBT00001604988.
DR   EnsemblGenomes-Tr; EBT00001604989.
DR   EnsemblGenomes-Tr; EBT00001604990.
DR   EnsemblGenomes-Tr; EBT00001604991.
DR   EnsemblGenomes-Tr; EBT00001604992.
DR   EnsemblGenomes-Tr; EBT00001604993.
DR   EnsemblGenomes-Tr; EBT00001604994.
DR   EnsemblGenomes-Tr; EBT00001604995.
DR   EnsemblGenomes-Tr; EBT00001604996.
DR   EnsemblGenomes-Tr; EBT00001604997.
DR   EnsemblGenomes-Tr; EBT00001604998.
DR   EnsemblGenomes-Tr; EBT00001604999.
DR   EnsemblGenomes-Tr; EBT00001605000.
DR   EnsemblGenomes-Tr; EBT00001605001.
DR   EnsemblGenomes-Tr; EBT00001605002.
DR   EnsemblGenomes-Tr; EBT00001605003.
DR   EnsemblGenomes-Tr; EBT00001605004.
DR   EnsemblGenomes-Tr; EBT00001605005.
DR   EnsemblGenomes-Tr; EBT00001605006.
DR   EnsemblGenomes-Tr; EBT00001605007.
DR   EnsemblGenomes-Tr; EBT00001605008.
DR   EnsemblGenomes-Tr; EBT00001605009.
DR   EnsemblGenomes-Tr; EBT00001605010.
DR   EnsemblGenomes-Tr; EBT00001605011.
DR   EnsemblGenomes-Tr; EBT00001605012.
DR   EnsemblGenomes-Tr; EBT00001605013.
DR   EnsemblGenomes-Tr; EBT00001605014.
DR   EnsemblGenomes-Tr; EBT00001605015.
DR   EnsemblGenomes-Tr; EBT00001605016.
DR   EnsemblGenomes-Tr; EBT00001605017.
DR   EnsemblGenomes-Tr; EBT00001605018.
DR   EnsemblGenomes-Tr; EBT00001605019.
DR   EnsemblGenomes-Tr; EBT00001605020.
DR   EnsemblGenomes-Tr; EBT00001605021.
DR   EnsemblGenomes-Tr; EBT00001605022.
DR   EnsemblGenomes-Tr; EBT00001605023.
DR   EnsemblGenomes-Tr; EBT00001605024.
DR   EnsemblGenomes-Tr; EBT00001605025.
DR   EnsemblGenomes-Tr; EBT00001605026.
DR   EnsemblGenomes-Tr; EBT00001605027.
DR   EnsemblGenomes-Tr; EBT00001605028.
DR   EnsemblGenomes-Tr; EBT00001605029.
DR   EnsemblGenomes-Tr; EBT00001605030.
DR   EnsemblGenomes-Tr; EBT00001605031.
DR   EnsemblGenomes-Tr; EBT00001605032.
DR   EnsemblGenomes-Tr; EBT00001605033.
DR   EnsemblGenomes-Tr; EBT00001605034.
DR   EnsemblGenomes-Tr; EBT00001605035.
DR   EnsemblGenomes-Tr; EBT00001605036.
DR   EnsemblGenomes-Tr; EBT00001605037.
DR   EnsemblGenomes-Tr; EBT00001605038.
DR   EnsemblGenomes-Tr; EBT00001605039.
DR   EnsemblGenomes-Tr; EBT00001605040.
DR   EnsemblGenomes-Tr; EBT00001605041.
DR   EnsemblGenomes-Tr; EBT00001605042.
DR   EnsemblGenomes-Tr; EBT00001605043.
DR   EnsemblGenomes-Tr; EBT00001605044.
DR   EnsemblGenomes-Tr; EBT00001605045.
DR   EnsemblGenomes-Tr; EBT00001605046.
DR   EnsemblGenomes-Tr; EBT00001605047.
DR   EnsemblGenomes-Tr; EBT00001605048.
DR   EnsemblGenomes-Tr; EBT00001605049.
DR   EnsemblGenomes-Tr; EBT00001605050.
DR   EnsemblGenomes-Tr; EBT00001605051.
DR   EnsemblGenomes-Tr; EBT00001605052.
DR   EnsemblGenomes-Tr; EBT00001605053.
DR   EnsemblGenomes-Tr; EBT00001605054.
DR   EnsemblGenomes-Tr; EBT00001605055.
DR   EnsemblGenomes-Tr; EBT00001605056.
DR   EnsemblGenomes-Tr; EBT00001605057.
DR   EnsemblGenomes-Tr; EBT00001605058.
DR   EuropePMC; PMC3035213; 21304636.
DR   EuropePMC; PMC3271361; 21320320.
DR   EuropePMC; PMC3406152; 22660709.
DR   EuropePMC; PMC3571714; 23330869.
DR   EuropePMC; PMC4210621; 25301375.
DR   EuropePMC; PMC5640789; 29062941.
DR   EuropePMC; PMC6454037; 31001220.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001630.
DR   SILVA-SSU; CP001630.
DR   StrainInfo; 267378; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082379
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Actinosynnema mirum 101, DSM 43827
CC   Culture Collection ID :: DSM 43827, ATCC 29888, NBRC 14064
CC   GOLD Stamp ID         :: Gc01024
CC   Funding Program       :: DOE-GEBA 2007
CC   Assembly Method       :: Newbler version 1.1.02.15, Phrap
CC   Sequencing Depth      :: 8.9x Sanger; 20x pyrosequence
CC   Gene Calling Method   :: Prodigal
CC   Isolation Site        :: "Blade of grass from Raritan River NJ,
CC                            USA"
CC   Collection Date       :: September 1976
CC   Isolation Country     :: USA
CC   Latitude              :: 40.491816
CC   Longitude             :: -74.322087
CC   Oxygen Requirement    :: Aerobe
CC   Motility              :: Nonmotile
CC   Sporulation           :: Sporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 10-30C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Soil
CC   Phenotypes            :: Nocardicin A producer
CC   Energy Source         :: Chemoorganotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8248144
FT                   /organism="Actinosynnema mirum DSM 43827"
FT                   /strain="DSM 43827"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:446462"
FT   gene            98..1831
FT                   /locus_tag="Amir_0001"
FT   CDS_pept        98..1831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bha:BH0001 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33975"
FT                   /db_xref="GOA:C6WCF4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF4"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACU33975.1"
FT                   /translation="MSDHQADLGLVWEQVVEELANSALSSSTLSPQQRAWMRVTRPIGL
FT                   LDGTALLAAPSDFAKEAIERALREPITAALSRRLGRAVSLAVKVDSPEPPMASGPPTTP
FT                   IPVPMPPVPPSVAHGITFGQQVLGPVGPNGQTSLPIGGQADGPAGPPPPAPTGLPLEQP
FT                   ANAQAPAESPESDAEPEEGDEERETLATVNEIWPKFSRGAGGQPTPPSGTPFTRPANPA
FT                   SSQTRLNEKYNFDTFVIGASNRFAHAAAVAVAEAPARAYNPLFIWGESGLGKTHLLHAV
FT                   GHYAQRLFPGMRVRYVSTEEFTNDFINSLRDDRKVAFQRRYRDIDVLLVDDIQFLEGKE
FT                   GTQEEFFHTFNTLHNSNKQIVVSSDRPPKRLETLEDRLRTRFEWGLITDIQPPELETRI
FT                   AILRKKAAQDRLAAPAEVLEFIAARVVRNIRELEGALIRVTAFASLNRQPVDVQLAEIV
FT                   LRDLIPDSHVPEITAPTIMAVTAEFFEVTIEDLCGPGKTKVLSTARQISMYLCRELTDL
FT                   SLPKIGQTFGGRDHTTVMYADKKIRKEMAERRRIYDQVQELTSRIKQRSRYLVAPPVDP
FT                   T"
FT   gene            2628..3764
FT                   /locus_tag="Amir_0002"
FT   CDS_pept        2628..3764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: azc:AZC_1013 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33976"
FT                   /db_xref="GOA:C6WCF5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF5"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACU33976.1"
FT                   /translation="MKIRVERDGLADAVAWVARSLPSRPPVPVLGGVLLDAGAEDGSGD
FT                   ALTVSGFDYEVSAQCGVPATISDGGKALVSGKLLADITKALPNHPVEINVDGARMTITC
FT                   GSAKFSLPTMPVEDYPALPSMPQLAGELPGEVFGEAVAQVAVAAGKDDTLPMLTGVRLE
FT                   IADGKLVLVATDRFRLAMREFEWTPDETLGDVAVLVPAKTLNDSAKTLGASGAKIELSL
FT                   AANDGLLGLSGNGRRTTTRLLDADFPKYRQLLPSEHSAAAIISVDTLVQAIKRVSLVAE
FT                   RGTQVRLEFGDAGLKLSAGGDDEGSAEEELPVDYQGDPVTIAFNPTYLLEGLQAVRTPR
FT                   AHLSFTTPSRPALLKPVNEDGEVAEGYVYLLMPVRLPG"
FT   gene            3806..4720
FT                   /locus_tag="Amir_0003"
FT   CDS_pept        3806..4720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein; NADP oxidoreductase coenzyme F420-dependent; KEGG:
FT                   dde:Dde_3470 6-phosphogluconate dehydrogenase- like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33977"
FT                   /db_xref="GOA:C6WCF6"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF6"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ACU33977.1"
FT                   /translation="MQLGIVGLGKMGFNMRERVRRAGHEVVGYDRNPDVSDTTSLADLA
FT                   AKLTGPRVVWVMVPAGEITRNTVAELSEVLSEGDLVIDGGNSRFTDDALNAAKLAEKGI
FT                   GYLDCGVSGGVWGLENGYGLMVGGDAADVERAMPIFDALRPEGPREEGFAHAGKLGAGH
FT                   FAKMVHNGIEYGLMQAYAEGFELLEASELVENVPATIKAWQRGTVVRSWLLDLLVNALD
FT                   SDPELDDLRGYVEDSGEGRWTVEEAINHAVPAPVISAALFARFASRQSDSPAMRAVAAL
FT                   RNQFGGHAVQSAGPSSGSGSTQG"
FT   gene            4728..5843
FT                   /locus_tag="Amir_0004"
FT   CDS_pept        4728..5843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: bsu:BSU00040 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33978"
FT                   /db_xref="GOA:C6WCF7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF7"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACU33978.1"
FT                   /translation="MYVRHLQVTDFRSWEHADLAFEPGVNVLVGRNGHGKTNLVEALGY
FT                   VATLGSHRVASDAPLIRSGAQRAVVRTAVVNEGRELLVELEITPGRANRARVNRGPVPR
FT                   PRDVLGILRTVLFAPEDLSLVRGDPGERRRFLDELLTLRAPRYAGVRSDYERVLRQRGA
FT                   LLKTVRSVRSAELGTLDVWDGHLAKHGAELLAARLDLVAAIAPHAAAAYAEVAPESRPA
FT                   LLSYRSSLGEAFPGTHDREVLEDALLAELHRLRPQEIDRGVCLVGPHRDDLELSLGELP
FT                   AKGYASHGESWSFALALRLGAYELLREEGAEPVLVLDDVFAELDRGRRRQLAKVAAAAE
FT                   QVFITAAVAEDVPEELDAARFHVGHGEVRRD"
FT   gene            6031..6462
FT                   /locus_tag="Amir_0005"
FT   CDS_pept        6031..6462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33979"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF8"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACU33979.1"
FT                   /translation="MRSRRATGGAAARRRRRTWSGPGPDDRDPQPLGRLASRIAADRGW
FT                   AEKLRGGQVIAQWPKLVGEDVAEHAQPVSFEDGELTVQADSTAWATQLRLLQRELLKKI
FT                   AAGLGPNVVKRLKVLGPAAPSWRYGPRHVSGRGPRDTYG"
FT   gene            6701..8674
FT                   /locus_tag="Amir_0006"
FT   CDS_pept        6701..8674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: bha:BH0006 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33980"
FT                   /db_xref="GOA:C6WCF9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF9"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACU33980.1"
FT                   /translation="MAAQKKDYGASSITVLEGLEAVRKRPGMYIGSTGERGLHHLIQEV
FT                   VDNSVDEAMAGYASKVVVTLLANGGVRVVDDGRGIPVDLHPVEGKPTLEVVLTKLHAGG
FT                   KFDSDSYAVSGGLHGVGISVVNALSTAVDVEVKRQGFTWNQRFEASKPAHELQRGVPTS
FT                   ETGTTITFWADPTIFETTDYNIETISRRLQEMAFLNKGLSIVLRDERVAEEGAEEADAE
FT                   GHVAKVRERVFHYPGGLEDFVRHLNHTREAVHQKVVSFEAKGDDLEVEVAMQWNTGYTP
FT                   SVYTFANTINTHEGGTHEEGFRAALTRVVNEYARDKKLIKEKDANLTGDDIREGLAAII
FT                   SVKLKEPQFEGQTKTKLGNSEAKSFVQKSTNEHLADWFERHPNEAKTIITKAVSSSQAR
FT                   IAARKARELVRRKGALDIGGLPGKLKDCRSSNPEECEVYIVEGDSAGGSAKEGRDSMYQ
FT                   AILPIRGKIINVEKARIDRVLKNTEVQSIITAMGTGIHDEFDVSKLRYHKVVLMADADV
FT                   DGQHIRTLLLTLLFRFMRPLLEHGHVYLAQPPLYKIKWLRAEPEYAYSDRERDGLIEQG
FT                   LAAGKKIGKDDNIQRYKGLGEMNAEELWETTMDPANRVLLQVTMDDAAAADELFSVLMG
FT                   EDVEARRSFITRNAKGVRFLDV"
FT   gene            8721..11243
FT                   /locus_tag="Amir_0007"
FT   CDS_pept        8721..11243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: sus:Acid_3975 DNA gyrase subunit A; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33981"
FT                   /db_xref="GOA:C6WCG0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG0"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACU33981.1"
FT                   /translation="MSETTLPPIGGGSDRTEPRDLQQEMQNSYIDYAMSVIVGRALPDV
FT                   RDGLKPVHVRVLYSMFDSRFLPERSYNKCARVVGDVMGNYHPHGDSAIYDALVRLAQPW
FT                   AMRYPLIDGQGNFGSQGNDPAAAMRYTECRLTPLAMRMLADIEEDTVDFRDNYDGRIQE
FT                   PTVLPSRVPNLLINGSSGIAVGMATNIPPHNLREVAEGVVWALDNPEASDEETLEAMIA
FT                   RIKGPDFPTYGQILGTQGIEDAYRTGRGSVKMRAVVEMDEDAKGRTILVVSELPYQVNP
FT                   DNLVENIASLVRDQKINGISNIADESNRRSGMRIVVTVKRDAVAKVVLNNLYKHTQLQY
FT                   SFGVNMLSLVDGVPRTLRLDQMIRHYVKHQIEVIVRRTKFRLRKAEERAHVWRGLVKAL
FT                   DQLDAVIALIRRSDTTESARSGLMELLSVDEVQSNAILEMQLRRLAALERQKIIDQLAE
FT                   IELQIADLKDILAKPERQRAIVRGELLEIVDKHGDDRRTKIVPFDGDVSMEDLIAVEDV
FT                   VVTITRTGYAKRTKTDLYRAQKRGGKGVQGAQLKQDDIVQHFFVCSTHDWILFFTNKGR
FT                   VYRTKAYDLPEASRNARGQHVANLLAFQPDEEIAQVIQIKNYEAAPYLVLATRNGLVKK
FT                   SKLSDFDSNRSGGLIGINLREEDELVGAVLTGEGDDLLLVSKDGQSIRFHSSDDVLRPM
FT                   GRATSGVQGMRFNSDDELLSMGVVQEGLFVLVATDGGYAKRTPIEDYPVQGRGGKGVLT
FT                   IQHDRRRGRLVGALIVDVEDELYAITSAGGVIRTSAKEIRKAGRQTKGVRLMNLGEKST
FT                   LIAVARNADEPADVSTGEEDDQAIEPAN"
FT   gene            11278..12144
FT                   /locus_tag="Amir_0008"
FT   CDS_pept        11278..12144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33982"
FT                   /db_xref="GOA:C6WCG1"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33982.1"
FT                   /translation="MTPPEKEDRDADKTAVITRPSVEAAKAPEAAAASSGEPEKKPEEV
FT                   VTTAVPAAAPEAAKAPEKPAEKPVDESPTVAVTPPPWQRSTSEGGYSEAAQVGPGDDVK
FT                   PAEAGAPASPVFPSLDQDTVAVAKPVPPGAAPAAAAAAAAPRTAVNLGTQSRPQASSSA
FT                   RRPGRGPRRASLQVKRVDPWSVLKLALVLSVALFFVWLVAVGVLYGVLNGMGVWDKINN
FT                   TANDLLQSEEASGDPLISAGRVFGVSAIVGAVNIVLFTALATVGAFVYNVSADLAGGLE
FT                   VTLSERE"
FT   gene            12199..12275
FT                   /locus_tag="Amir_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            12199..12275
FT                   /locus_tag="Amir_R0001"
FT                   /product="tRNA-Ile"
FT   gene            12309..12428
FT                   /locus_tag="Amir_0009"
FT   CDS_pept        12309..12428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0009"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33983"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33983.1"
FT                   /translation="MKKIIALVAVAGAVLFFVKRSRAAKADADLWREATAPAN"
FT   sig_peptide     12309..12380
FT                   /locus_tag="Amir_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.925 at
FT                   residue 24"
FT   gene            12465..12537
FT                   /locus_tag="Amir_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            12465..12537
FT                   /locus_tag="Amir_R0002"
FT                   /product="tRNA-Ala"
FT   gene            complement(12873..13304)
FT                   /locus_tag="Amir_0010"
FT   CDS_pept        complement(12873..13304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0010"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: gur:Gura_3338 DoxX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33984"
FT                   /db_xref="GOA:C6WCG3"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG3"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACU33984.1"
FT                   /translation="MSLLDRGREQILSIFRIVIAFFMICHGAQKVFGVLGGKGGFSPLN
FT                   WPSGPAGLIEVVGGALVLIGLWTRVASIIVSGAMAYAYFVVHQPMGLLPIENKGELAAV
FT                   YSWAFLLLAFTGPGVWAVDTILASRKKNAENRELANAAA"
FT   gene            13441..13986
FT                   /locus_tag="Amir_0011"
FT   CDS_pept        13441..13986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to Host cell factor C1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33985"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="InterPro:IPR018567"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33985.1"
FT                   /translation="MKRLLPSLLILGALTACGGQESSGGTSAQASQPASTQVTTSSTPS
FT                   GPPPAPEPAVEGTCPYLDKSDVAQANGQLVPKVMLSSDETNPACFFYANATEIQLTVRV
FT                   YRGDATTAKALVNEAAPIADSNPATEPAGWEGGSMATDAGAVYAVAKAGDAVVITSNQK
FT                   QTIKAKQIAKLVVQGLAG"
FT   sig_peptide     13441..13533
FT                   /locus_tag="Amir_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.566 at
FT                   residue 31"
FT   gene            complement(14069..14509)
FT                   /locus_tag="Amir_0012"
FT   CDS_pept        complement(14069..14509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0012"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpt:Rpal_3590 putative histon H1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33986"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33986.1"
FT                   /translation="MTADHVRGVVADRAGLLVERAEQVEKQTRRSRRKLAKRAKAVRKD
FT                   VAKATERARKEAGVRAKDIRKAAKQARKEFGKPQKSSRKWPWVLGLLTAGAVAGWVALN
FT                   KRPQEVLLEEEAPLHPLNGDIPSSGTTDRDAASRNGRVTERS"
FT   gene            14769..15317
FT                   /locus_tag="Amir_0013"
FT   CDS_pept        14769..15317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0013"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: bba:Bd0177 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33987"
FT                   /db_xref="GOA:C6WCG6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG6"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACU33987.1"
FT                   /translation="MADSNESLVGRKVTATLHTSQGVIKINLFPDHAPKTVANFVGLAE
FT                   GTKAYTEANAKGEASGPFYDGAIFHRVIAGFMLQGGDPTGTGRGGPGYKFADEFHPELK
FT                   FDRPYLLAMANAGPNTNGSQFFITVAPTSWLNFKHTIFGEVADQDSRNVVDAIENGPTG
FT                   AADRPVKDVVIEKVAIEKV"
FT   gene            15317..16213
FT                   /locus_tag="Amir_0014"
FT   CDS_pept        15317..16213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0014"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: bsu:BSU24870
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33988"
FT                   /db_xref="GOA:C6WCG7"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG7"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACU33988.1"
FT                   /translation="MAGTPVPPGGPIGAQPGQAACARHPDRATGLLCARCERPACPDCL
FT                   REAAVGFQCVDCVTEGARTTRQARTVEGATHASTGRRLLVVPVLIVVNLALFALTAYLG
FT                   GGVTDRDVFQSDVTQEGALVPYFVALGEWWRLVTSGFLHLGVTHIGLNMASLYILGRDL
FT                   EPVLGRARFLAVYLLSLLGGSASVYLFEEVVSLTAGASGAIYGLMGSLLVVLLRRRLNA
FT                   TPVLAIIAINVFLSFSLPNISILGHLGGIAVGAAVTAALVYAPRGPQRARWQAGSVVAF
FT                   AVALVVLTVVRTAVLVG"
FT   gene            complement(16463..16885)
FT                   /locus_tag="Amir_0015"
FT   CDS_pept        complement(16463..16885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33989"
FT                   /db_xref="GOA:C6WCG8"
FT                   /db_xref="InterPro:IPR019692"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33989.1"
FT                   /translation="MTSPPPTRSWAPNPAFVALAGALAVVVLVLLLMSPDAPSRVMLGL
FT                   AVALLGWMSLQGALVRPKLAVDETGLTVRGLRREHHMAWHEVKVRLQSTRRLGRVVRTL
FT                   ELDWERGEDERLVVLTQLDLGADPQDVAEVLHALRP"
FT   gene            complement(17118..17384)
FT                   /locus_tag="Amir_0016"
FT   CDS_pept        complement(17118..17384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0016"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33990"
FT                   /db_xref="GOA:C6WCG9"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG9"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ACU33990.1"
FT                   /translation="MPKSKVRKKAVYTAPADRRTPVKVKAAGPSHPFYITVMLGVMLLG
FT                   LAWLVVNYIAGEKIPVMMDLGSWNFGIGFSLIIVGLLMTMRWR"
FT   gene            17775..18836
FT                   /locus_tag="Amir_0017"
FT   CDS_pept        17775..18836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0017"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: sus:Acid_5377 sortase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33991"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH0"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ACU33991.1"
FT                   /translation="MLRPVGDAPTQYAQPVGRSLPPPPGRPVAPPRHRAPRRPVEPPTE
FT                   VIPRFEDDRDDYEDPQDDLDRDDLDRDDLDRDERAGADRHEPEYPPEGPLRKVVRGTGE
FT                   ALITLGLVVLLFVVYEVYVTDLISAGKQDDVTSALDEEWKDSNTVAADPQREVKYDLLD
FT                   GKAFAKIYIPVFGADYKFSIVEGTTDKDLETGPGHYKGTALPGEKGNFAVAGHRVGKGS
FT                   PFNDLDLLSSCDAIVVETQASWFVYRMLPKNSEVAGWASRASDPRCKDVAPLSGPYSKT
FT                   QGQEIVLPSAGEVINEVPYNEAQVPEDQLKSLMTLTTCHPRFSDKQRLIVHATLAQHYP
FT                   KSDGFLPPELKEQ"
FT   gene            18838..18996
FT                   /locus_tag="Amir_0018"
FT   CDS_pept        18838..18996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0018"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33992"
FT                   /db_xref="GOA:C6WCH1"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU33992.1"
FT                   /translation="MYSWIWRHLPGPLPVRVLEAVVLVAGVVALLMFVVFPWAEPMLPF
FT                   NQVTTEQ"
FT   gene            complement(19042..20388)
FT                   /locus_tag="Amir_0019"
FT   CDS_pept        complement(19042..20388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0019"
FT                   /product="Ferredoxin--NADP(+) reductase"
FT                   /EC_number="1.18.1.2"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: ade:Adeh_3296 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33993"
FT                   /db_xref="GOA:C6WCH2"
FT                   /db_xref="InterPro:IPR021163"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH2"
FT                   /inference="protein motif:PRIAM:1.18.1.2"
FT                   /protein_id="ACU33993.1"
FT                   /translation="MSRSLRVAVVGAGPAGIYAADILTKSDAEVSIDLFERMPAPYGLI
FT                   RYGVAPDHPRIKGIVNALQKVLDRPEIRFFGNVEYGVDVKLEDLRQHYDAVIFSTGAEK
FT                   DRAMDVPGIELDGSYGAADFVSWYDGHPDVPRTWPLTASQVAVLGVGNVALDVARVLAK
FT                   TADELLTTEIPDNVYEGLKSSPVTDVHVFGRRGPAQAKFTPLELRELDHSPNVEVIVHP
FT                   EGIDFDEGSMASIRSSKQVEMVVKTLQEWALRDVGDRPRRLHLHFLEAPVEVTGEDGKV
FT                   VGLRTERMELAGDGNVKGTGEFTDWPVQAVYRAVGYLSTSLVDLPFDTASGTVPHAGGR
FT                   VVDLDEQPLPGVYVTGWIKRGPVGLIGHTKGDALETVTNLLADADALPACQFPEPDAIV
FT                   RFLEQRAVPFTTVEGWLKLDAHEKALGAERGRERVKVVDRETMTSVSRS"
FT   sig_peptide     complement(20329..20388)
FT                   /locus_tag="Amir_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.925) with cleavage site probability 0.828 at
FT                   residue 20"
FT   gene            20454..21095
FT                   /locus_tag="Amir_0020"
FT   CDS_pept        20454..21095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0020"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   swi:Swit_3227 anthranilate synthase, component II"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33994"
FT                   /db_xref="GOA:C6WCH3"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH3"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACU33994.1"
FT                   /translation="MRVLVVDNYDSFVYNLVQYLAQLGAECVVKRNDEVGPEDVAAAGG
FT                   VLVSPGPSTPHRAGRSMDVVRWCADSGVPVFGVCLGHQAIGAVWGATVDLAPELLHGKT
FT                   SVVHHEGAGVLAGLPRPFTATRYHSLTVLPETIPDEFEVTCRTEGGVVMGMRHRELPVE
FT                   GVQFHPESVLTDGGHRMLANWLAVCGYEVPEAVVGGLERNMRDLAAAARR"
FT   gene            complement(21196..23241)
FT                   /locus_tag="Amir_0021"
FT   CDS_pept        complement(21196..23241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0021"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG: bha:BH2504
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33995"
FT                   /db_xref="GOA:C6WCH4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH4"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU33995.1"
FT                   /translation="MSTPRLLSNRYELGETLGYGGMSEVHKGKDVRLSRDVAIKVLRAD
FT                   LARDAQFQERFRREAQNSAALNHPAIVAVYDTGETETQYGPLPYIVMEYVDGRTLRDIV
FT                   KTQGPLSNKRAMEVMADVSAALDFSHRHGIVHRDVKPANVMITRSGAVKVMDFGIARAV
FT                   HDGQAAVTQTAAVIGTAQYLSPEQAKGEAVDGRSDVYASGCVLFELLTGEPPFTGDSPV
FT                   AVAYQHVREEPKSPSSLNPKVSPALDSIVLKAMAKGPANRYQSAAELRADLVRVLSGQR
FT                   PSAPVVMTSEERTALLDQQSASAPTRSEAVQTTSGGGRHRQSVVRERERERDREDTGNY
FT                   SAALEEERERLAARRRMWMITIVVLLCAGVLALAIWITTSLLGDNESSGGDPKQVTVPT
FT                   LIGKSTSEARGALSDAGLEINLQLVPCQPGSQPKCDPAKDVDRVLETSPTSGKSVDRNS
FT                   KITVMVGTNPDDVEVPDLTGLSVADAQAKLGEDWKLDTNQERVETSDPAKVDKVVEQNP
FT                   MHGTKAPKGTTITIKIGKEPEAVTLPNVIGVQEDDARSSLEQSGFKVQVKQVDSATDAG
FT                   QVIAQDPGAGRVEKGSTVTLSVSKGNMVSMPDLRGMTENEAKAALRQFQWNGDLQTTKT
FT                   PVSDLSQDRKVQSQQTSPGSAITKAQRITVVIGEFRPGASSTPPSN"
FT   gene            complement(23322..25025)
FT                   /locus_tag="Amir_0022"
FT   CDS_pept        complement(23322..25025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0022"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; SMART: serine/threonine protein
FT                   kinase; tyrosine protein kinase; KEGG: ade:Adeh_3649
FT                   serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33996"
FT                   /db_xref="GOA:C6WCH5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU33996.1"
FT                   /translation="MLSSGQLLAERYRLTRRIAVGGMGEVWEAADTRLDRNVAVKVLKA
FT                   ELSGDAEFLNRFRIEARTTASLNHPGIAGVHDYGETASEPDGPEDTAYLVMELVEGEPL
FT                   AAVIARGRMNAERVLDVLEQAGTALQAAHERGLVHRDVKPGNILVTPDGKVKITDFGIA
FT                   KAADAAPVTRSGMVMGTAHYIAPEQATGHDAEPASDVYALAVCGYECLVGHRPFRSENA
FT                   VTVAMMHIRDVAPPLPPDVPPAVRALIEATLVKDPRQRYRNGGEFASAVAAVRAGQPLP
FT                   APSGLAMAVGGPQLAPPPQAPPSQQLPVQQLQVQPMQAQPMQAQSMQAQPMQAQSMQAQ
FT                   PMSAPPMQAQPMSAPPMPQQPMPSQQLPAQLAPPQQLAAPPPVAPQQLTPPAQLTHPGI
FT                   PVTHPGSRPGMQPIHPPAAGPHTGAFHPPGAPGRHPGRGRPLLWVMVAFLVIALIALSV
FT                   LIVREIAGDDGVPGGPSPQGSTPSASRAAPEDATDRFPGRPTVEITGADYLGAPADEVA
FT                   ATLTGHGVEPEVRSERGGAPADARRCRVSELEPEGEVPIGSRVRVTCVPT"
FT   gene            complement(25025..26491)
FT                   /locus_tag="Amir_0023"
FT   CDS_pept        complement(25025..26491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0023"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: penicillin-binding protein 2; K05515 penicillin
FT                   binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33997"
FT                   /db_xref="GOA:C6WCH6"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH6"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACU33997.1"
FT                   /translation="MNTPLRRVGVAMMVMMMILLANATYVQVIKAEEYRTSPYNVRGRL
FT                   EMLSRERGSIIAADGTPLATVTPIPDKDRWQRVYANGPMYLPVTGYLSNTYGSNGLERA
FT                   ENDLLIGEDDRLFTRRLSDLITGRDPKGASLQVTINPKAQQAAYEALGDRTGAVVAIEP
FT                   KTGKILALVSTPSFDPNKLAVQDGQEEKAYWAEVTQDNPAQPDANRALSWTYPPGSTFK
FT                   LVVAAAGLEEGMDKSTQVDARPTITLPGTNTELPNFNGTNCNNGVNATLEQAIAQSCNT
FT                   AFAKLAGDLGTAKLREQAAKFGIDDQKYQVPMTTAASTLGPVPDQAALFQTGIGQRDVQ
FT                   VTPLANAVMVATIANKGVRMKPYLVDKILGTDTATVDETKPDEVDEAISEDSAQLLTEM
FT                   MIAAENKAGGAGKLSNIQIASKTGTAEWGVGSTPNPHAWYTAFAPANDPQIALAVIVEK
FT                   SGGKRDGAATGSLVAAPVGRAVISSYLGSR"
FT   sig_peptide     complement(26420..26491)
FT                   /locus_tag="Amir_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.769 at
FT                   residue 24"
FT   gene            complement(26488..27951)
FT                   /locus_tag="Amir_0024"
FT   CDS_pept        complement(26488..27951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0024"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: bcb:BCB4264_A4012
FT                   stage V sporulation protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33998"
FT                   /db_xref="GOA:C6WCH7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH7"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACU33998.1"
FT                   /translation="MGSPGTGAEDTPLARASGTSPGLKPPPTKRSTELFLLAFGAVLVT
FT                   AALVLVEANQEKELSLNIIWYGLAYLVMLAVTHLAVRTWAPYADPVILPCVTLLNGIGL
FT                   VMIHRIDLGMADVLVDGEPWSAAAPKQVMWTGLSLVLFCAALKLLKDHRTLAKFGYVSG
FT                   LVGLVALILPGVLPGFIAPTINGAKIWLRFGGVSIQPGEFAKILLMVFFAAFLVSKRDL
FT                   FTIAGRRFLGMDLPRARDLGPLIAVWAVVVSVMVLQKDLGSSLLFFGIVLVLLYVATER
FT                   AVWIIIGTVLFMGAAVAAWRMFTHVQTRVDNWVDPFADPGGAGYQIVQSLFGFGTGGLF
FT                   GAGLGGGRPDQIPEANTDFIAAVIGEELGLVGLTAVLLLYTVFALRGLRNALAVRDTFG
FT                   KLLGGGLAFAVAFQVFIIIGGVMKLIPMTGITAPFLSKGGSSLLANYVLVALLLRISDA
FT                   ARSPQAPVKPRVQQPAIADQFTVMVERPK"
FT   gene            complement(27955..29379)
FT                   /locus_tag="Amir_0025"
FT   CDS_pept        complement(27955..29379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0025"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: tgr:Tgr7_0952 protein
FT                   phosphatase 2C-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33999"
FT                   /db_xref="GOA:C6WCH8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH8"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ACU33999.1"
FT                   /translation="MTLVLRYAARSDRGLVRQNNQDSVYAGPRLLALADGMGGHAAGEV
FT                   ASKVVIAALAPLDDDEPGDDLLGQLRDAVISGNGAISELVQSDPDLDGMGTTLTAVLFA
FT                   GTRLGMVHIGDSRAYMMRNGTFSQITHDDTFVQSLIDEGRITEEEAATHPQRSLLLRAL
FT                   TGHEVEPRLMVREARPGDRYLLCSDGLSGVVTLETLDEAIRIPDPQACADRMIELALKG
FT                   GGPDNVTVVVADVVDVDFGENAPIVGGAAGDGGDDPPPPDSPASRASSITGPRPAPPRQ
FT                   EQPPPPQQDPKRERKGKLKALALVVLVLALLAAAGLGTRWWVMRQYYVGAAQDGQVSVF
FT                   RGVTGNVLGFELNTVVEGSCPPGSQGCEPISLDDLKVFMRDEVSSGITAVDGLEGAREA
FT                   IRRLRTEQLLPLCADPLTSTPAPPTTTTGSATSAEQPPPSGDQGTSSSAPPTTTTEGTP
FT                   LPTLAQTPGTDCRKGQ"
FT   gene            complement(29376..29840)
FT                   /locus_tag="Amir_0026"
FT   CDS_pept        complement(29376..29840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0026"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: mxa:MXAN_4649 FHA domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34000"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCH9"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU34000.1"
FT                   /translation="MPELVMQLTRAGFLILLWLFVLAALRVVRSDLYAASGLRVPTPSI
FT                   KKGFRGAGKGGAKAPRQLVVTQGALSGTRITLDGKPIMIGRADDSTLVLDDDFASTRHA
FT                   RLSARGDEWFVEDLGSTNGTYLDRAKVTSPVRVPIGSQIRIGKTVIELRS"
FT   gene            complement(29891..31153)
FT                   /locus_tag="Amir_0027"
FT   CDS_pept        complement(29891..31153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0027"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: eba:ebA2155 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34001"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI0"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU34001.1"
FT                   /translation="MGLVQRFERRLEGMVGDTFARVFGGNVVSQEVAQALQREADGNIR
FT                   ELAGGRLLAPNHYVVLLGPEDHDRLAGDGQDELRITKSLGDSIQEHLEESGWDTYGDVV
FT                   VSLERSDALHTGQFRTRSSVDPDVKVDSRRSAPPRTAGDGSMSQPPGYGQGQGQPGYDP
FT                   YAQGGYGGQQPGYDQQGYGQGGQQQGYGQGQQGYDQQGYGQGGQQPGYDQGYGQGGQPG
FT                   YGQGQQGYDQGYGQGGYGGQQPGYDQQGYAGGQQPGYGQGQQGYDQGYGQGGAGYDQGG
FT                   QAGYGQQAAGYDQAGYGQQAAGYDQGYGQQAGYGGAPAGGAQRQLSATLHLDDGSNRTY
FT                   NLKQGGNVVGRGQEADFRLPDTGVSRRHLEITWDGHSAMLADLGSTNGTTVNGTPVQTW
FT                   QLAEGDVVRIGHSSLVFRTQG"
FT   gene            31268..31353
FT                   /locus_tag="Amir_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            31268..31353
FT                   /locus_tag="Amir_R0003"
FT                   /product="tRNA-Leu"
FT   gene            31797..32417
FT                   /locus_tag="Amir_0028"
FT   CDS_pept        31797..32417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34002"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34002.1"
FT                   /translation="MSSTPARIEVTDSAKAKATSAAAVPIPELPGSVEELATVAAVRLG
FT                   WHGVVLPEMVLMGRKVVVVADLIADAHAERLCLGAAPEVDRATVSTWVWPEMDGRVPPA
FT                   AVRIVGVLAVARHWRTALASAVPFARFGNAAAVLPASVALSHDYLANCLPRVRRYGVNV
FT                   LLADESSELTTDVCGRNETVPVEDTATTRWVNELVYERVLATA"
FT   gene            32468..33103
FT                   /locus_tag="Amir_0029"
FT   CDS_pept        32468..33103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0029"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   xca:xccb100_0085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34003"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI2"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACU34003.1"
FT                   /translation="MRLVIAGGHGKIALHVQRLLAAGGDAATALVRNEDHFADVTEAGG
FT                   VPVLCDLEASDVASVAEYLTGADAVLFAAGAGPGSGVGRKDSVDRGASALLADAAERAG
FT                   VRRFVQISSAGIGRTTGDEVFDAYLLAKGAAEEDLKARDLDWTIVRPGRLTDEPATGAV
FT                   RLTEGDAQDGSVPRADVAAVVVAVLAQPSSVGKTYELISGETPVQDAI"
FT   gene            complement(33316..34593)
FT                   /locus_tag="Amir_0030"
FT   CDS_pept        complement(33316..34593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0030"
FT                   /product="FAD-linked oxidoreductase"
FT                   /EC_number="1.1.3.8"
FT                   /note="KEGG: bur:Bcep18194_B3008 FAD-linked oxidoreductase;
FT                   TIGRFAM: FAD-linked oxidoreductase; PFAM:
FT                   D-arabinono-14-lactone oxidase; FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34004"
FT                   /db_xref="GOA:C6WCI3"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI3"
FT                   /inference="protein motif:TFAM:TIGR01679"
FT                   /protein_id="ACU34004.1"
FT                   /translation="MAPPWTNWARTETAAPIRVEHPTTAEGISEVVRTADAVRARGSGH
FT                   SFTGVAVAPSVALDLDRWTGLVDVAGELVTVRAGTTLRQLNELLHREGLAMPNLGDIDA
FT                   QTIAGATATGTHGTGAALGGLATTIVALEVVLADGSLVRCSPTERPDLFEAARLGLGAV
FT                   GVISTLTLRCVPSFVLHAREYPARLDAVLEEFDHLTATEDHVEFHWFPHGDRVIVKRNN
FT                   RVDEPRAPLSGLRRFYEYDVMENAAFGAVCKVARAVPATARGLNRMCGALIGERDYRDQ
FT                   SHRVFTTPRRVRFVETEYAVPRAELHGVLRELRAAVAGLEHGVIVPVEVRVARGDDIWL
FT                   STAHGRDTAYVAVHQYVGMPHRRYFDAFERIALAVGGRPHWGKLHSLGAEELATRYPRF
FT                   ADFRRVRAEVDPDRKFGNRHLERVLG"
FT   gene            34677..35864
FT                   /locus_tag="Amir_0031"
FT   CDS_pept        34677..35864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0031"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bur:Bcep18194_B3007 amino acid aldolase or racemase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34005"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI4"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACU34005.1"
FT                   /translation="MQPRTRLDLATKDLEAPLAIVDLDAFDHNAADLVRRAGGKPIRVA
FT                   SKSVRVRALLDRVLARPGYAGLMCYSLPEALWLSSCDTAEDLLVAYPTVDHAALRALAA
FT                   DKKARGRVTIMVDSTAHLDLVDAALGEDHPEIRVCLELDVSWRPLPGLHVGPRRSPVHT
FT                   EGDAVRLARAVVARKGFRLVGVMAYEGQVAGIGDAPAGRRAWGLAVRWMQGRSVPELTE
FT                   RRAAAVAAVRRVADLEFVNGGGTGSLETTGADRSVTELAAGSGLVGPTLFDAYRAFSPR
FT                   PAALFALPVVRRPKKNVATLFAGGYVASGTGTPDRLPSPHLPSGLELIGLEGAGEVQTP
FT                   VVGKAADRLELGDRVWLRHAKAGELAERFAEYHLVSGDRVEAVVPTYRGEGKAFG"
FT   gene            complement(35861..36493)
FT                   /locus_tag="Amir_0032"
FT   CDS_pept        complement(35861..36493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0032"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: scl:sce5559
FT                   HTH-type transcriptional regulator BetI"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34006"
FT                   /db_xref="GOA:C6WCI5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR041674"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI5"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34006.1"
FT                   /translation="MTSTTPLRRQPVQQRSAKRVERMLEACAALIEEVGYDGVTTTLIA
FT                   ERAGVAVGSLYQFFPDKRAVVQELTLRNLERFIQTVDGTFTTKALAHWWDAVDSIFDVY
FT                   VAMHREVPAFSRLHFGDVVDLRLMDDRKDNNSVVSDRIAEMISSRFAIPLDEVKLPISI
FT                   AVEAADGVLGLAFRRDPAGDPLVLDEAKAMIRGYLSTRMPGQPPATP"
FT   gene            36613..37875
FT                   /locus_tag="Amir_0033"
FT   CDS_pept        36613..37875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0033"
FT                   /product="beta-galactosidase"
FT                   /note="TIGRFAM: beta-galactosidase; PFAM: glycoside
FT                   hydrolase family 1; KEGG: hch:HCH_06907
FT                   beta-glucosidase/6-phospho-beta-
FT                   glucosidase/beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34007"
FT                   /db_xref="GOA:C6WCI6"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI6"
FT                   /inference="protein motif:TFAM:TIGR03356"
FT                   /protein_id="ACU34007.1"
FT                   /translation="MTGPDFLWGVSTSAFQIEGGFDEDGRLPSVWDEFPSFEGQTARVA
FT                   CDHRNRHAEDVALLRELGVNAYRFSLSWPRVEGGRAAGSGSAASSGLDFYDRLVDDLLD
FT                   AGIAPVATLYHWDTPAHVEEAGGWLARDTAHRLADYAATAAARLADRVAMWIPVNEPAI
FT                   VTLLGYATGQHAPGKALLFDALPAAHHLNLGHGLAVQALRAAGATSVGTANNHTPAWAA
FT                   TGSAEDAAAASAYADLHNWLYADPVLAGRYPESLVDLLPVEDGDLATIAQPLDFYGVNY
FT                   YNPTRLSAPSPGNPLPFDLVPITEHPVTGFGWPVVPAGLGEMIGALRTRHPNLPPVHVT
FT                   ESGCSYPHSLDDTERVDYLAAHSEAAIAAGAKGYFVWSVLDNFEWDSGYSQRFGLVHVD
FT                   YATQRRTPRASFRWYRDRIRR"
FT   gene            37872..39179
FT                   /locus_tag="Amir_0034"
FT   CDS_pept        37872..39179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0034"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ccs:CCNA_02400 transporter, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34008"
FT                   /db_xref="GOA:C6WCI7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34008.1"
FT                   /translation="MSALGPGAPDPAITGPAAPNPVVPDSAATAHDPLAEPVAPVGRGW
FT                   TTLLFLANLGLWLGVYAPIQVLLPQQAERISPDAKELVFGLVTALGAAVALIANPLIGL
FT                   SSDRTCSRFGRRHPWTLAGALVGALGLAVLSAADATWSMALGWCLVQAGLNGMLASLTS
FT                   GVPDRVPVAQRARVGGLVGISQMLGTVLGAVVVTVLVTGQTAGYLVCAALVVAGALAFV
FT                   LATPDTRLPRAARPPLVARELWVSPKRHPDFAWAWTAHFAINLGNALGTLYLLFFLADE
FT                   VRHPSPEDGLLVLMLLYGAALVVGAVLVGARSDRTGRRRGGVHLSAALMALAALLLAAW
FT                   PTWWSALIAAPLLGFGFGAYWAVALALLTQVLPAATDRAKDLGVVNVANALPQVLAPAL
FT                   ASVVLVDLGGYRGLFLLSAAATLVASLCVTRIRGVR"
FT   gene            39176..39943
FT                   /locus_tag="Amir_0035"
FT   CDS_pept        39176..39943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0035"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34009"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34009.1"
FT                   /translation="MRVLVTGASQGIGAAVAERFAAQGAEVHLVARGAVALAAVVERIT
FT                   ARGGRAVAHVADLADERRVLALAEEVGPVDVLVNNAGVGRWLFLDDTAPDELRGMTALP
FT                   YASYALLTSLLLPAMRERGSGRLVFLNSPASRIAIPGATGYTAARWAVRGLVAALRQDL
FT                   RGTGVGVTEVVPGAVRSNYFDNNPGSAERIPWVVSRLVPTMTPERVAAEVVKAVARGRS
FT                   EVVFPWQIKLFDLVGRVIPGAVAYLAWRTGVHR"
FT   gene            complement(40316..40678)
FT                   /locus_tag="Amir_0036"
FT   CDS_pept        complement(40316..40678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34010"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34010.1"
FT                   /translation="MDEILGQVLRNAVWERLDLLTELASQADAPSLLSVARSELPRLTE
FT                   GWRALLAAHEPDDKGNCPECSGRWRQQKSPCSVWRAAYEHLVAGGLAPRPARHLRTAPV
FT                   TPPVTRSRRGVAVRAH"
FT   gene            41233..42615
FT                   /locus_tag="Amir_0037"
FT   CDS_pept        41233..42615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0037"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; Tetratricopeptide domain
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34011"
FT                   /db_xref="GOA:C6WCJ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ0"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34011.1"
FT                   /translation="MNTIGSSNSPVTPEVWDQQEMRDALAKREISTVYRLLRRHGVSQR
FT                   QIAALTGQSQSEVSEILKGRQVMAYDVLTRIANGLGVPRGYMGLAYDEATAVRVAATAE
FT                   APHSEEDESVKRRKFLAHAAAITVGAAVFGTDSGSWTGSPAQTPAPGRIGMTDVRQVEA
FT                   ATKALRTLDYQYGGGSCRDAVVAQLSWGQQMLGANATELVKEWLFVALADLHNLAGWTS
FT                   FDTGLYDSARNHFGQALSLAKQGRKEELVANILYRMGRVYLHQDAPDDALKVFQLGQLA
FT                   AQNSGSELAVGILCANEAWAYAKMGSDTQALKLLGRARDEFARANVAEAPAWARFFDAN
FT                   DLSAMVGTVHTELAQTVDVKYTRTAIPALSKAIGGYGEDMTRSKSFNFISLSINHLLQG
FT                   DLDHGSKVGRQALDLSESLKSIRTKDRMKPLLGEAQKRRNNQDARELAERVSKFTGTDS
FT                   AA"
FT   gene            42689..43585
FT                   /locus_tag="Amir_0038"
FT   CDS_pept        42689..43585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0038"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   bcz:BCZK4351 homoserine kinase type II (protein kinase
FT                   fold)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34012"
FT                   /db_xref="GOA:C6WCJ1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ1"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACU34012.1"
FT                   /translation="MAGGGRFTPAVLADVLERLCAGLGLDHRGARLLKFTANAVYELPA
FT                   EQVVVRITGSMALRHRAPKVVAVARWLARHDVPAVRLVEDVPQPLVVGEHVATLWRTAP
FT                   SGGPPVDGRDLGRLLRLVHSLPEPDFAVPKWSPLEDVRRRIADAEELAADDLEFLEERC
FT                   AALAERLRSLETALPVGLVHGDAHLRNLIPSPDGPLICDFDSTGLGPREWDLSMVPVGA
FT                   ARLGHPWRWHEQLAAEYGFDVTGWPGYALLRDVRELKLTTSVLPILRSHPEVAPELRRR
FT                   LRSLREGDSGTRWEPYR"
FT   gene            43715..43996
FT                   /locus_tag="Amir_0039"
FT   CDS_pept        43715..43996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34013"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34013.1"
FT                   /translation="MLGTRRRRAKRALDAARMLDEVVDTQLPLLASFDEERRRRSADYL
FT                   AELVKLAQDYRYFANGWIDARELDRRGQEALVVLGKFRNDPTARLAQD"
FT   gene            complement(44172..45191)
FT                   /locus_tag="Amir_0040"
FT   CDS_pept        complement(44172..45191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0040"
FT                   /product="copper resistance D domain protein"
FT                   /note="PFAM: copper resistance D domain protein; KEGG:
FT                   bja:bll4878 copper export protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34014"
FT                   /db_xref="GOA:C6WCJ3"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ3"
FT                   /inference="protein motif:PFAM:PF05425"
FT                   /protein_id="ACU34014.1"
FT                   /translation="MTADRTSGPARPRARVAGGLLLGALAGVLVGLAIAGTGAAVGGPG
FT                   IAALVAQPLARVLLDLSATGVVGLSLLPRLLGAARPSATEPVLRLARPAAVVLSAVWAL
FT                   VALLSVVLRAHETRPDVPLTTARLLDYVQRVPAGQGLLFSAVCAVVCLGVGAVAVRRGE
FT                   AVPAELRVLVALFGLLPLPATGHASNRDFRDVAVVAMELHVLGAALWTGGLVALVVLVA
FT                   HRRGLLAEALPRFSRLATAALLVVTATGIGTGLLELAAAPGGGLPGSLVTTPYGLLLVG
FT                   KALCALALAGLGARIRWWLLPLVRRHRPTALVGWAAAELAVMGAAFGLAVVLSRAPVA"
FT   sig_peptide     complement(45063..45191)
FT                   /locus_tag="Amir_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.412 at
FT                   residue 43"
FT   gene            complement(45188..45736)
FT                   /locus_tag="Amir_0041"
FT   CDS_pept        complement(45188..45736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0041"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   bra:BRADO4155 copper resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34015"
FT                   /db_xref="GOA:C6WCJ4"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ4"
FT                   /inference="protein motif:PFAM:PF04234"
FT                   /protein_id="ACU34015.1"
FT                   /translation="MRRAVSLLLSALVAGGVALGAAPAAWAHNVLISSDPKDGAELATG
FT                   PREVTLTFDQPVQAGERFNTLTVTSADGTRWEDQAEPTVRDNSVIFPVRELGPAGEYTL
FT                   GYRILSADGHPVSGSLKFTTTTAAQGTPVPASESATRDASGGDSGGGVPVWVWIVGAVV
FT                   LLGGGVFFALRGGGDGADR"
FT   sig_peptide     complement(45653..45736)
FT                   /locus_tag="Amir_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.955 at
FT                   residue 28"
FT   gene            complement(45733..46482)
FT                   /locus_tag="Amir_0042"
FT   CDS_pept        complement(45733..46482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0042"
FT                   /product="nuclear export factor GLE1"
FT                   /note="PFAM: nuclear export factor GLE1; KEGG: sme:SMa1200
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34016"
FT                   /db_xref="GOA:C6WCJ5"
FT                   /db_xref="InterPro:IPR012533"
FT                   /db_xref="InterPro:IPR038507"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ5"
FT                   /inference="protein motif:PFAM:PF07987"
FT                   /protein_id="ACU34016.1"
FT                   /translation="MSTTRTGLRPLVRAGALLTTAGFLALGTAGTASAHVSASTTAPAT
FT                   QGGYAKVIFRVPNERPDSGTVKLEVTLPAEYPLASVSTKPLPGWQVEAVKATLDKPVTS
FT                   HGREVTEAVRTVVWTADAGVQIAPGQFNEFEVSVGPLPDTTEQLVMPAKQTYASGEVVD
FT                   WSAPPADEEPEHPAPVLKLVKPAEGADSHGNAPAGSGDSHSETAASTTTDDTARWLGGA
FT                   GLAVGALGLGLGAGAVLRTRRSGKPSA"
FT   sig_peptide     complement(46378..46482)
FT                   /locus_tag="Amir_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.891 at
FT                   residue 35"
FT   gene            complement(46508..47065)
FT                   /locus_tag="Amir_0043"
FT   CDS_pept        complement(46508..47065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0776 putative membrane glycoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34017"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34017.1"
FT                   /translation="MATRPGVTSRAARGSLVAVTSASLGLAAHGAAGGEAVELTPVLPL
FT                   LLLTASAGTALAERRRTPWAVVGALVSAQAGQHALLSLAAHQHHGPGLGLDPLAMTAAH
FT                   VVAALLTGLLLARADAVLLALAGAAARLLPVLREPRPASRPAALPAPEGHPQPTPVRIT
FT                   LRRVNARRGPPALPIAPHPGPR"
FT   sig_peptide     complement(46973..47065)
FT                   /locus_tag="Amir_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.983) with cleavage site probability 0.550 at
FT                   residue 31"
FT   gene            47159..48991
FT                   /locus_tag="Amir_0044"
FT   CDS_pept        47159..48991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0044"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: ppw:PputW619_2676
FT                   choline/carnitine/betaine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34018"
FT                   /db_xref="GOA:C6WCJ7"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ7"
FT                   /inference="protein motif:TFAM:TIGR00842"
FT                   /protein_id="ACU34018.1"
FT                   /translation="MTTAEPQIKTPLPGEPKVDRPGRTDYVVFGVAAAITVAFLGWGVF
FT                   ATDSLASASKTALGWVMGNLGWAFVLLASGFVLFALWLAVSRYGRIPLGRDDERPEFTT
FT                   VSWIAMMFSAGMGIGLMFYGVNEPLTHFVNPPPGTVEAGSDAALRTAMATTLFHWTLHP
FT                   WAIYAVVGLAIAYSSFRRGRSQLISAAFAPLLGERTANGGVGKAIDVLAIFATLFGSAA
FT                   SLGLGALQIGSGLEIVGWAGEVGNAVLVGVIAVLTVAFIASAVSGVAKGIQWLSNVNMV
FT                   LAVVLALFLFVVGPTVFILNMVPTAIGEYFRELAEMTGRTAATGGDPMETWLSGWTVFY
FT                   WAWWIAWAPFVGMFIARISRGRTIRQFVAGVIGVPSLVSLMWFAIFGGTAIATQRGGAD
FT                   IAGQSTAEGQLFAVLREYPVASVSIVLVMVLVAIFFVSGADAASVVMGTLSQRGSIAPT
FT                   RGVVIFWGVVTGAVGAVMLLVGGSSGLTGLQNLTIIAALPFAVVMVGLCLSLARDLRSD
FT                   PMIRREERVAEVLEEVSTKIGPEEAALRAVESLTKGEGLSRAEKRVRSEAAGKAAEAEG
FT                   DEPAATGGVTAEGSTAQDVTAQDTTAEGGSLTKK"
FT   gene            complement(49044..49484)
FT                   /locus_tag="Amir_0045"
FT   CDS_pept        complement(49044..49484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0045"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34019"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34019.1"
FT                   /translation="MARRTARKRGISPSGAKNLVGVAKVVVPALLPVLAPLAARAASAA
FT                   GDRYDRYRAARLGVDVERLAEYSGRGARLHARISNAGAALAGLVDEDAGYAQRCQQRLA
FT                   QLQAAVRASEGMPAPRRKAAHRAVAADLDAVEGELLKRLGVD"
FT   sig_peptide     complement(49359..49484)
FT                   /locus_tag="Amir_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.574 at
FT                   residue 42"
FT   gene            49586..51220
FT                   /locus_tag="Amir_0046"
FT   CDS_pept        49586..51220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0046"
FT                   /product="nuclease (RecB family)-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34020"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCJ9"
FT                   /inference="protein motif:COG:COG2251"
FT                   /protein_id="ACU34020.1"
FT                   /translation="MTSQVQLDAGVVTRCRRRVHLEHDPDVREAAKAPPDAAGQQRRAD
FT                   AVDHRAAVARALGREVGSALVEVPPDVPVADRERVTAEAMRVGAEYIWGAVLPRDPRGG
FT                   RKGGVELLVRDRTGYVPVIVVRHKTTDPGHGARTSPLSYPQPAGARTDPVRKVRPQPRD
FT                   QLRLAHVQRLLQASGHAAPGRATGGAIGMDADVVVWHDLEAATWPGGRTALSEYDARFA
FT                   DRLAIADAAIAGTSPLARPSRVVECKTCPWWPVCSDALTQARDVSLVVRGEDAMALRRA
FT                   GVPTVDDLAALDPAEPAVPLVGMAHEDAVVLARAWLRGLAVARRVPRIEVARAEVEVDV
FT                   DMESFGDLGAYMWGCLLSGADVGVEPGYRAFATWDKLPCADEARSFAEFWAWLTGVRRA
FT                   AAERGLGFKAYCYNELAENRWLLSSAQRFKGQPGVPPVAEVKEFITSDDWVDLFGVVRD
FT                   QFLSTNGKGLKTIAPLAGFHWRDPEAGGENSMRWYRDAVGMDGQEPDPAQRRRLLEYNE
FT                   DDVRATHALRGWMTSDAVAGLPYAGDL"
FT   gene            complement(51262..52014)
FT                   /locus_tag="Amir_0047"
FT   CDS_pept        complement(51262..52014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0047"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bac:BamMC406_2467 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34021"
FT                   /db_xref="GOA:C6WCK0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCK0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34021.1"
FT                   /translation="MEISGTAAIVTGGASGLGAATARALAARGARVFALDISVDGAPAV
FT                   EGVTYLAADVTSEEDVQAAVDTAAGSGAPLRIAVNCAGIGPSTRTVGKAGPHPLDLYRK
FT                   VLDVNVVGTFNVLRLAAAAMGATEPGPDGARGVVVNTASVAAYEGQIGQVAYASSKAAV
FT                   VGMTLPAARDLSSVGVRVMTIAPGIVDTPMLATVSEEFRAGLAAGVPFPKRLALPDEYA
FT                   RLALSIIEHDYLNGEVVRMDGALRMAPR"
FT   sig_peptide     complement(51934..52014)
FT                   /locus_tag="Amir_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.967) with cleavage site probability 0.547 at
FT                   residue 27"
FT   gene            complement(52050..52175)
FT                   /locus_tag="Amir_0048"
FT   CDS_pept        complement(52050..52175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0048"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34022"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34022.1"
FT                   /translation="MHRFPMQVLMFALVFAGLALVAAVPLVALLHVSEHHGLNDR"
FT   sig_peptide     complement(52107..52175)
FT                   /locus_tag="Amir_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.499 at
FT                   residue 23"
FT   gene            52353..54134
FT                   /locus_tag="Amir_0049"
FT   CDS_pept        52353..54134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0049"
FT                   /product="Gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="PFAM: gamma-glutamyltranspeptidase; KEGG:
FT                   bbt:BBta_2852 putative gamma- glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34023"
FT                   /db_xref="GOA:C6WCK2"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCK2"
FT                   /inference="protein motif:PRIAM:2.3.2.2"
FT                   /protein_id="ACU34023.1"
FT                   /translation="MFTTRPELAGTHGMVASTHWLASSAGMAVLEDGGNAFDAAVAAGF
FT                   VLQVVEPHLNGPGGEVPALFSVRGGAPRVLCGQGTAPAAATPAHYRDLGLDLVPGSGLL
FT                   AATVPGAWDGWLTLLRDHGTKSLREVLGHAIGYARDGFPLLARVPVTIAAVADLFRDHW
FT                   TTSADLWLPGGKPPVAGERFRNPKLADTWEWLLAAGEAAGADREAQIEAARRAWSQGFV
FT                   AAQVEEFCRTAHRDDSGRDHAGVLTGQDMAGWEASYEEPVTADFGDWTVAKIGAWSQGP
FT                   ALLQQLRLLEGFADRLEYVDGAPTAETVHLAVECAKLAFADREAWYGDSADVPLEALLS
FT                   REYAAERRALVGERASLELRPGAPGGAEAVLAQHIRRGPSVAEELGGAVGEPTVSRTGA
FT                   VRGDTVHVDVVDRWGNIVSATPSGGWLQSSPTIPSLGFCLGSRAQMFWLDEGLPNSLAP
FT                   GKRPRITLSPSLALRGGEAVLAFGTPGGDQQDQWQLGFWLAHAVGGMNLQEAIDSPMWH
FT                   SNAFPSSFYPRAWTPGELVVESRAHGLDELRERGHSVVDAGPWALGRMSAVSRDPRSGL
FT                   LRAGANARGAQGYAVGR"
FT   gene            complement(54212..54541)
FT                   /locus_tag="Amir_0050"
FT   CDS_pept        complement(54212..54541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34024"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCK3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34024.1"
FT                   /translation="MNLRKTVTGALLGLGSAAAMLGLGGTAMAADTIDITTTANPDIDA
FT                   HAPDAVKVGEIVDLDINEISDINLNVLDDDNVDADVFAHDLQALVNNGDLPADALVHLL
FT                   IEGND"
FT   sig_peptide     complement(54452..54541)
FT                   /locus_tag="Amir_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            complement(55503..55877)
FT                   /locus_tag="Amir_0051"
FT   CDS_pept        complement(55503..55877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34025"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34025.1"
FT                   /translation="MDLALSKVVELRESGFQFLHLRDEDGQLDRIMAFKQRRGFIDSIL
FT                   FWSETEARAGRLPAVRESSRAAQAVWIYEGPLVEAVDRLLDLPEPGTRNAPTLMRRTAS
FT                   DLAVVTTLPFTLKLPPGAIA"
FT   gene            56251..57537
FT                   /locus_tag="Amir_0052"
FT   CDS_pept        56251..57537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0052"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_0951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34026"
FT                   /db_xref="GOA:C6WDN1"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34026.1"
FT                   /translation="MTSDQRAGLPPLPESMLPRDHALYRPRHSGRQRPALVAAGVYFLL
FT                   PLLLLAVGVRPGEFENRQLAEFPSVTDGWDFFTGLSDWADDHIPLREQAVAAADGISRG
FT                   VFGEPAPLRGPSTGTGPIPEVPSKDPSADRPTPTGHVRVLEGKDDWLYLGLDVEGACDP
FT                   DFLLGDTLGKLKSLRAAVESSGRRFVLVVPPNKSTAMPEKLPSKYYGADCAAKARDDLW
FT                   KRLPETGAIDLRSALADEAKRLQAPVYLQRDSHWNHAGAMVMVRRVAEEVQPGVTGSWK
FT                   VEPAEESKVAADLPTLLGHPEEITLTSYDVLADGKKKAGEPLKGPWDQPKTTTKARGTG
FT                   IANATALLIGDSFSEQAAPYLSGVFTRFTYQNAATIQADPAATARLMVQNDVVVVEMVE
FT                   RNVVIGASSLLAEGTLNEIKAQLAANPKR"
FT   gene            57672..59063
FT                   /locus_tag="Amir_0053"
FT   CDS_pept        57672..59063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: FAP262; flagellar associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34027"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34027.1"
FT                   /translation="MLADPQPAGGTAALWSSSDLPGLGDQLLVRVIERELRARLGDWCV
FT                   RPFAPHGWTRPQRADAGFIAEPLGERTPHRVRELAENHHLHLVAPSFPLGDDLAARYGA
FT                   DVPGAAFFTAGLGLRPDAACVAVRVAEAVPAELVAWAGRQPLLSVRDEESARRLREAGV
FT                   KGEVAVVGHPGLLLERLLPADSLKARANQLRQLGQLPADGRSYLVVQVPAEGFEKLRPT
FT                   IAKIVELLAVQDVVLLPIGVPVPEGDWAALPPDTVLEDRAAVLADSAAVIAVDEHVAAA
FT                   AQAYGRNWVLLDPTGREGAAAELFGAAERVAQRPSQLAAAFRRALKAGPGGHEEAVRAL
FT                   DEHLDAVAKTAEAAFAASGQGLPDRVAALVAENRALRVAHHRLRERVTADRHAMVELTL
FT                   KGGPVEGGPELEEERRLHGELAERHRELVERLGASERELDAMRRTKLFRYTRALRFVYG
FT                   KLRSR"
FT   gene            59060..60733
FT                   /locus_tag="Amir_0054"
FT   CDS_pept        59060..60733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0054"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rce:RC1_0824 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34028"
FT                   /db_xref="GOA:C6WDN3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34028.1"
FT                   /translation="MTPRITFVLVTYGGGELAAHCLDVLAEHTPEPYEVVVVDSASPDG
FT                   SGEWLERNLTGATVVRMTENLGFGAGCNLGVQHARTEFVCFLNADVEVTEGWLAPLLEL
FT                   LDGTPAAAAAAPLMVFPDGRLQEAGSLLGGDAFSRGWGDGWEDGAELYPRVVDYASAAC
FT                   LVVRRRAFHDVGGFSSEYHIAYYEDTDLQFGLRDRGWQVWVQPSSHVVHVRHGTSSTAT
FT                   AERLSDINREVFRRRWADDLALRPPALGVHEHPHRLWWLRDKPASVRVLVVAPGAPADG
FT                   DRDAALLSAWRADPEAAVTLLVPEDAADDGAFARWRSRGVEVRPGDAGEASRERVGNYD
FT                   VVVALGDVPVEAVTRWQRAAVKALDLASLPHRAHERRFALSRAKEDAVRAGAARARTAE
FT                   LLQWADVVSCASEEDAEWVRGGAGATAHVLTHPVEAPPVLCELADRVTGDAAGDVDLAV
FT                   RRVLVAPFPGSAGLRPELVRAMAVGTPFVTTWEGADGLGLPGWVFECTEEQLLTDDELW
FT                   GRVHRELVAAHRARFAPERFRAVFADLQADCGVAPAPLVP"
FT   gene            complement(60861..64376)
FT                   /locus_tag="Amir_0055"
FT   CDS_pept        complement(60861..64376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0055"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2;
FT                   Methyltransferase type 12; Methyltransferase type 11; KEGG:
FT                   ppf:Pput_3926 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34029"
FT                   /db_xref="GOA:C6WDN4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN4"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34029.1"
FT                   /translation="MVEQPVYADGAEDEVLSRLRRAADVSAGSAELARALPSWELIYHF
FT                   SPQRTALLAPIELVEGTRVLDFGCGSGVLTRAMGELGAGVVGVEGTPTRAEAARERCRD
FT                   LPNVRIVDGGAEEIGLNGPFDLALLCGVLEYSSVYGDGPEALLEDVVGALEPGGALVLA
FT                   IENKIGLGYLTGRPEDHHGKSWVGLADYPRGGARTWPRAELAELLANAGLTAQRWMLPY
FT                   PDYKLPRVIVDADVHGRGDAVDLVDKLVRDPLYGAFGGTTGAVPGRSLHRTAVVEGFGA
FT                   SVSPSFLVVAARTPEAVRRFVRPGLGWLVNSARLPRWRRSRVLTTALELRAVEGAGAES
FT                   DWLRQEAPAVEPLLPGRPLDSLLLEALARGDEEELRGLLGLWRSCCEEGATGLGDQPRH
FT                   PFLPGAPGVPVLAANALDVHPGNVVLLPDGSPRRIDLEWCAGEGVDAELVLVRALLEFA
FT                   REVHRSGAPHPWEAELTTAELTLRLCGLVGLAGRARERWSELLAAEARLQELVSGTPSD
FT                   EVLTALLGDVDRPGPARAWELPPLTQLAAAAADREHLRGVADELRGDVARAEDALDATR
FT                   RLREEAMAALAEVERLREEATAEAAHLRRAVAKADEQLGDALMLVADAESERVGVEREL
FT                   AERSSRAEELAGENARLRTELDRLASSSVVRAGNRYLWPAARLVRGARDLALGRGGEEP
FT                   DRVLRGVGKVAPSAVPLLAGRVRRVSERDAGLRYQLSAPSEVPVGLGQVVDLDGWAVHD
FT                   DLPVRAVSVELGGRVLPATSGHPRPDVAAALGVHGWTGFRVRLPVRAGAVRPVLLVELA
FT                   DATVLRRELPELVGVPHEPEPVAVDWPGEGPRIAVCLATYNAPGGHFHEQVQSIKEQTH
FT                   SNWVCLISDDGSTDKAALRSATAGDPRFVVVEHAENVGFYRNFGRALAMVPVDADLVAL
FT                   SDQDDVWDADKLAVMAERFADPSVQLAYCDMRLVDGGGAVVAESAWTNRPNQWTDLEQL
FT                   LLLNTVTGAATVLRADLLRERVLPLPPGTPAAYHDQWIAATALAVGRIEFVDRALQSYR
FT                   QHGANVTGWQVPRLADGLPGLRGLAAAGAGVGHGVDLLEARQAELDHITEHELRRIAQF
FT                   STVLLMRNQDLLSERETAKLERLAGAERRLWPLVRLALEGEERPETAGAERRLLAAALL
FT                   RRHQQ"
FT   gene            complement(64376..65581)
FT                   /locus_tag="Amir_0056"
FT   CDS_pept        complement(64376..65581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_4178 ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34030"
FT                   /db_xref="GOA:C6WDN5"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34030.1"
FT                   /translation="MNWQEELRKLDEELAAGRISADDYRTRRDQVLSSAQPAAQPAPPQ
FT                   EWQAQQPSGGPSNGPTGTSTGATQYIQPVNPDATQVVPGGGNRPGHNPDATQVVPGGGN
FT                   RPGDSDRTQVVPNGGMAPQYGQPSPAGGFPQPGAFGGPQQGGGMPPWQGGGGDTSAPWA
FT                   SSSSDNWLRQGPEVFDEGSSGGGKKVFAIIGVVLVVALIGGAVWFFGFKGSGDDSAKGG
FT                   DTPAPQSSTSAPTTTTTKAPIDLLPDPPGTPSTNNGTVELARAVEEKLLSADEAAAVEE
FT                   AAVKEVAFVGSTQDAFTYDAMVFEVGDEAKAEALVEGLVAAQGKTGMVDGAKGQLPAQS
FT                   TVQQLIRQGEPGIYRAIYAAGDKVVRVSTTQTPIAPGPNDQELIKKFQEFGIGVAKQFP
FT                   TS"
FT   gene            complement(65703..68078)
FT                   /locus_tag="Amir_0057"
FT   CDS_pept        complement(65703..68078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0057"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   xcb:XC_3634 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34031"
FT                   /db_xref="GOA:C6WDN6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACU34031.1"
FT                   /translation="MNTPVACTATAESGLPSALVLARSYLAHHPGHRFTIAVLDGEDGG
FT                   RRGSDGVTVIGPDLIGPSRDEFLGLATAHPLPQLVDAVKPWLMRGQLRNASRVTWFSPT
FT                   SFVTAPIGEQRGTVVAPHLLRPLTGEAAESAEARLIGTGVLNPGYLSTDDESLLDAWVE
FT                   AVAAFRAVRFDRDALSDQDWFDQALSLVPHEVSTDPGLVLTAWNAFERPGVEPKVVDLL
FT                   GFEPRAPWVLSSLLLDRPAALLSERPDLVPLVREYADLLIAAGHLDEEEVLPTWLDELP
FT                   DGTPLTPLLRGTYRAAVLASTDPRRAKRPAAPPHAFTGAEFRDWLNGPGELGGTTRFTR
FT                   AVWDSRPDLQAVFGRPVHPGFAHWCRESAPAEGVLPAWAVPVPDDPPSAPQDRLGVNLL
FT                   GHLTAVLGVGELGRVLNSALSRSGLDVAPVVEEAMVVNRTDVDRPEESAPVYPVSVLCV
FT                   NADLVRAVSEQHPQVVHERYRIGVWSWELEEFPEAMREFDCVDEVWTISEYCRAAIAPH
FT                   TDKPVRVFPIPIRERPAVEFRAGGPVRFLFAMDFNSLVERKNPFGAVEAFRRAFPDRED
FT                   VELVVKVINGERHVAGLERLRSAAAGDPRVTLLERYLTAEELHDLYAGSDCYVSLHRAE
FT                   GFGFTVAEAMAMGLPVITTDYSGTAEFVDRENCWLVPAEPVPVGPGSPPYPADALWADP
FT                   DLDVAAAAMREVADDPARAAERGLAAREHLRRTRGEDAAAEWVRDRVEQAHRTWRERRA
FT                   PAQAQAAPEAKPQLVVPLLRKVAVRALGRYDSARHRDR"
FT   gene            complement(68337..69401)
FT                   /locus_tag="Amir_0058"
FT   CDS_pept        complement(68337..69401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0058"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: swi:Swit_4011 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34032"
FT                   /db_xref="GOA:C6WDN7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN7"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU34032.1"
FT                   /translation="MALDVLRDTWEKLGGVDPLWAVLTDPGRRDGRWDVEEFMRTGPEA
FT                   VGQVRTLLGERTLGSRVLDFGCGVGRLSNALAAHADRVVGVDIASTMVARARELNRHPD
FT                   RVEFVHYDGRLLPFEDASFDGALSLIVLQHARPWVQIGALLELLRVVRPGGTLVVQIPS
FT                   ARRAPAPMPEEAYRADIEVLEAPSALGVGQSALVRARVTNLSEHPWPGTKTIKLGNHWR
FT                   SGGEVVQLDDGRVGLPAMVAPGESFEVGVPVTAPRAGELVLELDLVHEMVTWWESEGGT
FT                   PARVPITVTASPAPPSEVTPAGEAHPGEQIEMHALHTEFVQALFGHCGAEVVAAVPDEA
FT                   AGEEWESFTYVVSR"
FT   gene            complement(69961..70266)
FT                   /locus_tag="Amir_0059"
FT   CDS_pept        complement(69961..70266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34033"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34033.1"
FT                   /translation="MNLHPRVGLPTRGWGDRSGYRHPFGKIAHVTFSHESDQSKPNYDQ
FT                   PTIRIAPVAPIVPVVPAAGPGTVPPAQRQQAQPVARKSKLRRIARRIVGPTILTKR"
FT   gene            complement(70271..70696)
FT                   /locus_tag="Amir_0060"
FT   CDS_pept        complement(70271..70696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0060"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: mlo:mlr4254
FT                   osmotically inducible protein C, putative ATP/GTP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34034"
FT                   /db_xref="GOA:C6WDN9"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDN9"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACU34034.1"
FT                   /translation="MATVRKATTHWKGSLMEGDGTVTLESSGVGTYDVSWPSRAEQANG
FT                   KTSPEELIAAAHSSCYSMALSHGLAQAGTPPQQVDTSAEVTFKPGTGITGIHLTVRAVV
FT                   PGLEADAFAEAAETAKKNCPVSQALAAVEITLDAALA"
FT   gene            complement(70827..70899)
FT                   /locus_tag="Amir_R0004"
FT                   /note="tRNA-Gly5"
FT   tRNA            complement(70827..70899)
FT                   /locus_tag="Amir_R0004"
FT                   /product="tRNA-Gly"
FT   gene            complement(70942..71337)
FT                   /locus_tag="Amir_0061"
FT   CDS_pept        complement(70942..71337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34035"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34035.1"
FT                   /translation="MADWRTRAASLLPELTAVVERESWSCHVFLTELWQLALDGHREDD
FT                   RDLLTRVYGFAHWCFRQEQFLANAAVVSFYEHVFDEWELRDAVAPWLPTEVVDKVRPLW
FT                   EWRWPQERLSEVDRLLSGSGTPGERAV"
FT   gene            71534..73003
FT                   /locus_tag="Amir_0062"
FT   CDS_pept        71534..73003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0062"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; KEGG:
FT                   afw:Anae109_0839 ECF subfamily RNA polymerase sigma-24
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34036"
FT                   /db_xref="GOA:C6WDP1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP1"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU34036.1"
FT                   /translation="MAIGARLGLEVPGGMADEADVDLELLARVRAGDDAAFGELYSRHA
FT                   DAVRRFALRHVREHAEADDLAAEAFFRVLQAIRRGSGPTEHVRTYLLTTARRVAWEWSG
FT                   RRRDVPVEDEELSRRVEPFPDATAGRAEHTLISRAFTSLPERWRSVLWQVEVEGVRPSA
FT                   VAPAFGLSPNAMAALARRAREGLRAAYLQAHLADDRGPRACHSVVAKLGAYTAGGVQGA
FT                   EQARIRKHLRTCSSCNALHAELAEVCSALRAHAGLLAAPALLSLAFAPEVVAPVAGKVK
FT                   LALTAASVAAVGVFGVAAGALDGGPGPALVQPGPYALRTTVDDPLTPRPSVTLTGTATS
FT                   LPPAGDGAARPATSNRPSGGGGRGSLTGGDRVGPPTGAPPQSGGPQSGEPPTGGPPFGE
FT                   PASGEPGSGQSEPPATTSPTPGALEDPGTTALSTPDDPEQSGKEDPEPPGTTTTGQGPD
FT                   PEPGPSVLQSPELGITPTTVTLHPRTAYPVG"
FT   gene            73127..73564
FT                   /locus_tag="Amir_0063"
FT   CDS_pept        73127..73564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34037"
FT                   /db_xref="GOA:C6WDP2"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34037.1"
FT                   /translation="MTRLVRGADGRMWTVRSQVEWRNPAADADFEHDVSGGQGPGVLML
FT                   AIVAAMGVLLVAWTPEQVVVPAWLGLALAMMFLFFPVRWAIRRPHLVVAESKATGDDLP
FT                   PERWVGHVRGVLNVRDEVGNIARKIEMYSLPDIDGPLQPVD"
FT   gene            73786..75072
FT                   /locus_tag="Amir_0064"
FT   CDS_pept        73786..75072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0064"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; KEGG: signal transduction histidine
FT                   kinase, LytS; K07704 two-component system, LytT family,
FT                   sensor histidine kinase LytS"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34038"
FT                   /db_xref="GOA:C6WDP3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP3"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACU34038.1"
FT                   /translation="MPGARRPHSMDGVRDLLTERAVLGVIATLAVLGLFVMLCRARRVS
FT                   TSVEDAVMDMLHRMSKASADLREGLTAEAADKATPHLREMLRCVAVGITDSTGSVLSWD
FT                   GGAADHYELMRGHIEQAIREVHKEHVEHRKLDCDLSGPCPMHSAVIVPLIVESEVAGTL
FT                   IVVSGVPNKRQIRMAEETARFVSTQLELEVLQKSRQALAQAEVRALRAQISPHFVYNAL
FT                   NTISSLIRTDPVYARELLQEFAEFTRYSFRTDGFFTTLSDELTNIHRYLTIEQARYGAR
FT                   LEVRLRIAPEVLQVVLPFLCLQPLVENAVRHGLAKKPGGGMLTITAEDNGAEALISVED
FT                   DGVGMDPERLFEDLKDAHQTGAHVGLGNINHRMRAVFGDDYALVVETAPEAGMKIILKV
FT                   PKYRQGVRPNLTLVAPRVEETGEQAVLRA"
FT   gene            complement(75077..75244)
FT                   /locus_tag="Amir_0065"
FT   CDS_pept        complement(75077..75244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34039"
FT                   /db_xref="GOA:C6WDP4"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34039.1"
FT                   /translation="MTFNPIRWLERYVEWWDERGRKNADGPSAMHVYWMWITWAVCGVM
FT                   LVTALAVAAR"
FT   gene            75285..76157
FT                   /locus_tag="Amir_0066"
FT   CDS_pept        75285..76157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0066"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: rce:RC1_1672 proteinase
FT                   SohB, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34040"
FT                   /db_xref="GOA:C6WDP5"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP5"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ACU34040.1"
FT                   /translation="MSVTDKIASRLPKIVGDRVDRGPVVAAVRLHGVITPNPGPVAARG
FT                   SLNAQSVESALTRAFEHERLVAVALLVNSPGGAPTQSALIADRVRELAAKRRVPVLAFC
FT                   EDVAASGGYWLACAADEIHAHPTSLVGSIGVVSSGFGLTGLMERFGVERRVHSAGESKV
FT                   RLDPFQPEKAEDVAWLEGLQSELHEQFKAWVTERRGRRLAADAPDLFAGEVWTGAKALE
FT                   LGLVDGLGTLRGVIGKRYPDAEIAIAEPRRNLLSRLGLGNAASTRSGDFVTQALASLEE
FT                   RARWSRFGL"
FT   gene            76254..77081
FT                   /locus_tag="Amir_0067"
FT   CDS_pept        76254..77081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0067"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: LytTr DNA-binding region; response regulator
FT                   receiver; SMART: response regulator receiver; KEGG:
FT                   gur:Gura_2791 LytTR family two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34041"
FT                   /db_xref="GOA:C6WDP6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP6"
FT                   /inference="protein motif:PFAM:PF04397"
FT                   /protein_id="ACU34041.1"
FT                   /translation="MSSGLLVLAVDDEAPGLDEIKFLLESSPHIRRVLTAFDAAEALRI
FT                   LRGDYDTEVMERQEAGQPPVDAVFADINMPGLSGTDLARVLGAFRAPPALVFVTGVEHS
FT                   EAVVAFDVGAVDFVTKPINSDRVNKAIARVVDRVNSVSAAAAAPEPTAADSQDDEVIPV
FT                   ELGGTIKLVPRASVRYVEAQGDYARLHTNDGQSHLVRIPLAQLEERWENAGFVRIHRSF
FT                   LVALPLVTELRMTSNGYAVVIGSGEGAKELPVSRRHTRDLKERIVRPPKSNWG"
FT   gene            77078..77500
FT                   /locus_tag="Amir_0068"
FT   CDS_pept        77078..77500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34042"
FT                   /db_xref="GOA:C6WDP7"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34042.1"
FT                   /translation="MSEQPGPPAEQPAPGEHAPAQGRKPRRRRVVLADPKGRGRVLRTI
FT                   IELEEQTSVGEKLVRDLIRQQLRTAFVLGGGTLLAVALLPLLFYLVDLSEVQLFGVRLP
FT                   WLLLGLVPFPLFYLVGLLSRRQAERHERDFVSMVDR"
FT   gene            77504..79315
FT                   /locus_tag="Amir_0069"
FT   CDS_pept        77504..79315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0069"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: dac:Daci_5957 SSS
FT                   family solute/sodium (Na+) symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34043"
FT                   /db_xref="GOA:C6WDP8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP8"
FT                   /inference="protein motif:PFAM:PF00474"
FT                   /protein_id="ACU34043.1"
FT                   /translation="MVQNLWSLSLVAVVAVVTFLLGYVGSRRANTTPDFLVARRAVPAT
FT                   RNAAAISGEYLSAASFLGVAGLILKDGVDALWYPIGFTAGYLAMMLFVAAPLRRSGAYT
FT                   LPDFAEARLGSRKLRHFCTFFVVCIGVLYLVPQLQSAGLTLNTITGLPAWLGGVLVTLI
FT                   VVANVLGGGMRAITLVQAFQYWGKLFAISAPTFVLFAVFLTGPGTSAQSVDAEGVLLFH
FT                   EPVTVTTVDPVRLEVTSLTKLHVVGEVDGARADGPAYWGPDSGGAPKTYSVAKGTELRF
FT                   TAGSPVPVVEGAPSANDVWLRPQTDGLGGLFETYSLIFATFLGTMGLPHVLVRFYTNPD
FT                   GKAARRTALHVLYLLGLFYVFPTVLGVISRLYLPQLLVTGKTDAAVLLLPHTMLPGVLG
FT                   QILGAVVAAGAFAAFLSTSSGLVVSVAGVVSTDILRGKVRDFRWATVLTGAVAIGLALL
FT                   LPRSDASLTVAMSFALAASTFCPLLLLGIWWRGLTWVGAVAGLVVGGGLVILSQVVTAV
FT                   SKATGDWAPALLAQPALVTVPIAFLTMIWISKLTGPSRPADVNQVLLRLHAPDRLGFMR
FT                   DRGARFASGGARRAGEGQHRGAAGSGG"
FT   sig_peptide     77504..77593
FT                   /locus_tag="Amir_0069"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.894 at
FT                   residue 30"
FT   gene            79609..79965
FT                   /locus_tag="Amir_0070"
FT   CDS_pept        79609..79965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0070"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   gme:Gmet_3287 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34044"
FT                   /db_xref="GOA:C6WDP9"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDP9"
FT                   /inference="protein motif:PFAM:PF04341"
FT                   /protein_id="ACU34044.1"
FT                   /translation="MSTTEDSAGPTPGSPDSTDWVAVQSSPEFTELRRRLRTFVFPMAG
FT                   LFLTWYVLYVLLADYAHGFMSTKLVGNINVGLVLGLLQFVSTFAITALYVRHANRNLDP
FT                   TAEKIRHELEGGDA"
FT   gene            79962..81548
FT                   /locus_tag="Amir_0071"
FT   CDS_pept        79962..81548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0071"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: bca:BCE_1726
FT                   sodium/solute symporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34045"
FT                   /db_xref="GOA:C6WDQ0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ0"
FT                   /inference="protein motif:TFAM:TIGR00813"
FT                   /protein_id="ACU34045.1"
FT                   /translation="MNTNAVLNIGIFGLFVAATLVVVIRASRNTKTAADYLAAGRAFTG
FT                   PQNGIAIAGDYLSAASFLGIAGAIAVYGYDGFLYSIGFLVAWLVALLLVAELLRNTGKY
FT                   TMGDVLSFRMRQRPVRAAAATSTMVVSFFYLLAQMAGAGGLVALLLGITGKGGQAIVIA
FT                   VVGALMIAYVLIGGMKGTTWVQIIKAVLLIVGAGVMTIWVLAKYGFNLSTLLGAAVDNA
FT                   PKAGEKLLGPGLQYGATGTTKLDFLSLGLALVLGTAGLPHILMRFYTVPTAKEARRSVV
FT                   WAIWLIGLFYLFTLVLGYGAAALVGPDKINAAPGKANSAAPLLAEAIGGPLLLGLIAAV
FT                   AFATILAVVAGLTITASASFAHDIYANVIKKGEVEDKDAEVRVARRTAIVIGVVSILGG
FT                   IAANGQNVAFLVALAFAVAASANLPTILYSLFWKRFNTAGALWSIYGGLSVTLVLIVLS
FT                   PAVSGRPTSMFPTMDFDLFPLSNPGIISIPLAFLLGYLGTVLSKERNPAKYAEMEVRAL
FT                   TGTGAEKATSH"
FT   gene            81691..82116
FT                   /locus_tag="Amir_0072"
FT   CDS_pept        81691..82116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0072"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: maq:Maqu_3385 DNA binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34046"
FT                   /db_xref="GOA:C6WDQ1"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ1"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACU34046.1"
FT                   /translation="MGATERDVLFANEVNQRQAQELIGLLSGRNARFTAESDGGGAARQ
FT                   VPAELSGLIAKLVHAVARGQAVTVTTMPEELTTTAAAQLLGISRPTLMRKVNAGEIPSR
FT                   KVGAHTRLRTEDVLRERRERRQRQLAALDELRDLEEF"
FT   gene            82184..82774
FT                   /locus_tag="Amir_0073"
FT   CDS_pept        82184..82774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lpc:LPC_2191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34047"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34047.1"
FT                   /translation="MKVLADANVLYSRTLLDWFGLLQGSDEQQVYHAYWTEDLLAEALF
FT                   HLRRDKPALDGGQISSIRDKIEKAFEGGRVDDFVIDDSFPGKDVNDRHVHAAAVTCQAD
FT                   IVLTCDEGFHSEQVADLLPYEVHKPDEFFVLVHDIAPEIVWQATLKQTRYWVGRGKRAD
FT                   LFDRLVKAGCPEFAARVQVHQSRLSLPHDTTRP"
FT   gene            82815..83162
FT                   /locus_tag="Amir_0074"
FT   CDS_pept        82815..83162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0074"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: rfr:Rfer_3913 rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34048"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ3"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACU34048.1"
FT                   /translation="MSRVTVPSVEVSDVPAELPEGAVLLDVREVDEWAAGHAPGAVHIP
FT                   MSELAGRLGEVPEADVVYVVCRMGGRSARVTEYLNANGWDAVNVDGGMQTWSTQGRPMV
FT                   GELPDVEPEVI"
FT   gene            83164..84072
FT                   /locus_tag="Amir_0075"
FT   CDS_pept        83164..84072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0075"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34049"
FT                   /db_xref="GOA:C6WDQ4"
FT                   /db_xref="InterPro:IPR025565"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34049.1"
FT                   /translation="MRPLQPMRVDWVATPPPGAYPARRFGGARRPYAGPPSYPVPPRWG
FT                   FPLLAWRWPTSVALDEARPLDRVDQVQRLARTASQALGLAGMTALWAAGSELWRYALLL
FT                   LSRTGALSATTVGVSDAMVVAASAVAGITSAIALVLSFLWVRAARAAAAAASGYAPSRS
FT                   ERELVLGLVVPGVNLVVPGSALAELEHAALRLPVDARPKPSKLLLRWWALWVVSALFFA
FT                   LTVAWSFRSSVQALADGVFLHAVSDLLAAGVALTTAVVVRRLTTLLLPLDPASLRRMRV
FT                   VGVKGAPAPELRAIRASGSPR"
FT   gene            84163..85212
FT                   /locus_tag="Amir_0076"
FT   CDS_pept        84163..85212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0076"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34050"
FT                   /db_xref="GOA:C6WDQ5"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ5"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACU34050.1"
FT                   /translation="MRALGAALVVMLLLPGAASAGAGTGAGHGHGHGHGKHGFDLQAHR
FT                   GGIGLTVESTLAAFAKALEVGVTTLELDVQITRDGREVVTHDRRTNPAKCVDTAPARPG
FT                   DPEFPYAGKYVKDLDFAQVRTLDCGSRRSAQHPDQELSPGARMPTLAEVFALARRYRAH
FT                   DVRFNVETKVEAAAPHETAPREQFVDVTWREIRRSGFERDVTIQSFDWGTLMLWRKVAP
FT                   RLPVIALTQPEFLAPGSPWTGGLDLADFGGSPARAARSFGASALSPVHGNPQNGKVGDP
FT                   DYVPFTTEALVEDAHRNGLEVIPWTVNDPATMRKLIRDGVDGLITDYPDRLRAVLEDLG
FT                   YRLPQRYHR"
FT   sig_peptide     84163..84225
FT                   /locus_tag="Amir_0076"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.826 at
FT                   residue 21"
FT   gene            complement(85244..86476)
FT                   /locus_tag="Amir_0077"
FT   CDS_pept        complement(85244..86476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0077"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: jan:Jann_1726
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34051"
FT                   /db_xref="GOA:C6WDQ6"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ6"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ACU34051.1"
FT                   /translation="MDASGPQDLPSGVVAPFDQNDPSFIADPYPVFAALRVQGEVHWHD
FT                   GMGLAVAVSHAASSAVLRHRSLGRLWTDAKPLEEFASFNLLHRNSLLENEGATHARLRR
FT                   LVSAAFGRGHVERLRPRIAELADGLVDGLVDRVRADGSADLLEHVAGPLPVEVIAELLG
FT                   VPHSERSLLQPWSNAIVKMYEHGLAEDKRAAAERAAREFVAYLREVVALRRRQPGDDLV
FT                   SDLVAVTDSDGARLSEDELVATAVLLLMAGHEATVNVIGNGVLALVEHRDQWERLVADP
FT                   GLLETAVEELIRYDSPLQLFERTATKREEIAGHVVEEGAKIAALLGAAARDPEVFERPD
FT                   EFDVGRTPNQHLGFGMGIHYCLGAPLARIEVQAAVDALRRKLPGMELAATPRRREEFVI
FT                   RGLHELPLGAG"
FT   gene            86596..87294
FT                   /locus_tag="Amir_0078"
FT   CDS_pept        86596..87294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0078"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: gbm:Gbem_3150 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34052"
FT                   /db_xref="GOA:C6WDQ7"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ7"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACU34052.1"
FT                   /translation="MSPEVVAHRGASAALPEHTLAAYELAIAEGADALECDVRLTRDEQ
FT                   LVCVHDRTVSRTSDGRGAVGALTLAELRALDFGSWHGGDPAPVLTFAELAGLAADHGTP
FT                   LFVETKHPVRTGGLVETRLAQELARHSLDVHMMSFSALAVRRFKALAPAVPTVWLLDRL
FT                   WPQRLPEWADLPGPGVSLLRRSPGRGRGAYCWTVDTAPDIDLCRERGVRHLATNHPART
FT                   RKILAADLAP"
FT   gene            87313..88257
FT                   /locus_tag="Amir_0079"
FT   CDS_pept        87313..88257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0079"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34053"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ8"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ACU34053.1"
FT                   /translation="MAKRTAVKSKSADGVNPRQPCPCGSGKRYKACHGGADGGADVIVA
FT                   RPFAGLASEAELIALREFVPSATVKLPLKDAPREVVLASVLPMAAAGLVRADGTAFVGL
FT                   QVQTRSGDLSRDLARAVQWAYTAETGDVLPVVGPEDGTNPGRLQDLLDVEASVSPELHA
FT                   DFAWWMPPGNEPAGDVALSLERANAAILPTERVDAPGVTAAYWVDAGDKAHLRWVRPEP
FT                   EEQLLAALARLSVRGELDLGDGTRYAGSFRAHGLLVPVWDLDRESHSSEWAGPAEALGK
FT                   RLLDALASLDSEPLSEAERRSRDGLRGRQITLR"
FT   gene            88330..88656
FT                   /locus_tag="Amir_0080"
FT   CDS_pept        88330..88656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0080"
FT                   /product="protein of unknown function DUF952"
FT                   /note="PFAM: protein of unknown function DUF952; KEGG:
FT                   rru:Rru_A0513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34054"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDQ9"
FT                   /inference="protein motif:PFAM:PF06108"
FT                   /protein_id="ACU34054.1"
FT                   /translation="MLLRISTRADWAEARESGAIPLDLEGFVHCADPGTVHLPANSLYR
FT                   NRSGLVLLVVDPEGLPVLYEPGDGDESGPWFPHVYGPIPADSVVAVLDFEPDPDGVFRP
FT                   PPVL"
FT   gene            88777..89808
FT                   /locus_tag="Amir_0081"
FT   CDS_pept        88777..89808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0081"
FT                   /product="Phenylacetaldoxime dehydratase"
FT                   /EC_number="4.99.1.7"
FT                   /note="KEGG: xau:Xaut_1560 phenylacetaldoxime dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34055"
FT                   /db_xref="GOA:C6WDR0"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR025702"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR0"
FT                   /inference="protein motif:PRIAM:4.99.1.7"
FT                   /protein_id="ACU34055.1"
FT                   /translation="MSSLPLDDRATAHRPEGYDPRGGPGHEVRWSDDVTHLVVARFGVQ
FT                   TDDSAAGVKAIARVLELAAGESGPALVERVSDDDSEMAVCYWPDPEAHRAWWASGPVRD
FT                   WWASLPVDGPIGHWHETSVTPVEQFETLYSAEFAAGPSRFAGTGPTNLHDYDNSTLDRM
FT                   PATAHRDLRQERAEEPTTDLPPGESPRGRRVRLAEPSPSGLCWIRTAQEWSIAPDDQLA
FT                   SYRDGVEPAYRTAIAHLQDNPHDTGCLSARLVGNLDANGARAAGAEAVVWWRGIGDLLR
FT                   WAHDHKTHQDILNGFWEHVIAKFGPGTRVRLWHEVHVLPEGALTAEYVNCHPGTGLLQT
FT                   WPG"
FT   gene            complement(89920..90483)
FT                   /locus_tag="Amir_0082"
FT   CDS_pept        complement(89920..90483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0082"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34056"
FT                   /db_xref="GOA:C6WDR1"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR1"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACU34056.1"
FT                   /translation="MALNLKKLPTETSSKFRALLQEQIGNEFTASQQYTAIAVWYDSRD
FT                   LPRLAAHFYAQALEERNHAMMLVKYLLDTDVPVTIPGVGEVRNDFGSAREPVELALAQE
FT                   KTVTEQIVALAKAARDEGDYLGEQFLQWFLKEQVEEVSSMSTLLTVVDRADGNLFHVEN
FT                   FVARELSGAGGDDPTAPAAAGGAL"
FT   gene            complement(90632..91879)
FT                   /locus_tag="Amir_0083"
FT   CDS_pept        complement(90632..91879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0083"
FT                   /product="arginine deiminase"
FT                   /EC_number="3.5.3.6"
FT                   /note="KEGG: ses:SARI_03184 arginine deiminase; TIGRFAM:
FT                   arginine deiminase; PFAM: amidinotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34057"
FT                   /db_xref="GOA:C6WDR2"
FT                   /db_xref="InterPro:IPR003876"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR2"
FT                   /inference="protein motif:TFAM:TIGR01078"
FT                   /protein_id="ACU34057.1"
FT                   /translation="MTAHIEHTQSATPAPGPAPRVDSEVGPLRTVLLHRPGAELKRLTP
FT                   RNNDQLLFDGVPWVDRAQEEHDAFAGVLRSRGVEVLLLGDELVRALHDDRARIAGVHSA
FT                   VDERRLGIHLADALRSHLSGLAPEALATILTSGMTFEELPAAEGASLVRRMHQPGDFAV
FT                   DPLPNLLFTRDSSVWVGDRVAITSLAMPARGRETALTDLIYAYHPRFAKTGRAYGAHSA
FT                   PLEGGDVLLLAPGVLAIGVGERTTPAGAESFARSALADGLAHTVLAVPIAQQRATMHLD
FT                   TVCTMVDRDAVVMYPAVRDNLFAYPVRQDGSGGVRVSGPSPFLEAAAEAMGIDRLRVID
FT                   TGLDAVTAEREQWDDGNNTLAVGPGLVVAYERNVETNARLEEAGVEVLRISGSELGSGR
FT                   GGPRCMSCPIDRAPLV"
FT   gene            complement(92019..92672)
FT                   /locus_tag="Amir_0084"
FT   CDS_pept        complement(92019..92672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH0832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34058"
FT                   /db_xref="GOA:C6WDR3"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="InterPro:IPR038261"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR3"
FT                   /inference="similar to AA sequence:KEGG:BH0832"
FT                   /protein_id="ACU34058.1"
FT                   /translation="MTTLADELVLICYSDEGRPSVTHPILGYGVTGALLTELVLAGRVD
FT                   LVDKKVVVTDPTPTGEPAVDALLARLAGADKPRKPQQWMHKLYKESTTQVLDGLVERGV
FT                   VRREEAKVLLVFPTTRYPTPDGRQPALEADARARLRAALEGDGPVDERTAALCALVGAA
FT                   RQERKVLPDVPKDRLKARLKEISQGAWASDAVRRAIDEIQVALVAGAAVAAAGA"
FT   gene            complement(92746..93540)
FT                   /locus_tag="Amir_0085"
FT   CDS_pept        complement(92746..93540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0085"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   dal:Dalk_0566 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34059"
FT                   /db_xref="GOA:C6WDR4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR4"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ACU34059.1"
FT                   /translation="MIDQTRGPGELGPERFTPDQRRGYQVELLLVFSVTLGLSGLRSLV
FT                   RLVDSLLRPVPLNQQTVAINVPQARFDLLDLIAQLLSVLQLSAWGGLGLYLLWRSGVTF
FT                   KAVGLDRARPVFDAWGSLGLAALIGIPGLAFYLVAWNLGLNLAVQPSTLDSWWSAITLT
FT                   LAAAGNAWAEEVLVVGFILTRLRQLGWKDNTSLVVAAVLRGSYHLYQGFGGFIGNVVMG
FT                   LVYGRFWQRTGRLWPLIGAHTLLDVVAFVGYSLLRDHLSWLP"
FT   gene            complement(93550..94308)
FT                   /locus_tag="Amir_0086"
FT   CDS_pept        complement(93550..94308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4194 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34060"
FT                   /db_xref="InterPro:IPR019595"
FT                   /db_xref="InterPro:IPR037119"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34060.1"
FT                   /translation="MTEIRRPPAPHPAERARTIATRGGRAALLPPDGAEDRVVPELHHV
FT                   HACGEATLLLPDEHPLVARAALGEVTSMLEIADHAAVPLREPVRGLLWITGWLRALDGP
FT                   DAREACVEVAEERPDPRLLDVGHGLTALRLVPASLVVADAETTTSLRPEVFAQAEPDPF
FT                   CAHEDHWLRHLELSHRDVVGLLVQHLPEGLRGGHVRPLGLDRFGLRLRVELEDTDHDVR
FT                   IAFSRPVATPSELSSELRRLMGCPFLAQRR"
FT   gene            94407..95036
FT                   /locus_tag="Amir_0087"
FT   CDS_pept        94407..95036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34061"
FT                   /db_xref="GOA:C6WDR6"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34061.1"
FT                   /translation="MVVPNQPSTEGAAIDDRWTHHCLETASRRVFGWVVLGALAFTAQL
FT                   VLVLWSDVPSHVPFALLAFSLGSIAWGLVRRPSPAGAMREEPWRFARVHWSNGRLVVHG
FT                   EEKSSVLEVRGAGPLVRGRIGKHRRAWLVLPDRQGNTVVTFRGVPKLFPARVLRAPVRR
FT                   GTGKAAGSSGAAGAGSAKGVKAGRTRRGTTRRGAKERGTGRDRSQG"
FT   gene            complement(95197..96399)
FT                   /locus_tag="Amir_0088"
FT   CDS_pept        complement(95197..96399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0088"
FT                   /product="homogentisate 12-dioxygenase"
FT                   /note="PFAM: homogentisate 12-dioxygenase; KEGG:
FT                   bcz:BCZK0217 homogentisate 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34062"
FT                   /db_xref="GOA:C6WDR7"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR7"
FT                   /inference="protein motif:PFAM:PF04209"
FT                   /protein_id="ACU34062.1"
FT                   /translation="MPYYRQVGDIPRKRHTQFRSPDGSLYAEELMGVEGFSADSALLYH
FT                   RHLPTAIVDAVTVPDTRGPLVPNLPLKPRHFRTEPLVGSDPGGPGGPGGAADAVTGRRV
FT                   LFGNADVVICFAAATEPSPLYRNAFGDELLYVQSGEGVVETIYGALVVESGDYVVLPTS
FT                   CTYRLAPRTPMRLLVLEATGHIGPPKRYLSARGQFLEHSPYCERDLRGPAEPLLVDGED
FT                   VDVLVRHRAGLTRMTYAAHPFDVVGWDGCLYPWVFNIGDFEPITGRVHQPPPVHQTFEG
FT                   PNFVVCSFVPRKVDYHPLAVPVPYNHANVDSDELMFYVGGDYEARKGSGIGLGSLSLHP
FT                   AGCAHGPQPGAVEASLGAESFDETAVMVDTFRPLELGEAALAGEDARYAWSWSRRGPDL
FT                   D"
FT   gene            96535..97335
FT                   /locus_tag="Amir_0089"
FT   CDS_pept        96535..97335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0089"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_6517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34063.1"
FT                   /translation="MDDAALFPPGDATMADAVRGYLDSRSGDWAGPLNLFLCPASRLAE
FT                   LITELIKVKPVKPVALSLVIDTGLGGVPKAVSIVESRSELLALRMVEMPAPSDVDEVWL
FT                   ERVSEFVPEDVIRVVEPRRGGAEWLDGVRRVIEHGSWPKLRCGGMRKENFPSVDEVADF
FT                   LAVVSGGGVAFKATAGLHHAVRHEDPETGFTHHGFLNLLVATARSLSGGDVRAALSSTD
FT                   AEALTAEAKALSDQAAHAVRGVFASYGSCSLADPIRDLEELGLL"
FT   gene            97332..98516
FT                   /locus_tag="Amir_0090"
FT   CDS_pept        97332..98516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0090"
FT                   /product="Fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; Domain of
FT                   unknown function DUF1969; KEGG: jan:Jann_1436
FT                   fumarylacetoacetate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34064"
FT                   /db_xref="GOA:C6WDR9"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDR9"
FT                   /inference="protein motif:PRIAM:3.7.1.2"
FT                   /protein_id="ACU34064.1"
FT                   /translation="MSWIEDPAFGPDHPFGPQTLPYGVTPDGVAVRVGDRALPLRPLAG
FT                   SFGRLADLVSAPDLDPLLRAGRPAWSELRARLVDLVTAPTAPRGAALTDLGGEILPFTV
FT                   ADYVDFYSSRHHAENVGRIFRPDGDPLLPNWTHLPVGYHGRAGTVVVSGTPVVRPRGQR
FT                   RAEGGPVFEPSARLDVEAEVGFVCGGPPESRLTPDRAADHVLGVVLVNDWSARDVQAWE
FT                   YQPLGPFLAKSFATSASAWITPLEAFSAARVAPPALPNPVLPHLAEERPWGLDLTLEVE
FT                   WNGEVVSRPPFREMSWTFAQQLAHLSSNGAPVRPGDLIASGTVSGPGVDERGSFLELTW
FT                   NGRDPVVVAGAERSFLEDGDTVRITATAPGPDGSVVGLAEVVGAVLAAAPVQGR"
FT   gene            98519..99178
FT                   /locus_tag="Amir_0091"
FT   CDS_pept        98519..99178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0091"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; SMART: regulatory
FT                   protein IclR; KEGG: dac:Daci_0951 IclR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34065"
FT                   /db_xref="GOA:C6WDS0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS0"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACU34065.1"
FT                   /translation="MSRSPEAGRADQKESSLTLERGLALLQAVADAESDAPTISELATA
FT                   IGASRAAVYRLLVPLQARGLVRREGSKVRLGLGVLRLAANVLPQLRIAAQPALRELAEA
FT                   VGATAHLTVADGAEAQAVAVVEPSWTAFHVAYRVGSRHPAHRGAAGRAIGLSTEGAQWT
FT                   VSSGELQHGAFGVAAPVRGVHGLRASVGVVSLDELVGDRVGPQVVAAAQQVADALR"
FT   gene            99260..100771
FT                   /locus_tag="Amir_0092"
FT   CDS_pept        99260..100771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0092"
FT                   /product="cytochrome bd ubiquinol oxidase subunit I"
FT                   /note="PFAM: cytochrome bd ubiquinol oxidase subunit I;
FT                   KEGG: bsu:BSU38760 cytochrome bd ubiquinol oxidase (subunit
FT                   I)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34066"
FT                   /db_xref="GOA:C6WDS1"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS1"
FT                   /inference="protein motif:PFAM:PF01654"
FT                   /protein_id="ACU34066.1"
FT                   /translation="MNVLDLSRWQFGITTVYHFLMVPLTIGLSLLVAAMQTAWVRTGDR
FT                   KYLAMTKFWGKLLLINFAMGVVTGIVQEFQFGMNWSAYSRFVGDVFGAPLAMEGLAAFF
FT                   VESTFLGLWIFGWDRLSKKAHLACAWAFSLATMLSAYFILAANSWMQHPVGTIISDEGR
FT                   PQLVSIGEVLTNNTTLAAFPHVIFGAFAVAAAFLVGIACWHLWKRSDEEPVWRASVKLG
FT                   AWVGIVSFVGLAITGDFQGKLMFQQQPMKMAAAEALCHTEEPAAFSIFAVGDVSRADCE
FT                   SVKSVTVPALLSFLAHNDFSSEVKGVQDLVTEYQAKYGENYPVDERLGELSGQPIDYVP
FT                   MLPVTYWGFRLMIGFGAISALVGAVALWLVRGGRQAPTGKWFPRLMLLSIATPFLGNSF
FT                   GWIFTEMGRQPFVVAPNPTGVDGVWMFTASAVSANTVGEVLTSVTVLTLLYGALAVVEG
FT                   FLLKKYVAGGVAGVMPPVKAPTGDGKDKDSDDKSDDDDDVLAFAY"
FT   gene            100786..101790
FT                   /locus_tag="Amir_0093"
FT   CDS_pept        100786..101790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0093"
FT                   /product="cytochrome d ubiquinol oxidase, subunit II"
FT                   /EC_number="3.1.3.1"
FT                   /note="KEGG: glo:Glov_1209 cytochrome d ubiquinol oxidase,
FT                   subunit II; TIGRFAM: cytochrome d ubiquinol oxidase,
FT                   subunit II; PFAM: cytochrome bd ubiquinol oxidase subunit
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34067"
FT                   /db_xref="GOA:C6WDS2"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS2"
FT                   /inference="protein motif:TFAM:TIGR00203"
FT                   /protein_id="ACU34067.1"
FT                   /translation="METFWFCVIALFWLGFLFLEGFDFGVGMLLPVLGKDNTERRVMIN
FT                   TIGPVWDGNEVWLIVAGAATFAAFPLWYASLFSTAFLALLLFLVALIGRGVAFEYRGKV
FT                   DSERWRKNWDRVIISTSWVASFGIGFVLTTNVHGLPIDEIGDRVGGPFSYLTWQGIVGG
FT                   LAVSGFSLVHGALFTALKTEGEIRERARALVLKMAPVALLPLVVTLLLVQFEFGGPATW
FT                   GATVVVLLAAVGSLARLWAGREGQAFALMGVAVVATVIALFGAMYPNVLPSTVDPAFSL
FT                   TIENASSSSYTLTVMTWVSAFGAPAVLVYQGWTYWVFRKRIGVKNIPPVHVPS"
FT   gene            complement(102023..103051)
FT                   /locus_tag="Amir_0094"
FT   CDS_pept        complement(102023..103051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0094"
FT                   /product="TIR protein"
FT                   /note="SMART: TIR protein; KEGG: vvy:VV1926 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34068"
FT                   /db_xref="GOA:C6WDS3"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS3"
FT                   /inference="protein motif:SMART:SM00255"
FT                   /protein_id="ACU34068.1"
FT                   /translation="MRKTRRTGGLTCGVPPSEESPIRVFLSYAQDDDHVLGFIGPFTRA
FT                   LEQFAFSDRGRRVEVFVDRTDLVWGQEWRSGIDQAIDSAPVFLPLITNLYFDRPYCRKE
FT                   LHRFHSEADRRGVPSLLLPVVLLGHRMLTPDHEDPLVRVISERQYRDLREAMLEGSGSA
FT                   VWRRAVLALAGDLVDVVEEAERVLATAPPAPSADEDPLLGAFRERHRAVGALLAEVRTA
FT                   LSAELVAVERASVRPSVEAQRTALGVASALRVLGERFSDGCRDYEAAVAGALAPERRAG
FT                   AAALADEVAALWADERAVSDLLDRFRPLEEEYAPLRHTLRTLRRGCKSLQTALLLVERG
FT                   AG"
FT   gene            103158..106223
FT                   /locus_tag="Amir_0095"
FT   CDS_pept        103158..106223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0095"
FT                   /product="ABC transporter, CydDC cysteine exporter
FT                   (CydDC-E) family, permease/ATP-binding protein CydD"
FT                   /note="KEGG: bpt:Bpet3362 HlyB/MsbA family ABC transporter;
FT                   TIGRFAM: ABC transporter, CydDC cysteine exporter (CydDC-E)
FT                   family, permease/ATP-binding protein CydD; ABC transporter,
FT                   CydDC cysteine exporter (CydDC-E) family,
FT                   permease/ATP-binding protein CydC; PFAM: ABC transporter
FT                   related; ABC transporter transmembrane region; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34069"
FT                   /db_xref="GOA:C6WDS4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS4"
FT                   /inference="protein motif:TFAM:TIGR02857"
FT                   /protein_id="ACU34069.1"
FT                   /translation="MSFPGDLPARKKPGRGPLGALPKLSGSARRALVLCAFLAACTAVA
FT                   LVAQAVTLGTALADLVAGGSPLLWPIAATVLARALLAWATESAAARAAAGAKEELRAAL
FT                   LDRSLANGPEWITGRGPAELTALATKGLDALDAYFTRYLPALVTTAVVPPAVGLWILIS
FT                   DPTSAVLIAITIPLIPMFAILIGKFTEQKVAAVATTTEKLSARLHELVRALPVLTAFGR
FT                   AQAQAEAVRRTGDAHRRATMGTLRVAFLSALVLEIAASLSVALIAVGIGVRLVYGDMSL
FT                   ATGLIVLILAPDCYLPLRNAGAAHHASEDGLEAVRRVAEVVDSPRAEVTVPEAGETGVE
FT                   VRDLRVERRGGFAPDGLSFTVRPGQVHHLDAPSGRGKSTTIAALLGFLAPTSGEVRVRG
FT                   SVAWVPQRPAFAARTVAEELELTTGRVDHEVLRRVAAEHLVDRPVAELSTGERQRVAVA
FT                   RALSTGADVLLLDEPTAHLDPATAAKVMAAITAAAEGGAAVVLATHRLAEAADTDDDTT
FT                   AVRAADREPTTPRTPRPTRLLLGGAAIGTAALLSGVALTALSAYLIAKASTQPPILTLS
FT                   VITVGVRACALAKGVLRYLERLVTHDAAFRFADALRIDMWRNLRPGRAELTRLVDDTDT
FT                   VRDLVPRVLQPPLAAAGVGLAAVVLLTAIQPVAGLALAVLLLVGGLAAPLLAAALDRRA
FT                   TTALARGRRRVSEDVLTLLTAAPDLIAFRAEGRYRAGLAAVDAELARQTRRQAFGAGAA
FT                   TGLITLATGLAAVVCTALAGDVNPLLVPVLGLVPLALVETLSTLPAAAQHRAALREAYG
FT                   RVTERHPEVRPGTGPAKLENVDVRWPGAAEPVLRDFTLTPGVGERIAVVGPSGAGKSTL
FT                   FALLLGFLEPERGRVSRPERVAWCPQEPMLVSTTLRENLKLGDAHADDDRLREALVTAG
FT                   LPEWVDRLDTMIGPTLLSGGEAQRVALARALLHDADLVLLDEPTAHLDRPTAEALLDRL
FT                   DVALKGKTVVHITHRPEETRHADLVLSMRPAR"
FT   sig_peptide     103158..103310
FT                   /locus_tag="Amir_0095"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.792 at
FT                   residue 51"
FT   gene            106220..107338
FT                   /locus_tag="Amir_0096"
FT   CDS_pept        106220..107338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0096"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerization and phosphoacceptor region;
FT                   GAF domain protein; SMART: GAF domain protein; ATP-binding
FT                   region ATPase domain protein; KEGG: pna:Pnap_3765
FT                   multi-sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34070"
FT                   /db_xref="GOA:C6WDS5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU34070.1"
FT                   /translation="MTAVDPARVLAASTEITSLALEGDDPDAVLPLVVRHAAELAGADL
FT                   GLSMISADDGTLTVEASSAGPEPVGIVVSSRSSAARAARTGIPVVAADLVSDPRTAPFV
FT                   PKPLRGYGPFAVAPFGTKERRIGALAVYRRRGSAPFSPDTVDVLTAFAAHAGLAVVLAE
FT                   GTTARQRVAVYQERERIARDLHDVVIQRLFATGVQLDLLDRKLKLEGREAKRLADAVDQ
FT                   LDETIAEVRATVRALRGTMPEQLAHTDLVDSVRSEARTAGELLGFRPDVRIVGHFLDLA
FT                   PALADQARAALREALANVVRHAGAGWVGITVDKDAERLALEVSDDGCGIPDGVEKRGLR
FT                   HLEERALAMGGGCEISSSPSTGTTIRWHVPLA"
FT   gene            complement(107555..108184)
FT                   /locus_tag="Amir_0097"
FT   CDS_pept        complement(107555..108184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0097"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   xca:xccb100_3213 two-component system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34071"
FT                   /db_xref="GOA:C6WDS6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU34071.1"
FT                   /translation="MTIRVLLVDDHEVVRRGLRELLEDEADLKVVAEAGGVREAVVRAQ
FT                   ASKPDVAVVDMRLPDGTGVELCGKLQDLPGGPRCLVLTAFEDDEALVGAITAGASGYLL
FT                   KQVRGQDLVHAVREVAAGRSLLDPVTTSRVLERMRKPQEPDELATLTEQERRVLSLIGE
FT                   GLSNRQIAERLFVAEKTVKNHVTAVLSKLGMERRTQAAAWVARRGR"
FT   gene            108245..108727
FT                   /locus_tag="Amir_0098"
FT   CDS_pept        108245..108727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0098"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bca:BCE_4174 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34072"
FT                   /db_xref="GOA:C6WDS7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU34072.1"
FT                   /translation="MLVRAIEEADRIVVGRLVLELWGTHTSVAHGQVFFPASLPGFLVE
FT                   QQDQVLGLLTYTTNDNLLEIVTIDALRRGRGVGTALLEAVVHRARQLGCNRIRLTTTND
FT                   NLDALRFYQRRGFRLTSLRSDAVRESRRVKPEIPSVGDYGIPIVDELDLERWVAPR"
FT   gene            complement(108789..109388)
FT                   /locus_tag="Amir_0099"
FT   CDS_pept        complement(108789..109388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0099"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   dal:Dalk_0690 Appr-1-p processing domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34073"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS8"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ACU34073.1"
FT                   /translation="MAADTEGEINAPVVVPRLVLCAVDEPLTRAWAGVADGRTGVVVHR
FT                   GSVLDIVAEAVVSFGNSSGWLRTGVDELYARAFPHVEDQVRRAVLALHGGELPVGEALA
FT                   VPTCEPQPEWLVSAPTRRVLGERLPDDSVHPYLAARAVLRLWQTGRLDDGRLLRDVVRT
FT                   IAMPGLGTGVDGVSPWTCARQVAAAWDEVFSPIPRR"
FT   gene            109492..110394
FT                   /locus_tag="Amir_0100"
FT   CDS_pept        109492..110394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0100"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ank:AnaeK_2061 prephenate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34074"
FT                   /db_xref="GOA:C6WDS9"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS9"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACU34074.1"
FT                   /translation="MVAPVPRIAYFGPRGTFTEQAARGFGSDLEPRETIPAALEAARTG
FT                   EAELACVPVENSVEGAVPATMDALAEGAPLIAVAETVLAVRFSLLVRPGGGPVRTVASH
FT                   PHALAQVRHWLAANLPDAVAVAATSTAAAAVAVQRGEHDAAVTAPVAAEHYPLEVAATD
FT                   LADVRDAKTRFLLLRGPGALPEPTGSDRTSVVVTAPDRVGVLSDVLVEFALRGVNLTRI
FT                   ESRPTKGPLGEYRFYIDFDGHVAEPRVGDALAALRRHCPDTRFLGSYPKAVREDVVAEN
FT                   ADFVAAAEWVVAIREGRGA"
FT   gene            110391..111002
FT                   /locus_tag="Amir_0101"
FT   CDS_pept        110391..111002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0101"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: lch:Lcho_3955
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34075"
FT                   /db_xref="GOA:C6WDT0"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT0"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACU34075.1"
FT                   /translation="MRLLLVRHGETASNVAMALDSLPPGPPLTEAGRAQAEALARDLAD
FT                   VPVTAVHASVAVRAQQTAAPVAAAHGLEVRVVDGVQEIFCGELEGRSDREAYGTFMRTV
FT                   RSWAEGDLDVPLPGGESGRQVLDRYLAAVEEVTAGRAEDDVVVLVSHGASLRMAALALA
FT                   TNVTPALMAAGLLPNTGRVELERVGDGWVCTSWTGVDVAG"
FT   gene            complement(111064..111585)
FT                   /pseudo
FT                   /locus_tag="Amir_0102"
FT   gene            complement(111597..111792)
FT                   /pseudo
FT                   /locus_tag="Amir_0103"
FT   gene            complement(111845..112261)
FT                   /locus_tag="Amir_0104"
FT   CDS_pept        complement(111845..112261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34076"
FT                   /db_xref="InterPro:IPR025680"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34076.1"
FT                   /translation="MVTRLRISHQRGKPILAASVAELDAAIDLISGDSARQECPSMVEI
FT                   TIEEDPYGHAYIDAGIGVEQGFVHLNGPDTYRTTVGDPNAAGTVLYDCCGNGEDVPARE
FT                   EVPLATVHAVLAAFLAHDGLIPDDHPDLHLSPTG"
FT   gene            complement(112255..112677)
FT                   /locus_tag="Amir_0105"
FT   CDS_pept        complement(112255..112677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34077"
FT                   /db_xref="InterPro:IPR032724"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34077.1"
FT                   /translation="MDGPHGTPVLDRIAKLREELPPPAVPGKGQKTDGRWFDGNGAVRD
FT                   SVSGKDVDSEEAWRLLRESGIPLPRPPVVAHAEMKVAAAMRRLNVRHAVLVITNVPCDE
FT                   RWSCENLLPAVLPVGCSLSVHGPGYQRTFHGRTPKW"
FT   gene            complement(112751..112936)
FT                   /locus_tag="Amir_0106"
FT   CDS_pept        complement(112751..112936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0106"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34078"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34078.1"
FT                   /translation="MSTYIKVEDGATIECGTVDGEVELTVDRTVDLVLTREAARRTVAT
FT                   LTEALAALEARGAAAI"
FT   gene            113121..114014
FT                   /locus_tag="Amir_0107"
FT   CDS_pept        113121..114014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0107"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34079"
FT                   /db_xref="GOA:C6WDT4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34079.1"
FT                   /translation="MIECPIELRPMANTQTRRRRKLGLYLQELRKKAGRTPDDVADLLG
FT                   ISRPTVNRTESGHTRCRRAELQAVLGYYGASEDERAKAVQLWEDAKDDATKIRFPARSS
FT                   SAFRNFLQAEAEATAVDSLEPHLVFGQLQTADYARALQHPAASPYLEEAVEAEEYVKAR
FT                   LERQRLLGGDNPIRVRAFMDESVLSREIGGVPVLLGQLRHLLELGERDNIAIHVVPLSV
FT                   GAYGAMSGGVTVLDFGDPEDPPVVFLDHAGGGAWVEDEEAVGRYVHMMNELESVALSES
FT                   ATAELIRTKIEVLERR"
FT   gene            114011..114196
FT                   /locus_tag="Amir_0108"
FT   CDS_pept        114011..114196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0108"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34080"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT5"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACU34080.1"
FT                   /translation="MNTWRKSSRSGAGASNCVEVAHDRGSALFRDSKAPESGRLTFTTD
FT                   EFQRFRTAAALGRFDR"
FT   gene            complement(114247..114795)
FT                   /locus_tag="Amir_0109"
FT   CDS_pept        complement(114247..114795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0109"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: ade:Adeh_1652 peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34081"
FT                   /db_xref="GOA:C6WDT6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT6"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACU34081.1"
FT                   /translation="MTESNNVITGRDVFATLHTSAGDVRIKLFPQHAPQTVANFVELAE
FT                   GRREYTDPRTGERTTAPLYDGTVFHRVISGFMIQGGDPLGTGTGGPGYTFGDEFHPDLS
FT                   FTKPYLLAMANAGPGTNGSQFFVTVNATSWLNFKHTIFGEVADSASRGVVDRISLTETG
FT                   PQDRPVDDVVIEKVTIERD"
FT   gene            115026..118412
FT                   /locus_tag="Amir_0110"
FT   CDS_pept        115026..118412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0110"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="PFAM: glycoside hydrolase family 31; Carbohydrate
FT                   binding family 6; Ricin B lectin; SMART: cellulose binding
FT                   type IV; Ricin B lectin; KEGG: aba:Acid345_1956 glycoside
FT                   hydrolase, family 31"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34082"
FT                   /db_xref="GOA:C6WDT7"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT7"
FT                   /inference="protein motif:PFAM:PF01055"
FT                   /protein_id="ACU34082.1"
FT                   /translation="MPRPLLAALLALGTALAGTAALDPPTAEAATGTVVDGNARFQVLS
FT                   PTLIRLEHAGDGAFTDATTFNALNRDFPTPQYTTTVSGEYREIRTSALTLRYKRGSGPF
FT                   TAANTTVQTSAGTGAPAFPSHCAFGTACEAENGLFGGTASAAYDHVGHSGSGFLAGFTG
FT                   AGASLTHRVSGIPGAGTYDLSVRYANAVGGDGQQVTRTLATSVDGTPGPTITLPVTGSW
FT                   DTWSTASVRITVGAGSRTLRLAQEGGATGNVNLDTVALTPVGATHPAADTTLLTTAYGA
FT                   GPKSTLGGWARSLDNPRTVPVALNPGVLNRGGWYLLDDTRTPLSTGPRPSHGDQPYQDG
FT                   YLFGYGKDHKRALGDLNALTGDSALLPRSAYGVWYSRYHAYSDADYRNTLLPAFRANFA
FT                   PIDWLVVDTDWKSPAKWDGWNWDRTLFPDPDGFLTWTEQQGLDVSLNVHPAIESDDPAF
FT                   AEANRVAGGLDHEGGTRYTWDWSDPAHLRSYFGLHEPFERQGVRAWWLDYCTGCGAARA
FT                   SDQAVAADNLINQAYAKDAEERGLRGFAFSRIGGAEQGGIQSNYALGPWSERRNTMHFT
FT                   GDTPGTWELLAFAARFTPDAAAAGLSNTSHDIGSFHGKHLADDLYARWVQLGAFQPIDR
FT                   LHSDHGDRLPWDYTGAAAEAGLKFLRLREALVPHTYSLARQAAKTGVPITRPMYLNYPD
FT                   HEDAYNHPAQYLFGDDVLVAPITTPNSASGTGSVNAWIPPGTWTDYFTGARHTGPAKVT
FT                   LTAPTTEMPVLVRSGGILTTRTDYVHNQGESPLTRLTLTIGSGGDGSTSLYEDEGEGLG
FT                   HRSGASATTALSWRDATRTLTVGARSGNHPGAVGSRSYTLRLAGTTAPTAVVVDGVRLP
FT                   ETAWSYNTNTRTTTVTTPALTTTSAHTVALSGSAAGNPTTGRVTGPDGRCLSAQPAGLA
FT                   ACDGSAAQQVSAPTGGTVRALGRCLGPAGTFVACDGSTGQTWVLRTTGELANRATGTCL
FT                   DATGARLSACSGVAWRFPPGALTGPGARCADVANADPASGTAVQLWECNGSDAQRWHAP
FT                   ADRTVRALGKCLDVRHGATADGTQVQLWDCNGTGSQLWETQADGTLRNPVSGRCLDGSD
FT                   QAQLRIRTCAGTAAQQFRLDA"
FT   sig_peptide     115026..115115
FT                   /locus_tag="Amir_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.496 at
FT                   residue 30"
FT   gene            118546..120380
FT                   /pseudo
FT                   /locus_tag="Amir_0111"
FT   gene            complement(120442..120792)
FT                   /locus_tag="Amir_0112"
FT   CDS_pept        complement(120442..120792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0112"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   eli:ELI_09390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34083"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT8"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ACU34083.1"
FT                   /translation="MPVEMTRQRFEELVAEALDEIPPEFASAMDNVVVLVEDRNPDEPT
FT                   LLGLYHGVALTERTSEYGGVLPDRITIYREALLDVCEDEDHVVEEVAVTVVHEIAHHFG
FT                   IDDATLHELGWG"
FT   gene            complement(120797..121825)
FT                   /locus_tag="Amir_0113"
FT   CDS_pept        complement(120797..121825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: YALI0F05786p"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34084"
FT                   /db_xref="InterPro:IPR026004"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34084.1"
FT                   /translation="MVLVGAFVGALLLLGLSSFTTLPFSSGPLGGVTPPERIDPFEAAQ
FT                   AGDCLNWDRADLADIGKVECSASHLFEVSGVVDISSEYGPQAPFPDATTWQTINADHCA
FT                   SESLKYLSNKLDPFGKYTVGPLNPGEKRWAAGKRTLRCGLQVAAPSGRLLPAYGSARTQ
FT                   DQSDVHDPGVCLGIQDNSIGDPVSCEEPHTFEIIGVVDLGAGNTRFPTEDEQESLMTER
FT                   CDAIANEYSGGKVIKERGLLVTWDYRAQESWDAGSKLANCKVGALPNGTLLTAWTGSVH
FT                   NPDAPPLAPSNPPQTSAVQQAEATGAPMHSEAPASESSAPSSPAPSSSTPPSSKENEEE
FT                   GG"
FT   sig_peptide     complement(121730..121825)
FT                   /locus_tag="Amir_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.591 at
FT                   residue 32"
FT   gene            121985..122737
FT                   /locus_tag="Amir_0114"
FT   CDS_pept        121985..122737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0114"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34085"
FT                   /db_xref="GOA:C6WDU0"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34085.1"
FT                   /translation="MTENDGTKNTSNHGTGGNPPPPAAPQGPPPPQQHPAPPEAPGTPP
FT                   SAGPGTPPPGFPPPAPPGPGAVPPKAPPRGQVRNQVAGVTQPRPPSLAEQRAREHALRE
FT                   QEEQRLAYEAEQARKKKLRKRLLIGGGVGVGVVALVAIWYAASTPDEVEAQCTMDGVVV
FT                   DDKYCSESYATSNGGHVSGGFIYIGGSSYRYHYGGSSTPVGQKVSGGSYTMPDNSKVTT
FT                   KSGSTVQRGGFGVVDGGKSSGGTKSGGS"
FT   gene            122738..123901
FT                   /locus_tag="Amir_0115"
FT   CDS_pept        122738..123901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0115"
FT                   /product="glutathionylspermidine synthase"
FT                   /note="PFAM: glutathionylspermidine synthase; KEGG:
FT                   sus:Acid_7141 glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34086"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU1"
FT                   /inference="protein motif:PFAM:PF03738"
FT                   /protein_id="ACU34086.1"
FT                   /translation="MRRELSVPRPNWQRTVSDQGLVFGAPASRVDGTPRPYWDESVHYA
FT                   FDMSDVLSMEADVELLHNMCMEAVDNVVLTERYRDFGIQEWVWPAIAESWKRRDPHLYG
FT                   RFDLRYDGRGPAKMLEYNADTPTSLLEASVIQWNWKTDVHPDDDQWNSIHEKLVERWAE
FT                   IGGNLPSAELHFTWSGGDASGEDHVTVAYLQETAAEAGMNTVGLAIEEIGWDPLLKRFV
FT                   DLEEATMNTVVKLYPWEWMTDDQFGRHAVESLPATLWVEPLWKMLLSNKALLAVMWEMY
FT                   PGHPNLLPAYLDDPGLLTEYVRKPRLGREGANIQIVAPGYETQTGGVYGKEGFVYQLFD
FT                   PLPDFDGYRPVLGAWVVGDQAAGLGIRESVGLVTDDGAAFVPHRIVE"
FT   gene            123918..124370
FT                   /locus_tag="Amir_0116"
FT   CDS_pept        123918..124370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0116"
FT                   /product="protein of unknown function DUF350"
FT                   /note="PFAM: protein of unknown function DUF350; KEGG:
FT                   met:M446_5403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34087"
FT                   /db_xref="GOA:C6WDU2"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU2"
FT                   /inference="protein motif:PFAM:PF03994"
FT                   /protein_id="ACU34087.1"
FT                   /translation="MTTNLALDPGFGSALVQGLGAIVLYAIVGLILMVVGFYAIDWTTP
FT                   GKLSTLVRTGAPNAVIVTAAGLVSMAFIVVIAIYNAGGKLAEGLLTGLVYGLAGIVVQV
FT                   LAVRLLEWVTRLEIGSMIESDRFAPASVVVAAAHVALGLVVAVAIF"
FT   gene            complement(124531..125205)
FT                   /locus_tag="Amir_0117"
FT   CDS_pept        complement(124531..125205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34088"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34088.1"
FT                   /translation="MVDVRLFYIDDSGSAVSKLVVYGWVELLAQNWRPALLAWLDWRNA
FT                   LHDSTGVPTNYELHASDFANGRGNPTGTPWDRNKSARTAAMVDALNAVSTIPGTCTGAV
FT                   YRRVGSRYTAAKAAVYADLVREIDQRLCSVDEFGIVYMDGDGTAPFYRPAHRALDLKTR
FT                   RIIDDPNFQGSYLNQWVQVADLVAYAAYQHVLRTPGKEAAWEWYPNLLGGTSTTGSTPK
FT                   EL"
FT   gene            125363..126613
FT                   /locus_tag="Amir_0118"
FT   CDS_pept        125363..126613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0118"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: bcz:BCZK0013 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl- tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34089"
FT                   /db_xref="GOA:C6WDU4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU4"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ACU34089.1"
FT                   /translation="MIDLKALRENPEAVRASQRARGEDESLVDALLSADERRRSAVSRA
FT                   DTLRGEQKAFGKQVGKARGEEREALLVKGKELAAEVKAAEADQAAAEAELTELHRSVPN
FT                   LVHPDAPEGGEDDYVVVKHVGEPREFDFEPLDHLDLGTRLGAIDMERGAKVSGSRFYFL
FT                   TGIGAQLELALLNMAVAQATAAGFQLMITPTLVRPEVMAGTGFLGAHSSEIYRLEADDL
FT                   YLVGTSEVPLAGYHADEIIDGPRRYAGWSSCYRREAGSYGKDTRGIIRVHQFNKVEMFS
FT                   YVPPEEAEAEHARLLAWEEEMLAKVEVPYRVIDTAAGDLGTSASRKFDCEAWVPSQQAY
FT                   RELTSTSNCTTFQARRLNVRYRDENGKSQITATLNGTLATTRWIVAILENHQQADGSVV
FT                   VPQALRPFLGKDVLLPA"
FT   gene            complement(127550..128737)
FT                   /locus_tag="Amir_0119"
FT   CDS_pept        complement(127550..128737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0119"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; HI0933 family
FT                   protein; KEGG: sus:Acid_5855 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34090"
FT                   /db_xref="GOA:C6WDU5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU5"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACU34090.1"
FT                   /translation="MAAVRRIVVIGGGIVGLATARELSRRGDEVVVLEKEGRWAAHQTG
FT                   HNSNVVHAGLYYRPGSLKARMSVAGNASIVAYAREHGVPVEVCGKLVVATSEEEVPRLR
FT                   ALAERASRNGVPARMVSVAEAREHEPEVSCVAALRVESTGIIDFPAVCAAMVRELTAAG
FT                   ADLRTNSPALAIRTRAGRVEVATPSGVVRGDALVNCAGLHSDRVARMAGLEPEARIVPF
FT                   RGEYYELRPERRSLVRGLIYPVPDPTLPFLGVHLTRMLDGSVHAGPNAVLALSREGYRW
FT                   GDVSAGDVAEVLRFPGTWRLARKYAYPTGLAEVLRSLSKRRFAESLARLVPAVGEADLV
FT                   RAEAGVRAQAMRRDGSLVDDFLVQEAPGQVHVLNAPSPAATGSLEIGAHVAGLVR"
FT   gene            complement(128739..129671)
FT                   /locus_tag="Amir_0120"
FT   CDS_pept        complement(128739..129671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0120"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   rpb:RPB_4411 luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34091"
FT                   /db_xref="GOA:C6WDU6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU6"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU34091.1"
FT                   /translation="MVHVRVPGSATVAVVRTGIVILPEQRWWVAEPKWRVAEEYGFHHA
FT                   WTYDHLGWRTLVDGPWFGAVPTLSAAAMVTSTIRLGTLVASPNFRHPVPFARELMALDD
FT                   LSDGRITVGIGAGAVGYDTTVMGDTELPPAERTARFAEFVDVLDRLLTRERTTFEGAHY
FT                   EVREARSAPGCVQRPRLPFVVAANGPKAMAVAARYGTGWVTTGPPAGSVETAEEWWAGV
FT                   ERYAARFTRALDAIGRRKHTIDWYLNADSSPAYSLSSAGHFRDVAGRAQELGFTDLLAH
FT                   WPREEGVYAGSEAVLERVASEVLPELVSG"
FT   gene            129678..130499
FT                   /locus_tag="Amir_0121"
FT   CDS_pept        129678..130499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0121"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: mno:Mnod_7133 Cof-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34092"
FT                   /db_xref="GOA:C6WDU7"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU7"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACU34092.1"
FT                   /translation="MQKPSLVGSDVDGTLLGTDGRLSARTTTAIGRVLESGTPFVLATG
FT                   RPPRWIPEVADAAGLTGHAVCSNGAVLYDVGADRVVGHHGLDPVLLQDVAKVLDAALPG
FT                   CALAVERVGDSARGSDHFRDFLAETSYQHPWIEGGQPILGHSRGEVLGHPAVKLLVRHT
FT                   GMTSAEMAAAAGPLLGDQVALTYSTNSGLLELAAPGVSKATGLAEVAELLGVPREEITV
FT                   FGDMPNDVPMLTWAGHGVAMANAHPEALAAADEVTAANTEDGVAQVLERWF"
FT   gene            130616..132532
FT                   /locus_tag="Amir_0122"
FT   CDS_pept        130616..132532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0122"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sml:Smlt0624 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34093"
FT                   /db_xref="GOA:C6WDU8"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34093.1"
FT                   /translation="MSTSSEIDSTALGDEPESTTARASRWGRLPELAASWEAPSRAVLS
FT                   FSALLTVIFWNLPAFTPNQPKGDYDYGLLIYLARQTGLSFGTEISTTYGPLYFLAIPNV
FT                   LHRGEVLVGYLLWFAFATAATAAIHQALARTVGRNLAWLAVGVMALSSSFVPLTVVITS
FT                   TFAFVVVLSLFFVREELPRWADRAYPIAMGLLVGAMLLTKFSVGLMCGPVILGAVLARE
FT                   GRVLRGFLEYAISGIAGLVGFWLLAGQPPLEVVDYVVRALSVGSGHAQSMGLEIPGNVW
FT                   EYVIAAPMVVVLVVALVTTDAGKRRWLFYLGTALGTFLLLKQGFVRHDSHSAQFFSVAA
FT                   GFSLVIALLRRSSVLASTAVVALLAQAFSFGGGLSSSIDPSRSLKMFGEGMSVVASGGQ
FT                   RDRIVADARADLLNRMQVPERYVERIGDAKMRTAPFDFAMGWTYGMTVDILPTLLDYGA
FT                   YTELLDEMNEEWVVDDARAPEFIVREDTRITLDNRFPLWDSPRVNLAQACRYELVDSDV
FT                   RWQLLERIENRCGEEKPLGEVTMGAHQSIPVPTSDEGLVVARFHPEQSILAKLKSTAFR
FT                   SGEYWITLDGEPHRLPLSHAEAPILISAPGDDSLVLGGRELDTKNITANIPGRVVFSVV
FT                   TTK"
FT   gene            132542..133594
FT                   /locus_tag="Amir_0123"
FT   CDS_pept        132542..133594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0123"
FT                   /product="Ribonuclease III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rme:Rmet_6128 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34094"
FT                   /db_xref="GOA:C6WDU9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDU9"
FT                   /inference="protein motif:PRIAM:3.1.26.3"
FT                   /protein_id="ACU34094.1"
FT                   /translation="MVGAPASRRKITYIFPIYNEQDNIDLLHQTIDEVTTPLRDRYDLE
FT                   FVYVNDGSRDASLDKLLALRERDERATVISLSRNFGHQLAVTAGLDAAADADAVIIMDA
FT                   DMQDPPRVSLELIERWEQGVDVVYAQRRSRQDGLFKRLTANVFYRTLEKLASIDIPRNT
FT                   GDFRLLDRKVVAELAKYREQHRFLRGLVSYIGFRQEAVQFDRDARHAGETGYPLRKMLK
FT                   FAADGMLGFSTTPLKLISRIGYLLSVVAFTGVLYVLGVKLLDPSSAVPGWAFMTIALFL
FT                   IGGIQLIMLGVLGSYIGRTYVEVQRRPLYAVAVVARSAGRAPDSAEGKGGEGGTPEDGT
FT                   PATEYELQGT"
FT   gene            133597..134106
FT                   /locus_tag="Amir_0124"
FT   CDS_pept        133597..134106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0124"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: GtrA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34095"
FT                   /db_xref="GOA:C6WDV0"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV0"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ACU34095.1"
FT                   /translation="MAVDDQAGRDPAEQALAPEPVISPVPAPVPQPAPSGGLGQLVRFG
FT                   LVGGVNTLIDLVLYMVLTGAGLPFVVANFVSTSAGMGFSFVANKYFTFGGGGGGAAKQG
FT                   ALFFAFTAFGLWVIHPVVILGAEALMAALDQPLTGLAAWLPKLAAICAGLVWNYTAYSR
FT                   VVFRRR"
FT   gene            134133..135434
FT                   /locus_tag="Amir_0125"
FT   CDS_pept        134133..135434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0125"
FT                   /product="acyltransferase 3"
FT                   /note="PFAM: acyltransferase 3; KEGG: acr:Acry_1134
FT                   acyltransferase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34096"
FT                   /db_xref="GOA:C6WDV1"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV1"
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /protein_id="ACU34096.1"
FT                   /translation="MQKADTQVTEQDAGGRQEPPAVNGSPSAASPSAASRVPHINQLTG
FT                   IRALAALWVLLFHFRPELIEAFGFLYPLIPLMNVGYLGVDLFFVLSGFILTYTHLDRMI
FT                   VGWGPRKMIAFLWLRLSRIWPVMFTMLIVWGCYLAWLATTTNDGGYHYALQPGRFLAHV
FT                   FLVQAWGTAHHDWNPIDWSLSAEWMAYIAFCFLVVLLAKFRALLSSRALIGLALLAVLP
FT                   IVLVGIGFQDGSDLMWDGDKVVEGMVPLRVLTEFVGGAIVAVLVLRHGLTAKLPWFLRP
FT                   TVVLPLILVVIYAICLYDPAVRVRFAVDWRINGHLMWGATETVVVVPLFLLLVGSLAVS
FT                   GRDVTSRFLSTKVMVWGGKVSFALYLVHWLLLDLMRRLLTSWGYVDDPSSWGYRLLLIA
FT                   ALVLSVVGGWLLHRYVEEPCQRSMRKMLPRSIKV"
FT   gene            135536..137167
FT                   /locus_tag="Amir_0126"
FT   CDS_pept        135536..137167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0126"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: pae:PA1391
FT                   glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34097"
FT                   /db_xref="GOA:C6WDV2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV2"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACU34097.1"
FT                   /translation="MNQLPGIVELLDESGVGLTGGGGLLDERERRILIGAINFHALTRP
FT                   GQTFRITVLRGPRGSMPSLTDEKTRQIEWEDDREVVGSLVVRSTVQTTTGKGATEGLLD
FT                   LAVDLGGEPEIASAYHQLPGVLGKVRRSVRFFAPVQFDVLRQYRTDVTEKRYRQRDVPK
FT                   KAPVRITRGTTATTAGTTPAILFGIHWLELGGAERFALETVQLAKDAGFTPIVVTDRPS
FT                   THPWITRPELDGAIVVPLTHPVAAAEESAFLNGVLSAYDVRGVHLHHSTWLAQRLPWLK
FT                   SIRPDLPVVDSLHILEWRTGGFVDISVRMTNVIDQHHVISPMLRDYLIGKQGVNPEKVK
FT                   LATLANLTTKGIEENTRTEKPAGAPFTVAFVGRFTQQKRPYLFLQLAASLKEAVDSPIK
FT                   FIVHGDGELASEVTGLIARLNLSDVLELRGPDKPVTRTLADADVLVISSDNEGLTLTSF
FT                   EATAAGVPVVSTEVGSQASLIAEDLLLPRHPYPFISTATKRIRTMINSPEQRKIWLDEQ
FT                   AGKAAAFAKLPDARTWVRDTYEGWLK"
FT   gene            137164..138063
FT                   /locus_tag="Amir_0127"
FT   CDS_pept        137164..138063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0127"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bcj:BCAL3234 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34098"
FT                   /db_xref="GOA:C6WDV3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34098.1"
FT                   /translation="MSTVAAVVVTYNRKAKLPKVLDHVLAQTRKADWLVIVDNASTDGT
FT                   DEVLKQYEGVENVEIIRLTENTGGAGGFATGMNRGYELGADFVWIMDDDCYANSDALEE
FT                   LLNGLAKAEAELNMQLPFACSLVKWVDGSICEMNNPVTTWDWGRLISKGQENVLVKHCS
FT                   FVSVMFPRWALTKHGLPLREYFIWFDDQEYTLRVNKSGPGVQVLSSVVVHDLGVNRGVN
FT                   FSDVNASNMWKFEYGARNEASYRLHHENPVAFAKFVGRVHQGLKQGRVPMGLRVKLFKK
FT                   IVEGVKFNPKPEMPRSVL"
FT   gene            138200..139384
FT                   /locus_tag="Amir_0128"
FT   CDS_pept        138200..139384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0128"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /note="KEGG: gox:GOX1488 UDP-galactopyranose mutase;
FT                   TIGRFAM: UDP-galactopyranose mutase; PFAM:
FT                   UDP-galactopyranose mutase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34099"
FT                   /db_xref="GOA:C6WDV4"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV4"
FT                   /inference="protein motif:TFAM:TIGR00031"
FT                   /protein_id="ACU34099.1"
FT                   /translation="MSFAGFDLIVVGSGFYGLTVAERAASQLGKRVLVLERRDHIGGNA
FT                   YSEAEPETGIEVHRYGAHLFHTSNKRVWDYVNQFTEFTGYQHRVFAMHDGTAYQFPMGL
FT                   GLITQFVGKYLSPDEARAWVAEQAAEIDAKDATNLEEKAISLIGRPLYEAFVRDYTAKQ
FT                   WQTDPKELPAAVISRLPVRYNFDNRYFNDTYEGLPVDGYTAWLQKMADHENIEVRLGTD
FT                   FFDVRADIPEGTPVVYTGPVDRYFDYSEGWLGWRTLDFEMEVLNTGDFQGTPVMNYNDA
FT                   DVPYTRIHEFRHFHPEREYPADKTVIVREFSRSAEKEDEPYYPINTAEDRAKLEKYREL
FT                   AKKEASEHNVLFGGRLGTYKYLDMHMAIGAALTAFDNKIAPHLTEGKALDGSLD"
FT   gene            complement(139453..140256)
FT                   /locus_tag="Amir_0129"
FT   CDS_pept        complement(139453..140256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34100"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34100.1"
FT                   /translation="MRKAGITALAIAATAAALGGAPAASAAEGTGTVTGVIWQDLNANG
FT                   ERDAGEPGLKGAYVGIDGLSSTYTRTEADGSYTITAPAGSGYRVHLADGLLSGYVWGPE
FT                   VRGHSVFGHCTGKSLPIDLGAGEVVANANGGVVAPSFDFQPTGLTLSPAKDVYAVGDVV
FT                   EVLGGIGHDGAGCYGTSAVLSLPDGVTKLDRLGDYLPFYATDKPNEVTGQPDGRRAGRH
FT                   PFTLGARVVVDRPLDAAEFTLSTMWNDSFDPDHTNNSATTTLSAR"
FT   sig_peptide     complement(140176..140256)
FT                   /locus_tag="Amir_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.994 at
FT                   residue 27"
FT   gene            complement(140289..141086)
FT                   /locus_tag="Amir_0130"
FT   CDS_pept        complement(140289..141086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0130"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_5514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34101"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34101.1"
FT                   /translation="MRKAGITALAIAATAAALGGAPAASAAEATGTVAGFVWQDLNANG
FT                   LRDAGEPGVKNAYVGIKGLNSSYVATAADGSYSITAPAGSHVVHLGDQSGFGKVWGPQA
FT                   EGGSAFGHCTGETAPISVGAGETARVDGGLVPAVFDFQPTGLTLSPAKDVYAVGDVVEV
FT                   LGGITHDGAGCSGAHATLDLPAGVTKLDRLGDYLPFYATDKPNQVTGQVNERRAAGHAY
FT                   TLGARVVVDRPLDAAEFRISTMWNYSEDPDHTNNSATTTITAN"
FT   sig_peptide     complement(141006..141086)
FT                   /locus_tag="Amir_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.992 at
FT                   residue 27"
FT   gene            complement(141148..141948)
FT                   /locus_tag="Amir_0131"
FT   CDS_pept        complement(141148..141948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: jan:Jann_1080 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34102"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34102.1"
FT                   /translation="MTVKKTARIAALALTAAAATLAAAPAALAGPAGGEATVTGVIWND
FT                   LNANGLRDAGEPGIKGAYVGVLGGSYTTTAEDGGYSLTAPSGLAVQVHAADRSGWGAVW
FT                   GPEAEGGSVFGHCTGESGAVVLEPGQVLSGYDGGFVTSKVDYSPAPITLSPAKDVYAVG
FT                   DVVEVLGGIGHEGPGCAQLFAEVQLPEGVTKLDRLGDLRPYMSDGPRTVTGWTADRQAP
FT                   GTPGAIGARFVVDSPLSAATITVKSAWFDSNPANDSASVQLNAS"
FT   sig_peptide     complement(141859..141948)
FT                   /locus_tag="Amir_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.956 at
FT                   residue 30"
FT   gene            complement(142456..143352)
FT                   /locus_tag="Amir_0132"
FT   CDS_pept        complement(142456..143352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0132"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   apl:APL_1469 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34103"
FT                   /db_xref="GOA:C6WDV8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34103.1"
FT                   /translation="MSALPKGSVVGVVVTRHRRELLADSLKVLASQTRQLDHLVVVDNG
FT                   PDQPVDDLVAECPIPTTYLVSHRNLGGAGGFALGMLHALSLGADWVWLADDDGRPADET
FT                   VLEVLLQEAGRRNLAAISPVVTNIERPEKLAFPMRRGLTWKRDTGALGSDFLPGIASLF
FT                   NGALFRASTLDVVGVPDYRLFFRGDEVEIHRRLVRSGLPFGTSLKVAYLHPDGSDEFKP
FT                   MLGGRFHAQDPENQIKRYYTYRNRGYLLSQPGMRKLGLLELARFGLYFLGVRKDPKAFV
FT                   EWLKLVRLGQRERFFRK"
FT   gene            complement(143356..144171)
FT                   /locus_tag="Amir_0133"
FT   CDS_pept        complement(143356..144171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0133"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cbc:CbuK_1550 polysaccharide export ATP- binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34104"
FT                   /db_xref="GOA:C6WDV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDV9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34104.1"
FT                   /translation="MVSIDVWNASVDFPIFDAKSRSLKKLALGKVGGKIGSEGRVPIIE
FT                   ALHDINISLKHGDRVGLVGHNGAGKSTLLRLLAGIYEPTRGSSRIVGKVAPVFDLGVGM
FT                   DPEISGYENIMIRGLFLGMSRKEMEKRVDDIASFTELGDYLSMPLRTYSTGMRVRLALG
FT                   VVTSINPEILLLDEGIGAVDAAFLEKARDRLNDLVDRAGLLVFASHADEWLAELCTKAI
FT                   WMDEGRVKQQGDLREVLTAYKGRDPFANMSEETLKRLGQSKVTTANGGE"
FT   gene            complement(144188..145099)
FT                   /locus_tag="Amir_0134"
FT   CDS_pept        complement(144188..145099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0134"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: tbd:Tbd_1878 ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34105"
FT                   /db_xref="GOA:C6WDW0"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW0"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACU34105.1"
FT                   /translation="MQPTSTVADPQAPLAPDSRTFARAFADVRDAWRNRALWGHLGWQD
FT                   IKQRYRRSVIGPLWITISMGTTAVAMGLLYSQLFGQDISTFLPYMTAGFLIWNFMVGCI
FT                   TEGTDVFIANEGLIKHLPAPITVHVLRLVWRQMLFFVHNLVVYVIVAGIFFGTLSEPYH
FT                   MQGDPNLHPGISWTILLAIPGFFLLAVNAVWVALLFGIISTRFRDIPPVIHSFINLVFF
FT                   MTPIVWHTGILSKLGEGSGDWRVLIAELNPLYHFLEIVRAPLLGHAQDWHHWVVVGAFT
FT                   VVGWALALVALRNYRARVSYWV"
FT   gene            complement(145369..145917)
FT                   /locus_tag="Amir_0135"
FT   CDS_pept        complement(145369..145917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34106"
FT                   /db_xref="GOA:C6WDW1"
FT                   /db_xref="InterPro:IPR019695"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34106.1"
FT                   /translation="MNEPREQAEADQHVIVVGPDGAPVGAARLGGGEDGVPQDVTELVE
FT                   QPAKVMRIGTMIKQLLEEVRAAPLDEASRARLKEIHKRSIHELEDGLAPELRDELERLS
FT                   LPFTEEGTPSDAELRIAQAQLVGWLEGLFHGIQTALFAQQMAARAQLEQMRGRALPPGS
FT                   GSSATSTEGGHFKGTGQYL"
FT   gene            146032..147231
FT                   /locus_tag="Amir_0136"
FT   CDS_pept        146032..147231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0136"
FT                   /product="cysteine desulfurase family protein"
FT                   /note="TIGRFAM: cysteine desulfurase family protein; PFAM:
FT                   aminotransferase class V; KEGG: mlo:mlr0102
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34107"
FT                   /db_xref="GOA:C6WDW2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW2"
FT                   /inference="protein motif:TFAM:TIGR01976"
FT                   /protein_id="ACU34107.1"
FT                   /translation="MAFDVARVRGLFPALGDGWVHLDAPAGMQVPEQVATAVSTALRAP
FT                   VSGPGGIFPASQRAEAIVDAARRAVADLVGADPAGVVLGPSSAVLLQRLSDALSEGWFL
FT                   CDEVVVSRLDHPGNIAPWQRAAQRTGSVVRFAEVDIETCELPAWQYDELITDKCKLVAV
FT                   TAASGAVGTRPDLPRIGAVAREHGALVVVDASAAAPFVPLDITSMRADVVAVSANTWGG
FT                   PPVGALVFRDPSLLDLLPSVAVEAGARGPERLELGPHAYPLLAGLVASVEYLAGLDDAA
FT                   IGPRREKLLTSLGSVKAYQAGLLANLIHELRSLRHVTVIGDAMRRVPALAFTVAGVKSA
FT                   EAVEHLSERGVCAFADPGQHGVFSVLGVGEVGGAVRVGLAHYTNAAEVDDLVRAVAELG
FT                   "
FT   gene            147357..148010
FT                   /locus_tag="Amir_0137"
FT   CDS_pept        147357..148010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_0486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34108"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW3"
FT                   /inference="similar to AA sequence:KEGG:Meso_0486"
FT                   /protein_id="ACU34108.1"
FT                   /translation="MGTGLDEALARELADLSALHRLAPLMSEYLPSTAHELSPSALVAL
FT                   LDEVLVGSRTVLVECGCGSSSVVLARLLAKRGFGHLLSLEHDERTAAFVASQLRREGLG
FT                   HVARVVHAPLAAHPAAGPGGQWYAPSAVRDEVSSFVDSHGLVDLLMVDGPLLGDSRYPA
FT                   LPVFRDVLAPGAAVLVDDAHRPGERAVLERWSREYALRFRPTGGTSLAAATALA"
FT   gene            complement(148245..149723)
FT                   /locus_tag="Amir_0138"
FT   CDS_pept        complement(148245..149723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7164 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34109"
FT                   /db_xref="InterPro:IPR029121"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW4"
FT                   /inference="similar to AA sequence:KEGG:sce7164"
FT                   /protein_id="ACU34109.1"
FT                   /translation="MHSDRARPDQDRRSAARVPAPRARSPRAGEEAASGEPPSALSTGE
FT                   LIGIQQRAGNGAASAIVQRMVEDQGDDDRPGPSAEAKGKKKATPESDLANALAPGGGEP
FT                   GSPARVAAVRAALHTRQRNGPMFTGPQLAAIEQADPTWLDAVGVGTREAADRYLAEGSY
FT                   RQWNSLDPGRRVLLATIAFRQRHAATAPDAQLNSPAYTLGRSLFFRERGVPPEDIARLE
FT                   QQQGDQITSAYVETLLREDAPPEVTGAEAARQKQVVTRAREVLIRVFVLLQAGLKVYNG
FT                   EGAHIDYTEGDVTRALAHGGRVNVRVPRLRLGENPFFMNEFLRLKALEERRPFSSHHMK
FT                   LGTAFENKFVEQGEGMASFKNALALIAGFGLWHRMHGLNLAAGGWGNRDFNNDVITPDG
FT                   GHGHLFLAFQPPNLWKNGSVQIGMETTAPRLPVVGKKVPNPVGYEHTARSTEKTANPES
FT                   SFHGHKSDKIGKGGLEDSGRLVDLGGWGPTGSGP"
FT   gene            complement(149847..150821)
FT                   /locus_tag="Amir_0139"
FT   CDS_pept        complement(149847..150821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0139"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34110"
FT                   /db_xref="GOA:C6WDW5"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW5"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ACU34110.1"
FT                   /translation="MRAITLSEFGGPEVLQWSEVRDPAPGPGEVLLDVAATAVNRADLL
FT                   QRKGHYPPPRGASEVLGLECSGVVAALGPGVEGWSVGDEVCALLAGGGYAERVVVPAAQ
FT                   LLPVPVGVDLVTAAALPEVACTVWSNVVVLAGLRAGETLLVHGGAGGIGTHAIQVGKAL
FT                   GARVAVTAGSAERLARCAELGADVLVDYREQDFVEVVGAADVVLDNMGASYLGRNVDVL
FT                   APDGRLVVIGMQGGVKGELDLGKMLGKRASLIATGLRHRPVEGRTGKGAVVAAVREGLW
FT                   PLVADGRVRPVVHEVLPLERAADAHRALEGGGAVFGKLVLATG"
FT   gene            150866..151498
FT                   /locus_tag="Amir_0140"
FT   CDS_pept        150866..151498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0140"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   atc:AGR_C_5049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34111"
FT                   /db_xref="GOA:C6WDW6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU34111.1"
FT                   /translation="MNPWPFHDLVITTPRLELRPDDDAGLLELAAEAQRGVHPPEYMPF
FT                   AFPWTDASADRLATSTLQHHWRMRAALTLDDWSLNFLVRLDGRVIGTQSVEAKDFAATR
FT                   EVMTGSWLGLRHQGSGLGTEMRAAVLAYAFDHLGAVQARSAAWEDNAASLAVSRKLGYR
FT                   PDGTKVAVRRGEAVTEIRLLVTREQFTRPTWNPTVEGHAACAELLTA"
FT   gene            151575..153095
FT                   /locus_tag="Amir_0141"
FT   CDS_pept        151575..153095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0141"
FT                   /product="Aminopeptidase Y"
FT                   /EC_number="3.4.11.15"
FT                   /note="PFAM: peptidase M28; protease-associated PA domain
FT                   protein; KEGG: pag:PLES_21241 putative aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34112"
FT                   /db_xref="GOA:C6WDW7"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="InterPro:IPR041756"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW7"
FT                   /inference="protein motif:PRIAM:3.4.11.15"
FT                   /protein_id="ACU34112.1"
FT                   /translation="MSAKNGVRRAVAIAASASLALVAVPTATAAPAGPDGPALAKKLTK
FT                   EVGVDGVNRHLIALQRIADRNDGNRAVGTPGYDASVDYVVGKLRGAGYEVTTPQFTYPV
FT                   QVYDAATAAVGGDEYEALALEESPQTPVGGLTGPLRAVPEDATPGCEADDFAGQDFTGA
FT                   IALIRRGACTFDVKHRNAAAAGAVAVLVANNADGPLSGVTLGSPGVVPTGGVSKADGTA
FT                   LFGRAGQQVTVDLRFHEENRVARNVIAQTRTGRSDNVVMAGAHLDSVEEGPGINDNGTG
FT                   SAGLLETALKLGGSPKVNNAVRFAWWGAEELGLVGSTEYVRALDFEQQLDIALYLNFDM
FT                   IGSPNAAYFVYDGDDSDGVGAGPGPHGSAQVEQAFTDYLAAAKGVEVEGTDFDGRSDYG
FT                   EFIARGIPAGGLFTGAEGKKTDDQAAKWGGEAGAAFDPNYHGPGDTLANLDRTALDRNA
FT                   DALAWVTASYAISTEDVNGVPPRATRSTSRAAAQARAAVVHPSHADVA"
FT   sig_peptide     151575..151664
FT                   /locus_tag="Amir_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.990 at
FT                   residue 30"
FT   gene            complement(153173..154078)
FT                   /locus_tag="Amir_0142"
FT   CDS_pept        complement(153173..154078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0142"
FT                   /product="protein of unknown function zinc metallopeptidase
FT                   putative"
FT                   /note="PFAM: protein of unknown function zinc
FT                   metallopeptidase putative; KEGG: rfr:Rfer_2725 protein of
FT                   unknown function, zinc metallopeptidase putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34113"
FT                   /db_xref="GOA:C6WDW8"
FT                   /db_xref="InterPro:IPR007343"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW8"
FT                   /inference="protein motif:PFAM:PF04228"
FT                   /protein_id="ACU34113.1"
FT                   /translation="MQFNEDAELDTSQVNDQRGVGGRVALGGGGLGIVGVIIYLVLNQI
FT                   GGGVPLPQGSGFGDVGQNQQVGSQSLGQKCRTGADANRSDDCRAVAFINSIQAFWNDQF
FT                   ARSGRSYKAAQTNFFSGGVRTNGCGSASSASGPFYCPADSQVYIDLTFFQELKTKFGAT
FT                   GGPFVEAYVLAHEYGHHVQNLLGTSSRVGGETGPKSGSVRLELQADCYAGAWANHATTT
FT                   PAASGKPLITGVTDQDIAAALDAAARIGDDFIQKELGGGRVDTTQFSHGSSEQRQKWYT
FT                   AGYRSGNPAQCGTFDTDDLG"
FT   gene            complement(154537..156264)
FT                   /locus_tag="Amir_0143"
FT   CDS_pept        complement(154537..156264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0143"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: 5'-Nucleotidase domain protein;
FT                   metallophosphoesterase; KEGG: scl:sce7039 putative
FT                   5'-nucleotidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34114"
FT                   /db_xref="GOA:C6WDW9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDW9"
FT                   /inference="protein motif:PFAM:PF02872"
FT                   /protein_id="ACU34114.1"
FT                   /translation="MTWFRRSAALAATAVAGAAVLLAQSPATPAQADGRASGKTVDVRL
FT                   IGINDLHGNIEPPTGSSGRVTLSDGTTVNAGGAAFNATHIKKLQSEVRNSVIVGQGDLI
FT                   GASPVVSALFHDEPTVEILNKVGMDATAAGNHEFDEGYRELLRMQHGGCHPVDGCQFSP
FT                   SYTGAKFKILGANVTLAKSGLPALPPFWVEFRDGVPIGFIGMPLKDVPILVDPNGIKDL
FT                   KFGDEIAAANKYADLLNWLGVKSIVLLVHQGDNTTGGGPDDCNTVSGGPGRLIAEKVSP
FT                   KIDAVFSGHSHQQYNCTVTDPAGNPRPFIEGLAFGRELSVVDLKIDKRTRDVVRSATKA
FT                   RNHVVTQDVTPDPKIQAVIDQAKTKAGPIANKQVGTIASDVLRAQNPAGESPLGNLIAD
FT                   SQLAATTGNGAVAALMNPGGVRADLTYAGSPAGEGDGVVTYGEAFTVQPFGNILQTVSL
FT                   TGAQLKAALEQQWQTVNGAQRQIVLQPSAGLTYSWSASAPQGAKISNLAINGTAVDPAA
FT                   SYRITINSFLQGGGDGFSAFTAGTSVTGGGIDLDAFAGYLATHPNVSAPALDRITTTP"
FT   sig_peptide     complement(156166..156264)
FT                   /locus_tag="Amir_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.623 at
FT                   residue 33"
FT   gene            156424..156891
FT                   /locus_tag="Amir_0144"
FT   CDS_pept        156424..156891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0144"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: acp:A2cp1_4259 transcriptional
FT                   regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34115"
FT                   /db_xref="GOA:C6WDX0"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX0"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34115.1"
FT                   /translation="MGAEPRWLDEGEMRAWRNYVVGAAMLSDRLHRELQTDHDLSLADY
FT                   EIMVRLSEQPGGRMRMSQLAEDVASSKSRVSHQVARMEKEGLVRRRECPEDGRGVFAEL
FT                   TADGARLLENSAPTHVRGVREHMVDLLSPEEQEVLAKVFNRVITHLRGSDG"
FT   gene            156905..156989
FT                   /locus_tag="Amir_R0005"
FT                   /note="tRNA-Ser1"
FT   tRNA            156905..156989
FT                   /locus_tag="Amir_R0005"
FT                   /product="tRNA-Ser"
FT   gene            157221..157970
FT                   /locus_tag="Amir_0145"
FT   CDS_pept        157221..157970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0145"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   sfu:Sfum_1521 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34116"
FT                   /db_xref="GOA:C6WDX1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX1"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACU34116.1"
FT                   /translation="MTVFEAVVVALAGMFAGAINTVVGSGTLVTFPVLLAIGYPPVVAN
FT                   VSNSLGLVPGSLSGAYGYREELKGQGERIRRLLPASVLGGIVGAVLLVVLPESAFSAIV
FT                   PVLIAVALVLVVAQPWINRKLAERRRPAHGGAALWIGVLLAGIYGGYFGAAQGVLVMGL
FT                   MGALVNDQLQRMNALKNVLTAFVNLVAGVLFIFIADVEWLVVLLLALGAVVGGQIGAKI
FT                   GRRLPPPVLRGVIVLVGLAAIAQLLLA"
FT   gene            complement(158047..159114)
FT                   /locus_tag="Amir_0146"
FT   CDS_pept        complement(158047..159114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0146"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: scl:sce8915
FT                   histidinol-phosphate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34117"
FT                   /db_xref="GOA:C6WDX2"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024892"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX2"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ACU34117.1"
FT                   /translation="MSVRTRPDLSLLPPYVPGRSVPGAIKLASNEVSAGPLPSVVRAIA
FT                   DAATSVNRYPDSGSGALVERLSGKLGVPEEQIAVGCGSVTLCQQLVQATCGEGDEVLFP
FT                   WRSFEAYPIITQVVGATQRRVPLTPEHGLDLDAMAEAITPSTRLVFVCNPNNPTGTAVR
FT                   TEEVERFVERVPDDVLVVLDEAYKEFVDDPHVPDGVELAKAHWSRGRDNVAVLRTFSKA
FT                   YGLAGLRVGYAVGSPQVADALRKVYVPFGVNALAQVAAIASLDAEPELLERCRGLVVER
FT                   GRVRAELLAAGYEVPETQANFVWLPLGERTAAFNEHCLDRKVVVRAFAGDGARVTIGSP
FT                   EENEAFLVAARSFER"
FT   gene            159236..159919
FT                   /locus_tag="Amir_0147"
FT   CDS_pept        159236..159919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0147"
FT                   /product="dienelactone hydrolase"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: cvi:CV_3204
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34118"
FT                   /db_xref="GOA:C6WDX3"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX3"
FT                   /inference="protein motif:PFAM:PF01738"
FT                   /protein_id="ACU34118.1"
FT                   /translation="MKQTRIETLQLTDGRELRMTVAEPESAVRGGLVVLHEARGVTDAV
FT                   RGLVSGLAAEGWLAVAPHLYADDELDDDQAGTAVSGLDGESVLADTDVAFVWLGQRGVS
FT                   TDLMGVVGFDLGGSVAMAVAASRSVGAAVTVGGGGVLEPLAAGLPPLVDLAQELACPWL
FT                   GLYGASDDGVPAAEVAKLRDAAAGAPVATDVVRYEDSEHRFDTSPSNASDAWQRALNWF
FT                   DSHLR"
FT   gene            complement(159963..160340)
FT                   /locus_tag="Amir_0148"
FT   CDS_pept        complement(159963..160340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0148"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GK21229 gene product from transcript GK21229-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34119"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34119.1"
FT                   /translation="MPWMRVVVAGATSAATSSADSTLVAAAPGASVPSSSSARAGVPGG
FT                   PPSACAAATSPGRTTWVDAVSAGGVGPVAGVGAPRKPAGAACVSRTVFPSLIHYPLALR
FT                   SRRNLAARYRRARPHALDAPP"
FT   sig_peptide     complement(160260..160340)
FT                   /locus_tag="Amir_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.525 at
FT                   residue 27"
FT   gene            160367..161743
FT                   /locus_tag="Amir_0149"
FT   CDS_pept        160367..161743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GH10507 gene product from transcript GH10507-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34120"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34120.1"
FT                   /translation="MIPDGATKHLGPAELAEAGRAVTQSTTQTISLKDLAHALPASSTT
FT                   HKITAADARPASTGQGPAATQVVPGAQPGGARTTPPGSTPPGGATAAGSAAPLPPAPQQ
FT                   QSAQPQAAQAAGAQGNQIVHGPVSPASTPAAPAPAAPAPAAAQNAAHQTPDAPPVLPTA
FT                   AAPSGMSAGTTAAAGATGPAAAPGATGTAADPTTATAAAPISEPISGTLADPTFATAAE
FT                   PAVAPADLDPADLVAGVPLGATTEPAATTGAAPIPAAPLPAAPPQTADPATTAAPSPAA
FT                   STPAPTTPATDPATADPVTAGATTAGATTAGAAAAAGDPAEGDASFTGAAKADLEKAGA
FT                   ALDAVDKGQVKLAMDNQSVDELLKLITEARDMVSSVHVTALTSLDVELRFGDNWVGRSI
FT                   SKRLHDLAVGDESSAVNVIGDFLRILLEVEETIRKAARNIRNADDDARDNFNKSGWGHH
FT                   "
FT   gene            161743..163089
FT                   /locus_tag="Amir_0150"
FT   CDS_pept        161743..163089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B5390 glycin-rich signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34121"
FT                   /db_xref="InterPro:IPR000030"
FT                   /db_xref="InterPro:IPR038332"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34121.1"
FT                   /translation="MAGEQRDHRKNGDHANQGGGDQGGGDHGGYGRGNEPSELGQKVDW
FT                   MTYTHQQLYDMVHTGVDLDSATSAKAGWSGIGKSLGEVRDLLVKAINQSSQAWEGETAD
FT                   RAREGLESVMKWAQNTSDHAENVATCINEEIQHVVTAREQMPAPVPPTLPTAVVPGAVA
FT                   PGADQALVPSAIARAADVPATSTAESALTGSSTLGSALRRTATPESFAGLDTVAAPAAE
FT                   TTAVADATHRQAAEVMAMFQQNSYAVDLTVPSFSAPVNPVATPTPGAQVPLAPGGATAD
FT                   GPAGAGGSAVVNPAATTGQSSADRQRQQGGGSAGRMPAGAGRGAGGYGGGGVFARGRVP
FT                   SSGSGSSGGAGGGSLGATPIGAGGSSANVGSGHGASGSPGGVTSQFQASKAVAPQHGMI
FT                   GATPMAAPPPMAAGMGGGGNDSRNRPDYLEDDENVFGLDHKAAPPVIGL"
FT   gene            163086..163844
FT                   /locus_tag="Amir_0151"
FT   CDS_pept        163086..163844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34122"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34122.1"
FT                   /translation="MTERVFRLSEQEFFLLWQSVHGPDVPVPLGARHYGHTQAERAGLV
FT                   ESASRALAGRGLGTVQRPDEQLHDILRGLGEYEVGLEVVFSRGGDQGRGLATAAWHGAF
FT                   AARAAGQVQLTSFHATALATKTIATLPAAPTGSGRSVSVRWTDYLAAGEAGRVDGAEGF
FT                   LEALRSVGVREPEANTLLRAVISRRGGGQVAVIARNRAGYLRPTGGAVSWLDTAEGRYL
FT                   VRRDGPWLVLAPANAQRLTSALEGVVAAGR"
FT   gene            163955..165910
FT                   /locus_tag="Amir_0152"
FT   CDS_pept        163955..165910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0152"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: sil:SPO1959
FT                   acetoacetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34123"
FT                   /db_xref="GOA:C6WDX8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX8"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ACU34123.1"
FT                   /translation="MTDTQTGTAAGSPEPLWTPDPDRVAASRMAAFRDWLRAQRGLDLP
FT                   DYPSLWEWSTSDLEGFWGALAEFTSTRFHSPPERVLAVDAMPGAVWFPGATLNYAEHAL
FT                   RHEGVAVVLRREDGHRAELTYAELRARVAAARAALQALGVVAGDRVVGLVPNTPEALIA
FT                   FLAAASLGATWSSCSPDFGAPAVVDRFAQVTPKVLVAVPGYRYGGRDYDVRPVVARVRA
FT                   AVPSLVATVLIGGDEPGTLGWDALLAEHAGAEPAYDPVPFDHPLWVLYSSGTTGLPKGI
FT                   VHGHGGILLEHLKMLALHSDLGPGDRFTWFTTTGWMMWNYLVSGLLVGATAVLYDGSPG
FT                   HPDLSALWRVVEQERVTYFGTSAPYLQACLKAGLRPRDDHDLSALRVVGSTGAPLTPEG
FT                   FRWVADAVGDVQTASVSGGTDMCTAFVAAAPDLPVWVGELSCRALGAAVAAYDESGRPV
FT                   LDEVGELVVTRPMPSMPVFFWGDEDGARLREAYFETYPGVWRHGDWIRITPRGTAVIYG
FT                   RSDSTLNRGGVRMGTSEFYRVVEAVDGVADSLVVDTSDAANPDGELLCFVVLDAGAPLA
FT                   EVEAELRARLRALLSPRHVPDRFVEVAEVPRTLNGKKCEVPVKRILAGVDPERAVSRDA
FT                   LRNPDALLPFLNWISR"
FT   gene            166068..166159
FT                   /locus_tag="Amir_R0006"
FT                   /note="tRNA-Ser2"
FT   tRNA            166068..166159
FT                   /locus_tag="Amir_R0006"
FT                   /product="tRNA-Ser"
FT   gene            166198..166273
FT                   /locus_tag="Amir_R0007"
FT                   /note="tRNA-Arg1"
FT   tRNA            166198..166273
FT                   /locus_tag="Amir_R0007"
FT                   /product="tRNA-Arg"
FT   gene            complement(166576..168750)
FT                   /locus_tag="Amir_0153"
FT   CDS_pept        complement(166576..168750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0153"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: SAMD1; sterile alpha motif domain containing
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34124"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34124.1"
FT                   /translation="MSARTGELLGVDLEDCFVFQNGRLYPCEVWSRARIGVASRAHDAA
FT                   SGKPVEWSRRFRGEVEPLFRLGVVRLTGNGPEPVPDADLHAGLLAGDADERLVLVRRPD
FT                   VPYPDVPEVADTPVLPQALAEAEAAVLAGAPEGWRELVLGCRFFRAQAEFRAEVVLADG
FT                   STRSWTPPALAAQWLHRLRMTDHRTAWDWRFAPGAEVVREGRSEPPAPERPGNNRCELI
FT                   GPVGVFDGHAPRWYRPPVGEAELEAVLGYLRGAPVVLEGDGFVEDLVAEQTGGSRETEV
FT                   PLTHHTDGVLTWTSAVAYFLERHGVPPHPALVRRMRERDYAVGGVSEFGLRRGEVFAGD
FT                   DLAPGFREGRTAWASLQKALAPVRGFLEAHGLALEDTESTGWVVEVAPYDGYLVKPHGS
FT                   ATGEEFDSAEHAAMYLLGRLCAELGAPAAPAAAAVPPPAAPPLPAQHSQPLPVQHPRSQ
FT                   PLPVQQAQPVQQSLPLPVPPPGPQTPPPWQAQPLAPQDGQWRPGPHTVTTSNGPTHPKH
FT                   PGMPPVTPELLAAQRANRQPYVRCVDPAVNHPRFAGAVPDWAVYGAYLTNPATGELTGE
FT                   AVLNSEYRPSPRHLGLPEPRTELEAVLGLVTAGWLPSASAGDAALRAKLFVVMRGPDEL
FT                   PVIVSTTGARLMEVYTTRDRFLEGVQRTMDGRPQDHVGVFDEKLLVEVDAHSLLPSIHN
FT                   VVLVVNPRTGLTTRVAGSALIAAANRPVFR"
FT   gene            complement(168872..169687)
FT                   /locus_tag="Amir_0154"
FT   CDS_pept        complement(168872..169687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0154"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: sml:Smlt3132 putative
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34125"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY0"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACU34125.1"
FT                   /translation="MESLRAVSQWPVDSAAVAAVSSDGRVLGSHGDLERRYPLASVTKL
FT                   LTSYAVLVAVEEGAVEWDDPAGPEGSTVRHLIAHTSGLAFDSDKVQAAPGERRIYSNRG
FT                   FEVLADAVERSSGIAFGDYLAEAVLGPLGMGSTALEGSPAAGGVSTVADLVAFAAEVQS
FT                   PKLVSAGLVAEARTVAFPGLKGVLPGYGLQRENDWGLGFEIRSAKSPHWTGTTSSPGTH
FT                   GHFGQSGTFLWFDPALSAACVALTDRPFGEWAVAAWTPFTDSVVAELAR"
FT   gene            169787..171295
FT                   /locus_tag="Amir_0155"
FT   CDS_pept        169787..171295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0155"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; KEGG: bur:Bcep18194_A5663 DNA translocase FtsK"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34126"
FT                   /db_xref="GOA:C6WDY1"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY1"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ACU34126.1"
FT                   /translation="MSRKSFPLVVVVVALAASTPALTASAAPSDCPAGTEGVPITWDEP
FT                   GLEWPANVVDAQVEDVGGTDLDVAVVLSDPASRNADDSNPLADFAAARPADLPGWAAIP
FT                   RTGTLSSYGPGYLTAGMNSLAVGDTVSYTVRFTRPVVVPDFTVGGIDHTGLGTVPARDP
FT                   WHSHQDEVVVTAVRAGTAVATSGTGTGLGGPYALGVDGTLPPGDPRATLVRGTAEPVTA
FT                   LRLDLSNGPDDEAAELADPRATVLPQPANSVADAVTVRVAGFTACLGTGAITSSVYADA
FT                   DRDGVRDPGEAGVAGAALELRDPQGSVLATTTADASGGYAFDRLPPMAWTVRLVSATPP
FT                   ATYTGPTSRTVALTPGEQATAAGDFAFQPPAPQPAATTTTAPPTTTAPTTTPPTTAPPT
FT                   TTAGPISSSPTTTAPTAPTTTAPAAGPITARPAPPSAQAQALASTGADVRALAPLGALL
FT                   VALGGLAVGASRRRARRAPGRAPVRPARTAPGGLAVSATRRRTR"
FT   sig_peptide     169787..169867
FT                   /locus_tag="Amir_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.877 at
FT                   residue 27"
FT   gene            complement(171267..172106)
FT                   /locus_tag="Amir_0156"
FT   CDS_pept        complement(171267..172106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0156"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; short-chain
FT                   dehydrogenase/reductase SDR; dTDP-4-dehydrorhamnose
FT                   reductase; KEGG: hha:Hhal_0769 UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34127"
FT                   /db_xref="GOA:C6WDY2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY2"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACU34127.1"
FT                   /translation="MSPMRVLVTGARGYVGRAVAAELSGAGCEVVPLGCDVRSPEARDA
FT                   ARSVDAVVHLAALARVRESFERPLDYFDVNVAGTANLLRAEPARFVLASTAGVYGAPGV
FT                   PVLSEDVPRAPASPYAASKAAAEDLVRWAAPGGVVLRLFNVAGGGDRDDTRIVTRACAA
FT                   ASGRLGPLAVYGDGGAVRDFVHVRDAARAFLVALGLDGGVFNVGATAASVADVVAAVEQ
FT                   VAGRPPAVEHHPAHPGEVRELRSDSARLRAAGWAPERSGLVELVRDQWLSESAAGSR"
FT   gene            172215..172442
FT                   /locus_tag="Amir_0157"
FT   CDS_pept        172215..172442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34128"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34128.1"
FT                   /translation="MPRTIEVALAEHAEREAERQHFLRTAAAVADSTPFPHPSRADDDT
FT                   LLALAIGVTRPRGRRAFLDRLDLVLREAAR"
FT   gene            172593..174020
FT                   /locus_tag="Amir_0158"
FT   CDS_pept        172593..174020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34129"
FT                   /db_xref="GOA:C6WDY4"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34129.1"
FT                   /translation="MDHVLLALQERLGTLFGDRRVVLAGGTRLSNRVNELHQLGARHTL
FT                   VLSTDDHAPLHDSERARWVPLGIGGFVATEQNRLTKLLTSPGRRVRAVLDEFDPEGEAL
FT                   VISTPYSQVPSFAGRPVLSARRPEWVELENKTTVDALWDELSAPRAPAEVLGLDFDALW
FT                   EATLRLDRGAGAVWSGDGPAINGGANFVRRVRDREEARDAFEVLAPKCDFVRVMPFLEG
FT                   IPVSVHGIVFPDGTAVLRPIEMVVPRRAGSARFLYAGCASYYDPPARIREQMRNLARRV
FT                   GERLRETVDYRGTFTLDGIATADGFLPTEINTRYGGAMVCFEDALPQLPLSLVQVALVA
FT                   GHDLGVSSMEFEELLVSAADAYRHGSVGANARAVRPTETVERPIVFSEWACRFAHPDET
FT                   PHGALRLKPSPLGGKLELDFTADQLQLGRPVAALTVAAFALADQEWGTGFGPLEPAVPI
FT                   ADDEQPAQVVEQVFVTA"
FT   gene            complement(174010..174810)
FT                   /locus_tag="Amir_0159"
FT   CDS_pept        complement(174010..174810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0159"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34130"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34130.1"
FT                   /translation="MELPAAWWRPDPLRGVEDVPWRALSGGLGVDDLLRGAAEGEPGAC
FT                   DGLAARLLDEDTVSEATVRAVPFLVELGAGYKVPADTRDRVIFLLAAIALAGAGFTEGG
FT                   TRRTRRRWNRLGRELPRRQPDLMTQARQAVALGAPKVFDSLGLAEVACSMALAIAVPEV
FT                   APQHVVDVAHGIAFAGSFPEPLQESAVVALHLVHGWECDESWVYAIAQGDPELLRAYEE
FT                   GAFPPYQPSAVTLQLLGFRYAFLAAYGQEGVLGMDLLGGAPVTP"
FT   gene            174893..176107
FT                   /locus_tag="Amir_0160"
FT   CDS_pept        174893..176107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0160"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /EC_number="2.1.1.37"
FT                   /note="PFAM: C-5 cytosine-specific DNA methylase; KEGG:
FT                   nmc:NMC1992 modification methylase (cytosine- specific DNA
FT                   methylase)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34131"
FT                   /db_xref="GOA:C6WDY6"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY6"
FT                   /inference="protein motif:PRIAM:2.1.1.37"
FT                   /protein_id="ACU34131.1"
FT                   /translation="MRGPTYKVVDLFSGAGGMSLGFRTHRDFTVVGAADAQIGKPSSPL
FT                   GSLRCNNVYRDNIGIDPLQVDLGRIDPAVLREVWGLRRGELDVLVACPPCSGFTRITAA
FT                   NHLRDDPRNSLVGRVARFVAELRPKVLLMENARELVRGKQRHHLDGLAEQLIALGYEVD
FT                   ASSHMLSRFGLPQLRERAVVVAVDAGIPLRTLEDVWRGREVRPAAVTVRRAIGKLPPIP
FT                   AGYAHPDDAMHVSPSFRADRSLDRMRAIPVDGGSWADLVGAPDTELLLNPAQVKIIEAG
FT                   RWGSHPDVYGRMWWDEPARTIKRECAHVGNGRYAHPEQHRLCTVREMALLQGFPRKFRF
FT                   DVSVLGNAYRHLGDAVPPLISYQLASLVRWMLSGERPTARELCLPGTSLRPSDIRPALV
FT                   PSLVA"
FT   gene            176495..177745
FT                   /locus_tag="Amir_0161"
FT   CDS_pept        176495..177745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0161"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; KEGG: ADR019Cp; K01066 esterase / lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34132"
FT                   /db_xref="GOA:C6WDY7"
FT                   /db_xref="InterPro:IPR013552"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR023849"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY7"
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /protein_id="ACU34132.1"
FT                   /translation="MASRLLKRAGAIALGASIALTTAALPASATAIEILPIPRHDPDFA
FT                   KFHEEGIEVKMSGHKDKDNWLGANLIALKVKEDGKTTGVKAYCVELPTPLENGTPLTEV
FT                   PWGEHPNSGTKFKENADKINWILQNSYPVKDASVLSEATGKSVSKREAIAATQAAIWHF
FT                   SDGADLDTTKDRDRQTNEDVKAVYAYLIGEKNVGIKEQPAPSLAITPKTQSGKPGDLIG
FT                   PFEVSTTAGAVVLKADLPQGVTLVDAAGATLKTAAKGDASASADTKFEKVFVKVPEGAK
FT                   DGQVSFSLQADAKLNSGRLFVSSDKNKKTQSLVVALPSQVTVKAEATASWKAEQVTTPP
FT                   TTTSVSTSPSAPAPSSSNPSTPESSTPETSVSPVPVAEKDELASTGASIFVPLLIGLGL
FT                   LGAGAAAMIVMRRRKTA"
FT   sig_peptide     176495..176584
FT                   /locus_tag="Amir_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.658 at
FT                   residue 30"
FT   gene            177884..178057
FT                   /locus_tag="Amir_0162"
FT   CDS_pept        177884..178057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34133"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34133.1"
FT                   /translation="MNFDEIKNKATQLLEQHHETVEKGIDQAADFISDRLGHQEQVHSA
FT                   AEKAKDALPGAR"
FT   gene            178054..178677
FT                   /locus_tag="Amir_0163"
FT   CDS_pept        178054..178677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0163"
FT                   /product="protein of unknown function DUF1089"
FT                   /note="PFAM: protein of unknown function DUF1089; KEGG:
FT                   sme:SMc03980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34134"
FT                   /db_xref="InterPro:IPR009467"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDY9"
FT                   /inference="protein motif:PFAM:PF06475"
FT                   /protein_id="ACU34134.1"
FT                   /translation="MSTARTAERATAQQGESRAAARMVTWQGCSVPRLEQVRVLVSEHK
FT                   LRASGRIVASGPAEQFNGSFELSVGEDGAVTRLLLRTATVAEERHVSLSRSSDGVWMVD
FT                   RGHGGERADFDGAVDVDVEFAVLFAAIPVRRLGLHREPGEAELPVVRVSLPDLDVTVVR
FT                   RGYRTASVGDGGSVVAIRAEDGEQDVTVDAEGLVVDYPDVAQRI"
FT   gene            complement(178764..179948)
FT                   /locus_tag="Amir_0164"
FT   CDS_pept        complement(178764..179948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0164"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: gbm:Gbem_1434 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34135"
FT                   /db_xref="GOA:C6WDZ0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ0"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACU34135.1"
FT                   /translation="MQRPLILDAARTPFGRYRGGLSGVRVDDLAALPISELLRRHPDLD
FT                   PARVDDVLYGNTNGAGEENRNIGRMAALLAGLPPTVPGASVNRLCASGGEAIVQASRAL
FT                   AMGDADVVVAGGVEGMTRAPFVVPRPDRPFADRLEPVSTALGWRLVNPRMPSAWTVPLG
FT                   RAAEQVAAELGITRERMDQYALRSHRRASAAWDAGVHDGFAFPVQLPDGSAVRRDESVR
FT                   PETSAEKLAKLKPAFSDDGTVTAGNSSPLNDGAAAVLLGTESLATELGVTPLGEVLGSA
FT                   VTAGEPQRFTLAPVGAIRKLLGRLGIGGADVDLWEINEAFAAMALSVLHHLPEVDREKV
FT                   NVHGGAIAYGHPLGASMPRVVVDLCRHLRARGGGVGVAAACVGVGQGMAIAVRV"
FT   gene            complement(179961..181772)
FT                   /locus_tag="Amir_0165"
FT   CDS_pept        complement(179961..181772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0165"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: CG32656"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34136"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34136.1"
FT                   /translation="MDRRRIGFFAAGAVLFAGVVVVLRGGGAPGPADAGITTQPPPPTS
FT                   LTAFASDGVLAPSPGSVPDPPEGLEAAPGPGSLVVTWTGGAPGYEVRWGLGDVSRTRLV
FT                   TGSLVELRLADGLEQRVEVRAVDGFGQRSAPASVSGAPGPVGVSEPGAYHLVDRFEGAS
FT                   APDPARWRLTARPGCARAGAGSDEEAAALVVATTCAGVPAVLRSRAPLVLREDGEELGR
FT                   FAVGAGAPIANGELALELAPGPVAALSGAEPPPGALRLLVRATEDSVTARVLTAEGDRT
FT                   RELRPLDGVAPGTGHVWELVLRRDGALVLLDGEPVATSPVVPAWREATALISVSGPIGQ
FT                   RVPVWLAGLGGAPSTAPPLVGPVRVEVTPQGGEAGSGVGAPAGQLRLTVSHTLSRERDA
FT                   PLVALVSGVPVPLRRAVDGAPVRADTGLPLVGDVPAGVASVSPDGVVGVRLDLGFDATA
FT                   THAELELGPGGAVPVAANPEPGPPQSALPRPSARVLDASGRPLPPGTPVPRGRVVVEVE
FT                   LVGAPAQHGLAGLAGFGLWLDGTRIASVPTAVGGPAVAGTYRVAVNTGALPGGPLSEGP
FT                   HMVEARLFGTSGSTRPTSAFASFFAAR"
FT   sig_peptide     complement(181668..181772)
FT                   /locus_tag="Amir_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.806 at
FT                   residue 35"
FT   gene            complement(181830..182186)
FT                   /locus_tag="Amir_0166"
FT   CDS_pept        complement(181830..182186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34137"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34137.1"
FT                   /translation="MTGGEVGAPVLDSWSPPLPATPPVRTRFARDGDRVRLVVSLLDPL
FT                   ARELLPLRELRVDLDGERLAVVPLGGSVGGVHEFEVSGVEPGGHRVRVEVEPEQLDLAT
FT                   TVRETEVTQSLPPR"
FT   gene            complement(182183..183073)
FT                   /locus_tag="Amir_0167"
FT   CDS_pept        complement(182183..183073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0167"
FT                   /product="PE-PGRS family protein"
FT                   /note="KEGG: ade:Adeh_1681 PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34138"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ3"
FT                   /inference="similar to AA sequence:KEGG:Adeh_1681"
FT                   /protein_id="ACU34138.1"
FT                   /translation="MGRPGAARARPRGGADRSRPGRAEAGGGAGGRRAGRPVGRRRGGG
FT                   HARRGRREPGDPARCAAAGVRRARVGAPRPVAGAARPGAAAHRRVRARRPWAAAARLPH
FT                   RGPPVEHAAGAARAARGRAARPGRAGGGGPGGRQRAVARAGARPRAGPGRAGRRAVAVR
FT                   LGGHDRAGRGRGAARGQWRADGLGADRVALGRGAAPLGGAGARVVGGGAAGRRGRGRAG
FT                   RDHPVESVLAPVGAARGRTGGADRLRQRGRARRAVTGAGGPAAVGRGGRDDGHDPVVDR
FT                   RGPGRRAPGSPGTWW"
FT   gene            complement(183317..184273)
FT                   /locus_tag="Amir_0168"
FT   CDS_pept        complement(183317..184273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0168"
FT                   /product="Prephenate dehydrogenase"
FT                   /note="PFAM: Prephenate dehydrogenase; KEGG: gsu:GSU2607
FT                   prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34139"
FT                   /db_xref="GOA:C6WDZ4"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ4"
FT                   /inference="protein motif:PFAM:PF02153"
FT                   /protein_id="ACU34139.1"
FT                   /translation="MRELCVVGLGLIGGSVLRAAVAAGWTAWGATASEEDAGTARADGF
FT                   DVVDLVEALARAQRSDALVVLAVPLPAVERVLRMLPAGVRLTDVVSVKGPVADLVGRCA
FT                   PSARYVGGHPMAGTSASGWAASDVALFRGAAWVVAAEDGCDLDVLGDVVRLALAVGAHV
FT                   VPTDADEHDVAVARVSHLPHVLAAVLASVGAEGGPLALALAAGSFGDATRVAGSDPDLV
FT                   RAMCEGNRNALLGAVDDALGRLGAARGSLASTGGLAKTIDAGHAARGRLDALRADEGAE
FT                   VTVDLAARDAREALRAVGARGGRVVALDGTTALARTF"
FT   sig_peptide     complement(184205..184273)
FT                   /locus_tag="Amir_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.986) with cleavage site probability 0.660 at
FT                   residue 23"
FT   gene            complement(184371..185606)
FT                   /locus_tag="Amir_0169"
FT   CDS_pept        complement(184371..185606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0169"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: sal:Sala_2314 peptidase M20D, amidohydrolase;
FT                   TIGRFAM: amidohydrolase; PFAM: peptidase M20; peptidase
FT                   dimerization domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34140"
FT                   /db_xref="GOA:C6WDZ5"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ5"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACU34140.1"
FT                   /translation="MSTPAPSPSEHTEDPRFTGLSEEARALQPRTVALRRQVHRHPEQG
FT                   LDLPRTQAAVLHALEGLPLEITTGTTSSSVVAVLRGERPGPTVLLRGDMDALPVQEETG
FT                   LDYASEVPGAMHACGHDAHVAMLASAARLLSGRRDALAGQVLFMFQPGEEGHHGARFML
FT                   EEGLLDAAGARPVKALALHVSATVASGVVLTRPGPMMASADTFRVLVRGRGGHGGMPHD
FT                   ALDPVPAAAAMVGALQTMVARRVSVHRPAVVTVGRIEAGTTNNVIPETALLEGTIRTLS
FT                   EETRTLVHRELVAVCEHVAAAHGCAAEVEVTPGYPVTVNDAEVAPRLLELASTVLGPRW
FT                   VAEAEDPLMGAEDFSYVLREVPGAMAFLGACPRGVDLARAEPNHSGRALFDEAALEHGV
FT                   VVYSAFALDALR"
FT   gene            185647..186177
FT                   /locus_tag="Amir_0170"
FT   CDS_pept        185647..186177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34141"
FT                   /db_xref="InterPro:IPR023869"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34141.1"
FT                   /translation="MLPGEGRWPYGVHMPEQEPPVHGFAVAVVREDNRWRCSTLDGDAL
FT                   SELDAAITQLRGLRSTGAVFGLLAVDDEFFIVLRPVPGGVSLLLSDAAAALDYDIAADV
FT                   LDLLRVDPPDEEDEELWPEGDLAVLADLGMPKHELQVIVDEVDLYPDEQLQMIAQRIGF
FT                   GEEFTRLLDTLQA"
FT   gene            186174..186656
FT                   /locus_tag="Amir_0171"
FT   CDS_pept        186174..186656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0171"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   gur:Gura_0055 CMP/dCMP deaminase, zinc- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34142"
FT                   /db_xref="GOA:C6WDZ7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ7"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACU34142.1"
FT                   /translation="MITAPYDAMVGAALEAAAGAGEDIPIGAAVFGPDGAELARACNAR
FT                   ERLGDPTAHAEVLALRAAAAVFGDGWRLGGCTLAVTVEPCAMCAGALVLARVDRVVFGA
FT                   WEPKTGAAGSLWDVVRDRRLNHRAEVVGGVREAECAALMRDFFAGRDTSERWPESG"
FT   gene            186714..186798
FT                   /locus_tag="Amir_R0008"
FT                   /note="tRNA-Ser3"
FT   tRNA            186714..186798
FT                   /locus_tag="Amir_R0008"
FT                   /product="tRNA-Ser"
FT   gene            complement(186876..188189)
FT                   /locus_tag="Amir_0172"
FT   CDS_pept        complement(186876..188189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0172"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sus:Acid_5994
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34143"
FT                   /db_xref="GOA:C6WDZ8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ8"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACU34143.1"
FT                   /translation="MPREKKGRSANGRSSIYYSETDQSWHGWVTVGTKDNGQSDRRHVR
FT                   GKNQDEVSDKVSKLERMRDQGRVTKAGQNWTVETWLKHWLENIVAPPVVSENAYSAYEV
FT                   AVRVHLVPGIGAHRLVKLQPEHLEKLYRAIMRKSTKFGPTTSSSTAHQVHRTIRAALNV
FT                   AVRRKHLTENPALEARAPKLEETEVEPYSVDQVKALLVTALKRRNSARWAIALALGLRQ
FT                   GEALGLRWQDVDLEVGTLVVRRNRLRPKWRHGCTEPCGKKHGGYCPQRVALREETAGTK
FT                   SAAGKRGMGLPDELVRLLRVHRDVQARERERAAELWTDTGYVFTTPTGGPLNPRSDYDE
FT                   WKRLLDIAKVPDGRLHDARHTAATVLLLLGVPERTVMGIMGWSNTAMAARYQHVTAAIR
FT                   LDVAQRVGGLLWEPAEKPTEPRDEGEEGDATGALIPTA"
FT   gene            complement(188197..188499)
FT                   /locus_tag="Amir_0173"
FT   CDS_pept        complement(188197..188499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0173"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34144"
FT                   /db_xref="GOA:C6WDZ9"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDZ9"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACU34144.1"
FT                   /translation="MSTNGRNAEIAELIARLTVLMTASPERQVPAQRPAPVRVLLTVEE
FT                   AAERLGIGKTKAYALVKAGSLESVLIGRLRRVHVDAIDHYTARLVAEQSSARPAA"
FT   gene            complement(188496..189647)
FT                   /locus_tag="Amir_0174"
FT   CDS_pept        complement(188496..189647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc2483 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34145"
FT                   /db_xref="InterPro:IPR022081"
FT                   /db_xref="UniProtKB/TrEMBL:C6WE00"
FT                   /inference="similar to AA sequence:KEGG:RSc2483"
FT                   /protein_id="ACU34145.1"
FT                   /translation="MSAALRAVPTAQPAPGHVVLDQVRDFVKRFSVFPDEHCAPTLALW
FT                   YAHTWVADAFYTTPRLVLSSPEAGSGKTRVLEIAQHLTREPEMTAGGSAAALVRMVAAG
FT                   PISILMDEVDTVFGTGGAGNEEVRQMLNLGYKRTATIPKTKGDPASGFTVERLPIFAPA
FT                   ALAGLAGRMPDTITTRAITIHLRRRRHDEPVEPYRESKVVRQATPIREALGDWTASIGE
FT                   NLIEAEPDMPPGVEDRPAEIWEPLLAIADVAGGHWPETARAACSHFVLNQKSTQTLGVR
FT                   LLDDLRALFTAEGTERMHTAEIVTRLRGLEDAPWADLNGKPLDSRQLARQLSLYQVAPL
FT                   TFKHKNTNAKGYVTYPTNTQVTQVGLADAWARYLAPEHNGGAV"
FT   gene            complement(189644..190216)
FT                   /locus_tag="Amir_0175"
FT   CDS_pept        complement(189644..190216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0175"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34146"
FT                   /db_xref="UniProtKB/TrEMBL:C6WE01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34146.1"
FT                   /translation="MNADYRRPFCDPDSQRPWNRPAHASTDPVRAWAEPLLRRAYAAAR
FT                   QQPAGCSHGPIPCVGSREWAALPDTDPRKPAAVVMAALARVEENTPHAIATRVAADWAD
FT                   AQMGRRERAREVAHAPDELGHIIGHLPFCLSERRKLTSELPCAHRGCPRVVRFTHPLPN
FT                   ALAARLPDTSWVRCDAHGGTKRLGVAA"
FT   gene            complement(190299..190574)
FT                   /locus_tag="Amir_0176"
FT   CDS_pept        complement(190299..190574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34147"
FT                   /db_xref="GOA:C6WF15"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF15"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34147.1"
FT                   /translation="MDPLTTIITTPALLITAITVGYLLTCAIWPFKRCRKCRGAGRHRS
FT                   PVMRAYRTCGHCRGDGYRLRIGRHVWNALTRNGRARRANRKNRKDL"
FT   gene            complement(190727..192922)
FT                   /locus_tag="Amir_0177"
FT   CDS_pept        complement(190727..192922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0177"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG:
FT                   bac:BamMC406_0006 cell divisionFtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34148"
FT                   /db_xref="GOA:C6WF16"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF16"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ACU34148.1"
FT                   /translation="MSLPTARSTPDPDENNVVHLADARARAAATEPTAVVERAPEVLDA
FT                   EVVEDDAPTELVQVDQPDSSDDSTWVSRLRETERLPIIPGYLRTLSEVRQTAAWVGRHY
FT                   AHATGYHAARTPLYLLKLAARSPQGALLLMAATGRWVADAEGRPLRREMAVRGEAEKYL
FT                   RLVQERNARVRFRTVLLAAGSALGVVLLVLLPGVAPEWVWWVCVTAALAVLGKLGTPQD
FT                   RPVAGRAVVGPQAQKLTSDVVVRALSSLGIGGINQAVGKNAHAIGFTAPITRDGPGWRA
FT                   DVELPPGVTATEVVEKRDKLASGLGRPLGCVWPENNASGHPGQLVLWVGDRDMSKAKQP
FT                   AWSLRRGGAVDLFKPQPFGTDVRGRWVEVTLMFVAGIIGAIPRMGKTFTLRELLLIAAL
FT                   DPRSELHSYDLKGTGDLSPLAPVCHRYRAGDDPEDLEYAVADLRALRQELRRRTKVIRE
FT                   LPKDLCPENKVTTELASKRSLRLHPIVIGVDECQVWFEHPEFGAEVEEICTDLVKRGPA
FT                   TGIVLLLATQRPDSKSIPTQISDNAVLRFCLKVTGQMANDMVLGTSSYRNGERATQFSF
FT                   SDKGIGLLKGVTDETKTVKGVYVDGPGAETIAGRARALRTAAGLLTGYAAGLDAEVVDG
FT                   DVTSTLLPDVLAAMGSADKMWSESIVERLAELRPGAYGQWADQDGKGRAVQLAAALKPH
FT                   GVSTGQVWGTDADGKGANRRGLTRADVAAAVTDSASK"
FT   gene            complement(192919..193884)
FT                   /locus_tag="Amir_0178"
FT   CDS_pept        complement(192919..193884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0178"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmv:BMASAVP1_A1237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34149"
FT                   /db_xref="GOA:C6WF17"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34149.1"
FT                   /translation="MTSAYPPQLDRLAMKVDKLADDHGRLPSRNEVMRTFKVGGPKAKA
FT                   ALDAVKAMRSAGFVAGTSLVTSPTRRLHSVPTPDEGTAEDTTEFGTEHDAAPAAEHAEP
FT                   ASAPADITTSTTVDAVVPTPATRAEPAPSTQVSTLADLGTPHVPTGGAVEQGRVRGAWA
FT                   VLTNRTAEPRQARQVRPWPVLVIALGAFVAIWGGWVELGKLTGFGEITPLPGIADGWTI
FT                   DSAITLPLGVEAYAAFALRVWLSDTTRSGRARRFAKWSALGALVLGAAGQVAYHLMSAA
FT                   GLTSAPWQITTAVSCLPVIVLGLGAALAHLMHNGDQEVTR"
FT   gene            complement(193881..193976)
FT                   /locus_tag="Amir_0179"
FT   CDS_pept        complement(193881..193976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34150"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF18"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34150.1"
FT                   /translation="MSSRTRTHKPPAEVSPGESHLTVPTVAGVLR"
FT   gene            complement(194069..194224)
FT                   /locus_tag="Amir_0180"
FT   CDS_pept        complement(194069..194224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34151"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34151.1"
FT                   /translation="MITTNCRGCGEIADCDINELCDYCANDPEINPDLCDECGGFGCEW
FT                   CTEIYE"
FT   gene            complement(194253..194564)
FT                   /locus_tag="Amir_0181"
FT   CDS_pept        complement(194253..194564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0181"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34152"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF20"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34152.1"
FT                   /translation="MNTPATYPDGLTWAVLNALQEQVSREDVPAAEPTSALVSGEAQMR
FT                   RNLRVLRRALNGVTAHHGVGLMQAVAELRETFPHLLVTTAEDSSQVEPIASPAVRRVA"
FT   gene            194728..195081
FT                   /locus_tag="Amir_0182"
FT   CDS_pept        194728..195081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0182"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34153"
FT                   /db_xref="GOA:C6WF21"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF21"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACU34153.1"
FT                   /translation="MIPDWEGVATAINARLSDRGMKQQELAERSGVSVAALRLLQKAKA
FT                   TNARPRTLAAVSEALGWPREHLAAVRDGRTPSDGAARPEPTVAELAAAMEDLRERVAEL
FT                   ERVVGEGSSERRA"
FT   gene            complement(195181..196023)
FT                   /locus_tag="Amir_0183"
FT   CDS_pept        complement(195181..196023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0183"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG: similar
FT                   to F57G4.9"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34154"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:C6W8S8"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACU34154.1"
FT                   /translation="MAKPLVAELSTKKVLHRQGLHVLFYRAALPLSHQTLTFVSGLVRA
FT                   HRKQLGSVWRKLNPGQQALLVLVYLRKGETFADLAAGFAVSTSTCWRYVNETVELLAQR
FT                   SPKLREALRKAKRQGMAHVVIDGTLIPIDRIAADRPFYSGKHKIHGVNLQVIASPDGTI
FT                   LWVSGDLPGSTHDTAAARIWNILAALRHAGLIALGDKGYHAYDPTDRHVITPYKGRNKP
FT                   ESQKDANRAHARLRGPGERANAQLKTWRILRKLRCCPRRAGRLAKAIHVLQNYEATTG"
FT   gene            196208..196987
FT                   /locus_tag="Amir_0184"
FT   CDS_pept        196208..196987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0184"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: smt:Smal_1152
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34155"
FT                   /db_xref="GOA:C6WF23"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF23"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACU34155.1"
FT                   /translation="MELNGAPVTLEEVKALALTNYGHFTSMLAEDGKVRGLSLHLQRLA
FT                   RDCRLLFDVELDTDMVRHCVRSALPDSGDRTVVRVTSYDPGIDLGTIGSDATPHILVTK
FT                   RSASDKVPSPMRLQAASYQRELPTVKHIGLFGALQRRRTAQREGFDDVLFLNPDGYISE
FT                   VATSNIGFVRDGQIVWPRAAYLAGITMTLLHQELDEPVSTEPLSLADLGQMEAAFATNA
FT                   STGVREILSVDDVAWESGHPMLGELRKMYEDIPAETV"
FT   gene            197023..197958
FT                   /locus_tag="Amir_0185"
FT   CDS_pept        197023..197958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0185"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: protein of unknown function DUF323; SMART:
FT                   helix-turn-helix domain protein; KEGG: scl:sce5487 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34156"
FT                   /db_xref="GOA:C6WF24"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF24"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACU34156.1"
FT                   /translation="MATVQSWSGVEVRALREAKRMSIREFAAHLGVSERMISKWEAGRE
FT                   SIRPRPVNQAALDTCLTRSDPDTKARFSLLTGDSLVPGSGENVQVEPIGSSQVHHPADG
FT                   SLMVKVDGSVFLSGPSNTPVWIPDFYIDVYPVSNADYARFIVATGHAPPHHWPDGRHPA
FT                   ELVDHPVVFVTWEDAAAYAAWAGKALPTSQQWEKAARGTRGTVYPWGDQPTPAKCNVRE
FT                   NGVGQTTRRDCYQSGASPYGVYDLCGNVWEWCATESKPGRRELRGGAWTSPFNRATPSS
FT                   FNDAAVSMCDDDTGFRCVAPVEAFGGREAK"
FT   gene            complement(198068..198250)
FT                   /locus_tag="Amir_0186"
FT   CDS_pept        complement(198068..198250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34157"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34157.1"
FT                   /translation="MDDRRRTNENTAKPDPNRTDESQKRGGYLAPAIPFELPKAPPGPG
FT                   QGGAPTTDKGGQTDK"
FT   gene            complement(198251..198898)
FT                   /locus_tag="Amir_0187"
FT   CDS_pept        complement(198251..198898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_0912 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34158"
FT                   /db_xref="GOA:C6WF26"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF26"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34158.1"
FT                   /translation="MIATFQGLLVALLALLPGASYTFAYERVAGGYGISFADRLVRFLA
FT                   SSALFHALFSGPEYLLYRDLFKNNRLQGGGVDWWLVEAVALAYVLVPVAVGALLGWGHK
FT                   HHKKWAVLLVGNAPEPRAWDYFWRHTDRAVVRLKLKSGMWLAGLYGMAGNGRRSYASGH
FT                   PEEGDLYLAVALEINNQSGELTLTDEQVTPLPGARGLLVRWPEIEYIDIQEY"
FT   sig_peptide     complement(198824..198898)
FT                   /locus_tag="Amir_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.971 at
FT                   residue 25"
FT   gene            complement(198895..199368)
FT                   /locus_tag="Amir_0188"
FT   CDS_pept        complement(198895..199368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0188"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_C1257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34159"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF27"
FT                   /inference="similar to AA sequence:KEGG:Bxe_C1257"
FT                   /protein_id="ACU34159.1"
FT                   /translation="MIIGVSGHQDLPASAQAHAEKRIRALLAEQAAPVTGVGSLAEGAD
FT                   QLFAQLVLAAGGSLHVVIPSRGYETTFAVEARCLYRELLARADTVTELDFPEPGEQAYY
FT                   AAGHHVAECCDLLVAVWDGQPARGLGGTADAVAHARELGRDVMIVWPEGVRRT"
FT   gene            complement(199368..200309)
FT                   /locus_tag="Amir_0189"
FT   CDS_pept        complement(199368..200309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0189"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: bcr:BCAH187_E0055 peptidase C14 caspase catalytic
FT                   subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34160"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF28"
FT                   /inference="protein motif:PFAM:PF00656"
FT                   /protein_id="ACU34160.1"
FT                   /translation="MKRALLVGIDRYKNFQPLAGCVNDANAVKPLLARNEDNSLNFHCK
FT                   LLLDAVERDQLLEEVDALLGGGADFALLYFAGHGAGVGDDLTLVTTNGTPQSPGVRFAD
FT                   VLERIGRSPVREVVVILDCCFSGNAGNVPVLGAGSAYLREGLSILTASRGDQTSAEARG
FT                   RGVFSTYLEGALDGGASDVMGHVTVAGLYAYLSELFGAWDQRPTFKANVDRLQDLRACK
FT                   SAVPLDTLRSLADWFPTAEAEFPLDPSYEPDAEPENLEHEDVFKQLQVCRANKLVEPID
FT                   TDHMYYAAMNSTGCRLTPLGKRYWQLAERENI"
FT   gene            complement(200314..200691)
FT                   /locus_tag="Amir_0190"
FT   CDS_pept        complement(200314..200691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0190"
FT                   /product="Domain of unknown function DUF1863"
FT                   /note="PFAM: Domain of unknown function DUF1863; KEGG:
FT                   sbm:Shew185_4383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34161"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="InterPro:IPR036490"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF29"
FT                   /inference="protein motif:PFAM:PF08937"
FT                   /protein_id="ACU34161.1"
FT                   /translation="MADKKTVFIAFAMEDERDRDLFVGQRLNSRTPYEYTDMSVKEPYE
FT                   TQWKERVLARVRRSHGVIALISPSTVQAEGQLWEIECAVEEGKPLLGIFIKEQRIKPAV
FT                   MGSAPCVAWTWKAVEDFIDGL"
FT   gene            complement(201557..202771)
FT                   /locus_tag="Amir_0191"
FT   CDS_pept        complement(201557..202771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0191"
FT                   /product="protein-L-isoaspartate(D-aspartate)O-methyltrans
FT                   ferase"
FT                   /note="PFAM: protein-L-isoaspartate(D-aspartate) O-
FT                   methyltransferase; Methyltransferase type 11; KEGG:
FT                   bmj:BMULJ_02352 protein-L-isoaspartate (D- aspartate)
FT                   O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34162"
FT                   /db_xref="GOA:C6WF30"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR026448"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF30"
FT                   /inference="protein motif:PFAM:PF01135"
FT                   /protein_id="ACU34162.1"
FT                   /translation="MTTVPEDEWRERAAALADMLGELGKLTDPAWREAVRAVPRHVLVP
FT                   RFHTQDTNGTWVESSTSTKEGRAAWLDAVYSNKPLVTALRQDAEVGRVVSSSSQPGLMT
FT                   RMLEALDIRDGHRVLEIGTGTGYNAALLSHRLGGENVFSVDVEPDLVDLARSRLAELGH
FT                   APTLVAANGALGLAEHAPFDRIIATCAVPAIPWAWIEQLRVGGTVLTDLKITQNAGNLV
FT                   KVTRTSEHRAEGRFDPTYAAFMGLRHQPGGPAQPVTRAARDSADVHESTSPVDPQTPWK
FT                   NMVVWFLAALDLHADVTIGYTGPSTTSPPTAVTLSTSDGSWAQIALAGAHGLHEVTQGG
FT                   PQRLWQAVENAHDLWNHLSRPDWGQFGLTITPNSHTLWHDRPDSEQHWTHLTEMIHGKR
FT                   WAKQL"
FT   gene            complement(202768..203733)
FT                   /locus_tag="Amir_0192"
FT   CDS_pept        complement(202768..203733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: scl:sce7176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34163"
FT                   /db_xref="InterPro:IPR026449"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF31"
FT                   /inference="similar to AA sequence:KEGG:sce7176"
FT                   /protein_id="ACU34163.1"
FT                   /translation="MTVLILAQEADAPTDAVVAELTRRGVEVFRADTSWFPRQLVLDAE
FT                   LVDGRWTGTLSTDHRTVDLHDIRSVWYRDPSAFVFPPDLTEVERAYAHREARLGFGGVL
FT                   AALPDVLWVNHPNRAADAMYKPLQLTTAAACGLYVVPTLVTNSPTAVRRFAAALPGGVV
FT                   HKSFGPNTVTEGGAVKVAYTRRFQPADLVDLRGVRSTALQAQAWVDKAVEARVVVLGER
FT                   MFTIVITANSTAAHEDWRADFDALTYELVDTPPEVEAGVRAYMRTLGLAYAALDFGIER
FT                   DTGRFVFYESNSAGQYGWLESQTGAPITAALADLLTGVPS"
FT   gene            complement(203733..204038)
FT                   /locus_tag="Amir_0193"
FT   CDS_pept        complement(203733..204038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34164"
FT                   /db_xref="InterPro:IPR025843"
FT                   /db_xref="InterPro:IPR026496"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34164.1"
FT                   /translation="MADLPGTLVDTNPLSSSQLRNTIRAHAVSTAPGPDETRPFGLRFA
FT                   VTVPTPVRRTVSYCPTRQLAVDNERRPLIETMGKEWATKGSTDGDEGPEENWGWEE"
FT   gene            204230..205435
FT                   /locus_tag="Amir_0194"
FT   CDS_pept        204230..205435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0194"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein;
FT                   Tetratricopeptide TPR_4; SMART: helix-turn-helix domain
FT                   protein; KEGG: eca:ECA3401 putative phage regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34165"
FT                   /db_xref="GOA:C6WF33"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF33"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34165.1"
FT                   /translation="MAASPPATGENITVLRKAAGLTQRQLATRANISLSLLSKVEVGDR
FT                   AASNALVAAVARALAVPIERVHGQPYQAEHRESGVDNAIDRLRAALRGYDLAPDESVPL
FT                   RPVERLRADVEGVSRRRRSGRYSRLAFTLPALLEELTLARHSVTGAREQEEVFELLVMA
FT                   FYAAHGLAYRLGYADLAESIEHKLGWAADRTSDPLAVGLAQWTRVNAFQAAGDYGRGLQ
FT                   LLDNARHQLDEHVDLTGSAAVTVYGSLHLRASTLASRAGDADTARAHLGAAAELGVRVR
FT                   RDRVHYQLTFGPTNTAIHDVAASVELGDPERAVRIGADFKRGSGLPATRIGHLHIDLAR
FT                   AHLMLGDRPGTLRALEQARRAAPEQTRFHPMVRETTRVLVSLHRRSNPDLSKFATWIGL
FT                   AD"
FT   gene            206393..208858
FT                   /locus_tag="Amir_0195"
FT   CDS_pept        206393..208858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0195"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   scl:sce0688 endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34166"
FT                   /db_xref="GOA:C6WF34"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF34"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACU34166.1"
FT                   /translation="MRTTPLRAGLAAAAATVVSIASATPVTAAPSQDALIAEVYGGGGN
FT                   SGAVLTQDFVELANRASAPVAVDGWSVQYLPASASAASQWQVTPLTGSIAPNARYLVAQ
FT                   AKGAGGTTALPTPDATGATAMAAGAGTVALVSGTQPLTCKTAADCAAAPGVKDLVGYGT
FT                   TAVVREGGPTATLTSTTSAARPQLVDSDDNAADFTAGAPTPVNSKGEGVGQNPDPDPDP
FT                   DPDPQPGDKRIRDIQGATRISPLLGQKVTGVPGLVTATRATGDRGYWIQDAQPDGDPRT
FT                   SEGVFVYTGDAAPTVQPGDSVLVGGTIAEYRPGGVEAGNSNQTLTEITAPTTSVLSSGN
FT                   PLPAPERLAPPAGYLPTASGGSIEQLPLEPDKYALDYFESREGMLVEVVDARVTGPTNN
FT                   FGETWITTRPQDNPTARGGTVYLGYDQPNPGRLKAKAGSATPPVSDVGDVWSGSTVGNL
FT                   EYTNFGGYTLATKSVGAHAPGGTKPEVSDATGRHELSVATYNVENLAATNDQAKFDRLA
FT                   AAVVANLRSPDVVVLEEIQDDNGTANDGTVTASATYQRFTDAIVAKGGPRYQWRQIDPV
FT                   NNADGGAPGGNIRVGFLFNPGRVSFVDRAGGDATTPVSVVKSRGRAALSVSPGRIEPAN
FT                   EAWDASRKPLVGEFSFLGRTVFVLANHFNSKGGDQAMHGRYQEPVRSSEEQRLKQATLL
FT                   KGFVDEVKSVDRGANVVLAGDLNDYQFSPVVAKLTEGGQVVDLMSTLPANERYSYVYEG
FT                   NSQTLDHILLSSNVKRYRYDVVRINAEFADQASDHDPQVVKIRPSTGNQLLDHLVFGLE
FT                   DLADLFHRP"
FT   sig_peptide     206393..206479
FT                   /locus_tag="Amir_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.958 at
FT                   residue 29"
FT   gene            complement(208921..209328)
FT                   /locus_tag="Amir_0196"
FT   CDS_pept        complement(208921..209328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0196"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: scl:sce5646
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34167"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF35"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACU34167.1"
FT                   /translation="MAITLVNPDGLPQVEVYRQVAIGAGAKLVFVAGQVARDGDGNRIG
FT                   EGDLAAQAEQAYLNVGTALAAAGATLGDLAKLTIYVVDWRLDLMPVLMEGVNRAFARLG
FT                   GSSLAPVTLIGVAALAEPDLLIEIEATAVVE"
FT   gene            209402..210040
FT                   /locus_tag="Amir_0197"
FT   CDS_pept        209402..210040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0197"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: mlo:mlr3102 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34168"
FT                   /db_xref="GOA:C6WF36"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34168.1"
FT                   /translation="MLCILVPMARQKDPAVRTLLVERAAHMLRVREPITLRSLVAGTGV
FT                   STMAVYTHFGNMDGMWMAVRQEGFTRLARRFAEVPVTTDPVADLTALVAAYLGNALEHP
FT                   DLYRVMFDANFDLEDLKAADATLEHMVQAALRAQDAGRFHAGTTPLDLATQSWAVGHGV
FT                   VSLVANGPLPRETLAHCPVLLEALFTRTGDEPGRCADSVARGWDPALAG"
FT   gene            complement(210110..210194)
FT                   /locus_tag="Amir_R0009"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(210110..210194)
FT                   /locus_tag="Amir_R0009"
FT                   /product="tRNA-Ser"
FT   gene            complement(210404..212551)
FT                   /locus_tag="Amir_0198"
FT   CDS_pept        complement(210404..212551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0198"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: pca:Pcar_1336 putative methyl-accepting
FT                   chemotaxis protein (MCP)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34169"
FT                   /db_xref="GOA:C6WF37"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF37"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACU34169.1"
FT                   /translation="MKRTRVTPLNLGLGHRLLALSIGTVIATAGVLVVVGAWQSDKFST
FT                   AAAGNVAELIQTDTDHVTSGVSTLTRTAGEAIQESVNSSMNVANAELAQRGGLRLDDSS
FT                   TTSWKAVNQLTQEATDVTLPRAEVSGAWLGQNRDQSTPTPLVDDIRSMVSATVTVFQKM
FT                   DDKGDLLRVATNVPNKAGERAIGTYIPATAQDGTPNAVAKAINSGTSYRGVAKVVDTWY
FT                   IAAYDPIKNANGDVIGALYVGIPQDKAIAQLSQAISDTTVGANGRVTVYSTAAADKGRI
FT                   IASTGGKDVGTTNADAADANGVKYVDEIVSKATSLGEGQVFNAVYQLPGLDGEPAAASP
FT                   TNVVYYGPYQWAIAVSSYGPDSAGAIEEVEQGRSAMLWAFVVAAVLIAAAAALVSLIWA
FT                   RRMTARLRGLTGALTALSERDLTVQAKVGGNDEIGEMGTALNTAVGELRELMSGISEAS
FT                   RRVEETSRNVSSTGAKLSDSASSAAEQTSNAAEAAAEVTRNVQTVAHSSTEMGSAIAEI
FT                   SRNTQAAAATAHDSVERTRQASDVIAELSAASAEITDVVRTISSIAEQTNLLALNATIE
FT                   AARAGDAGKGFAVVAGEVKDLAQETARATEDVSRRVEAINSGTTKAIESIAAITTAIDS
FT                   VNESQSAIAAAVEEQSATTDEVNRSISLASDHSSQIAVRLNQVSSTVESTRDAVRMSAD
FT                   AAEELSGTARQLTDLVGRFTL"
FT   sig_peptide     complement(212441..212551)
FT                   /locus_tag="Amir_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.958) with cleavage site probability 0.657 at
FT                   residue 37"
FT   gene            complement(212696..214294)
FT                   /locus_tag="Amir_0199"
FT   CDS_pept        complement(212696..214294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0199"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: aba:Acid345_1672 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34170"
FT                   /db_xref="GOA:C6WF38"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF38"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACU34170.1"
FT                   /translation="MAVKGRALAGAPVGVKILSGVAVAVLGMVVITGVAVGQMTSLRDG
FT                   QEQLNSEAVVPLAKFDEVRRAYLQTRVDALADEWVATTNGAEHEAFTKDIKAMDAALAD
FT                   LAKSAVTDVQRSSTAELQSAWSEYIKVVASDQFLQLARTGDRAGYVAARDSQVKPQAVR
FT                   IQNALDALVQDMTTSTAAQLERASDNYATGIWVLVGTLLAAIAVAVGLAVAATRAVTGP
FT                   LRRLSEVCDALAEGDLTKRTGLTGTDEVSRVGAALDGATAKTAEAISVLSDSARSVVAA
FT                   TGKLTDTAGRISGSSADTASRADAATEAAEHVSDGVQAIATGAEEMSASIQEIARNASH
FT                   AAQLGSHARSLTEQTGATMAQLGGSSAEIGNVIKVITSIAEQTNLLALNATIEAARAGD
FT                   AGKGFAVVANEVKDLAQETARATEEISNRVEAIQADSSNAVTAIATIADVINELDGVQA
FT                   TIAAAVEEQAATTAEMSRSVADASGRTTEITGNITGVAGSAAATSDGARTTTETIGELV
FT                   AVAGDLESVVDRFRY"
FT   gene            214464..215432
FT                   /locus_tag="Amir_0200"
FT   CDS_pept        214464..215432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0200"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   atc:AGR_pAT_447 DtxR/iron regulated lipoprotein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34171"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF39"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACU34171.1"
FT                   /translation="MRLRPLVVLLALFATACGGSTDSGADTPSSASGDSAGVVTVDTRF
FT                   GPVQVEGTPKRVVALGWSDAEAALALGVQPVGVSDWMAFGGKGVGPWAESLYTETPQIL
FT                   GTMELDYEAVAALQPDLILNTRSDNDQAKHDKLSQIAPTIGAPKDVVTYGTTWQQQIEM
FT                   VGKALGKDAEAKKITEDLNAKFAANKKFDGKSAVVGSYFDGKFGAYVSGDARVDFLKAI
FT                   GFTPKAEVESLATGTFFVDVSAEQLNLFDADFTVIFPIGADTAPIKQHPVLSGIPSAKD
FT                   GRMLVMEDKTLVSAFSSGSTLGVAHALDKAVPQFQEILKVG"
FT   sig_peptide     214464..214541
FT                   /locus_tag="Amir_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.528 at
FT                   residue 26"
FT   gene            215465..215564
FT                   /gene="ffs"
FT                   /locus_tag="Amir_R0010"
FT   ncRNA           215465..215564
FT                   /gene="ffs"
FT                   /locus_tag="Amir_R0010"
FT                   /product="SRP RNA; RNA component of signal recognitionparti
FT                   cle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            215613..217754
FT                   /locus_tag="Amir_0201"
FT   CDS_pept        215613..217754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0201"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: gbm:Gbem_0212 DNA polymerase III, subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; SMART:
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34172"
FT                   /db_xref="GOA:C6WF40"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF40"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ACU34172.1"
FT                   /translation="MVRPVALALYRKYRPATFAEVIGQEHVTDPLRIALGAGRVNHAYL
FT                   FSGPRGCGKTSSARILARSLNCAKGPTPDPCGECNSCVGLAPNGPGSVDVVELDAASHG
FT                   GVDDTRELREKAFYAPAEAKYRVFIIDEAHMVTTQGFNALLKIVEEPPEHLIFIFATTE
FT                   PDKVLPTIRSRTHHYPFRLIPPVSMRALLERNCAAEGVAVEPSVFPLVIRAGGGSARDT
FT                   QSVMDQLLSGAGPEGVRYDRAIALLGVTDVALIDDVVEGLAAGDGSAVFGTVDRLVDAG
FT                   HDPRRFATDLLDRLRDLVLLCAVPDAGERGLVSAPEDVLAKMIPQAQNIGPATLTRYAE
FT                   VLHQGLTDMRGATAPRLLLELLCARMLLPSVSDAESAVLQRVERLEKHGVAAGGGNGGG
FT                   GAPAVESKFQRPSQRQAEPEPAPAQAAPQAVAPPVAATQIAAPPVVAPPAAAQPVAAPA
FT                   EPTPQPATPQQPAAQARPTAQAAPQQARFQRPSQSPPQPASAAAEPAAPAAAPASGAVD
FT                   AVEIRRRWPELLGVVKGASRSTEAMLTNATVAEVDGTSVTLTHTSGPLARRLAEQRNAE
FT                   VIAKAFGQVLGGSWQVRCVQGDAATAQRPQQQSRQARPAPARPSQAESAPAPGHGRQML
FT                   EKAMQAQANRSTGRAGDDIPLPPEPDEPDDPLPPEPVDEEEMFAEAARPGEPGEERLDP
FT                   EAVVLKLLADELGARPLKS"
FT   gene            217802..218149
FT                   /locus_tag="Amir_0202"
FT   CDS_pept        217802..218149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   gme:Gmet_3421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34173"
FT                   /db_xref="GOA:C6WF41"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF41"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACU34173.1"
FT                   /translation="MQPGQPNMQQILQQAQMMQQQLATAQQELTEAEVTGTAGGGLVRA
FT                   VVTGGGELKSLAIDPRAVDPEDVETLSDLVVAAVRDANRAAQELAAQKMGPLASGMGGL
FT                   DGLGGLGKLFG"
FT   gene            218149..218742
FT                   /locus_tag="Amir_0203"
FT   CDS_pept        218149..218742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0203"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: mxa:MXAN_1930 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34174"
FT                   /db_xref="GOA:C6WF42"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF42"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACU34174.1"
FT                   /translation="MYEGPVQDLIDELGRLPGVGPKSAQRIAFHLLAAEPADIGRLQDA
FT                   LQKVKEGVVFCEVCGNVSAETTCRICRDPRRDLTLICVVEEPKDVLAVERTREFKGRYH
FT                   VLGGALDPLSGIGPDQLRIRQLLTRIGTDVSEIIIATDPNTEGEATATYLVRMLRDFPG
FT                   LSVTRLASGLPMGGDLEFADELTLGRALSGRRSL"
FT   gene            218756..219226
FT                   /locus_tag="Amir_0204"
FT   CDS_pept        218756..219226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0204"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:BCZK2509 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34175"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF43"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34175.1"
FT                   /translation="MLLIAVDGPSGSGKTTYARSLGGVVVPTDHFATWDDPVAWWPRLV
FT                   EGVLEPLWRDEPAHYQRVEWVGGEPKPGEWITFEPPEVLVLEGVSSARRAIADRLDLAV
FT                   WVEVPSESERLERAVARDGEDCRIHLRRWQDFERGWFAVDGTKARADRVILR"
FT   gene            219650..221154
FT                   /locus_tag="Amir_R0011"
FT   rRNA            219650..221154
FT                   /locus_tag="Amir_R0011"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            221505..224583
FT                   /locus_tag="Amir_R0012"
FT   rRNA            221505..224583
FT                   /locus_tag="Amir_R0012"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            224708..224824
FT                   /locus_tag="Amir_R0013"
FT   rRNA            224708..224824
FT                   /locus_tag="Amir_R0013"
FT                   /product="5S ribosomal RNA"
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),scor
FT                   e 53.56"
FT   gene            224710..224825
FT                   /locus_tag="Amir_R0014"
FT   rRNA            224710..224825
FT                   /locus_tag="Amir_R0014"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(225081..228347)
FT                   /locus_tag="Amir_0205"
FT   CDS_pept        complement(225081..228347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0205"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain; TPR repeat-
FT                   containing protein; Tetratricopeptide TPR_4; NB-ARC domain
FT                   protein; transcriptional regulator domain protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: scl:sce5225 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34176"
FT                   /db_xref="GOA:C6WF44"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF44"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ACU34176.1"
FT                   /translation="MGEQLELGVLGPLRVVVGGRHVAVRAGRQRCLLASLLTRPGSPVS
FT                   VDELAEHVWGDRPPARARQTLHTYVMRLRRLLGPEVPIRTVPDGYLVDVPAASVDVARF
FT                   DGLLALGDREQAAGRLAEASSALAAALELWRGPALADVPSAVLHRDEAPRLTECGLHAR
FT                   ERRAEVDLALGRHAELVPELTALTAEHPLRERLWAQLVVALHRSGRRAEALAAYDRVSA
FT                   LLAEELGIDPGGELRRVHRAVLADEGGPAPGPEGAESGPEPVAPSQLPAGAGDFVGRSN
FT                   SVHLVETLLRRSHGVPVVTLSGQPGVGKTALAVHAAHRLRGDFPDGQLYVNLRGHAQGP
FT                   PLSAVDVLPRFLRAQGVAPESVPLDPDEQEALYRSRLTGRRVLVVLDDAASAEQIRPLL
FT                   PGSPGCAVLVTSRDALRGLAVSHAATNVRLDVLDDGEARALLSGVLGADVVGCQRAATG
FT                   ELVALCAHLPLALRIAAANVLSRPGTTVAEHVEELRAGNRLAALSVEGDERAAVQAAFD
FT                   LSYAALKPELAQLFRLLAVAPGDLTPDLAAALGGLPVPEARRRLHRLATVNLVDRPAPG
FT                   RYQFHDLLRDYAAQRLVAEDGEAGRDRVFRRLLDWSIRSVDAATEALKSTLVRHPRASD
FT                   VPGVEPKRFDSPAEALAWLDAERANLVALVSHAAARPPHEDGWQLADALRRYFYLAALP
FT                   VEWRAAAGAGLASARAARDPVGEAAMLSSLGVLYWSIGRHPVAVDHFLSALGVQERGGA
FT                   WPRARAQVLANLGAVYIDVGELERATEHLERALAITGEIGALQQQGITQLNLGGVYLQL
FT                   AELDRAAACFEGALDVGTRLGVWMTQADALHALAEVELLRGAPARAAGLFERSGELYGL
FT                   AGARSFAHIPHEGLAQAHLARGRYAEAIAEAGRALEFAQERENLKGRCDAKNVLGQALV
FT                   GAGRLVEGAGRHTEALGIAEEISYPWGIVAARRGLATAHHAAGRLVEAEEAARGALEGA
FT                   AAYRLRLPEGDVLVLLGRIELDLGEPDRALDTATRAAAAGAASGRRLLAAQADHLLGDL
FT                   RAAAGDSRAARALWDAAAAGYESAGAPEATSLRTLLRRVS"
FT   gene            228577..230262
FT                   /locus_tag="Amir_0206"
FT   CDS_pept        228577..230262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0206"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: hap:HAPS_0936 periplasmic dipeptide transport protein
FT                   DppA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34177"
FT                   /db_xref="GOA:C6WF45"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF45"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACU34177.1"
FT                   /translation="MVHSRSAQRRWVAAIGLTSAAALVLTSCVQSERSQDSGTGGAAGG
FT                   TFTFGAAGAPKLFDPMFATDGETFRVARQMFDGLTTFKPGTAEPAPSLAKEWSSTPDGL
FT                   TWTFKLETGVKFHDGSDFNAEAVCFNFDRWYNLKGDAQSDAVSQYYVDNFGGFSDKPET
FT                   SLYKSCAAEGADTAVVTLTKTTSKFPDILGLPSFSMQSPKALKEFNADDVKAQGDSFVF
FT                   PAYANEHPTGTGPFKFGKYDKANNVVELVRNDDYWGEKTKLDKLVFRIIPDETARKQAL
FT                   QSGDIDGFDFPNAADWDSLKSGGFNVEVRPAFNVFYVGINQKRNPKLQDLKVRQALLHA
FT                   INREQLVKSQLPEGAEVATQFIPKTVGGYADDVQKYEYSVDKAKSLLAEAGASDLTLKF
FT                   YWPSEVSRPYMPSPKDLYGAIAADLQAAGIKVEAVTKPWNGGYLTDVDQGAQADLFLLG
FT                   WTGDTGSADNWVGTFFGNPANRFNTGASAWGADLSAQLKTADAEPDRTKRYDLYKEINR
FT                   KIMAEYVPALPISHSPPALVVKNTVKGITPSPLTDEKFVDVTVN"
FT   sig_peptide     228577..228672
FT                   /locus_tag="Amir_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.966) with cleavage site probability 0.615 at
FT                   residue 32"
FT   gene            230308..231318
FT                   /locus_tag="Amir_0207"
FT   CDS_pept        230308..231318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0207"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pde:Pden_1670
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34178"
FT                   /db_xref="GOA:C6WF46"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF46"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34178.1"
FT                   /translation="MLRYTIRRLIQLVVVVLVLSLLVFSWLRALPGGPASALLGERGTE
FT                   ESRAALSKQLGLDQPIFVQYFKFLGRALTGDFGNSTGVQPGDAVVDIFLQRFPATIELS
FT                   AFAMLIAIALGIPLGYLAARKRGGLFDNLSVGGSLIGVAVPVFFLAYLLKYVFASQLGW
FT                   LPSAGRQSAGLDATRVTGFFVLDGFLTQEWDAALNALTHLVLPACALATIPFAVIFRIT
FT                   RAAVLDVLNEDYVRTAESKGLLGSVIRRRHILRNAMLPVVTTIGLQIGALLAGAVLTEK
FT                   VFAFPGVGEALAIGFERRDYPVLQMFILVAAMIYVLVNLLVDLSYALIDPRIRAR"
FT   sig_peptide     230308..230421
FT                   /locus_tag="Amir_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.932) with cleavage site probability 0.662 at
FT                   residue 38"
FT   gene            231325..232257
FT                   /locus_tag="Amir_0208"
FT   CDS_pept        231325..232257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0208"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH3642 dipeptide ABC
FT                   transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34179"
FT                   /db_xref="GOA:C6WF47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF47"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34179.1"
FT                   /translation="MTPTTKKERIDALAESSASDSGVSLAASAWKRLRRSPVFLLGAAI
FT                   IALFLVVAAIAPWLAPHDPAARDLIDQVIKARNQIPGPQEGYPLGGDLVGRDLLSRLLV
FT                   GAQQTLLVGVFATLIGLAGGMVLGILAGAFGGWVDSLVMRVVDVMLSIPQLLLAFGIGA
FT                   LFARPSLLTVILAVSIVQIPVFARLLRGSMLAQRSSDHVLAATALGVKPGPIVFRHMLP
FT                   NSLGPVIVQSTLVLATSIIDAAALSFLGLGNPDDTIPEWGQMLGSAQTVIDSHPHLAFW
FT                   PAGCIIVIALGFTLVGESLRDALDPKNRR"
FT   gene            232263..233258
FT                   /locus_tag="Amir_0209"
FT   CDS_pept        232263..233258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0209"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:bll2870 ABC transporter ATP-binding
FT                   protein; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34180"
FT                   /db_xref="GOA:C6WF48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF48"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACU34180.1"
FT                   /translation="MALLEVRDLTVVFERKGEQPFTAVDGVSFDVEPGQTVGLVGESGC
FT                   GKSVTSLAIMGLLPKRGARITGSVGYEGTDLLKLSDRQMRDRRGRDLGMVFQDPLSSLN
FT                   PVIPIGLQVTEVLERHRGMARKQAMVEAADLLDKVGIPDPTRRLSEYPHQLSGGMRQRA
FT                   LIAIALACRPRLLIADEPTTALDVTIQAQILALLKELVQDTGTALVMITHDLGVVAGLC
FT                   DEVNVLYGGRVVEKARRHELFGQPRHPYTHGLLASIPRLDAPRGERLVPIKGSVADNIP
FT                   WEGGCAFAPRCPNALDVCVTTTPEQEDLGGGRLLRCHNPVRPEVAEEVGA"
FT   gene            233255..234397
FT                   /locus_tag="Amir_0210"
FT   CDS_pept        233255..234397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0210"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:blr1357 peptide ABC transporter ATP-
FT                   binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34181"
FT                   /db_xref="GOA:C6WF49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF49"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACU34181.1"
FT                   /translation="MTAAEPVQAERAPEGDALISIEGIQVHFPIKRGVFLDRTVGHVYA
FT                   VDGVDLSIRKGETYGLVGESGCGKSTLGRAVLRLTEPTGGRVVFDGTDLSTLKGEALRT
FT                   MRQRMQMVFQDPMSSLDPRQSVESILVEGLRAHGLDKGKEATGKRLRELLAAVGLPSTS
FT                   LRKYPHEFSGGQRQRIGIARALAVEPDLIIADEPVSALDVSVQAQVVNLLEELQEKLGL
FT                   TYLVIAHDLAVVRHIADRVGVMYLGGIVEEASSDGLYAEPLHPYTRALLSAIPVPDPVV
FT                   EDRRERILLKGDLPSPANPPTGCRFHTRCPWRQATRCDTERPALREVLPGHRVACHWAE
FT                   DIRSGAIKPHEVEAVLVEEDGISPDVPLVGPASVTEVLNP"
FT   gene            234560..236698
FT                   /locus_tag="Amir_0211"
FT   CDS_pept        234560..236698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0211"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: xom:XOO_3262 type I
FT                   restriction system adenine methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34182"
FT                   /db_xref="GOA:C6WF50"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF50"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ACU34182.1"
FT                   /translation="MGLQPKLLTAGGIAELLSVRASAISNWRKRHRDFPRPREAAGQEL
FT                   FDAAEVGRWLAGRRVPRTALRRDEAEGATYQHRFLRGVGRPAPVVERGPVAPGRAPALL
FT                   AHAEPLRVASGLGVDFPLGLLRLRVADPAGWGALVAAARGGAGARVRGLLVDARLPGAD
FT                   VEAGGALPAAVLAAVLAAVLAADAAEEPARVADALLSRPGRDAGHRTPPLARCLVELVD
FT                   PRPGETVHDPCCGDGRLLVAVAGHLAPESPGAGALSGRAADEVSSRVCAALLGIRGMSA
FT                   DLRAHGDGFRCELFDVVVAHPPVTLAPPGGEGPPLGEPSARGAGLAWVQHALRELAPGG
FT                   RAALLVPGSTASGQAGRDVAVRRALVEAGVVECVVALPGRSSRAVVWVLRAPGAGPVDP
FT                   EVLFVDAAGGGEPGGRVVDDAVVDRVVGEHRRRAERGGRRFAGQEGFSRSAARAEIARN
FT                   DFRLAPAGYVARPAAASAPLEHLLAEVDALRAELSGLRGAVAAREAEGERAFAAALAAT
FT                   GGVPRAEVPLGRIAEVAAGPGTMARGDGVPVVLPRNIGGGRVDRGAHDLAPARGDRYAL
FT                   RAGDVVCARTGTLGRGRSGGTGRYGVVGADQDGWLLGPGCLRLRPGTGVVPGYLAHFLN
FT                   SPEGAAGLERLLSGGAVPHVTTRAMGELVVRLPPTAAQTTIAAALDAADARLALHRRVE
FT                   DAERELRELTFAAPTHAR"
FT   gene            237187..237762
FT                   /locus_tag="Amir_0212"
FT   CDS_pept        237187..237762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0212"
FT                   /product="putative membrane-associated protein"
FT                   /note="KEGG: pol:Bpro_3150 DedA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34183"
FT                   /db_xref="GOA:C6WF51"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF51"
FT                   /inference="protein motif:COG:COG0586"
FT                   /protein_id="ACU34183.1"
FT                   /translation="MTPLLVLFAVAAVPLAPTEAVLIACGVLAASGELPLGAVIAVAAA
FT                   GCTVADLVNLAIGRALGGRALARFERRAGSRAVLDWTRARLAGRGEAVLVAVRFVPGGG
FT                   VVAALLVGALRWRALRFLPIAAVGSLLWSAYVGLLGYFGGTLLDDPVLALIASLAVATL
FT                   IGVPAGVAVRAAQRREALRDGGPEPLAV"
FT   sig_peptide     237187..237249
FT                   /locus_tag="Amir_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.838) with cleavage site probability 0.418 at
FT                   residue 21"
FT   gene            complement(237857..239653)
FT                   /locus_tag="Amir_0213"
FT   CDS_pept        complement(237857..239653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0213"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="KEGG: csa:Csal_2535 2-isopropylmalate synthase;
FT                   TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34184"
FT                   /db_xref="GOA:C6WF52"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF52"
FT                   /inference="protein motif:TFAM:TIGR00970"
FT                   /protein_id="ACU34184.1"
FT                   /translation="MSTISPDAYSTGTSRIRPPARPAPEGQPAWNPQRGTSMPVHRYRP
FT                   FHELVETVDLPDRTWPAKRITQAPQWCAVDLRDGNQALIDPMSPARKRKMFDLLVRMGY
FT                   KEIEVGFPAASQTDFDFVREIIEDGAVPDDVTIQVLTQCRPELITRTYESLRGAHKAIV
FT                   HFYNSTSVLQRKVVFRADRDRIKAIATDAARFALEEAKKYPETEFRYEYSPESYTGTEL
FT                   SYALEVCDAVSEIIAPTPELPMVINLPATVEMATPNVYADSIEWMSRHLARRDSIVLSL
FT                   HPHNDRGTGVAAAELGYLAGADRIEGCLFGNGERTGNVCLVTLGMNMFSQGVDPQIDFS
FT                   DIDEVRRTVEYCNQLPVHERHPYGGDLVFTAFSGSHQDAIKKGFEALEADAKDADKHVD
FT                   EYPWEVPYLPIDPKDVGRNYEAVIRVNSQSGKGGVAYVMKSEHHLDLPRRLQVEFSRVI
FT                   QEVTDTQGGEVGPKEIWDAFADEYLQGVAPLRLLKHELSSDGTGSESIKTVLVVDGETQ
FT                   DVTGTGNGPIAAFVDALASVGYDVRVLDYSEHALSSGDDARAASYVECSVGDRVLWGVG
FT                   VDSSTVAASLRALVSAVNRANR"
FT   gene            239881..240186
FT                   /locus_tag="Amir_0214"
FT   CDS_pept        239881..240186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0214"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34185"
FT                   /db_xref="GOA:C6WF53"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34185.1"
FT                   /translation="MSRWRSTTRASSGSYTAARVISGVGVVFAVIEVLFILMVLLGAES
FT                   TNAFFQFISQLANPLALFFPGLFQFSDESVELIVNYGLAAVFWLVVTSLLARLIAR"
FT   sig_peptide     239881..239970
FT                   /locus_tag="Amir_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.671) with cleavage site probability 0.657 at
FT                   residue 30"
FT   gene            complement(240214..240846)
FT                   /locus_tag="Amir_0215"
FT   CDS_pept        complement(240214..240846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0215"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: ank:AnaeK_1659
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34186"
FT                   /db_xref="GOA:C6WF54"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF54"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACU34186.1"
FT                   /translation="MARNGAEQGGSGQGGLELAGVIADRWSPRAFDAGAALGEDEARSL
FT                   FEAARWAASHGNTQPARFLLARRGEPAHERVFAALSRGNRTWAGSASALVVAALATSDA
FT                   KGPLPNAEFGLGLAVQNLVLQAVQLGLVAHQMGGFDPEALREALSIPGDVRPVVVIAVG
FT                   REGDGSDLPEDLRAKDERPRKRKPLAETVFSGKWGEAAFTPETPATS"
FT   gene            complement(240873..242096)
FT                   /locus_tag="Amir_0216"
FT   CDS_pept        complement(240873..242096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0216"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5370 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34187"
FT                   /db_xref="GOA:C6WF55"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF55"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34187.1"
FT                   /translation="MAGTTLVAVPTVDAGPDSPERAPSTRGPLAGLAEHRFAPVIAPGA
FT                   LYLLVRLLGVLVLALMSDHWDKDVAKVLTSWDGQWFLGIAQGGYGGVTPALVDAFGRRS
FT                   AETPLAFFPGYPLLVGWVGALPGVSAVGAAFSVSLVSGVFCAYGLHRLGRSVRGGSERA
FT                   GLVLVVLFAASPMAVVLSMAYSEALFCALAAWSLVGVVERRWVLAGLCAAGAGLVRPTA
FT                   GALVLAVGLAALVAVWQRRDGLRPWAGGVLAPLGMLGYLGFVAVRTGQLDGWFAVQQRG
FT                   WGSKFDGGAATWRFTWEILANPRSVLELVTVWLLLGALALVVVCVRRRLEWPLVVYAVG
FT                   VIVMDLGSNGLMNSKARLLLPAFALLLPIALSLAKRRTGAVVSVLAGVAVFGAWFGAYS
FT                   ITAWQYAI"
FT   gene            242173..243438
FT                   /locus_tag="Amir_0217"
FT   CDS_pept        242173..243438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0217"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: tgr:Tgr7_1290 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34188"
FT                   /db_xref="GOA:C6WF56"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF56"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACU34188.1"
FT                   /translation="MALVVQKYGGSSVESAERIKRVAERIVATRKAGNDVVVAVSAMGD
FT                   STDELLDLAHQVAPVPPGRELDMLLTAGERISMSLLAMAISSLGASARSYTGSQAGVIT
FT                   TEVHGKARIIDVTPSRIQDALAEGHIAIVAGFQGVSQGTKEITTLGRGGTDTTAVALAA
FT                   ALKADVCEIYTDVDGVFTADPRIVPNAKRLESISYEEMLEMAACGAKVLMLRCVEYARR
FT                   YNVPVHVRSSFSNKPGTTVSGSVEDLPVEQAMITGVAHDRSEAKVTVTAVPDHPGVAAR
FT                   IFRVVAEAEIDIDMVVQNVSQAVSGRTDVTFTLPKDDGPRAVAALEKARGEIGFEKVIY
FT                   DDHVGKVSLIGAGMRSHPGVTATFCEALASAGVNIEIISTSEIRISVICRDTQLDDAVR
FT                   ALHDVFELGGDEEAVVYGGSGR"
FT   gene            243435..244502
FT                   /locus_tag="Amir_0218"
FT   CDS_pept        243435..244502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0218"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: bcb:BCB4264_A3899 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase
FT                   dimerization region; Semialdehyde dehydrogenase NAD -
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34189"
FT                   /db_xref="GOA:C6WF57"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF57"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ACU34189.1"
FT                   /translation="MSGGPVLALVGATGAVGTVMISIINNRETVPWGEIRLIASARSAG
FT                   KKIHVRGEDLTVVELTPEAFDGVDVAMFDVPDEVSARWAPIAAARGAVAVDNSGAFRMD
FT                   DEVPLVVPEVNADRIGDRPKGIIANPNCTTLSMMAAIGALHREFGLRELVVASYQAASG
FT                   GGQAAIDRLRAEVEAVSGKQVGERAGDVREALDAAGLPVSDSPFPAPLALNVVPWAGSL
FT                   KDDGWTSEELKVRNESRKILGIPDLKVSATCVRVPVVTTHSLAVHAVFERPVTVGQAHK
FT                   IFEEQPSVVLVDEPEAQRFPTPADVVGGDPTYVGRVRQALDFPNALDFFVCGDNLRKGA
FT                   ALNTYEIAEELAGRL"
FT   gene            244506..245936
FT                   /locus_tag="Amir_0219"
FT   CDS_pept        244506..245936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0219"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG:
FT                   bcb:BCB4264_A2253 gluconate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34190"
FT                   /db_xref="GOA:C6WF58"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF58"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ACU34190.1"
FT                   /translation="MRDEGVVLAVDLGTTATKVVAVDLRARVLRSTERGYPMRTTPSGE
FT                   ATQDPDEVLAAALAAVSEVALACPEGVRALVLTGALHTLLGLDESGRPVTPSLSWADRR
FT                   AVEQVARLRAGDGVALHRATGTPVHTMSPLVKLRWFADHRVEAHRWCGLKDYVFAHLTG
FT                   VLATEHSSGSATGLMDLRALDWHPEALAHARVRADQLPELHAPTDSFPLRAAVDGVAPG
FT                   TPVVLGGGDGPLANLGVGAIVPGVAALSLGTSGALRVVSPEPAVDERGRVFCYAIGDGL
FT                   WTVGGAVSNGGVVASWAAESFGADVVELLDEAARVPVGASGVTALPYLLGERAPWWDAD
FT                   ATSAVVGLRREHGRAELTRALVEGVAQQLALVLDAVRSVAEVRLVRATGGALRHELWAS
FT                   VLCAALDVPLEITEDTGGSAVGAALLAWRSLGGLDSLAGTADLVFPERRYEPDPVAAAH
FT                   YAAARPGVERLYEALREL"
FT   gene            246130..246333
FT                   /locus_tag="Amir_0220"
FT   CDS_pept        246130..246333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0220"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: vsa:VSAL_II0614 cold shock-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34191"
FT                   /db_xref="GOA:C6WF59"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF59"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACU34191.1"
FT                   /translation="MATGKVKWFNAEKGFGFIEQDGGGPDVFVHFTAINASGYRSLEEN
FT                   QAVTFEVTQGPKGPQAENVQPA"
FT   gene            complement(246436..247614)
FT                   /locus_tag="Amir_0221"
FT   CDS_pept        complement(246436..247614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0221"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ppg:PputGB1_3286 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34192"
FT                   /db_xref="GOA:C6WF60"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF60"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34192.1"
FT                   /translation="MSLNAYRSVLRTPQVVPTMLVVLLARIPITGVGMTLTMHVLLALD
FT                   HGYAAAGLVGMAATAGSAIGSPLLGRMLDRRGLRAVVGVSIVVEALFWLTAPLLSYPAL
FT                   LVTAFLSSLAALPVMSLGRQALTALVPESGRRTALALDSMAVELAFMAGPALGVFLGTH
FT                   WTGRPAMWVIGTAVVLSGLLLWVVDPPLRAGGAAPGGQAPRGWLDRRLVGVLISAGGAT
FT                   FLLTGVELATVAQMRAQGLTEWTGAAIVVMCAASLVGGFWYGGFERPVPVWALMAGMGV
FT                   LTLPLVLAGGSPWLLGPALALSSFLCAPTLTATGEAITTMAPEGARGTALGLQGAAFTL
FT                   GSALGQPVAGWAIDGVGPSAGFAVAALGSLAIAGLVVLLGVRGRTPEPVVAG"
FT   gene            247767..249221
FT                   /locus_tag="Amir_0222"
FT   CDS_pept        247767..249221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0222"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein; KEGG: eta:ETA_17240
FT                   catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34193"
FT                   /db_xref="GOA:C6WF61"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF61"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ACU34193.1"
FT                   /translation="MTDARPTTNNAGIPIASDDHSLTLGPNGPILLQDHYLIEKNAQFN
FT                   RERVPERVVHAKGGGAFGHFTTTADVSRYTKAALFQPGVRTEALLRFSTVAGELGSPDT
FT                   WRDPRGFALKLYTSQGNYDLVGNNTPVFFLRDPIKFPDFIRSQKRRVDTGRRDHDMQWD
FT                   FWTLQPETAHQVTWLMGDRGIPRTWRHQNGYGSHTYLWENAEGERHWVKYHFKTDQGIE
FT                   TLTADEAARIAGEDADAHRADLWHAVERGEFPSWTLHVQVMPYEDAAGYRFNPFDLTKV
FT                   WPQGDYPLIEVGKLVLDRNPSDHFAEIEQAAFEPTNLVPGIGASPDKMLLGRIFAYPDA
FT                   HRYRIGANYAQLPVNRPKSRVDSYAKDGAMRYGNASDPVYAPNSYGGPHASAAVGSEAT
FT                   TSYGVEDAVVRSAYRLHPEDDDWGQAGTLVREVMDDAQRDRLVETVVAHAGNGVSEPVL
FT                   RRVFEYWRNIDKGVGDRIAAAFDGRS"
FT   gene            249410..249832
FT                   /locus_tag="Amir_0223"
FT   CDS_pept        249410..249832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0223"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: bpy:Bphyt_6798 OsmC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34194"
FT                   /db_xref="GOA:C6WF62"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF62"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACU34194.1"
FT                   /translation="MNVLYTAEAIAVGDGRNGEVRSSDGVIDEQLAMPKELGGPGGDKT
FT                   NPEQLFAAGYAACFHSALKRVAGQAKADITDSTVTAKVGIGPNDQGGFGLTVELAVHIP
FT                   GADEAAAHKLVETAHQVCPYSNATRGNIEVALTTTV"
FT   gene            249865..250341
FT                   /locus_tag="Amir_0224"
FT   CDS_pept        249865..250341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0224"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   mpo:Mpop_0322 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34195"
FT                   /db_xref="GOA:C6WF63"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF63"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACU34195.1"
FT                   /translation="MSKSPITSPLSDEAKDAVGHVLQATLVDLVDLSLVAKQAHWNVVG
FT                   KNFRSVHLQLDELVTTARTYADQVAERAAALGVTPNGKARTVAESSGVPEFPDGWLKED
FT                   DVVKAVVTTLAALIGRMRERIDETDKPDPVTQDLLIEITKQFEEAHWMWQAQQA"
FT   gene            complement(250415..250981)
FT                   /locus_tag="Amir_0225"
FT   CDS_pept        complement(250415..250981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0225"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bpl:BURPS1106A_A1934 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34196"
FT                   /db_xref="GOA:C6WF64"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF64"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACU34196.1"
FT                   /translation="MTVTVVGIGGSLRANSSSERALRLVLSGAAETGARIVEVSGPDLV
FT                   LPFYDPTEPTRPEAARRLVEALRVADGVVLVSPGYHGTVSGLVKNALDYVEDLRGDERP
FT                   YLDGRAVGCVATAMGWQASVTTLTSLRSIVHALRGWPTPLGASVNTREVKFDEAGECSS
FT                   AEVAEQLRTVGRQVGEFAASRAKRW"
FT   gene            251061..252113
FT                   /locus_tag="Amir_0226"
FT   CDS_pept        251061..252113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0226"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: rce:RC1_2418 lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34197"
FT                   /db_xref="GOA:C6WF65"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF65"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACU34197.1"
FT                   /translation="MSKLADRVPTGVLAAGLRAAFALPAPVRRLLTGPPRVVHGQTLHP
FT                   DTQLLLRMQELSGTGWSTSSPATSRASLRRTTALVEGPGPHRVVTRQVLVDEHLKARHY
FT                   TPQGLPEGSPLLVFLHGGGWVSGDLETHDDLCRHLAVGAGVRVLAVDYRLAPEHRFPAA
FT                   ADDADAAYRYAVANAEELGADPDRIALGGDSAGGNLAASAALSAADADHRPAFLLLLYP
FT                   SLDATATGGSRDLFARGFFLTRPKMDWFMGNYAPDPSTHHDPRLSPLLAPDLSVLPPTY
FT                   VATAGLDPLRDEGEAFAARLAESGVPVVLRRHDGLIHGFANVLGVGTAGREAVAEAIGA
FT                   LRTGLALRRA"
FT   sig_peptide     251061..251129
FT                   /locus_tag="Amir_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.867) with cleavage site probability 0.866 at
FT                   residue 23"
FT   gene            complement(252213..254027)
FT                   /locus_tag="Amir_0227"
FT   CDS_pept        complement(252213..254027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0227"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S15; KEGG: pzu:PHZ_c2763
FT                   dipeptidyl aminopeptidase/acylaminoacyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34198"
FT                   /db_xref="GOA:C6WF66"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF66"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACU34198.1"
FT                   /translation="MTTHPTAPVPDPLFPDPEAEARWRDRFTAPRVSLPQWAEDAPDRN
FT                   LYLSNSSGVWEVYAWDRASDEHRKVTDRPNGTSHAALTPDGERIWWFSDTDGDEFGVWV
FT                   TEPFTATGDKAEPAVPDVPAAYPAGLGIGDEVVVIGASTDDGTTVYLSRAGGPAEVLYR
FT                   HANDAGLGALSKDETLVAIAHSEHGDNRHTALRVLTTSGETAAEKWDGPGKGLDAIAFS
FT                   PVRGDNRLLVMHERRGREELLVWDVAADAETEVVVDLPGEISADWYPEADALLVVHTFR
FT                   ARNTLHRYDLATGALTALETPHGSVGSVGVRPDGDVEYSWSSAARPGVVRVLTASGEDR
FT                   VLLSPAGHRPPPSAELRDVFVGDVHALVARPEGAPDGPLPTVFSLHGGPHAADEDRFSA
FT                   YRAVWLDAGFAVVHVNYRGSTGYGSAWRDAIEGRPGLTELEDVAAVHDWAVREGFADPA
FT                   RCVVNGASWGGYLSLLALGTQPERWAAGVAGVPVADYLAAYEDEMEPLRAFDRALFGGS
FT                   PQEVPERYRLCSPLTYVDEVRAPVLVLAGENDPRCPIRQIDNYLDRLAARGSEYEVYRY
FT                   DAGHGSLVVAETIAQTAAEVDFVRRRLG"
FT   gene            complement(254024..254854)
FT                   /locus_tag="Amir_0228"
FT   CDS_pept        complement(254024..254854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0228"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Cyclopropane-fatty-
FT                   acyl-phospholipid synthase; Methyltransferase type 12;
FT                   KEGG: hha:Hhal_0984 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34199"
FT                   /db_xref="GOA:C6WF67"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF67"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU34199.1"
FT                   /translation="MDPATPPQAPAPDHRADHRAELRRAYATGELAGLPVFGGGFINFG
FT                   FWRGIPLHGPLSAEDRVASQAALYDLVLDALSPTGRSTLEIGCGQGVGALRVLLRAPSR
FT                   CAGVDQEPEQVGRARLAAPEGEFAVGSAGALPFGDGEFERLLSVEAAQHFDDLGAFARE
FT                   AARVLSPGGRLAVATFFAADASAAPELSRLLATFARGLDLPHPIGGFLDRLREAGFGDV
FT                   AATSVGEHVWRGLDRWLELGPAPERWDRNWLVAAERGLLDYHLVTATKPAGSGV"
FT   gene            complement(255115..255591)
FT                   /locus_tag="Amir_0229"
FT   CDS_pept        complement(255115..255591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0229"
FT                   /product="synaptopodin 2-like protein"
FT                   /note="SYNPO2L; KEGG: SYNPO2L; synaptopodin 2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34200"
FT                   /db_xref="GOA:C6WF68"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF68"
FT                   /inference="similar to AA sequence:KEGG:450900"
FT                   /protein_id="ACU34200.1"
FT                   /translation="MSTAAQSGPHAEHRDPTSEPPVPAVPVPAVPVPPAPVPEAPPRAS
FT                   ATAGLGSVVLALAVVGAASLAADLTSPVFGAATGALLLLGAAAVRALRRAGRTADRIFA
FT                   EELPRPGTGPATLPGPRTPSDAHHKPTTRRTTPTSRRRPGRTRRPHRTAGRNGR"
FT   gene            complement(255737..256330)
FT                   /pseudo
FT                   /locus_tag="Amir_0230"
FT   gene            complement(256337..256627)
FT                   /pseudo
FT                   /locus_tag="Amir_0231"
FT   gene            complement(256654..257529)
FT                   /locus_tag="Amir_0232"
FT   CDS_pept        complement(256654..257529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0232"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34201"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF69"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34201.1"
FT                   /translation="MPNLSRVDQVKRAIDRACSLHKSTGVRRTGLDRALGPELRALWGV
FT                   GGSDSPDRVRAKAVLQLERVFAGLDPVVAAVARGWFNTSLDPAWWELNLTGRKRRLREG
FT                   LDLSQRTLERRFGDEAQPALIASLRAGPAPVPPADVLARLDAERRAVAGDPPDDGADER
FT                   IGRFREPVPPLEQALRFAREEPLHGLRDREGRPVVLDAGGHGAWMPVFSTRARLREYLL
FT                   ANPAFDGFAFTSTGPKLAAELTARHPGTGLAVNPVADPEGNLGRTFTLLPEQVWELLPI
FT                   RRSPGENRAG"
FT   gene            complement(258064..258140)
FT                   /locus_tag="Amir_R0015"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(258064..258140)
FT                   /locus_tag="Amir_R0015"
FT                   /product="tRNA-Pro"
FT   gene            complement(258162..259121)
FT                   /locus_tag="Amir_0233"
FT   CDS_pept        complement(258162..259121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0233"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: hch:HCH_04892
FT                   phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34202"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF70"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACU34202.1"
FT                   /translation="MNTFGRSLLATTALGTAALAYAAGIERRHWTLRRATIPVLAPGST
FT                   PLKVLHFSDLHMTPNQTSKQRWVAGLAELEPDLVVNTGDNLAHPQAVPGVIRALGPLLD
FT                   FPGVFVFGSNDYYAPRPKNPARYLLPSAKTKRIHGLDLPWRDLRAAMVERGWIDLTHVR
FT                   TSFEAGGQRIVAAGLDDPHLKRDRYSEIAGAPGKAALRLGVTHSPEPRVLDPFAADGYD
FT                   LVLAGHTHGGQLRVPGYGALVTNCDLDRGRARGVSRWGAHMWLNVSAGLGTSPYAPVRF
FT                   ACPPEASLLTLVPRDVDAGQSDDEAKRDTDFRVRGNVR"
FT   sig_peptide     complement(259053..259121)
FT                   /locus_tag="Amir_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.983 at
FT                   residue 23"
FT   gene            259185..259652
FT                   /locus_tag="Amir_0234"
FT   CDS_pept        259185..259652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0234"
FT                   /product="GatB/YqeY domain protein"
FT                   /note="KEGG: mxa:MXAN_5202 GatB/YqeY domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34203"
FT                   /db_xref="GOA:C6WF71"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF71"
FT                   /inference="similar to AA sequence:KEGG:MXAN_5202"
FT                   /protein_id="ACU34203.1"
FT                   /translation="MAQLKARLQSDLTGAMKNRESVTAGALRMALTAVTNEEVSGKTAR
FT                   ELTDDEVLKVLGREVKKRREAAEAFANAGRDEKAELERQELAILEAYLPKQLDDAELAA
FT                   LVDEAVAELAQGGEQPGLKQMGLVMKAANAKVAGRAEGGRVAAAVKARLNA"
FT   gene            complement(259758..262250)
FT                   /locus_tag="Amir_0235"
FT   CDS_pept        complement(259758..262250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0235"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; PASTA domain
FT                   containing protein; penicillin-binding protein
FT                   transpeptidase; SMART: PASTA domain containing protein;
FT                   KEGG: azc:AZC_0337 penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34204"
FT                   /db_xref="GOA:C6WF72"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF72"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ACU34204.1"
FT                   /translation="MRVRNSVLKLLGLCVLAGVLLAGALFPAVGALGVVSNQASDTVDS
FT                   ISSDLVTTDPPLITTITDRDGAPIAYLYDQYRVLVPPEDISPTMKAALVSVEDRRFYEH
FT                   QGVDWKGTTRAALTNQFSGSVTQGASTLTQQYVKNYLVHVVARNNKVEQQKAQEQTIAR
FT                   KMREARISLQLERKLGKEEILARYLNVVPFGSTIYGIAAASQAYFSTTADKLTVAQSAM
FT                   LAGMVNSPSALDPEVFPEKALERRNQVIDKMVENDKLSRDAAFEAKREPLGLAEPVRTP
FT                   PNGCVGAGPENGFFCSYVVEYLERNGFSIEQLKIGGYTVRTTLDRDITQKAKRAAEGQV
FT                   AKDTSGIANTMAVVRPGKESHEVVALVANRDYGLKADQFQTQFDLPSGVENKFGAGSIY
FT                   KVFTAAAALEKGMGIENVIPTPTFYESRVFKGGGNRCRSTGEPNTRWYCLGNDSATYSS
FT                   QMPLQQALQTSPNTGFVILEERLGMEPVVDMASRLGMRETMATNISGTPPDPRSKQREL
FT                   RVSQSEFYKQDGGNASFTLGPASASTLELANVAATIISGGTWCPPSPVAEVLDRDGQAV
FT                   PVNEAPCEQVVNEQLANGLAVGMSKDDQNGGTAAAAARGVKWTRPMLGKTGTTEEYKSA
FT                   AFIGATPDYAGAVQTYNDGPNPQPICVTGKPRLCANGNIYGGTVPARTWFDTMSQIHEG
FT                   LPVQQLPKVEPRYLKGGDEIRVPDVVGKSVNDATRVLQEAGYKVAQQSRNSAQAKGTVV
FT                   SQTPRGSALQGTLITLLVSTGYVPPPAPTQQPTQQPPTQGQPEQPTQPTQPGGQPGGGT
FT                   PGTPGQPGGPTRPTRPTR"
FT   sig_peptide     complement(262158..262250)
FT                   /locus_tag="Amir_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.546 at
FT                   residue 31"
FT   gene            262504..262797
FT                   /locus_tag="Amir_0236"
FT   CDS_pept        262504..262797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0236"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34205"
FT                   /db_xref="GOA:C6WF73"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF73"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ACU34205.1"
FT                   /translation="MQQQGDWRIKAACRDGEPDQLFVRGAEQRKVKVVCLGCPVRTECL
FT                   AEALDNRIEFGVWGGMTERERRALLKRRPDVTSWLELLDSARTDHYEESAAG"
FT   gene            complement(262823..263947)
FT                   /locus_tag="Amir_0237"
FT   CDS_pept        complement(262823..263947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0237"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG:
FT                   acp:A2cp1_0984 adventurous gliding motility protein R"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34206"
FT                   /db_xref="GOA:C6WF74"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF74"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ACU34206.1"
FT                   /translation="MNRLDVDALLDDPATRVLVCCGSGGVGKTTTAAALALRAAERGRR
FT                   AVVLTIDPARRLAQSLGLRELDNSPRPVVVEGFEPEGELHAMMLDMRRTFDDMVLAHAG
FT                   RERAQQILANPFYQTISTSFSGTQEYMAMEKLGQLVARDEWDLVVVDTPPSRSALDFLD
FT                   APQRLSTVLDGKLIKMLSAPARAGGRGIMKIVGTGFTLFTKAVSTIVGGQLLQDASTFV
FT                   QAFDSMFGGFRQRAQATYELLRSPGTEFLVVAAAEPDALREASYFVERLSAEEMPLAGL
FT                   VANRTHPVLAGLAPAGAEAAADRLEERVGGPSLASAVLRVHSDRVAVADREKRLLARFT
FT                   RAHPGVPLVGVPALPTDVHDLDGLREIGRRLAGE"
FT   gene            complement(263944..264936)
FT                   /locus_tag="Amir_0238"
FT   CDS_pept        complement(263944..264936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0238"
FT                   /product="Anion-transporting ATPase"
FT                   /note="PFAM: Anion-transporting ATPase; KEGG:
FT                   afw:Anae109_0972 chromosome partitioning-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34207"
FT                   /db_xref="GOA:C6WF75"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF75"
FT                   /inference="protein motif:PFAM:PF02374"
FT                   /protein_id="ACU34207.1"
FT                   /translation="MTGWTDELSRARLHVVTGKGGTGKTTVAAALALALATGGRRVLLV
FT                   EVENRQGLAQLFDRPPLPYSEERIASAPGGGEVRALAVDPEAALLEYLAMFYNLGFAGR
FT                   TLRRMGAIEFATTLAPGLRDVLLTGKVKECVRRVGKSGRHEYDAVVLDAPPTGRVVRFL
FT                   DVTRAMADLAKVGPIKGQSEGVVALLHSGDTAVHLVSLLEEMPVRETLDAVAELDGADL
FT                   RPGAVFVNRARPHRLPPDAVLKAAEGGIDPAELREGFAEAGLVVPDEDLDGLAEQTADH
FT                   AQRVLAEARAKDKLAEADLPTLELPELTGGVDVAALYELAESLVERGVR"
FT   gene            complement(265300..265569)
FT                   /locus_tag="Amir_0239"
FT   CDS_pept        complement(265300..265569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34208"
FT                   /db_xref="GOA:C6WF76"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34208.1"
FT                   /translation="METWRVVATGAFIVGGLVLVLVGMAQVRDRVRRRSERDAKHAQVL
FT                   RAALVGLVAVAAVALLIALWLPSTVAWALVAATALAIVFLTTAD"
FT   sig_peptide     complement(265492..265569)
FT                   /locus_tag="Amir_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.663) with cleavage site probability 0.568 at
FT                   residue 26"
FT   gene            266128..266283
FT                   /locus_tag="Amir_0240"
FT   CDS_pept        266128..266283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34209"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF77"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34209.1"
FT                   /translation="MQKWEYATVPLLTHATKQILDQWGEDGWELVSVLTGPTGEQHVAY
FT                   LKRPKS"
FT   gene            266280..266738
FT                   /locus_tag="Amir_0241"
FT   CDS_pept        266280..266738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0241"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: rce:RC1_1921
FT                   endoribonuclease L-PSP, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34210"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF78"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACU34210.1"
FT                   /translation="MTWTDRLAELGVELPEVAAPVAAYVPAVRTGSLVFTSGQLPFVGG
FT                   ALAATGKVGAEVSPEEAKAHARTCALNALAAVHALVGVDSVARVVKVVGFVASADGFTG
FT                   QPAVVNGASEFLGEVFGDAGAHARSAVGVAELPLGAPVEVELVVEIRE"
FT   gene            266740..267351
FT                   /locus_tag="Amir_0242"
FT   CDS_pept        266740..267351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34211"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF79"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34211.1"
FT                   /translation="MSDTLHELLLRLSGRLPDDVMWRFRDWAATDAVSVLARTLPRTLL
FT                   HDRVGLTDHEQRLLESALVPHGADRAATSSIRALDELPETDFAFTPESPDRAAMGDSAT
FT                   VVLGATLRGRPGVGEVRSSWRQVGGRNGRTNRVILVTATSGCARLAGELQRVLRALGEH
FT                   DPCVEVLPAGLEPPPYHRAALASSELVCTGAEDEGHLVTV"
FT   gene            267390..268634
FT                   /locus_tag="Amir_0243"
FT   CDS_pept        267390..268634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0243"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34212"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF80"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34212.1"
FT                   /translation="MAQDGTGLPVRLHDLLLALAGRVDDDALAQAREMLAVSELDRAVD
FT                   HVVGCLIAGRIPVRAEEREELGALLGEVRSDPLLADRLLAVETLPHVRHRFTSESDPTK
FT                   DLADVLGRTASALPDVRSVRCTWRSSPAGATPGPLPQRVVLVDIGPKGFPTATAYRLDT
FT                   VLRKAGIRASVEVLIVGKPMNEYHAAASSSSREVYFPSAPLGAKGEAPDNAAWFDGEVR
FT                   DKAPVIEPEPVPADDNQNGSTKSRRGRDEAFEAIQPFPPKPVKRTAARDQAQKGEPAPP
FT                   AAPEQQTPPPPPPPPPVAPPPAPKAAPAPPPVVPVAPPVAPPPALPEDSPFSRAEVTME
FT                   LNPEDLAALQAALADGQAPASVNLPPTVDAKLSDRERALLQQLHEELAQREQQTWPGGA
FT                   EYVNGVPKPNNGKFS"
FT   gene            complement(268651..269457)
FT                   /locus_tag="Amir_0244"
FT   CDS_pept        complement(268651..269457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_3797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34213"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF81"
FT                   /inference="similar to AA sequence:KEGG:Adeh_3797"
FT                   /protein_id="ACU34213.1"
FT                   /translation="MSAVDGLARYAAGLACAARGAWREAEAHHAGALAAWGRDGRAAAV
FT                   DRGLVERARDGADACATAAEVAVELHRLVPAAHRRGAALLAASGARSPHVRVLADLASL
FT                   LARGPAPLGVVRALHRRTPGLAAALTDREWLVVGGSVRATPRCAEFLRAVNAAHAEAVE
FT                   RLWPDPPVVELVVEHPMAAARTGPSPQARLFDLLRALRYQRADAHHTAAHYTAAHHTAA
FT                   HQAAGAEHRSTSEDERVTDLAASAPYRRIDRARRAALVTDLRGLAD"
FT   gene            complement(269454..270344)
FT                   /locus_tag="Amir_0245"
FT   CDS_pept        complement(269454..270344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0245"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   rec:RHECIAT_PC0000780 putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34214"
FT                   /db_xref="GOA:C6WF82"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF82"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACU34214.1"
FT                   /translation="MTVVAERLRVGLVGAGPWARAVHAPGLAAHPGVELVSVWGRRHDV
FT                   AAGLAAEHGAAAVREVDELLEQVDAVAFAVPPGVQAPIAVTAARRGRHLVLEKPVAESV
FT                   AGARELVDAVDEAGVAALVMLTRRFAPETREQLVDWRDLGGWTGGAARWVGGGLLGGPY
FT                   SASPWRHERGALDDVGPHAFDLLDAALGRITGVRAASCAGGLWQVLLEHESGAVSSAAL
FT                   GMSVPVSPGVAELEVFGAHGRRVLAGRGSTARDCYAVLLDDLVGAVASGAVRHPCDVRR
FT                   GLHLQRVIAEVRALA"
FT   gene            complement(270356..270715)
FT                   /locus_tag="Amir_0246"
FT   CDS_pept        complement(270356..270715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34215"
FT                   /db_xref="GOA:C6WF83"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF83"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34215.1"
FT                   /translation="MKGKGCLVNLAVLLAGAFGGVALTAVTGVLLFMPSTSVISSEPSD
FT                   GNRPGVYVKESTRFFGGTTHEVWLGCVERAHVVELPPGWEPNPAVEYTEAGLDLVFPDG
FT                   GRISVPEAKYAGDYC"
FT   sig_peptide     complement(270641..270715)
FT                   /locus_tag="Amir_0246"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.769 at
FT                   residue 25"
FT   gene            270739..271578
FT                   /locus_tag="Amir_0247"
FT   CDS_pept        270739..271578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0247"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rpd:RPD_3111 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34216"
FT                   /db_xref="GOA:C6WF84"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR039121"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF84"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACU34216.1"
FT                   /translation="MSRGVIGRTLAVVRELPEELVLPPGALPATTPDPPAPTRDAASVL
FT                   LVRDGERGLEVFLQRRVLGMAFAGGMTVFPGGGVDPRDADTSVEWAGPPPSWWAGRFGC
FT                   GEEVARALVCAAVRETFEESGVLLAGPSASEVVADASAYFAERRALERRELSLAAFLAG
FT                   ARLVLRADLLRPWANWVTPVEEPRRYDTRFFTAALPDGQLADGVTSEASDAVWQRPSEA
FT                   IADWEEGRRLLLPPTWVALADLAELGSVAEALAVEREVDRVIPKLVRDGDVVRVVLP"
FT   gene            271575..272375
FT                   /locus_tag="Amir_0248"
FT   CDS_pept        271575..272375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0248"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   aav:Aave_0793 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34217"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF85"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACU34217.1"
FT                   /translation="MSGRPAEGERFEHPAYGVLRPVTPEAAVLLADNPSVMTLDGTNTW
FT                   VLRAPGEESCVVVDPGPSDEAHLARAAGFGPVAQVLLTHGHPDHAEGAREFGERVGAPV
FT                   RALDPALRLGGEGLAHGDVVAAAGLEIRVVGTPGHTSDSLCFLVGGAVLTGDTILGRGT
FT                   TIVAHPDGRLGDYLESLRVLADLPPGTTVLPGHGPELPDAAEAARRYLAHREQRLAQVA
FT                   AALEALGPDATARQVVESVYADVDRALWPAAEWSVRAQLEHLRR"
FT   gene            272493..273131
FT                   /locus_tag="Amir_0249"
FT   CDS_pept        272493..273131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mlo:mlr3017 5'-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34218"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34218.1"
FT                   /translation="MTNKRALLTALTATTLALAGCTTLEPGRPVAAPGASAPASTSAKP
FT                   STSAKPSASGKPSASNAALTEIDVCGRVPADLMPTLVPQMVGKPGEATCAQEPTELNKA
FT                   GYPTQEGQFKVDGKVVMAIVVTVYQGALDMQGYVKFQLDQNPGKVSAYDVMSLPGYSGQ
FT                   SNFKDLKFVMGAAAGVNGDMHTGQVLLEQQPDELGMSATAFLLKMTIDD"
FT   sig_peptide     272493..272552
FT                   /locus_tag="Amir_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.509 at
FT                   residue 20"
FT   gene            complement(273148..273483)
FT                   /locus_tag="Amir_0250"
FT   CDS_pept        complement(273148..273483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34219"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF87"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34219.1"
FT                   /translation="MAASGTAVGGTAGKTVMRVLYSQHPGGAGEVAEVLKRLKPSGNIR
FT                   VEEAAIGKAGFRYRAPDTAAKFHVGGVTTIGSDALAVEIGTTDDLPDAAFAVPVLGLVV
FT                   TLGFLPG"
FT   gene            complement(273605..274702)
FT                   /locus_tag="Amir_0251"
FT   CDS_pept        complement(273605..274702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0251"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: sus:Acid_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain; SMART: DNA polymerase III
FT                   beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34220"
FT                   /db_xref="GOA:C6WF88"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF88"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACU34220.1"
FT                   /translation="MDLTATTSELASAVADVARLLPGRVLDPVLAGVVLRAGPGGVELS
FT                   GSDRERSLRLSRAATTHSEGAALVPAKPLAETLRALESPQVRLVVEGSRLAVRTGAARF
FT                   ALPLLELGDHPGVPELPPVAGSAPAGAFASALAAVATAASKDDALPVFTGVRVHAAGDR
FT                   LELITSDRYRLGFASVPWAGGALDALAPAVQLAEVAKQAARDERVELRADADRLALAWG
FT                   GGSASTALLAAPFPDERARKLLAAEGECTVVLEADELAGAVRRAAPYSGAHGAVQLAAE
FT                   DGELRVRGSDPQAGESSESVKASVSGGLLTRSFQVRYLSDALRAFAGRRVELRVQSGLR
FT                   STVLTAEEDTSGVRLTYLVVPLRTP"
FT   gene            complement(274744..276042)
FT                   /locus_tag="Amir_0252"
FT   CDS_pept        complement(274744..276042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0252"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   sml:Smlt0548 putative MFS family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34221"
FT                   /db_xref="GOA:C6WF89"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF89"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34221.1"
FT                   /translation="MVLAYQVCILARMSHSARLSDYRAALTTPAMRGPVVAGLFARLPI
FT                   AMIGFALLLYVQRASGSYGTAGLVSASALIGVALGAIAQGRLMDRFGPSRPLLAVTALF
FT                   ALAATGAVVAVESGVAVVVLAPLAFAVGFTEPMAGSASRALWTSIVPAGPLRDAGIAYE
FT                   AISMEVFFILGPGLAGVLVTAAWPGTGFVVGAAMMVVGALWFACTPTVRGRRPEPVQGG
FT                   GPLGALASPGMRTVALAALGFGLSIGFIEVAVPAAADAAGHKGVGGLLLSLWSVSSVLF
FT                   GVLYSLRPLPRPMHLRLPVLLGGFSLLAALLAIPTTLVGLAVALFVVGSLITPQSTAHS
FT                   AAIEQVAPEGTAAEAFGWVVTAVTLGLAAGQGLAGQIVEARGTSTAFLAAAASGLAVAV
FT                   VVWLLRGTVAAGAPGVPAGAAVPQEEEAGLVGR"
FT   gene            complement(276747..277421)
FT                   /locus_tag="Amir_0253"
FT   CDS_pept        complement(276747..277421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0253"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: bbt:BBta_5745 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34222"
FT                   /db_xref="GOA:C6WF90"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF90"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACU34222.1"
FT                   /translation="MDETLARAGIFQGVEPAAAEALAQTLESVEFPRGHVIFAEGEPGD
FT                   RLYIIQSGKVKIGRKSPDGRENLLGIFGPSDMFGELSIFDPGPRTSTATTVTEVRAVSM
FT                   DRPALRQWISNRPEIAEQLLRALARRLRRTNSMLADLIFTDVPGRVAKALLQLAQRFGS
FT                   QEAGLLRVTHDLTQEEIAQFVGASRETVNKALADFAHRGWLRLEGKSVLILDPERLARR
FT                   AR"
FT   gene            complement(277624..277872)
FT                   /locus_tag="Amir_0254"
FT   CDS_pept        complement(277624..277872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34223"
FT                   /db_xref="GOA:C6WF91"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF91"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34223.1"
FT                   /translation="MTAWFVIAVPIVIMFFALFMERVEARLRHVAVQEDEVEEFLESAR
FT                   PDEVKALYGHGIGRALELFRLRRFGGRSKNLRSRPRR"
FT   gene            278144..278917
FT                   /locus_tag="Amir_0255"
FT   CDS_pept        278144..278917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0255"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: pca:Pcar_0009 endonuclease III; TIGRFAM:
FT                   endonuclease III; PFAM: HhH-GPD family protein;
FT                   helix-hairpin-helix motif; SMART: HhH-GPD family protein;
FT                   iron-sulfur cluster loop"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34224"
FT                   /db_xref="GOA:C6WF92"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF92"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ACU34224.1"
FT                   /translation="MVGGARGGARPETRLGLVRRARRTVRVLGVGYPDAHCELDFTTPL
FT                   ELLVAVVLSAQCTDKRVNQVTPALFARYRSAEEYAAADRTELEELVRPTGFYRNKAAAI
FT                   SGLAAEIVERHDGEVPGTQAELVKLPGVGRKTANVVLGDAFGVPGITVDTHFGRLVRRW
FT                   GWTTEEDPVKVEHAVGALVERKDWTLLSHRTIFHGRRVCHARTPACGACLLAPQCPSFG
FT                   TGPTDPVRAAKLVKGDEAEHLIGLAERVRAGERLG"
FT   gene            278914..279594
FT                   /locus_tag="Amir_0256"
FT   CDS_pept        278914..279594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0256"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   xop:PXO_04554 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34225"
FT                   /db_xref="GOA:C6WF93"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF93"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACU34225.1"
FT                   /translation="MSAAARWSVVVLVLAVAGVVALWPRGEDPASPVIPQPQRDTSQRA
FT                   DLGVARNKAALRPCDQFSGNSASPASANAASPSPASPSAGPTSTSAGPEALRGATAVCL
FT                   GDGERVDAATALSGRVLVNFWASWCAPCREELRVLDDYSQRPGAIPVLGVQVKSGEADG
FT                   LDLLSRIGVHLPSLVDDSEALLRAFKVPPTLPASFLVGADGSITPVTDPLVFTSVDQVR
FT                   EVVG"
FT   gene            279591..280331
FT                   /locus_tag="Amir_0257"
FT   CDS_pept        279591..280331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0257"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: mch:Mchl_1739 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34226"
FT                   /db_xref="GOA:C6WF94"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF94"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACU34226.1"
FT                   /translation="MTDRTTDPVTGHDADRAAGLAPGGAPERLVDDLGELPEWMRGLAA
FT                   AAVDADADTFLNYPKPPAFTGRAASVLMLFGEGHRGPDLLLLRRADTLGSHPGQVAFPG
FT                   GAADPEDSGPVGTALREAFEETGVLAEGVRPVALLPELHVPVSGFLVTPVLAHWRTPVP
FT                   VAPVDPGETAAVARIPVAHLADPANRFRVSHPSGYTGPAFSAPGMLVWGFTAGLVSGLL
FT                   RLGGWERPWDATDVRDLDSALRAT"
FT   gene            280353..281540
FT                   /locus_tag="Amir_0258"
FT   CDS_pept        280353..281540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0258"
FT                   /product="Colicin V production protein"
FT                   /note="PFAM: Colicin V production protein; peptidase S1 and
FT                   S6 chymotrypsin/Hap; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34227"
FT                   /db_xref="GOA:C6WF95"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF95"
FT                   /inference="protein motif:PFAM:PF02674"
FT                   /protein_id="ACU34227.1"
FT                   /translation="MNWVDLLVLAIAAFAAVSGARQGMVVAVPAFIGVLVGLLLGTQLA
FT                   PVVVSRFDNVVTKVVFAVGVVVLLVALGETLGVYIGRAVKSKVNATPLRGVDNALGAVV
FT                   QGAVVFVVAWMIALPLTSVAGLPTLAKGLNQSAILSTVDGAMPQAARDLSEDLQNLFDV
FT                   SGFPAAMDPFNRTPLREVSPPDPELSGDPVVQRLRPSVLKVRGRAPSCSRALEGTGFVI
FT                   APERVMTNAHVVAGTTEVSIEVGQGKFDATVVHYDAQTDLAILAVPNLDAQPLQFRTDE
FT                   IDQGEDGIVLGYPLDGPYTASEARVRERIPMLRGPDIYDAQTVTRDVYTIRAKVRSGNS
FT                   GGPLVDREGRVMGVVFGAAVDDQETGFVLTPQEVADEVAKAPGLVRRAPTQTCAS"
FT   sig_peptide     280353..280424
FT                   /locus_tag="Amir_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.641 at
FT                   residue 24"
FT   gene            complement(281588..282514)
FT                   /locus_tag="Amir_0259"
FT   CDS_pept        complement(281588..282514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0259"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   acp:A2cp1_0551 alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34228"
FT                   /db_xref="GOA:C6WF96"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF96"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU34228.1"
FT                   /translation="MAPPPDPSSARIPGPWAHRDVSANGIRLHVAELGDGPLVLLLHGF
FT                   PEFWWSWRHQLVDLAEAGYRAVAVDLRGYGDSDKPPRGYDGFTLAGDVAGLVKALGEPR
FT                   AHVVGHAWGGMLAWVVGALHPRLVRSVTAVSAPHPLALRRAVRRNTAGQARALGHLLRF
FT                   QLPVLPERSLLAANGARVGELLRAWGGAGWTASPEFAEVVERNTAAVRIPGVAHSALEY
FT                   HRWAVRSQVRSDGRRFVEAVSRKLEAPVLQVQGARDPVMLAQTALDSARWRGPDSVLRV
FT                   LQDVGHFPHQEDRAEVSRVIAGFLAER"
FT   gene            complement(282523..282990)
FT                   /locus_tag="Amir_0260"
FT   CDS_pept        complement(282523..282990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0260"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   mpo:Mpop_1689 protein of unknown function DUF1469"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34229"
FT                   /db_xref="GOA:C6WF97"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF97"
FT                   /inference="protein motif:PFAM:PF07332"
FT                   /protein_id="ACU34229.1"
FT                   /translation="MTTPSENTPPPIPSIPLTAENASTIAGETSIGGLVRDATAHVSTL
FT                   LRAEVELAKAEVTHEVKRGLKGSVFFILALVVLSFSLFFFFMFVAELIAVWLPVWAGYL
FT                   IVFGLMIGITVLLGLLGYRKMKTLRAPTRTIESAKETVAVLRRRDDQDDTP"
FT   gene            complement(283062..284234)
FT                   /locus_tag="Amir_0261"
FT   CDS_pept        complement(283062..284234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0261"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; sodium/hydrogen exchanger; KEGG:
FT                   mlo:mlr5309 Na+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34230"
FT                   /db_xref="GOA:C6WF98"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF98"
FT                   /inference="protein motif:TFAM:TIGR00773"
FT                   /protein_id="ACU34230.1"
FT                   /translation="MSSPARKPAADFARYLRTETTGGIVLLVATAIALLWANSPLGDSY
FT                   TALRETHLGPLTIGDWVKDGLLAVFFFVAGLELKRELVVGELNSLKAAALPVIAAVGGM
FT                   VVPALVALGFSWGEPGAGQAWAIPMATDIAFALGVLAIAGSALPSSVRVFLLSLAVVDD
FT                   LGAIAVIAVLFTSGLELLAVLAAVALLALYAFLQHKRVTATWLYVPIAVGAWVAVHEAG
FT                   VHATIAGVALGLLTRVRADEGEDEAPAARLEHRLQPWSAGLVVPLFALFAAGVPIGGDA
FT                   LRALVDDPIALGVVAGLVLGKVIGILGFSALAVRLRLAVWPSGAGPRDVAAVGVLGGVG
FT                   FTVSLLIADLALAGEAAERAKAAVLIASLLASLIAAVLLVRRGRAHRDSD"
FT   gene            complement(284370..286355)
FT                   /locus_tag="Amir_0262"
FT   CDS_pept        complement(284370..286355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0262"
FT                   /product="acetate/CoA ligase"
FT                   /note="TIGRFAM: acetate/CoA ligase; PFAM: AMP-dependent
FT                   synthetase and ligase; KEGG: aba:Acid345_3520
FT                   acetyl-coenzyme A synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34231"
FT                   /db_xref="GOA:C6WF99"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6WF99"
FT                   /inference="protein motif:TFAM:TIGR02188"
FT                   /protein_id="ACU34231.1"
FT                   /translation="MTKPNENGPTLDNLLTESRTFPPSEEFAAQANATQALYDSAAADR
FT                   EAFWAEQADRLTWERKWDRVLDWSDAPFAKWFVGGRLNVAYNCVDRHVESGHGEQVAIH
FT                   WEGEPGDSRTITYADLKRDVSKAANALASLGVGAEDRVAIYMPMVPEAIVAMLACARIG
FT                   ALHSVVFGGFSAEALRTRVEDSQAKLVITTDGQYRRGNPAPLKPAVDEAVSKAASVEHV
FT                   LVVRRTGGEVAWTEGRDLWWHELVDGQSEEHAPEAFDSEHPLFILYTSGTTGNPKGILH
FT                   TSGGYLTQTAYTHHNVFDLKPDSDVYWCTADIGWVTGHSYIVYGPLANRVTQVVYEGTP
FT                   NTPHEGRHWEIVQKYGVSIYYTAPTLIRTFMKWGAEIPAKHDLSSLRVLGSVGEPINPE
FT                   AWIWYRENIGAGKAPIVDTWWQTETGAIMISPLPGVVSTKPGSAQRPLPGVGAKVVDDQ
FT                   GVEVGPGGGGYLVLDEPWPSMLRGIWGDDARYRDTYWSRFAEEGFYFAGDGAKYDADGD
FT                   IWLLGRVDDVMNVSGHRISTTEVESALVSHPTVAEAAVVGATDPTTGQGIVAFVILRGG
FT                   VAAGSDGAEAIKALRDHVAKEIGPIAKPRQIMVVPELPKTRSGKIMRRLLRDVAENRQV
FT                   GDVTTLADSSVMDLISSGLKKGSGED"
FT   gene            complement(286579..287160)
FT                   /locus_tag="Amir_0263"
FT   CDS_pept        complement(286579..287160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0263"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   aav:Aave_3953 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34232"
FT                   /db_xref="GOA:C6WFA0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU34232.1"
FT                   /translation="MTWFDRPVLSDPHVRLEPLTPDHAPGLLKAGADPGVWTWLSSRQP
FT                   TDLPAMAAFVDRALTDPDRAPWAQVDPATGEVVGTTSYYEVDPEHRNLCIGHTWIGAPW
FT                   QRTPLNTAAKLLLLTRAFDGLGALRVGWHTDIRNERSQRAIARLGATREGVLRAHRIRP
FT                   DGTVRDTVVFSVTAPEWPGVRDRLVARLAE"
FT   gene            287252..287974
FT                   /locus_tag="Amir_0264"
FT   CDS_pept        287252..287974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6904 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34233"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34233.1"
FT                   /translation="MTDPLAPLLDLPGVADAVASARDAVFRVHRHRVNLRGWATTAAEA
FT                   SVRAARASAALDGGPTTIPEDGEVTDPVLAGALRVAESLGVVFPTWQRAPLQALAKLHV
FT                   LAAADLGTELGRPRLVPGVAERLDLLAGLVTGGTSAPGPLVVAVVHGELMALTPFDTAN
FT                   GVVARAASRLASIATGLDPKSLGVPEVWCLRRRSEYDAALHGFSTGEPEGVARWITFSC
FT                   AALEAGAREAQGIADAAA"
FT   gene            complement(287971..289092)
FT                   /locus_tag="Amir_0265"
FT   CDS_pept        complement(287971..289092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0265"
FT                   /product="kynureninase"
FT                   /note="TIGRFAM: kynureninase; PFAM: aminotransferase class
FT                   V; KEGG: pde:Pden_2620 kynureninase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34234"
FT                   /db_xref="GOA:C6WFA2"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA2"
FT                   /inference="protein motif:TFAM:TIGR01814"
FT                   /protein_id="ACU34234.1"
FT                   /translation="MTDPLAHVRELFDLADDVVYLDGNSLGAPPRAVAERLDDVVRRQW
FT                   GRRLIRSWSEGWWEAPQRVGDRIGRLVGAAPGQVVVGDSTSVNLFKALVGAVRGTDRSE
FT                   IVVDAGTFPTDGYIAGSAAELTGLSLRPADPDDLRLDERTAVVLLNHVDYRTGRLLDMA
FT                   GLTERAHEVGAKVVWDLCHSVGVLPIELDALGVDLAVGCTYKFLNGGPGSPAFLYVPSA
FT                   AQPGFRQPLTGWTGHREPFAMAAEYTPDAGIGRARAGTPDILSMLALDAALDVWDGVEL
FT                   ADVRAKGLALTARFMELVRDLPGIEVITPADGRRGHQVSLRHPEAARLMAELIAGGVIG
FT                   DHRPPDVLRFGFAPLYNTFDEAERAAKALEELL"
FT   gene            complement(289089..289910)
FT                   /locus_tag="Amir_0266"
FT   CDS_pept        complement(289089..289910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0266"
FT                   /product="tryptophan 23-dioxygenase"
FT                   /note="PFAM: tryptophan 23-dioxygenase; KEGG: reh:H16_B1418
FT                   tryptophan 2,3-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34235"
FT                   /db_xref="GOA:C6WFA3"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA3"
FT                   /inference="protein motif:PFAM:PF03301"
FT                   /protein_id="ACU34235.1"
FT                   /translation="MEQVCPVAPKLDFGGTTPYEDYVRASVLHTLQRQASDDPREMSFL
FT                   VTTQVMELYFGLLCFEWRQAQKELRADDVTAAVRTLRRSELHMQALNAAWRPIARMTPG
FT                   EFNSFRDALGEGSGFQSGRYREVEFLLGEKSRSMLVPHRSAPAQHDALEALLSEPSLYD
FT                   DVLAALHRRGLDVPDELLKRDFAEAYAPDERVEAVWAHVYREGPRDLLELGEALTDVAE
FT                   EFSRWRHDHLLATRRSMGSKVGTGGSAGVAWLEKRVRRAVFPELWTARSYV"
FT   gene            290017..290466
FT                   /locus_tag="Amir_0267"
FT   CDS_pept        290017..290466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0267"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: bam:Bamb_3888
FT                   AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34236"
FT                   /db_xref="GOA:C6WFA4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA4"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACU34236.1"
FT                   /translation="MRTDLDAVDWALVDALQADARLSYNELARKVGVSPPTVAQRVRRL
FT                   ENAGVITGYRAVVDPTAVGRSVIALVRMKCYGPRCITVHPELLDDCPEVVEVVRLTGDI
FT                   CSVVKVVTTSVSELERLLVRLGGHGETSSAMVLSTPIPWRPLTAG"
FT   gene            complement(290435..291361)
FT                   /locus_tag="Amir_0268"
FT   CDS_pept        complement(290435..291361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0268"
FT                   /product="glucokinase regulatory-like protein"
FT                   /note="TIGRFAM: glucokinase regulatory-like protein; KEGG:
FT                   spe:Spro_3661 N-acetylmuramic acid-6- phosphate etherase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34237"
FT                   /db_xref="GOA:C6WFA5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA5"
FT                   /inference="protein motif:TFAM:TIGR00274"
FT                   /protein_id="ACU34237.1"
FT                   /translation="MTARGDVVRVESPTEARNPRTGEIDRMSTLDVLRMINSEDRGVPD
FT                   AVAAVLPELARAADLAVAALRGGGRVHYVGAGTSGRLATLDAAELPPTFNTPPDWFVAH
FT                   HAGGAEALVRAVENAEDQAATGAERIRAHAEPGDLVLGVTASGRTPFVLGALAAAHELG
FT                   ARTALVSNNPSAPPVPVDVLITVDTGPEAIAGSTRMKAGSSQKLVLTAFSTAVMVRMGR
FT                   TYSNLMVSVRATNAKLRGRTVRILSEATGLDERECTDALTAAGDDLKVALVHLLSGSPA
FT                   PDAAEALTATGGHVRQALTRLSAGATG"
FT   gene            complement(291358..292272)
FT                   /locus_tag="Amir_0269"
FT   CDS_pept        complement(291358..292272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0269"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: sugar isomerase (SIS); helix-turn-helix
FT                   protein RpiR; KEGG: reh:H16_B1066 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34238"
FT                   /db_xref="GOA:C6WFA6"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA6"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ACU34238.1"
FT                   /translation="MSTENTDASPLVKIRSLLPGLARAEQRVAKVVLDNPATVAHRSIT
FT                   EVAESAGTSETTVTRFCKAIGVGGYPELRIALAADTARTAARTDRDLGGDIGPGDDLRQ
FT                   VVGKVAFADARAVEETAEQLNVDTLQAVVDAVARAGRVDVYGFGASAFVAFDLQQKLHR
FT                   IGRTCFAWNDTHIALTSAAVLTGADVAVGISHTGSTTETVEALRVARERGATTVALTNF
FT                   PRSPISEVADHVLTTAARETTFRSGAMASRIAQLTVVDCLFIGVAQHHVESATSALEAT
FT                   YDAVAGHRLGARPDGRRRREAGR"
FT   gene            complement(292383..294536)
FT                   /locus_tag="Amir_0270"
FT   CDS_pept        complement(292383..294536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0270"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34239"
FT                   /db_xref="GOA:C6WFA7"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA7"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACU34239.1"
FT                   /translation="MRLPTRPATAAPHPAARLRTTDADTSTSTSTATTNTGTSTSTGTG
FT                   TSTGTGTGTGTGTAVLRLPARLGASITRLLAGLGKSVPQAFVRLGGSITRLPDRLSTTV
FT                   LRLPDRLGVVVVWLRGLLGGSAARRGGSSTAVVLRPLGWPGAGMARLRGLLGGSAARRA
FT                   GSLGTIGLRLSALLGATALLLGTLAPVSAETVPRARFDQPWAGFAPVGTVLRAGAPERV
FT                   GVDPVPVERALGVVRGYTVGAAPLFPGAVTLMAHDGVVVGHEAVGWAVRYADGVSELPV
FT                   GERVPTALDTIFDLASISKLFTSIVVVRQAELGRVGIERPVAEYLPEFGVAGKGDITVR
FT                   QLLTHTSGLAAWLPLWSGWPDRDSRIKAVMDVAPARAPGTGYLYSDLNLITLGVLVERV
FT                   SGMPLDALVRETITEPLGLVDTGYNPPPEKLGRIAATEFQTSPPRGIVRGSVHDENAWS
FT                   LGGVAGHAGVFSTARELAVLGQAILNGGAYRGKRILSEESVTGMLTNLTPEFPGNSHGL
FT                   GFELDTRWYMGALSAPRTAGHTGFTGTTMVLDPASRSIALLLTNRVHPSRDRGSINPAR
FT                   RAVASGLAEALAVGPVRGRSAWRGDPGGTLTTKPLPDGPKVLRFSAFTDLDAGESVAVQ
FT                   EFDGSGWRDLRVLTGAGTRTWERVELPMTGTAARWVRSGVGANGARGGYVDAIEVVAGR
FT                   RVLLDGERGTGEVTASGWRAVDR"
FT   gene            complement(294549..295880)
FT                   /locus_tag="Amir_0271"
FT   CDS_pept        complement(294549..295880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34240"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA8"
FT                   /inference="protein motif:PFAM:PF07075"
FT                   /protein_id="ACU34240.1"
FT                   /translation="MERRRFLAAGAVGVGTAVFGGAASSGAGAEPGGAGAGGAGGFGPG
FT                   GVGPEDVGQGGTDQNAVVRTGAEQLAGRGWRELAGRRVGVLTNPTGVLVDQTHVVDSMV
FT                   AAGVSPVAVFGPEHGFRGTAQAGGSEGDYLDPRTNIPVYDAYGADATKLAGLLTKAGVE
FT                   HVVFDIADIGARFYTYIWSMYTAMQAAARVGARFTVLDRPNPVGGEAHGPQLDPAYATG
FT                   VGRKPIVQQHGMTVGELAGFFNAEFLPSDGGAVVDLRVVEVRGWRRSRLDTGLPWVPPS
FT                   PNVPTRDTALVYPGTCLFEGLVFSEGRGTTRPFETIGAPGLDWRWAEDLNARGLPGVRF
FT                   REAHFTPWFGKFANTACSGVALQVTDPGRFDAIRTAVEMIVVARSRYPAVFAWRPDNWI
FT                   DKLSGSDRLRRMVGAGAGADEVVGAWSAELSTFRTRRRRHLRYR"
FT   sig_peptide     complement(295791..295880)
FT                   /locus_tag="Amir_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.639 at
FT                   residue 30"
FT   gene            complement(295935..296138)
FT                   /locus_tag="Amir_0272"
FT   CDS_pept        complement(295935..296138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to mucin 17"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34241"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34241.1"
FT                   /translation="MLVSGLAGPVAPVSELARPVALVSGLAGPVVLVSELARPVALVNR
FT                   LVRPVVPVSELARPVSRGRWCW"
FT   gene            complement(296355..298097)
FT                   /locus_tag="Amir_0273"
FT   CDS_pept        complement(296355..298097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0273"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: bha:BH0675 beta-hexosamidase A precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34242"
FT                   /db_xref="GOA:C6WFB0"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB0"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ACU34242.1"
FT                   /translation="MHRLSRTLLTAAVVASSTAALPSAHAARPEPPAPQSVTSLVRGMS
FT                   LEEKVGQLFVTYVHGQSADEVHPGNLRDFGVDTPAQVVTRYRPGGVIYFNNSSYDNIDT
FT                   PAQIAALSNGLQQASRVPLTISTDQEMGIVTRIGPPLTQFPGSMALGAGRDERAAERAA
FT                   SVTARELRALGITQNFAPDADVNSNPANPVIGVRSFSSDPDLAATMVAAQVRGYQQRHL
FT                   SRTAVSAAAKHFPGHGDTADDSHTSLPTVDRTVEQWREVDAKPFRAAIAAGVDSIMTAH
FT                   IRMPAIDPSGEPATLSKPVVTGLLREELGYDGVVITDSLAMAGVRQLHTDAEIPVLALK
FT                   AGVDQLLMPVKLGEAIDAVVAAVRAGELSERRIDQSVLRVLRMKFLRGALPVWPVPPNP
FT                   VVGTPDRLAQAQEVADRAVTVVRDDAGVVRAGRVSGSVLVTGWGETTTAALAERLRARG
FT                   ATPQVVVTGSAPNEQQIAGAVSAAGGVGAVVVLTNALSRQPAQRALVDRLVASGKPVVA
FT                   VAVQNPYDVAHSNAQAWLATYSYGAVAMESVARVLSGEVRPVGRLPVDVPGPVAYPLGH
FT                   GLSW"
FT   sig_peptide     complement(298017..298097)
FT                   /locus_tag="Amir_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            complement(298682..299494)
FT                   /locus_tag="Amir_0274"
FT   CDS_pept        complement(298682..299494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0274"
FT                   /product="HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IB hydrolase,
FT                   TIGR01490; HAD-superfamily hydrolase, subfamily IB (PSPase-
FT                   like); KEGG: pap:PSPA7_0428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34243"
FT                   /db_xref="GOA:C6WFB1"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB1"
FT                   /inference="protein motif:TFAM:TIGR01490"
FT                   /protein_id="ACU34243.1"
FT                   /translation="MTDPAAEGTRVAAFFDLDKTVIAKSSTLAFSRPFFQEGLINRRAV
FT                   LKSAYAQFVFMLAGADDDQMDRMRSHITALCSGWDVEQVRSIVEETLHDIVDPLVYKEA
FT                   TQLISDHKAQGHDVVVVSASGEELVSPIAQMVGADLSVGTRMVTSSGRYSGEVDFYCAG
FT                   ENKAVMVKQLAAERGYDLERCHAYSDSVSDLPLLEAVGHPTAVNPDRGLRKAATQRGWP
FT                   VLAFTDPVSLRARISRPSGAAVAVTAIGLGATVAAGAAWYGLRRRRRS"
FT   gene            299900..301015
FT                   /locus_tag="Amir_0275"
FT   CDS_pept        299900..301015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0275"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_2914 Flp pilus assembly protein
FT                   ATPase CpaE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34244"
FT                   /db_xref="InterPro:IPR022521"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34244.1"
FT                   /translation="MVIMRPLCPRSPGTTVLHVGFDESGERDVGRSVVLVDGAELLDEV
FT                   LRLAAVAECELERVVDVTALRGRWHDAPVVLLDERAVVACAEAGLPRRPGVLLVSTGPP
FT                   GELTWPRAVELGVERAVSADAGLVALLRDATEVAPEAGRVLAVLGGRGGAGASVLAAAV
FT                   ARAVAASGGPSLLVDCDPLGGGLDLALGAETSAGMRWSDLDLSGRVPAAALRQVLPACG
FT                   GVRVLSCGRDGEGPGAGAVASVVEAGRRSGQVVVCDLPRQRTPAADAALDRADLAVLVV
FT                   PAEVRACAAARGVARRLAERGARTRALVRVRASGGLSAQEVAAAVGVPLLTRMRGQRQL
FT                   ASALDRGRFPTSTRGPLAKAATTVLEVLRAG"
FT   gene            301321..302439
FT                   /locus_tag="Amir_0276"
FT   CDS_pept        301321..302439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0276"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   bav:BAV2285 pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34245"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR022399"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB3"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACU34245.1"
FT                   /translation="MGADLVERVRRRLAEGRAELTPSAVAAAVRGEAGGVLGDEEVLRA
FT                   MSELGREFAGAGLLEPLLRAPGTTDVLVTAPDQVWVDGEDGLRRADVVFPDERAVRRLA
FT                   QRLAVAAGRRLDEAVPHVDGWLPGAVRLHAVLPPITRNTCLSLRVLRPATHDLAELRAR
FT                   GAFSAEVAEALRALVRSRTAFLVVGGTGSGKTTLLAALLGCVPHDQRVVCVEDAGELEP
FT                   DHPQVVRLVARAANVEGAGEVTVRDLVRQALRMRPDRIVVGEVRGAEVCDLLSALNTGH
FT                   EGGAGTLHANSPAEVPARLEALAALGGLDRVALHSQVLAALRAVLHVRRTPEGRRLVEI
FT                   GVFERAAGDLRVVPVWRHDTGWRNRALLESSR"
FT   gene            302579..303334
FT                   /locus_tag="Amir_0277"
FT   CDS_pept        302579..303334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0277"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   acp:A2cp1_3010 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34246"
FT                   /db_xref="GOA:C6WFB4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB4"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACU34246.1"
FT                   /translation="MSLLLFAAAVLLLPSTARGRLEALRGKRKPRVTFRPTTPLVVGAG
FT                   ALLGLLLGPAGAVSGAVLAAVLWRAHRVRAAHRADLLAADALAEGLRSFTTELRTGAHP
FT                   AGAALAAARDAAEPAATVLTAIATSTSRGGDVVSALAGTPAARLARAWRLADHHGVPLA
FT                   EVLDTARADLERRTAFTRTVHARMAGPRTSAAVLAALPVLGVLLGQLSGTSPLSILRDT
FT                   LPGQALLLVGVLLLVVGLRWSAGLTGSAA"
FT   sig_peptide     302579..302638
FT                   /locus_tag="Amir_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.552 at
FT                   residue 20"
FT   gene            303331..303888
FT                   /locus_tag="Amir_0278"
FT   CDS_pept        303331..303888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0278"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG: Hcn2;
FT                   hyperpolarization activated cyclic nucleotide-gated
FT                   potassium channel 2; K04955 hyperpolarization activated
FT                   cyclic nucleotide-gated potassium channel 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34247"
FT                   /db_xref="GOA:C6WFB5"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB5"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACU34247.1"
FT                   /translation="MSFLLLALAVLILPGGRSPCARLRPPVQPIAKPRRAKRSPPDPLA
FT                   LAETWDLFAAALRSGLPVPSALHAVLPGTPPGPAERLGQVRDLLALGADPATAWDPALD
FT                   HPATAPLARSARRTARSGAALADQVADLAARLRASAADDAESRAQRAAVLVAGPLSLCF
FT                   LPAFLCLGVAPVLIGIASGLNR"
FT   sig_peptide     303331..303396
FT                   /locus_tag="Amir_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.737) with cleavage site probability 0.599 at
FT                   residue 22"
FT   gene            303910..304065
FT                   /locus_tag="Amir_0279"
FT   CDS_pept        303910..304065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34248"
FT                   /db_xref="GOA:C6WFB6"
FT                   /db_xref="InterPro:IPR025338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34248.1"
FT                   /translation="MLDDRGVATLEYAFCALCAAAFAGVLYVVISQGWAANALKTILDR
FT                   ALAGAT"
FT   gene            304062..304478
FT                   /locus_tag="Amir_0280"
FT   CDS_pept        304062..304478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34249"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34249.1"
FT                   /translation="MRTRLNRVALDDRGSVTVELALTMLTALLVLACCAEGVLTVVDHL
FT                   RCTDAAREAARLIARGDPESEARAAVGRIAPKNATLTVTRGPDAATVEVAVSWIKARAY
FT                   AVLETADVGAANWSPGAYAPTDDHDPPDGIPPDG"
FT   gene            304605..304934
FT                   /locus_tag="Amir_0281"
FT   CDS_pept        304605..304934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_2535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34250"
FT                   /db_xref="GOA:C6WFB8"
FT                   /db_xref="InterPro:IPR021202"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34250.1"
FT                   /translation="MRLGDRGSASVLGAVLVVVLVSLAVLGVQFGAAVVVRHRVVAAAD
FT                   LAALAAAGRLLEGDGVACGWAERVVREMGAVLERCSVREWEVAVSVSGPANLFGTPVGR
FT                   ARAGP"
FT   sig_peptide     304605..304688
FT                   /locus_tag="Amir_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.962) with cleavage site probability 0.602 at
FT                   residue 28"
FT   gene            305305..305910
FT                   /locus_tag="Amir_0282"
FT   CDS_pept        305305..305910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0282"
FT                   /product="Bifunctional DNA primase/polymerase"
FT                   /note="PFAM: Bifunctional DNA primase/polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34251"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFB9"
FT                   /inference="protein motif:PFAM:PF09250"
FT                   /protein_id="ACU34251.1"
FT                   /translation="MEWSESWRGAFRIELRAEAVNLAWHGWPVLPGTYPSGDGWLGRDQ
FT                   VEASGPVPVHADWRERIGTLPEQVATWWTGGSYTILLATGHGVDAVEVNAELGKRAAVA
FT                   LRTAGAPAPIVATPDGRWMFLVRSGGVVREDLAARGVVHRTRGEHITLPPSPARHGVVH
FT                   WRVKPQVCGWQLPEPGTVLDAIGSALAVRHDGLVALES"
FT   gene            complement(306276..308699)
FT                   /locus_tag="Amir_0283"
FT   CDS_pept        complement(306276..308699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0283"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; KEGG: dvu:DVU0256 DEAD-box ATP
FT                   dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34252"
FT                   /db_xref="GOA:C6WFC0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR022307"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC0"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACU34252.1"
FT                   /translation="MANQGRRLLDRVLAGVPLGEAPLTHAEELPGQDAREVPWPSWAAP
FT                   EVVSALVERGVPAPWSHQAQAAELAWSGRDVVVATGTASGKSLAYQLPVLSALVAEGRA
FT                   TALYLSPTKALGADQIRAVEELAVPGVRAASFDGDTAMDERDWVRAHANWVFSNPDMLH
FT                   RGVLPNHARWIRFFRGLAYVVVDECHAYRGVFGSHVALLLRRLRRVARRYGADPVFVLA
FT                   SATVAEPAASAERLVGKPCAAVVEDGSPRAGRVVALWEPPLLSELEGENGAPVRRSAGA
FT                   ETARILADLVVEGARSLAFVRSRVGAELTAMGARRVLAEVDPELPGRVAAYRGGYLPEE
FT                   RRALERALASGDLLGVATTNALELGVDIAGLDAVVVAGFPGTLASFWQQAGRAGRSGGD
FT                   SLVVFVARDDPLDTYLAHHPEAVLRRPVEATVLDPSNPYVLAPHLACAAAELPLTEECL
FT                   AGFGEGAREVVDGLVADRVLRRRPNGGWYWTARERPQGQVDIRGSGGEQVVVVEGDTGR
FT                   VLGTVDPAAAHWTVHEGAVYLHQGESYVVDSLDLEAGIALVRAERPDWSTTARDTKDIV
FT                   VVRVEQERRFAGVRVCLGEVEVTSQVVSYLRKLPSGQVVDQVPLDLPAQVLRTRAVWYA
FT                   VDDSLLGSAPGGAGLAPATVPGALHAAEHAAIGLLPLFATCDRWDIGGVSTALHQDTGE
FT                   ATVFVHDGHPGGAGFADRGFAAVVPWLAAAREAISSCACPAGCPSCVQSPKCGNGNDPL
FT                   DKAGGAAVLDVVLRAVENPPSDAQPDRLGGSGGAGGSGAGGSGSGLAGEAGTAR"
FT   gene            308935..311295
FT                   /locus_tag="Amir_0284"
FT   CDS_pept        308935..311295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0284"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: xcb:XC_0853 membrane-bound proton-
FT                   translocating pyrophosphatase; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34253"
FT                   /db_xref="GOA:C6WFC1"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC1"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ACU34253.1"
FT                   /translation="MSRQFLAEGIELSGGDRGLVAAVAVVALAALVVGAVLLKEVLAAG
FT                   QGTAKMQDIAKAVQEGASAYLNRQFRTLGIFVVVVFALLFLLPAEDTGERIGRSLFFIV
FT                   GAVFSATIGYLGMWLSTRANVRVAAAAQAGQSGREKAMRVAFRTGGVVGMFTVGLGLFG
FT                   AAVVVLVYAGQAPRVLEGFGFGAALLAMFMRVGGGIFTKAADVGADLVGKVEQNIPEDD
FT                   PRNAATIADNVGDNVGDCAGMAADLFESYAVTLVASLILGTAAFGSQGLLFPLIVPAIG
FT                   VVTAVIGVYITGARPGESGLSAINRSFYISAVISAVLCTAAAFAFLPGTFAELGGVSAE
FT                   IAATEGNPAVIAAAAVLIGIVLAGVILWLTGYYTGTEHKPVQEVGRTSLTGAATVILSG
FT                   ISLGFESAVYTALVIGGAVYGAFLLSGSVIVALFAVALAGCGLLTTVGVIVAMDTFGPV
FT                   SDNAQGIAEMSGDVDGEGAQVLTELDAVGNTTKAITKGIAIATAVLAAAALFGSYKDAI
FT                   EKALVEVGGVFEAQDFVAFTPNVLVGLVIGAAVVFMFSGLAVNAVTRAAGAIVFEVRRQ
FT                   FRDNPGIMDGTTKPEYGRVVDICTRDSLRELATPGLLAVMAPIAVGFGLGVGPLAGYLA
FT                   GAIATGTLMAVFLANSGGAWDNAKKLVEDGHHGGKGSDAHAATVIGDTVGDPFKDTAGP
FT                   AINPLIKVMNLVSVLIAPAVVTFSVGADASAPVRYGIAVFAVGVVVAAVVVSKRRGTVI
FT                   GDEPADPPSGSPSVPAQATVTDPVQARATGGTA"
FT   gene            311416..312054
FT                   /locus_tag="Amir_0285"
FT   CDS_pept        311416..312054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0285"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34254"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34254.1"
FT                   /translation="MRARLVTAVAASALSACLLAGCTGQDSEPTPTTSSTSTSASPEQL
FT                   AADYLDKVCSATSAFATVQKTPPGADVTDPGKRKELMAVYMGQFGEAFTRSATELRAVG
FT                   ESPVAGGDQVVEKMAATFSEMATVFTDAKSAVEQADANDQYGGLAPARDALAKLADFSV
FT                   PLKEVESTPELAAAARKAPKCQALRTATPSPSATAGAPAVESSVPPSTS"
FT   sig_peptide     311416..311490
FT                   /locus_tag="Amir_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.356 at
FT                   residue 25"
FT   gene            312083..312202
FT                   /locus_tag="Amir_0286"
FT   CDS_pept        312083..312202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0286"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34255"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34255.1"
FT                   /translation="MTGSTPVFELADDPVLKPTPPDRAAVDRAPAERASVLEG"
FT   gene            312321..312962
FT                   /locus_tag="Amir_0287"
FT   CDS_pept        312321..312962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0287"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_1732 peptidase M23"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34256"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34256.1"
FT                   /translation="MKHHSAVGALLVAAVALSACSSGPTDPAASPSSGTSSSGASASAS
FT                   SSAAAAPSGDKVTAWVEAYCGLVGGYALGLKAYQEKHVQLPTTTDVAERNKAQLAAFTE
FT                   LVSGLQTDFKAAEGELGKVGVPLSGAEELHGEIIEVLGRVNGQLGQAKQQVAALDPHDP
FT                   DFAQAVSQAGGLEAASALLAHGEKVSGVPELEQAMNTAPKCVEIQRQIGG"
FT   sig_peptide     312321..312386
FT                   /locus_tag="Amir_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.487 at
FT                   residue 22"
FT   gene            313088..313771
FT                   /locus_tag="Amir_0288"
FT   CDS_pept        313088..313771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: YALI0D24365p"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34257"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34257.1"
FT                   /translation="MKFRVSLVGAALASAAVLSACSSGTAGTASPAGDAPATSSSASPA
FT                   PSGSASAVPTSASAKAGGGDNAKAVSWAGELCATFTGMVDRSLVMLEDVSSEMEKGNLD
FT                   GYRSAVLDYLAGTGTAMSGSLKRLNELGAPTASSAALHAEMVKFLEGVGAESGAAAKKM
FT                   RGLAVTDPAFVEQMGALDQGQGGSDVLLKHLENAEKDPELDLAFATAESCQEMESKLGQ
FT                   MPGSG"
FT   sig_peptide     313088..313174
FT                   /locus_tag="Amir_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.451 at
FT                   residue 29"
FT   gene            313913..314566
FT                   /locus_tag="Amir_0289"
FT   CDS_pept        313913..314566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0289"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mucin-associated surface protein (MASP)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34258"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34258.1"
FT                   /translation="MKRHLSVTSVLLSATLALAACDTNTDGAAPASSPAAASAAPASAQ
FT                   VDDGEREARWAASFCTTLGSRAKAAVELMQKMFAQAAEAGENVSEADMQAMQKDLLVEF
FT                   MEDGAKESLDAAKQLEGIGAPAVVGEEFHQKFITLLKTSGDEAAAAVEKVKALDPTSPT
FT                   FEAELDKLSEGGAAETLVAPLQEVGKSKPELNEVLKRTPECVDVVKQMSAIAGK"
FT   sig_peptide     313913..313975
FT                   /locus_tag="Amir_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.504 at
FT                   residue 21"
FT   gene            314696..315328
FT                   /locus_tag="Amir_0290"
FT   CDS_pept        314696..315328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_0780 branched-chain alpha-keto acid
FT                   dehydrogenase E2 component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34259.1"
FT                   /translation="MGQQLSFYSAEARRPGVDDLAGLLCGPGRVLGFARGRAARLTAVL
FT                   ADPWRGPALVAALAERGVQAESGAPEPVGDPEPPADGQEPGAQPPVQVRTPFRTDLAPL
FT                   AAHWLLAGAKVVPRGFTPHGGVLRLWALTSGRWVEPGYLLGLDPDAPDTHEPLRAALAS
FT                   AGLPAALLTPKSGGPALRVTGRRRLERLSELVGRAPTGVGDRTWPAA"
FT   gene            315457..318228
FT                   /locus_tag="Amir_0291"
FT   CDS_pept        315457..318228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0291"
FT                   /product="DNA topoisomerase I"
FT                   /EC_number="5.99.1.2"
FT                   /note="KEGG: bba:Bd0964 DNA topoisomerase I; TIGRFAM: DNA
FT                   topoisomerase I; PFAM: DNA topoisomerase type IA central
FT                   domain protein; TOPRIM domain protein; SMART: DNA
FT                   topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34260"
FT                   /db_xref="GOA:C6WFC8"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC8"
FT                   /inference="protein motif:TFAM:TIGR01051"
FT                   /protein_id="ACU34260.1"
FT                   /translation="MAGSTRTRKSTGGSAGGNRRLVIVESPTKARKIASYLGNGFVVES
FT                   SKGHIRDLPRGAADVPAKYKGQPWARLGVDVDHDFEPLYIVTPDKKSTVAELKELLKGV
FT                   DELYLATDGDREGEAIAWHLLETLKPSVPVRRMVFHEITEPAILAAAASPRDLDLSLVD
FT                   AQETRRILDRLYGYEVSPVLWKKVMPKLSAGRVQSVATRIVVERERERMKFVTASFWDV
FT                   SATIDAGAEATPRQFAGRLVSVDGTRLATGRDFGSDGRLKDGVEVKVLDEAHARAIAEG
FT                   LTGAAMRVASVEEKPYTRKPYPPFMTSTIQQEAGRKLRFSADRTMRAAQKLYENGYITY
FT                   MRTDSTALSETAITAARAQATDLYGAQYVAKEPRQYTRKVKNAQEAHEAIRPAGEVFRT
FT                   PGQVARELDSDEYKLYELIWQRTIASQMADARGNTTSVRVAGRTGGGEDVLFASSGRTI
FT                   TFAGFLKAYVETVDSEAGGNADDAESRLPQLVAEQPVSAAELSADGHSTSPPPRFTEPS
FT                   LIKTMEDLGIGRPSTYASIISTIQDRGYVWKKGSALVPSWVAFAVVGLLEQHFGRLVDY
FT                   DFTAALEDELDGIAEGRQERTTWLSGFYFGGDVGPESSIGRSGGLKKLVGSSVEEIDAR
FT                   EINSIPLFSDEGGHTVVVRVGRYGPYLEREVDGASQRANLPDDLPPDELSLEIAEKLFA
FT                   TPQEGRSLGNDPATGHEIVAKEGRFGPYVTEVLPEPAEGKKAGKPRTSSLFKSMSLDTV
FT                   TLEDALRLLSLPRVVGADPESGAEITAQNGRYGPYLKRGTDSRSLTSEDQLFTVTLDEA
FT                   LKIYAEPKKRGRAAAAPPLKELGNDPVSGKPMVVKEGRFGPYVTDGETNASLRKSDNVE
FT                   TLSDERGSELLAEKRAKGPSTKKKPAARTTKAAAKPAAKKPAAKKTPAKSKG"
FT   gene            318252..318821
FT                   /locus_tag="Amir_0292"
FT   CDS_pept        318252..318821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34261"
FT                   /db_xref="GOA:C6WFC9"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34261.1"
FT                   /translation="MDGGLFGPDGTQAPPPPAAFPDPLAGLVTGELPWALPAPEVRAAE
FT                   VRAAAPLAPPAAVTPQRAARPTGAGGRPQAGRARTGQRAPQAPRPAVPHPPVPYPPASY
FT                   PPVPHPTAPYPQVPHPQLQHPAPPRRQVPGLRAQRGPAAPAQPAEALAKGTGSTVVGIL
FT                   VVLGVIASILFTTLREVVGELLDLLR"
FT   gene            318901..321033
FT                   /locus_tag="Amir_0293"
FT   CDS_pept        318901..321033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0293"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1;
FT                   thymidylate kinase; KEGG: eli:ELI_06215 thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34262"
FT                   /db_xref="GOA:C6WFD0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFD0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34262.1"
FT                   /translation="MSTIQDSDTAGGPGRSGSNRTEASTGHRIRSVLAIRPFRRLWGVT
FT                   YLCSVGDWLSLLALTGLVTKLAEGYRWEGFALSAVVITQLLPGMLFAPLGGVLADRFDR
FT                   RKVMVACDLARGALFLSIAFVGTAWWLFIANFLIGCCAMLWIPAKDSAVPNLLRRPDQV
FT                   ETANQLGLVMTYGITTISGFGLYALISGIPGYFHLQGGDLSFRIATIAVVVNGLLYVSS
FT                   AVLVATRIPELSGRMATPRKRDDDAPGFLVMMRDGLSYAWHRPLLRGLVIGMTGAFAAA
FT                   GAVIGSAKLYALSLLGGESAYGLLFIAVFAGLATGMITAPKLARRLTHGRLFGVTIVCA
FT                   GLSLGVVSLAPHLWFALVAVALVGGCAGIAFLTGLTIIGSKVEDEVRGRMVALVQSLMK
FT                   VILGLSTVASPLLVTTLQPRVITVLDHPLKIDGTRPVLFGAGVLAAAVGLIAYRLMDDR
FT                   RETPILSDLLAALRGRPRRERGLLITVEGDASLDTSVQARELAEVLRSAGHEVLLASEP
FT                   DLDERRVHELLNTADLAGVRAHALVAAAVRADVVERRVRPALEAGLIVVVDRFADSPIA
FT                   HFSASGSVDTSELERLSDWATGRLRPDLTVLLDRTPTTLPASALGAPPGAVPAGTAPPG
FT                   AASAGLEGARRTITHVEHHWQVQRLLTGMAAADPDRYLVVDADGTPDEVAARVKAAVAR
FT                   LVGGEIRAAAPLAETP"
FT   gene            321047..322246
FT                   /locus_tag="Amir_0294"
FT   CDS_pept        321047..322246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0294"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dal:Dalk_0024 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34263"
FT                   /db_xref="GOA:C6WFD1"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WFD1"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ACU34263.1"
FT                   /translation="MPRGVWSEVVGQPDAVTVLSAAAEAAAAIVAGGTPAPGAMTHAWL
FT                   FTGPPGSGRTEAARAFAGALQCTAADDRPGCGVCAGCHTALAGTHADVRVVAPEGLSIS
FT                   VNEMRALVQVSARRPTSGRWQVVIVADADRLTEGASNALLKAVEEPPDRTVFLLCAPSE
FT                   HPYDVSVTIRSRCRVVRLGSPKVPDVAAALEEEGVAPDLASWSASVTGGNVVRARRLAT
FT                   DEQSRLRRESVLAIPLALRRPADVFTCADDLVKAAEGDALSANEDRDEQERKALETAMG
FT                   AGGTGKGTASATRGAKGALKDLEKRQKSRATRTQRDSLDQALVDLAAFYRDVLVTATGS
FT                   EAALNHPDRAADARTAAAAWSRESTLRRLEAVLACRGALERNVKPRIAVEAMLTTLQRG
FT                   "
FT   gene            322589..322662
FT                   /locus_tag="Amir_R0016"
FT                   /note="tRNA-Thr1"
FT   tRNA            322589..322662
FT                   /locus_tag="Amir_R0016"
FT                   /product="tRNA-Thr"
FT   gene            322756..323649
FT                   /locus_tag="Amir_0295"
FT   CDS_pept        322756..323649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0295"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   dal:Dalk_4823 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34264"
FT                   /db_xref="GOA:C6WGE8"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGE8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACU34264.1"
FT                   /translation="MRRPDTTDAVVDVAPSRRTVRRPRSVSVVVTAHGLEPTAGVVVED
FT                   ALRGLEELGVPGEVVVVVGRADRTAQVALTAGASVVESRPGRGAAVLAGVAASRGDVVC
FT                   LLDGDVRYFGDPPLVPLLVEPILGGLADACVSDLYWRPPHPRLWLHGFFAPLIGRVYPE
FT                   LLPRAGSTPWSGQRAALRALWPAELPDGATADLALLLHWNREAALLRPVLADDWTAPGR
FT                   PRLEPSRADLDLVVADALAHGRIDETGAKALPDWFEAVQSGAGERWGDVVDPVDFAAAE
FT                   RDVLEEALRELRAHGL"
FT   gene            complement(323703..325736)
FT                   /locus_tag="Amir_0296"
FT   CDS_pept        complement(323703..325736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0296"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; ABC-3
FT                   protein; KEGG: bcb:BCB4264_A4637 iron compound ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34265"
FT                   /db_xref="GOA:C6WGE9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGE9"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACU34265.1"
FT                   /translation="MLRTAAVVAGAVAAIVLLSAVHLTQGTSDTGALDLLSAVLGDGNA
FT                   QAMAVLEGSRLPRLLTALLVGVALGVAGAGMQSIARNPLASPDTLAVNSGAHLAVVSFA
FT                   AFGIGLPAYAAGGAAFVGGLAATALVLALSGGASTSPRLVLVGSAVGLTLYSATTLVLL
FT                   LFEQETTGLYAWGSGSLSVGDLRTTSQMAPVVLVGVVGLVLMSRSLDVLALGDDNAAVV
FT                   GLKVRRTRLGAVLLTVALTAAAVTAAGPVGFVGLSAPVITRLLAARVPGLARHRALLPV
FT                   SGLVGVLVVLGADVLLRALLGASEAVRVPTGVMTTVLGASVLVWLARGQRSGGSRRQPP
FT                   SGRVGVVGSRRRLVAVSVVLAALVVAAPLVGLLMGDRVVLLGDLGNWVTGRTGPALTFV
FT                   LDQRLPRVLAAVVAGAALAVAGCGVQSVSRNPLAEPGLLGITAGAGLGAIGLITLVPGA
FT                   GPWQIAGAAGFGALVAFALVYGLSWRGGQDSDRLVIIGIALWSAGMSLITLLVATTDPW
FT                   NTVKALTWLSGSTYGRTLEQVLPPALALAAIGPLLWFAHRDLDLHSLDDDTPRVLGVPV
FT                   ERSRLLLLLGSGVLAASAVAAIGVVGFVGLVAPHLARSLVGGRNARVLPVAAGLGAVLV
FT                   SLADTIGRTVISPAQIPAGLVISLVGTPYFVLVLWRSRERRT"
FT   sig_peptide     complement(325665..325736)
FT                   /locus_tag="Amir_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.988) with cleavage site probability 0.334 at
FT                   residue 24"
FT   gene            complement(325736..326707)
FT                   /locus_tag="Amir_0297"
FT   CDS_pept        complement(325736..326707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0297"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bcb:BCB4264_A4636 iron compound ABC transporter, iron
FT                   compound-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34266"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF0"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACU34266.1"
FT                   /translation="MRLLTPALLAAAVLLSACGTTESTSSEPSASGDAGGAITLTDARG
FT                   KTVELKAPAKKVVSLEWAETEMVLTLGVTPVGAADPEGYATWNAAEALPGDVKDVGKRG
FT                   EPSVDAIVALEPDLVLMPLARDTAVAEQLEKAVPVVMTKSSDATKNFDRLREDFTLIAK
FT                   AVGKEAEAKTALAEMDAKLAEGKKAVEAKGATGTPFVMADGWMQGSTVSIRPFGKGSLV
FT                   SDTAEAVGLVNAWTGEVDAEWGLGATDVEGMTAITDPKTIMVYSASEEDVFTTGLKDNA
FT                   VWQRLPFTASGKITKLEKGTWTFGGPKSVAVIADQFVKAATS"
FT   sig_peptide     complement(326630..326707)
FT                   /locus_tag="Amir_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.379 at
FT                   residue 26"
FT   gene            complement(326738..327556)
FT                   /locus_tag="Amir_0298"
FT   CDS_pept        complement(326738..327556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0298"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ent:Ent638_1120 iron-enterobactin transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34267"
FT                   /db_xref="GOA:C6WGF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34267.1"
FT                   /translation="MSQGDALLTGEALVLAHHDRAVVEGVSLELRAGEVTALVGPNGSG
FT                   KSTVLRSLARLHKPREGGVRLGERQVWGRAALSGKEFARNVTLLTQHRPTPSGVSVRDV
FT                   VSYGRHPHRAGWRGVDAGGAAAVERAMELTGVTPMAGRGVDELSGGELQRVWLASCLAQ
FT                   ETSVLLLDEPTNHLDLRYQVEVLDVVRDLADDHGVAVGVVLHDLDHAGVVADEVVLLCD
FT                   GRVVASGAVRDVLTADHLTSAYGVEVQVVDDPVTGAPHCRPLGKRTQRRP"
FT   gene            328007..328162
FT                   /locus_tag="Amir_0299"
FT   CDS_pept        328007..328162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34268"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34268.1"
FT                   /translation="MLAMVVVTLLALPLVFVAQRIGRRRWNRRVDVARVPESALFPHRV
FT                   PSLSRT"
FT   gene            complement(328149..329243)
FT                   /locus_tag="Amir_0300"
FT   CDS_pept        complement(328149..329243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0300"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   swi:Swit_1615 coenzyme F420-dependent N5 N10- methylene
FT                   tetrahydromethanopterin reductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34269"
FT                   /db_xref="GOA:C6WGF3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019919"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF3"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU34269.1"
FT                   /translation="MTPAVGSGVRGSSEPTAVLSPSPTSRPDPAADWTWPPHPRTTGPV
FT                   LVDQVEVEYTPTTVVEAARAAEEAGIDGFWVAETRHDPFVALGRVADRVERVGLGTAIA
FT                   VAFARNPMSTAVQANDLQLLSRGRFRLGLGSQVEQHITKRFGMPWSRPAARMREYVLAM
FT                   RAIWESWATGERPRFRGEFSTHTLMTPFFDPGPNPFGPPEVWLAGVGERMTEVAGEVAD
FT                   GFLCHAFTTERYLREVTLPALERGLAKSGRTLEGFGVSGPSMVVTDDASAAAVRRQIAF
FT                   YGSTPAYRPVLDLHGWGELHEELHRLSRRGLWAEMDAAVPDEVLGAFAVTGTPAEAAAE
FT                   VVARYGDVVTRIAAPVLRADLRSG"
FT   gene            complement(329240..329704)
FT                   /locus_tag="Amir_0301"
FT   CDS_pept        complement(329240..329704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0301"
FT                   /product="Excalibur domain protein"
FT                   /note="PFAM: Excalibur domain protein; KEGG: GE20613 gene
FT                   product from transcript GE20613- RA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34270"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF4"
FT                   /inference="protein motif:PFAM:PF05901"
FT                   /protein_id="ACU34270.1"
FT                   /translation="MRSESNTRLSAPAPGRGGKVVCGFLVVLTALVLAGCEGSAPAGGQ
FT                   VSTSPSPTTTTTSATTTTSSPAPVTTTSTTTTTTTPPPAVAPPPQPNPQPAPNPQPAPN
FT                   PQPAPEPKPAPSAYYKNCAEARAAGAAPLHAGEPGYRTGLDRDGDGVACE"
FT   gene            complement(329694..330653)
FT                   /locus_tag="Amir_0302"
FT   CDS_pept        complement(329694..330653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0302"
FT                   /product="Excalibur domain protein"
FT                   /note="PFAM: Excalibur domain protein; KEGG: sal:Sala_0134
FT                   excalibur"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34271"
FT                   /db_xref="GOA:C6WGF5"
FT                   /db_xref="InterPro:IPR008613"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF5"
FT                   /inference="protein motif:PFAM:PF05901"
FT                   /protein_id="ACU34271.1"
FT                   /translation="MSANHGNDQNGGAPGYGVPDDNAGYGTPGYGVPGYGAPDYGYGPQ
FT                   ATAYTPPPQAKSGLKGKWSAMSRMKKTGTVAGGIFVALILIGALGDPPPADSTRAAATA
FT                   SATATTTSTTTTTTTAPTTTTPPPVTVAEVADGRSVAVAGGRVLVLAGLAQPGECWAQQ
FT                   AVDFLKSTVAGKELAQVGGQLLLPDGSDVSLLALSQGVAKALPEASAAHNAAQAAAQKA
FT                   GLGLWGAPCGGSDAKPAPTTTTQAPAPQPNPQPNPQPQPNPQPNPQPAPQPEPQPAPSA
FT                   YYANCAAVKAAGAAPLYAGSPGYSSKLDRDGDGVACEK"
FT   gene            complement(330650..331321)
FT                   /locus_tag="Amir_0303"
FT   CDS_pept        complement(330650..331321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0303"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); SMART:
FT                   nuclease (SNase domain protein); KEGG: mno:Mnod_4939
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34272"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF6"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ACU34272.1"
FT                   /translation="MESTALVRRTPLRLLLLVPALLLTACAAQPLAAPAVPAPAAEDAA
FT                   PDAAERWDRSGAWSTPSPAQPDPADLAPARASGVVDARTIAVAGGGSVRLLGLAEPGAC
FT                   WSRAAADFLGSLVAQKDLALDGASVRLPGGTDLSAQLVSQGMARAEPDAASTLTRAEAA
FT                   ARKAGLGLWGAPCGGSDSVVTTPAPTTRALARCTANTSTTPAGLPGSPVLDHDTDGVAC
FT                   A"
FT   sig_peptide     complement(331223..331321)
FT                   /locus_tag="Amir_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.938 at
FT                   residue 33"
FT   gene            complement(331443..331889)
FT                   /locus_tag="Amir_0304"
FT   CDS_pept        complement(331443..331889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c1913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34273"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34273.1"
FT                   /translation="MDPSLVADAMRKSVPWVQTNGVEFTEVGVDRVVAALPDRPESRNH
FT                   VGGPHAAMLFGVGETASGAVVMAAFGGHLDRATPLVARAEIAYRKLALGPLTAEAVLER
FT                   PAADVVAELEGGQRPEFPVRVSVRDAEGVVTTELVVTWTLKPQR"
FT   gene            332019..332537
FT                   /locus_tag="Amir_0305"
FT   CDS_pept        332019..332537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0305"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: atc:AGR_C_1531 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34274"
FT                   /db_xref="GOA:C6WGF8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34274.1"
FT                   /translation="MTTPEDAHGGGRSDEALADRFGTALVRLNKMHAALSASLSKAGID
FT                   KASFVLLANLAQMGPSRASALAEAVFSDPSTVSRQVAGLVKDGLVERRADPDDGRASVL
FT                   AVTDNGLSLLHERRRVRNAALARLFSDWSTHDWTTFVEHFERFVEGYEKALPDFIAEGG
FT                   QGPRSEGEK"
FT   gene            332537..334204
FT                   /locus_tag="Amir_0306"
FT   CDS_pept        332537..334204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0306"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ppg:PputGB1_3285 EmrB/QacA family drug resistance
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34275"
FT                   /db_xref="GOA:C6WGF9"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGF9"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACU34275.1"
FT                   /translation="MSETTTQAGATPPGAALLTHRQILTILSGLLMGMFLAALDQMIVA
FT                   TAMKTIADHLNGQTIQAWATTAYLITSTITTPLYGKLSDIYGRKPMYLTAISMFLVGSL
FT                   LCGIANSMYELAAFRAVQGLGAGGLMSLAFAILADITSPRERSRYAGYFMAVFGVASVA
FT                   GPVVGGLFAGMDHFLGFAGWRWVFLVNVPIALAALAVVAKVLNIPHQRVDHRVDFLGAI
FT                   TLTVGLVPLLIVAEQGREWGWGSATAIAMYVVGVLGLVAFVWAEKRAGDEALLPLRLFR
FT                   KQTFALGNTINFVLGAGMFGGMVSIPLYLQIVQGHSATTAGLMMLPMTLGIMTAAGTSG
FT                   KITSKTGRYKVFPVVGFAVMTASLFLFSTVGVDTATWQPMALMFTMGLGLGLCMQTLLI
FT                   AIQNDAEPRDMGVATSSATFFRQIGGTVGAAVFLSVLFSTVGDKIGEALRSAMGTDAFR
FT                   AALARPENQAFAQQLQSGGASADLNNTEFLSKLDPVLARPFLEGFSSAIDTVFFVGALV
FT                   TLVGFAIVWFLREVPLSDRSGLERSKDEADAASTIALH"
FT   gene            complement(334313..334816)
FT                   /locus_tag="Amir_0307"
FT   CDS_pept        complement(334313..334816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0307"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: gdi:GDI3491
FT                   inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34276"
FT                   /db_xref="GOA:C6WGG0"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG0"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ACU34276.1"
FT                   /translation="MEFDVTIEIPKGVRNKYEMDHKTGRIRLDRTLFTATQYPADYGFV
FT                   DDTLGEDGDPLDALVLVQEPTFPGCLIRCRAIGMFRMTDEKGGDDKLLCVPSDDPRSEH
FT                   LRDIHHLSEFYRLEIQHFFEVYKDLEPGKSVEGATWVGRTEAEAEIVRSYQRLKDAVAR
FT                   GEEH"
FT   gene            334943..337993
FT                   /locus_tag="Amir_0308"
FT   CDS_pept        334943..337993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0308"
FT                   /product="D-alanyl-D-alaninecarboxypeptidase/D-alanyl-D-al
FT                   anine-endopeptidase"
FT                   /note="TIGRFAM: D-alanyl-D-alanine carboxypeptidase/D-
FT                   alanyl-D-alanine-endopeptidase; PFAM: peptidase S13
FT                   D-Ala-D-Ala carboxypeptidase C; KEGG: bpm:BURPS1710b_1102
FT                   putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34277"
FT                   /db_xref="GOA:C6WGG1"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG1"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ACU34277.1"
FT                   /translation="MPEEPSWPTVDGDDTDREQVRSPRPADPPTMRIALPKKSGGAEKT
FT                   ELIKIDRLRPPGGPTPRTDLPEAGGESGADAAAAAQQPSGAQRGTAAEQGATPAGPDGD
FT                   EITRPAGASQAETARPGDEDNRSGGQAGAGGAGAGGAGAAALAAGAAALAAGAAGAQAS
FT                   GAQGGGAQSGGGQAGGGPAGGGKSGPQQSNAPQSGGGQQSGGQQTGDGQQTGGAPSGST
FT                   PPGGVPAPGMASGAPAGGFPAPGTPAGGFPAPGTPAGGFPAPGGLLGGEPTRFDPPKSA
FT                   PLPEAGWPGTRAEVPSFDPARADAQLAAQRAAANRAQNSGRPESGQQQAPGQQGPGQQA
FT                   GGQQAPGQQGAGQQSPGQQGAGQQGPHQQGIGQQGPGQQGPGHLGAGQQGPGNQAGGQQ
FT                   GPGRQGQGGHGSGPHGTIPPGAIPPGSGQAGAGTGGFGQQGPGRQGPGSQGIRHQGGQS
FT                   ASEQTQKVSVTPGQFTFPPPGQQPGGEQHRAAPPGTIPPGANQSGTIPPGANQSGTIPP
FT                   GANQPGVADHPGSSADRRDDDAAFAAFAADSDERADVPAQRSKRKRPLVVVGALAAVLV
FT                   LFGGAALAAVQLGWLETGPTSTTQPPAPPAQVDLAVRALGPDAPAPTPAGVQAVLQGPL
FT                   ANGALGNLTGTVIDPASKTVLWHQGETTPLVPASTVKNLVAAAALLQLDHTTQFTTKVV
FT                   QGAEPGTVVLVGGGDPTLSSLPEGRSSVYPGAPTLDELVEQVKASGPITEVEYDISRYS
FT                   AEPGLAPGVDPNDVAAGFITNIGPLMLDGARSDPTKGDTPRTATPAPDAAKALADRLGA
FT                   TVGGKTLAPQAAKVLGEVKSVPLDQLIENMMQLSDNVLAETLAREVAKARNAETSYEGA
FT                   TKAVRDVLTENGFDLTGVITSDASGMSVQNKVPAKLLGDLLTAAARPDAATDPVTTRLR
FT                   PLLTALAVAGGNGTLKERFAQSPAGKGWIRGKTGTLTEVHSLAGVVVDTDGRLLVFAFM
FT                   SNGSGDALGARAGLDALAAQLRGCGCS"
FT   gene            338032..339045
FT                   /locus_tag="Amir_0309"
FT   CDS_pept        338032..339045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0309"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34278"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG2"
FT                   /inference="protein motif:COG:COG5282"
FT                   /protein_id="ACU34278.1"
FT                   /translation="MTQQDRAASIDWEVAVSTAARLVRPGPVVPRAEADVAVGRLRELA
FT                   VDAEAHVRELTGLGHGLPLRAGEVVDRPGWVRAAAQGLSVLTDSAAPRQGGVLSGVVSG
FT                   TAGVQAGVVLAFLSSRVLGQYDPFSGDGRLLLVAPNIVGTQRALNVPGEDFSMWVCLHE
FT                   CTHRLQFTGVPWLAGHFSGLVTELLESMDNESPRLRDLPKRLREADGPVGLIELFQTPE
FT                   QRAALDRLIAVSTLLEGHADHVMDAVGPDVVPSVAVIRRRFTDRRSGGGLLDRVLRSLL
FT                   GVEAKVRQYAEGAAFTRHVVDEVGMTGFNAVWSAPEALPTRAEIADPAAWLRRVAP"
FT   gene            339042..339968
FT                   /locus_tag="Amir_0310"
FT   CDS_pept        339042..339968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0310"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: ade:Adeh_1494
FT                   tRNA(Ile)-lysidine synthetase- like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34279"
FT                   /db_xref="GOA:C6WGG3"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG3"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ACU34279.1"
FT                   /translation="MTPAANGPLSRVRTAVRRFLAEHRPARVAVAVSGGADSLALAACT
FT                   AALTSGARAVVVDHGLQEGSAEVAERAARTCAELGLDAQVRRVEVTGGGGPEAAARRAR
FT                   YAALRPERGLVLLGHTLDDQAETVLLGLGRGSGPRSIAGMRELDAPWGRPLLGVSRADT
FT                   EGACAELGLSPWSDPHNADPAFTRVRLRREVLPLLEEVLQGGVARALARTAAQLREDND
FT                   ALDDLADAFAGDRGAVADLAPLPVALRRRVLRRWLLAEGVPELSDSHLRAVDALVRTGA
FT                   GGGGVWVPGGFVVRRARGRLRVDPVQA"
FT   gene            339985..340533
FT                   /locus_tag="Amir_0311"
FT   CDS_pept        339985..340533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0311"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: spe:Spro_3998 hypoxanthine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34280"
FT                   /db_xref="GOA:C6WGG4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG4"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ACU34280.1"
FT                   /translation="MYDGDIASVLLSEQEISDKVGELARQVAADYPAGGDDLVLITVLK
FT                   GAVMFTSDLARALPVPVQLEFMAVSSYGSSTSSSGVVRILKDLDRDIADRDVLIVEDII
FT                   DSGLTLSWLLKNLASRKPRSMEVCTLLRKPDAVKVDVPVKYVGFDIPNEFVVGYGLDYA
FT                   ERYRDLPYIGKLDPKVYSG"
FT   gene            complement(340597..342291)
FT                   /locus_tag="Amir_0312"
FT   CDS_pept        complement(340597..342291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0312"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: dac:Daci_0766 von
FT                   Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34281"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG5"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACU34281.1"
FT                   /translation="MSARSERPGRARRIALPLGALVGVLAAGATAVVALKATSGPDCTG
FT                   TLPLKVATTPAAEAVVRGAADDYQATQPVVDGRCVQVQVEARTAADVAHELPTARINPP
FT                   VMWVPDSTMWAEEAQRQSASLGAEAPALEVGEPLAGSPLVIAGPAEKLRGLGWPSTSVA
FT                   WASVLAPGVEAAVSDPTTSTEGLATLAVIRARLGNADGTPNQELIGSLMRIGRNAVTVR
FT                   DSFNRVGQDEGSAPLFTASEQAVLAANRAAGGLRVAASYPAEGTMLLDYPVVRIKRASD
FT                   QPGTGVAASGFEQALRSAKTRERFVDAGFRTPDGQAAAGLSAERDGVGGDAVNAMPKPS
FT                   PAEVSELLGTWGAVSLDSRMLAVLDVSGSMTELMGNGQTRMAAASEAALTALGMLPDTS
FT                   EIGLWAFSTNKRPPNDWVELVPLGPLGEVLGSAPRRTRLQQGAKGLAALVGGGTALNDT
FT                   TLAAFRRMQSTYDPEKINSVVLITDGRNDDYASITTAQLLQALESESDPARPIPLIMVG
FT                   LGQEADMEALQEISSATGGKAYQALEAADIRSVLLDAISQRRCRPNC"
FT   sig_peptide     complement(342196..342291)
FT                   /locus_tag="Amir_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.471 at
FT                   residue 32"
FT   gene            342757..344988
FT                   /locus_tag="Amir_0313"
FT   CDS_pept        342757..344988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0313"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: bcy:Bcer98_0060 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; peptidase M41 FtsH extracellular; AAA ATPase
FT                   central domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34282"
FT                   /db_xref="GOA:C6WGG6"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG6"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ACU34282.1"
FT                   /translation="MDRKRLLRNPLLWIVAVVLLFYVFSVLFDEDRNYHQVTTSQALQQ
FT                   VRDGKVKEATIEDKEQKLKLVLNDGSTFENHGLLMASYPASATDEVFTLVDQAGNKPQV
FT                   ETKVTQDSLLTQMLLYLVPLGLLLLLLMWMMNNAQGGGNRVLNFGKSKAKQLSKDMPKT
FT                   TFADVAGAEEAVEELYEIKDFLQNPGRYQALGAKIPKGVLLYGPPGTGKTLLARAVAGE
FT                   AGVPFYSISGSDFVEMFVGVGASRVRDLFEQAKQNAPCIIFVDEIDAVGRHRGAGMGGG
FT                   HDEREQTLNQLLVEMDGFDSRGGIILIAATNRPDILDPALLRPGRFDRQIPVSAPDLKG
FT                   RKQILRVHAKGKPLAPDTDLDGLAKRTVGFSGADLANVINEAALLTARQNGTVIDGSAL
FT                   EESVDRVIGGPARKSRIISEKEKKITAYHEAGHALAAWAMPDIDPVYKVTILARGRTGG
FT                   HTLSVPEEDKDLMTRSEMIARLVFALGGRSAEELVFHEPTTGASNDIEQATKIARAMVT
FT                   EYGMSSRLGAVKYGQEQGEPFLGRNAGRQADYSLEVAHEIDEEVRKLIEAAHTEAYEVL
FT                   NTYRDVLDDLTLELIDKETLHQKDLERIFAGVEKRPRITQFNDFGNRIPSTKPPVKTPG
FT                   ELARERGEPWPPVVEDQVEAEPAALPAPAPETPQGPAQPQQVPAGANGVQHPPQQVTPG
FT                   SGPPNYGAPPGWTPATVPGSGGQPTTPAWRPDPADADKRNFDSDPDNRK"
FT   sig_peptide     342757..342834
FT                   /locus_tag="Amir_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.751) with cleavage site probability 0.668 at
FT                   residue 26"
FT   gene            344985..345614
FT                   /locus_tag="Amir_0314"
FT   CDS_pept        344985..345614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0314"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="KEGG: bha:BH1646 GTP cyclohydrolase I; TIGRFAM: GTP
FT                   cyclohydrolase I; PFAM: GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34283"
FT                   /db_xref="GOA:C6WGG7"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG7"
FT                   /inference="protein motif:TFAM:TIGR00063"
FT                   /protein_id="ACU34283.1"
FT                   /translation="MIEFDNAGLPSNGEAGVAAKRPFDQERAEAAVRELLLACGEDPER
FT                   EGLRETPARVARAYREMFAGLFTEPDGVLAKTFDESHEELVLVTEIPVYSFCEHHLLPF
FT                   HGVAHVGYIPNEQGRVTGLSKLARLVDLYAKRPQVQERLTSQVADALVRRLEPRGVIVV
FT                   VEAEHLCMGMRGVRKPGSRTTTSAVRGLLRTSASSRAEAISLIKGR"
FT   gene            345653..346438
FT                   /locus_tag="Amir_0315"
FT   CDS_pept        345653..346438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0315"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: afw:Anae109_2337 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34284"
FT                   /db_xref="GOA:C6WGG8"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG8"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ACU34284.1"
FT                   /translation="MGVLNVTADSFSDGGRYLGLADAVAHGLALRDQGAHLVDVGGEST
FT                   RPGAERVPSDLEVARTSHVIAALSAQGVVTSVDTTRSEVAVAALEAGVSVVNDVSGGLA
FT                   DPDMLRVVAEADVPYVVMHWRGHSAGMDRLAEYSDVVREVRDELSARVDAALAAGVRAE
FT                   NVVVDPGLGFAKRAEHNWQLLNRLDELIDLGFPVLVGASRKRFLGALLGERPPAGREDA
FT                   TAAVSALAAFNGAWGVRVHDVPRSVDAVAVAGAWRAGRG"
FT   gene            346431..346808
FT                   /locus_tag="Amir_0316"
FT   CDS_pept        346431..346808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0316"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; PFAM:
FT                   dihydroneopterin aldolase; KEGG: oca:OCAR_6643
FT                   dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34285"
FT                   /db_xref="GOA:C6WGG9"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGG9"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ACU34285.1"
FT                   /translation="MAEATGSGDRIELRGLTVRAHHGVFEHEKRDGQDFLVDVVVWLDL
FT                   TRAAATDDLRETLHYGELAERVAEVVAGGPHDLIETVAGRAADVVMADGRVTATEVTVH
FT                   KPHAPIPLIFADVAVTVRRTR"
FT   gene            346805..347281
FT                   /locus_tag="Amir_0317"
FT   CDS_pept        346805..347281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0317"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridin
FT                   epyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: mex:Mext_1812 2-amino-4-hydroxy-6-
FT                   hydroxymethyldihydropteridine pyrophosphokinase;
FT                   TIGRFAM:2-amino-4-hydroxy-6-hydroxymethyldihydropter
FT                   idinepyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin- pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34286"
FT                   /db_xref="GOA:C6WGH0"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH0"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ACU34286.1"
FT                   /translation="MSRAVLSLGSNLGDRLAHLRSAVDGFRPWLLAASPVYETAPWGVT
FT                   DQDDFLNAVLLVEGDLDEWGWLRRGQELERAAGRVRERRWGPRTLDVDVVAVDDVRSED
FT                   PELLLPHPGAHERATVLAPWLDVDPDAVLPGHGRVADLLSGVDLSGVRRLEVAL"
FT   gene            347278..347730
FT                   /locus_tag="Amir_0318"
FT   CDS_pept        347278..347730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0318"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_2860 cytochrome c oxidase subunit
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34287"
FT                   /db_xref="GOA:C6WGH1"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34287.1"
FT                   /translation="MTFTKGRDLLAAGLGSAALVFLLLKLSYSGLPPLPRLAGLVLLVI
FT                   AAIDLGLAVSLRARILRKPGAEPVQPLTAARAVALAKASSVLGAIMAGAWGAVLLHVAP
FT                   ARGRFPAADNDLTSAVVGLVCAAALTASGLWLERCCRTPDEPERRA"
FT   gene            347781..349451
FT                   /locus_tag="Amir_0319"
FT   CDS_pept        347781..349451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0319"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_2162 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34288"
FT                   /db_xref="GOA:C6WGH2"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34288.1"
FT                   /translation="MTGRAPSRDDEQQEHGRGSARLLLVAALAFALVAAAVLVLSDNAR
FT                   WLRLAVVSALWAALVGAFLAARYRRQVADREDEVADLQNVYELELEREVAARREFELEL
FT                   ETEAHRKAQEDAKDDLDALRGELRALRENLEALLGGEVLVERVALRAEATRMRSLGDQS
FT                   RLDQSRLVSAMNEHRVITSGKAKKDDQPSVVDLDPAEQTELIERVTDAQPARRVEPVRR
FT                   EAARAEPVRRDPVRSGTRPPQPKSAAPAAPKQAVQPPGVKRAQPKAEPQRPAAQAKPAA
FT                   AQAAPTAQVAHPAKQQQPRPAEGTAQDYFTDQSARGGAAASRGQGEPVKTAESQRRSRI
FT                   AERTEMISRDSVAEERPARPAAGGLTASEQSGVRRSVAGGRPAAAEQGAQQARRPAAAT
FT                   GRTASEQSGVRRGVAGGRSASEQSGVRRPAAAAGRSASEQSAVRRPVAGGLSASEQAGG
FT                   VRRAVAGGRSASEQSTTRRPVADEATPHAPQPEQPEQAAGGRRRADPRDEAPQPAAGRR
FT                   AAPEPDPAAGAHADGKSVSELLAAFGGGDSPRRRRRRED"
FT   gene            complement(349936..351012)
FT                   /locus_tag="Amir_0320"
FT   CDS_pept        complement(349936..351012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0320"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   KEGG: bcz:BCZK4997 NADH dehydrogenase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34289"
FT                   /db_xref="GOA:C6WGH3"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH3"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACU34289.1"
FT                   /translation="MQITVGVGAGAKHLGVDRVVDLGPLHPSAHGAYRLRLTVRDDEVI
FT                   TSAEPLVGHLHRGAEKLFEVRDYRQVLTLANRHDWLAAFCNELAVALAVERMTGMDVPP
FT                   RAQWLRALLCELNRVMAHLVFLAPLTDPVAAARGREAVQAVLEEASGGRIHFMANRIGG
FT                   LREDVPAGWAERVAGALDAVEVPEVPTGLAGLGVLSRADALARGVTGPIGRASGVDLDL
FT                   RRDDPLPAYRELDVRPSVRDGGDAHARVACMVDDLAQAVALARECLRRLPGGPVNLRLP
FT                   KAVKAPEGSVYTRVEAPLGVSGVHLASRGEKTPWRLKLRTPSFNNVQALSALLPGTPVA
FT                   QLPLVLGSFAVVVGDIDR"
FT   gene            complement(351017..351454)
FT                   /locus_tag="Amir_0321"
FT   CDS_pept        complement(351017..351454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0321"
FT                   /product="protein of unknown function DUF1203"
FT                   /note="PFAM: protein of unknown function DUF1203; KEGG:
FT                   rle:RL1972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34290"
FT                   /db_xref="InterPro:IPR009593"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH4"
FT                   /inference="protein motif:PFAM:PF06718"
FT                   /protein_id="ACU34290.1"
FT                   /translation="MIAEDVLARARAAAGADEEHELTTAPGVPLRCCLRRAGSEALVLF
FT                   RYRPGAGRGPYAEVGPVYAHAERCAGPEVVDGGLPLFTAPRVLRAYTAGGRIHDGVLSG
FT                   PDSGREDLAALLADPAVARVQVRSPTHGCFLFEVTGSAVRA"
FT   gene            351540..352457
FT                   /locus_tag="Amir_0322"
FT   CDS_pept        351540..352457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0322"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   lch:Lcho_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34291"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH5"
FT                   /inference="protein motif:PFAM:PF02636"
FT                   /protein_id="ACU34291.1"
FT                   /translation="MQDVESAWRTALYGPSGFFTRGEAPSDHFRTAPLVGPELAEALLE
FT                   LLRRVDTALDRPDALDLVDLGAGGGELSAAVRALADADPALRDRLRVTAVDVGPTRDLP
FT                   GVRWTRDLPDRVTGLLVAHEWLDALPCPVVAWPHRDPWLDRWWPLRPGGRAEIGAPRDA
FT                   AWASAVARVRGAALAIDYGHLADDRAAGRYPRGTFTAYRSGNQVAPVFDGSCDLTAHVA
FT                   LDACAEAAGRPWTLVSQRDALAALGLPAEPLTARTPDWLTAAARASRIAELRDPHGLGA
FT                   FGWLLHPRGTTTADLLPDLPPWRP"
FT   gene            352527..353855
FT                   /locus_tag="Amir_0323"
FT   CDS_pept        352527..353855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0323"
FT                   /product="putative membrane protein"
FT                   /note="KEGG: scl:sce5075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34292"
FT                   /db_xref="GOA:C6WGH6"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH6"
FT                   /inference="protein motif:COG:COG2339"
FT                   /protein_id="ACU34292.1"
FT                   /translation="MTAAAPSPARKRTEQRRWTVLLPVAALIVLGVCGLVLLGLGTSKV
FT                   GLAPILVGAAASLLPVMAVLSAYLWLDRWEPEPAKILLFGFAWGACGATITSLVFNQTA
FT                   QVIGELINDGDGATFAAVVGAPIVEEATKGVFLIALFLRRRHEFDGAVDGLVYAGVVAA
FT                   GFAFTENIYYFARVFVDSGLGDASSGVVALFILRGVLSPFAHPLFTSMLGIGVGLAAMS
FT                   HKRGVRIAGPLLGYLGAVGLHSLWNFSTTVGTGSTFINLYFLIMVPIFAGMVWLVVWQR
FT                   RREQRIVAEQLPGMAERQWIAASEVTLLASLQGRSRWRRTVRRKAGDGAAKAVAGYQVA
FT                   ATELAFLRHRMALGTAGADADRRHANLLRSLLATRVAAVNAPGALGAADGAGRPRLTER
FT                   AERTVRIARIARQGRAARPDAQGRPGSPTSPNDPDATGGVRRS"
FT   gene            353944..354837
FT                   /locus_tag="Amir_0324"
FT   CDS_pept        353944..354837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0324"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: sat:SYN_02774 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34293"
FT                   /db_xref="GOA:C6WGH7"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH7"
FT                   /inference="similar to AA sequence:KEGG:SYN_02774"
FT                   /protein_id="ACU34293.1"
FT                   /translation="MDATPRPARLAAGVISAGRVGSVLGAALTRAGHAVSAVSAVGAAS
FT                   LRRADALLPDVPVLPPPDVAAGADLVLLAVPDDELPGLVRGLVATGSLRAGQIVVHVSG
FT                   AQGVAALAPAAEVGALCLALHPAMTFTGRPEDVDRVRACTFGVTAADGDDIAWSVGEAL
FT                   VVEIGAEAVRVPESARPLYHAALTHGANHLMTLVADCAEALRGAGVANPERVLAPLLGA
FT                   ALDNALRHGDRALTGPVARGDTGTVAKHLAVLADRAPGTLDAYRALARRTADRAESAGL
FT                   LPADRATDVRTTLDED"
FT   gene            354841..355731
FT                   /locus_tag="Amir_0325"
FT   CDS_pept        354841..355731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0325"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: mno:Mnod_1014 pantoate/beta-alanine ligase;
FT                   TIGRFAM: pantoate/beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34294"
FT                   /db_xref="GOA:C6WGH8"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH8"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ACU34294.1"
FT                   /translation="MTKPLTKDDYTPGGVTVHRDPERLRRVTRALRSAGRNIALVPTMG
FT                   ALHEGHRRLIREAHVLQNTVVVVSVFVNPTQFGEAADLERYPRDLDADVEVCRQERAPL
FT                   VFAPEVATMYPAGSQVTLDPGPLGSELEGASRPGHFAGVLTVVSKLFNVVQPDYALFGE
FT                   KDYQQLSLIGRMATDLNVPTAVVGVPTVRESDGLALSSRNRFLSESERESATALSAALV
FT                   AGSHVSALGAEAVLSTARATLDAVPGLDLDYLELRAPDLGPAPVNGDARLLVAARVGST
FT                   RLIDNVPVLLGAGDE"
FT   gene            355746..356216
FT                   /locus_tag="Amir_0326"
FT   CDS_pept        355746..356216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0326"
FT                   /product="aspartate 1-decarboxylase"
FT                   /EC_number="4.1.1.11"
FT                   /note="KEGG: bcb:BCB4264_A1597 aspartate 1-decarboxylase;
FT                   TIGRFAM: aspartate 1-decarboxylase; PFAM: aspartate
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34295"
FT                   /db_xref="GOA:C6WGH9"
FT                   /db_xref="InterPro:IPR003190"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGH9"
FT                   /inference="protein motif:TFAM:TIGR00223"
FT                   /protein_id="ACU34295.1"
FT                   /translation="MFRTMLKSKIHRATVTQADLHYVGSVTVDEDLMDAADLLAGEQVA
FT                   IVDVTNGARLETYVIPGERGSGVIGINGAAAHLVHPGDLVILIAYGSMDDAEARAYRPR
FT                   VVFVDADNKVVELGSDAARAPEGSGLLSGAVTAQALAETADAAALDALIQNQ"
FT   gene            356227..357012
FT                   /locus_tag="Amir_0327"
FT   CDS_pept        356227..357012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0327"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: ank:AnaeK_1477 putative
FT                   transcriptional acitvator, Baf family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34296"
FT                   /db_xref="GOA:C6WGI0"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI0"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACU34296.1"
FT                   /translation="MLLVIDVGNTNIVLGLYDGTGDSAALVHSWRMRTDARMTADELAL
FT                   TMRGLLGEYADKITGISALSTVPAVLRELRVMLGRYYASVPKVLVEPGVRTGVPLLVDN
FT                   PKEVGSDRVINTMAAHHLHSTACVVVDFGTSTNLDVISAKGEFLGGALAPGIEISVDAL
FT                   AARAAQLHKVELVRPRSVIGKNTVECLQSGIVYGFVGQVDGLVRRIVEELATVDPGPVT
FT                   VLATGGLAPLVVSESTAIQIHAPDLTLLGLRLVFERNMR"
FT   gene            complement(357087..357866)
FT                   /locus_tag="Amir_0328"
FT   CDS_pept        complement(357087..357866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0328"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mno:Mnod_8065 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34297"
FT                   /db_xref="GOA:C6WGI1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACU34297.1"
FT                   /translation="MTSAEDHADLWARRAASFGAQASAYAEHRPDYPAEAIKWCLDPLE
FT                   STPLRVLDLAAGTGKLTAGVVALGHHVTAVEPDEQMLSELVRRNGGVRALPGTAERIPV
FT                   PGGTVDAVVVGQAFHWFDQTRALAEIARVLRPGGVLAALWTGDDHTVPWVADYLSAVWG
FT                   VDGDPHKIGSSGGPAEIMPQHEMFHDQETARFAHRQRRTPETLVATLRTHSGVATLPEA
FT                   ERLALEAKALDFLRSREETRDGFDLPLRVMVKRMVRV"
FT   gene            357929..359440
FT                   /locus_tag="Amir_0329"
FT   CDS_pept        357929..359440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0329"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: dal:Dalk_1784 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34298"
FT                   /db_xref="GOA:C6WGI2"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI2"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACU34298.1"
FT                   /translation="MSEQPQTGSPTSDDDLPEQLRVRREKRARLLERGVDPYPVEVART
FT                   HSLREVREAHTGLDPDTGTGEVVGVTGRVMFIRNTGKLAFATLREGDGTELQAMLSLNK
FT                   VGEQALADWKSDVDLGDHVFVRGEVITSRRGELSVMADEWAITAKALRPLPVAHKELAE
FT                   ETRIRQRYVDLILREQARDTVRNRAKLVRSLRESFHRRGFTEVETPMLQTLQGGAAARP
FT                   FVTRSNALDIDLFLRIAPELYLKRCVVGGIEKVFEINRNFRNEGIDSSHSPEFSMLEYY
FT                   EAYATYDTNAVMTRELIQEAAMAVAGSHVVTLVDGTEYDLGGEWTTLTMYGSLSEAAGV
FT                   EVTPGTSVDDLRALADKLGLETDPKLGHGKLVEELWEHLVGDHLHAPTFVRDFPVETSP
FT                   LTRQHRSTPGVAEKWDLYVRGFELATGYSELVDPVVERERLEAQARLGASGDVEAMPVD
FT                   EDFLRSLEYGMPPSGGVGMGIDRLLMAITGLGIRETILFPLVRPE"
FT   gene            359559..359909
FT                   /locus_tag="Amir_0330"
FT   CDS_pept        359559..359909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34299"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34299.1"
FT                   /translation="MAQKVTVTLVDDLDGGVAEETVDFGLDGVAYQIDLSSVNAGKLRS
FT                   ALGAFTTAARKTGGRKRGPGRPAGVKAAARPASADREQNQAIREWARKQGMKVSDRGRI
FT                   PAEVLEAYHQQG"
FT   gene            360226..361230
FT                   /locus_tag="Amir_0331"
FT   CDS_pept        360226..361230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0331"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   pde:Pden_3523 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34300"
FT                   /db_xref="GOA:C6WGI4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI4"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACU34300.1"
FT                   /translation="MVTVRTTRRYGVLALLLGALALAAAASVAFGSKSIDLGSVAHALL
FT                   SPTGTEDDSIVRELRLPRTGFAIAVGMALGIGGALIQGHTRNPLADPGILGINQGAGFA
FT                   VVLAISLLGVTSPLGYVWFAFAGALAASVVVFLLGSGRNGPTPVTLALAGAAVSALLQG
FT                   LISGVVLSDRQSLDSFRFWQVGSVEGRDVEVLWQVLPFLVVGLVLAAFNAPGLNALSLG
FT                   DEVARSLGQNVNRTRALGIGAITLLVGGSVAACGPIGFLGLVVPHAARAVTGPDHRWLL
FT                   PVAGLMGGVLLLVADVLGRVVARPGELEVGIVMALVGAPFFVALVRRRNLVKL"
FT   sig_peptide     360226..360321
FT                   /locus_tag="Amir_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.400 at
FT                   residue 32"
FT   gene            361227..362411
FT                   /locus_tag="Amir_0332"
FT   CDS_pept        361227..362411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0332"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   ppg:PputGB1_1806 transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34301"
FT                   /db_xref="GOA:C6WGI5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI5"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACU34301.1"
FT                   /translation="MSGDGGAAGEGTAAHGATATGATAVGLASGVPVGGDALARPTVKG
FT                   RTGVRLGPLSWPLRWRPIALVLGGLALAATVLAVAIAYGDFPISLGQVVDVLLGGGSRS
FT                   QRFVVMELRLPRVLTGLLVGAALAASGAIFQAISRNPLATPDIIGVTWGAGTGAVLVIV
FT                   LAGSSGAAAGAVAQVGVPLAALAGGLIAGLVVYGIAWRRGIEGFRLVLVGVGVTAITAN
FT                   ATQYLLTKADVNDTARAMVWIAGSLNNRGWEHIVPVALALVVLLPASVLATRTLGALQF
FT                   GDDTTRGLGVRLNGARTALLLLGVVLAAVATAAAGPVGFVALAAPQIAVRLAGTATPPL
FT                   FGSAVVGAVLVVLSDLIARQLIDGTELPVGVVTAVLGAPYLMHLLIRSRREART"
FT   gene            362408..363256
FT                   /locus_tag="Amir_0333"
FT   CDS_pept        362408..363256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0333"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cvi:CV_2234 enterobactin-iron transport system
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34302"
FT                   /db_xref="GOA:C6WGI6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34302.1"
FT                   /translation="MTTAPPSPSARLRAHELSIGYGDRVIVDRLDLDVLDGAVTAVIGP
FT                   NGCGKSTMLRALARLLPTRGGQVLLDGRPITEVPTREVAKVLGMLPQTPQGPEGLTVAD
FT                   LVARGRHPHQAWYRQWSGDDEAAVAEALRLTGMEDFAERTLDQLSGGQRQRAWISMALA
FT                   QGTDLLLLDEPTTYLDLAHQIDVLDLVRLLHAEGGRTIVMVLHDLNLAARYADHLVAMK
FT                   DGRIVVQGAPSEVLTEQVLKEVFGLEAAVIEDPVAGTPMVVPIRSTTHAAANRRKDHPK
FT                   G"
FT   gene            complement(363284..364099)
FT                   /locus_tag="Amir_0334"
FT   CDS_pept        complement(363284..364099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0334"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34303"
FT                   /db_xref="GOA:C6WGI7"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34303.1"
FT                   /translation="MTVPARIDPRDALNPLADTVSATSSLVGWLEIRYERTGGGAPDGW
FT                   TRCSDLLADPGRFTAWRGELADWLEGQHGGSTERATAGYVLGWYLGAVGMLGGALFHRA
FT                   RRVPSLRPEDLALRLADDGRPDVVGVALLAGGFACLPSDPAGNHPEATVVADESALAAL
FT                   LRARFAGHAAAFAAAYGPTTRLGRRALWAAATDALDGSAWLAGLHGGDEAAGVADSALL
FT                   LPFPEAPYTSATTLRVVDGTWTRRRESCCFHFTLPGAQACDTCPRVCGK"
FT   gene            364370..366928
FT                   /locus_tag="Amir_0335"
FT   CDS_pept        364370..366928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0335"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: ATPase AAA-2 domain protein; AAA ATPase
FT                   central domain protein; UvrB/UvrC protein; ATPase
FT                   associated with various cellular activities AAA_5; Clp
FT                   domain protein; SMART: AAA ATPase; KEGG: bha:BH0103 class
FT                   III stress response-related ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34304"
FT                   /db_xref="GOA:C6WGI8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI8"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ACU34304.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLGIALEGVRQQVEEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVLQLLSGYSGGKEPAEAGGRGEGTPS
FT                   SSLVLDQFGRNLTSMAREGKLDPVIGRAKEIERVMQVLSRRTKNNPVLIGEPGVGKTAV
FT                   VEGLAQMVVKGEVPETLKDKQLYTLDLSSLVAGSRYRGDFEERLKKVLKEIRTRGDIIL
FT                   FIDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKYVEKDPALERRFQ
FT                   PIQVGEPSLEHTIEILKGLRDRYEAHHRVSITDSALVAAATLADRYINDRYLPDKAIDL
FT                   IDEAGARMRIRRMTAPPDLREFDEKIADVRRDKESAIDAQDFERAAKLRDQEKTLLGQK
FT                   AEREKQWKDGDLDVVAEVDEEQIAEVLANWTGIPVFKLTEEETTRLLRMEDELHKRIIG
FT                   QVEAVKAVSQAIRRTRAGLKDPKRPAGSFIFAGPSGVGKTELSKALANFLFGEDDALIQ
FT                   IDMGEFHDRYTASRLFGAPPGYVGYEEGGQLTEKVRRKPFSVVLFDEIEKAHNEVYNTL
FT                   LQVLEDGRLTDGQGRTVDFKNTVIIFTSNLGTSDISKAVGLGFASGQDNASNYERMKNK
FT                   VNDELKKHFRPEFLNRIDDIIVFHQLTRDEIIRMVDLLIARVETQLKNKDMAIELTEKA
FT                   KQLLAKRGFDPVLGARPLRRTIQREIEDQLSEKILFGELQPGQIVITDVEGWDGESDQH
FT                   DKAKFVFRSEQKPTKVPDSPPVDLAGAGGDDSAQSEASGE"
FT   gene            complement(367074..367718)
FT                   /locus_tag="Amir_0336"
FT   CDS_pept        complement(367074..367718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0336"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /note="KEGG: saz:Sama_0018 pyroglutamyl-peptidase I;
FT                   TIGRFAM: pyrrolidone-carboxylate peptidase; PFAM: peptidase
FT                   C15 pyroglutamyl peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34305"
FT                   /db_xref="GOA:C6WGI9"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGI9"
FT                   /inference="protein motif:TFAM:TIGR00504"
FT                   /protein_id="ACU34305.1"
FT                   /translation="MDDPTVLITGFEPFGGERTNPSWDAVRELAERDPSLIAVELPCAF
FT                   DASARALREAVERHRPDLVVCVGQAGGRSGVTPERVAINLADARIPDNDGAQPIDVPVV
FT                   EGGPAAYFTGLPVKACVAALEEAGIPASVSHTAGTFVCNHVFYALMHLVATDFPDLRGG
FT                   FVHVPFAPEQVADREGVPSLEVSRTADALGLIVATCLSTTDDLAISTGTLS"
FT   gene            367737..368708
FT                   /locus_tag="Amir_0337"
FT   CDS_pept        367737..368708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0337"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   afw:Anae109_1227 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34306"
FT                   /db_xref="GOA:C6WGJ0"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ0"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACU34306.1"
FT                   /translation="MIEAPARRVGGRTATALVVLLAVGFLVPALTRLLGVDGNRYLAAT
FT                   TALTPLVTAAGVLVGALALLLRRWPVALVVLPVCLLLAASVTPRAIADDRPAGAGLPLR
FT                   VMASNFLVGKADAEAVVREVVERDVDVLAMQELSPAMVRDLENAGLDAVLPHRAFEDEP
FT                   GGSGSGIASRYPLTPARLVGPSSFRQASAVVELPNGKDVEVVSVHPMPPVEPQGPAQWR
FT                   RDLAALPPRNADGPIRVLAGDFNATLDHAPLRRLLDTGYADAADRVGAGLTPTWPNEGV
FT                   VPPLVALDHVLVDDRCPVDWFTAVDVPGSDHRAVVAQFVVPD"
FT   gene            complement(368769..369539)
FT                   /locus_tag="Amir_0338"
FT   CDS_pept        complement(368769..369539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0338"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: afw:Anae109_4302 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34307"
FT                   /db_xref="GOA:C6WGJ1"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ1"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ACU34307.1"
FT                   /translation="MVSGAGALLVCAGAGMGVDSGLPDFRGHAGFWRAYPPYERLGLGF
FT                   EEIADPVHFARDPEFAWGFYGHRLALYRATVPHAGFAVLRRLGARAFTSNVDGQFQLAG
FT                   FAGVAEVHGSIHHLQCQEPCSDDVWSADGVVVEVDPETMRAVSPLPTCPRCGGVARPNI
FT                   LMFGDSSWVGHRTGAQLAELAQWRREVGAGLVVLELGAGTAVPTVRRYAELSSAATGAL
FT                   VRVNPREADVRHGRGIAVPETALEFLDRLAGAAG"
FT   gene            complement(369553..369864)
FT                   /locus_tag="Amir_0339"
FT   CDS_pept        complement(369553..369864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0339"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   afr:AFE_2662 antibiotic biosynthesis monooxygenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34308"
FT                   /db_xref="GOA:C6WGJ2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ2"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACU34308.1"
FT                   /translation="MAVVKINAIHVPEGSGPELEKRFEARLRAVDEEPGFLGFQLLRPV
FT                   AGDSRYFVVTHWADDESFDNWRKGRAEAAHAGERAKPVASGADLLEFEVVLESWPERG"
FT   gene            complement(369874..371352)
FT                   /locus_tag="Amir_0340"
FT   CDS_pept        complement(369874..371352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0340"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: mxa:MXAN_0644 peptidase, M1 (aminopeptidase N)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34309"
FT                   /db_xref="GOA:C6WGJ3"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ3"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ACU34309.1"
FT                   /translation="MAISPRARPYLLITAVALLVAGLLVVRLPDGSDTARETPEAPAPA
FT                   STPAVVGQRGGAGAGDPYYPEDGNTGYDVAGYDVSIGYDPATGHLDGVARVTARATADL
FT                   VSFNLDLRGLEVSSVEVGGEGAGFAREGEQELVITPAAPLASGSEFTAVVAYSGEPQSL
FT                   QDPVLGTNGWQRSQSGGAFAAGEPHSATTWYPANDTPRDKASFALSARVPDGWAAVSIG
FT                   LERGSTSEGGWTTFRWEHPEPVATYLTTVAVDRWEFERGALPDGTPVVNAYAPGAEAAR
FT                   AHGQELPSVLAFLADRFGPYPFDAAGGIYLSDRIGFSLETQTRPIYAAWADLETVVHEN
FT                   AHQWFGDAVTIRSWADICLNECFASYSTWLWAESLGADLDADYRAEVEKWRGSTGYWSR
FT                   KLYDMGRGNEFRGVYDKGQLAVHALRARIGDEAFDRALKTWISEHLDANASWPEFEAHV
FT                   QRVSGQDLSAFFQAWFRGDAIPADEHLWPGGLRG"
FT   gene            371370..372116
FT                   /locus_tag="Amir_0341"
FT   CDS_pept        371370..372116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0341"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   ppg:PputGB1_4047 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34310"
FT                   /db_xref="GOA:C6WGJ4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU34310.1"
FT                   /translation="MSVIEFGGQGQGILLVHGLMSRATTWWKVARWLTAHGRVVAYDAR
FT                   GHGRNPQRGPFRTEDFVADAEALVERLGLGPCVVLGHSMGALHGLALAAARPDLVRAVV
FT                   AEDFVPDNRGRSVDDWRWYFDAWPVPFQSLAHVRSVVDVQGVEEMFEERGDGYHLIAQL
FT                   EDLYEIAAEWGERAYWDVVDAVACPVLVVEAGLHPLGPGQQAEVARRTGGAHLLVPESG
FT                   HVVHDEAPDVYRGAVEAFLSGLNPPV"
FT   gene            complement(372065..372571)
FT                   /locus_tag="Amir_0342"
FT   CDS_pept        complement(372065..372571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34311"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34311.1"
FT                   /translation="MHALVVLFDEEADSAVRALWRGLGATSEFPPHVTWASATAIGPKV
FT                   RAELAADLEHLWLPDLWLRTLGTSAESEPSLDLTAVVDAELLAVHSAIHDVLAGRVRNP
FT                   TARHLPGSWTPRCTLLKGEPAEVSAAFAKVNPVPPIRARVRELSVLDTQTGGLSPLKKA
FT                   STAPR"
FT   gene            complement(372629..373618)
FT                   /locus_tag="Amir_0343"
FT   CDS_pept        complement(372629..373618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0343"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: HhH-GPD family protein; helix-hairpin-helix
FT                   motif; SMART: HhH-GPD family protein; KEGG: scl:sce3935
FT                   A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34312"
FT                   /db_xref="GOA:C6WGJ6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ6"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ACU34312.1"
FT                   /translation="MSRTTSPTTSRATNRTASATTATAAAGAAEDAAKPESAHLPPSVL
FT                   NTWFAATARDLPWRDPECTAWGVLVSEIMLQQTPVARVEPIWRVWLDKWPRPSDMAAAS
FT                   QGEVLRMWGKLGYPRRALRLHAAAQAVAAEHDDVVPDDVETLLALPGIGAYTARAVAAF
FT                   AYGRRCPVVDTNVRRVVARAVHGAGDAGPPSTTRDLRDVEALLPEDEASAATYSAALME
FT                   LGALVCTARTPRCSACPVLGSCQWQRNGRPAYDGPAKAVQKFAGTDRQVRGRLLDVLRG
FT                   TSEPVAKEVLDRAWSDAGQRDRCLHSLLVDGLVEQTAAGLFALPGEHE"
FT   sig_peptide     complement(373532..373618)
FT                   /locus_tag="Amir_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.753 at
FT                   residue 29"
FT   gene            complement(373677..374168)
FT                   /locus_tag="Amir_0344"
FT   CDS_pept        complement(373677..374168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0344"
FT                   /product="carbonic anhydrase"
FT                   /note="PFAM: carbonic anhydrase; KEGG: aba:Acid345_1601
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34313"
FT                   /db_xref="GOA:C6WGJ7"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ7"
FT                   /inference="protein motif:PFAM:PF00484"
FT                   /protein_id="ACU34313.1"
FT                   /translation="MTAIDELLRRNEELGNIVPGDRSSPMPSMQVTILTCMDSRIRVFE
FT                   IFGLKQGEAHVLRNAGGVVTDDMIRSLALSQRKLGTREVLLVHHTNCGLELVTEDAFKD
FT                   ELETDSGMRPPWSVEAFREVKDSVRGSVNRVRNSPYLIHRDTVRGFVYDVRTGVLTEVV
FT                   "
FT   gene            374248..375048
FT                   /locus_tag="Amir_0345"
FT   CDS_pept        374248..375048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0345"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K05747 Wiskott-Aldrich
FT                   syndrome protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34314"
FT                   /db_xref="GOA:C6WGJ8"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34314.1"
FT                   /translation="MIHRIVRPPPSGVFAGRFASVGDVSWPHRPLPASVYWRRRVVAVG
FT                   GAALALVAAVWGTGAVLGRSAPQGAPVATTSTSNPPPLAEGLVLAEAGAASAGSTTGSP
FT                   APSADGPSAGAAEGTPPGSAGPPPPPEPPPGPPQPCDDAAVLVRAVLGKEQHAVGEHAD
FT                   FRIAVTNTGQLPCTREIGRGVRELVVTSPDGATRLWSSNDCLAAEGSEVRVMKPGEVFE
FT                   FGLKWPGTTSAPGCGPRTRLGAGDYLLVARVGDRSSDPAVFRIG"
FT   gene            complement(375152..376255)
FT                   /locus_tag="Amir_0346"
FT   CDS_pept        complement(375152..376255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0346"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: gox:GOX0577 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34315"
FT                   /db_xref="GOA:C6WGJ9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGJ9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACU34315.1"
FT                   /translation="MARSMHVRRPATLASLAAELGVSRTTVSNAYNRPDQLSPELRRRV
FT                   LETARRLGYPGPDPVARSLRTRKAGAVGLLLTENLSYAFRDPAAIGFLEGLALACETAG
FT                   QGLLLVPANPEREDVAAVHRAGVDGFVVYSVPDDDPHLAAVLERPVPTVVCDQPDLADV
FT                   DRVGIDDRAAMHQLAQHLIALGHRRVGVVCMRLARDRNDGFVPLSRQESAHFHVQRSRM
FT                   SGLRQAFTEVGVDWASVPVVERFDHTIAQGASAAAQVLDRDPQITALICTSDILALGAL
FT                   QEAERRGLRVPADLTVTGFDGIREAEQAGLTTVRQPVLEKGRAAGKLLMEIGERTKPRT
FT                   VTLETELITGTTAAEPRTIAEERWFGH"
FT   gene            complement(376377..377420)
FT                   /locus_tag="Amir_0347"
FT   CDS_pept        complement(376377..377420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0347"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: pen:PSEEN1955 ribose operon repressor RbsR;
FT                   PFAM: periplasmic binding protein/LacI transcriptional
FT                   regulator; regulatory protein LacI; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34316"
FT                   /db_xref="GOA:C6WGK0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK0"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACU34316.1"
FT                   /translation="MPGLAEIARAAGVSISTVSRVLNRRAGVNDETRQRVLAVLAEMPY
FT                   TPRGLGALQRTGVIGLLVPELSNPVFPAFAEALEVRAARLGYSSLLCNTRASGDAAMGE
FT                   EEYVRMLLARGVEGMVFVSPEITNAEAPLGRAARPSYYSRLLADGVHMVFVNGATPALD
FT                   VPDVTVDEQHAGYAATRHLVELGHRLIGFVSGPARALPSRLKRAGWAAALEEAGLGADG
FT                   SLVAHGPFGPEGGALAVAELLDSVRPTAVICSSDHMAIGVLREAHKRGLSVPGDLSVVG
FT                   FDDIPLAPYCSPPLTTLAQPIEEMATAAVDELVLRLDPDRRRRHSANYTRVFRPRLVVR
FT                   ESTASPE"
FT   gene            377686..378945
FT                   /locus_tag="Amir_0348"
FT   CDS_pept        377686..378945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0348"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: oan:Oant_3895 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34317"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU34317.1"
FT                   /translation="MRRTTLLTALAAGLAPALALTACGGSSGGGGASGEVVFWDTSGPN
FT                   ESPVFTKVAQDCAAKDGYQVKTETVAFDAALNNYKTAAQGGQGPDVFRAEVAWVPQLAK
FT                   NGLVLDLTGTDLVKDTSDFLETPLGSTVYEGKTYGVPQVTDSLALFYNKKLLADAGVQP
FT                   PKTWDELKSVAAKLGGEKAFFVNNDAYYALPFLYGAGGDLVDAEAKEIVVSSPENVKGL
FT                   ETAKGLVDAKAATTALDAGNSYSNMQAGFGSGEIAMVVNGPWSVPDYLKGAAFADESNL
FT                   GIAPVPGVTEATAGLAPVGGHDYVVRQGAKAKDNALKLIACMSSAESQAKIATELGLLP
FT                   TRKSAYEVAEVKANAVVAAFEPVVAQAHPRPWIPEGGQLFDPLKTAYADFLAGKKDAKS
FT                   ALDEVAKTYKDQILPEYTVG"
FT   sig_peptide     377686..377754
FT                   /locus_tag="Amir_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.238 at
FT                   residue 23"
FT   gene            379013..379930
FT                   /locus_tag="Amir_0349"
FT   CDS_pept        379013..379930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0349"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ade:Adeh_4135 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34318"
FT                   /db_xref="GOA:C6WGK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34318.1"
FT                   /translation="MRRFLDRHWYAYAMVLPVVLVIAVLVLYPLAQGVFFTLTDINESS
FT                   IANPVLDRPATYEWVGLRNYLTVLSGDASYGAFWATLLRTVVWTASCVLLHYGIGLGLA
FT                   VLLNRQVAGRAVYRVLLILPWAVPAFISAFAWKYMFNAQYGIINQVLRALGLPDPVWLG
FT                   QSNWALVAVVIVNVWLGVPFMMVSLLGGLQSIPADLYEAAEVDGATPWQRFRHVTLPGL
FT                   RSVSSTVVLLGVIWTFNMFAVVYLITGQNPSTRLLITYAFERFFSGASRDYAVASTYGV
FT                   LILSVLLVFASGYRRALRRQGEVW"
FT   gene            379930..380823
FT                   /locus_tag="Amir_0350"
FT   CDS_pept        379930..380823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0350"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: acp:A2cp1_4287
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34319"
FT                   /db_xref="GOA:C6WGK3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34319.1"
FT                   /translation="MSIEAASLRAATPARESRRAKRSRAASIGLHAALVTASLIAVFPV
FT                   FWVVVTSFKPDALAVETTPKLVNESSLDNYTRILSGEKGDFLAWFGNSVQIALLTTVLA
FT                   VFLSATAGYAASRFRFPGKRKLLLSFLVVQMFPFAVLIVPLYNTLLALGVQGTALGLVL
FT                   VYCTTAVPFCTYMLKGYFDTIPADIDEAGRVDGLSPFGVFWRLVLPLARPGLAVTSFYA
FT                   FLTAWGEVAFASAFLSAADESKTLAVGLQVFVQQNRTEWGHLAAASTLVAIPAVAVFYL
FT                   VQRFLVSGLAGGAVKG"
FT   gene            380907..382007
FT                   /locus_tag="Amir_0351"
FT   CDS_pept        380907..382007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0351"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: rlt:Rleg2_5484
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34320"
FT                   /db_xref="GOA:C6WGK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34320.1"
FT                   /translation="MAEVAYDKASRIFSGNPPVRAVDELSLDVADGEFLVLVGPSGSGK
FT                   STALRMLAGLEDVDEGAIKIGGKDVTNVPPKGRDIAMVFQSYALYPHMTVAENMGFALK
FT                   LRKVAKEEIKQKVAEAAAMLDLTKYLDRKPKALSGGQRQRVAMGRAIVREPSVFLMDEP
FT                   LSNLDAKLRVETRANIAALQQRLGTTTIYVTHDQVEAMTMGHRVAVLKDGLLQQCDTPR
FT                   ALYDKPANAFVAGFMGSPAMNLKTVPLTAEGAKLDGLLVPLERTKLDAASGKGLSEVVF
FT                   GVRPESLALVGDGEPGMEMAVELVEELGADALLHGAVRIGDSSERFVVRVDGRTPPALG
FT                   QTVKVGVRDASEVHLFHPETGLRLTD"
FT   gene            382167..383057
FT                   /locus_tag="Amir_0352"
FT   CDS_pept        382167..383057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0352"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   bpy:Bphyt_0292 periplasmic solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34321"
FT                   /db_xref="GOA:C6WGK5"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK5"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ACU34321.1"
FT                   /translation="MTVRTTLITAVAVLGLTTACGSADQGGSGSSDAPAGAVPVVTSTN
FT                   VWGSVVKAVGGDAVQVKALIDDPSADPHSFESKPADIAAVADAKLVVGNGGGYDDFFDK
FT                   IVDESARSAKRVDAFALSGKEENEHVWYDLATVRKVADKVAEELSAIAPDKKDAFTKGA
FT                   ADFGTALDGLTAKAERIKPAKVVVTEPVPAYLLETAGVEDLTPAEFTEAIENETDVPVA
FT                   AIAATGDLIVNKQVNALINNTQTENAVTGDLVAKAGTAGLPVVGMTETLPEGVTGYVEW
FT                   MTKQVDELTAALGTK"
FT   sig_peptide     382167..382238
FT                   /locus_tag="Amir_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.425 at
FT                   residue 24"
FT   gene            383054..383896
FT                   /locus_tag="Amir_0353"
FT   CDS_pept        383054..383896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0353"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bvi:Bcep1808_2715 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34322"
FT                   /db_xref="GOA:C6WGK6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34322.1"
FT                   /translation="MSAQTTTPDRPAAQRGAVSLRSARLAYGDRVLWDGLDLDVRPGEF
FT                   IAVLGPNGSGKTSLMRVLLGLQPLSGGSVEIAGVPAGRGSRAIGYIPQQRPVDTSTVLR
FT                   GRDLVGLGLDGHRWGLGLRGRAERRRRVDEVLEAVGATAYADRPVGLLSGGEQQRLRVA
FT                   QALVGDPAVLLCDEPLLSLDLAHQRVVSDLINTRRRASDTAVLFVTHEINPVLPLVDRV
FT                   LYLVDGRFRIGSPAEVMTGETLSELYRTTVEVVRVRGQIHVVGAHGVCEDQPHHAEER"
FT   gene            383896..384732
FT                   /locus_tag="Amir_0354"
FT   CDS_pept        383896..384732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0354"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; KEGG: bxe:Bxe_A0715 ABC
FT                   Mn2+/Zn2+ transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34323"
FT                   /db_xref="GOA:C6WGK7"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK7"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ACU34323.1"
FT                   /translation="MESLFDFATTADLIGLPVVQRALLAAAVLGLVAGAIGPLVITRKM
FT                   SFAVHGTSELAFTGGAAALLLGISVSYGAVLGAVVAALLLGLLGQRDSERDSVIGAVLA
FT                   FGLGLGVLFLWLYPGRAANKMGLLVGQPIGIPAGDVQVLVVCAVVVLVVLALLYRPLLF
FT                   ASVDPDVALARGVPVRALSPVFAVLVGITTALGVQIVGALLVLSMMITPAAAAARITAS
FT                   PAKATVLAIVFAEVAVLGGIVLSLAPGVPVSAFVTAISFAIYVICRIVGKSRVRAV"
FT   gene            complement(384876..386333)
FT                   /locus_tag="Amir_0355"
FT   CDS_pept        complement(384876..386333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0355"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: cvi:CV_3252 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34324"
FT                   /db_xref="GOA:C6WGK8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACU34324.1"
FT                   /translation="MANSLPDHEPPTTPGVSAGRNWELWSLRPAAIAYILSLELVVLIS
FT                   TIWLMAGVGSASESDWFRFGAFAAAVTVHLTIVRRAEESRRDESASLYFDLTSVWTFAA
FT                   AVVLPAPLAVLIVLLLRVVTQPIARRQPYRFVFTSTHIVASTVLAGVAVREAGFPLLAT
FT                   GRVLGDLGLLAVLALTAALYWFTQVVLMTGVLKILNPRTRFADTLGSRGDNMLEATTLG
FT                   VGALLGLLTATHWAAPLLMVVPVVLANALLHRASERQAHLERLLAEQAQAHQQLTQDAH
FT                   TDFRTGLLNTTGLAEFAHRLAERGRIDGKPVTVLAIDLDHFKRINDTWGHPAGNAVLAE
FT                   VGRILREKLRPGDVAGRDGGEEFVVVLADTGLAEGTAIAERVREAIGLMVVVTTDKHRS
FT                   TVHLRGRDLPVNEDGQEVRAISASIGVAVLGEGPDALAHAQHSADAALYAAKERGRNQV
FT                   RVANVDIGGPRPAALARLQDHGVPRTA"
FT   gene            complement(386565..387788)
FT                   /locus_tag="Amir_0356"
FT   CDS_pept        complement(386565..387788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0356"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   reh:H16_B2569 putative MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34325"
FT                   /db_xref="GOA:C6WGK9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR022324"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGK9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34325.1"
FT                   /translation="MTSGGALRALVGNREFRGLWIGSVVSTAGDQLAAVALSLLVFERT
FT                   GSPAWTAVTWASTLLPPLVSGPLLAWVADRHPRRTVMVTCAWLQAALVGAMALPGVPLW
FT                   GMVALLFSALMVASPFLAAQEASLPSVLPDERYDDGVALFGTSVDVAQMVGLAAAGFLV
FT                   TWAGPGAALALDAASFVLVAVLVQLSVEHRPAAAPRSAPEDPEGARSALALLLTEPRLR
FT                   SLLGMRLLAGLAMVPEGLAVPLADGLGAVWAVGLILAVEPAANVLGVALLFRFVRDPRQ
FT                   RERLMGPLAVLSLAPLALFALEPNLTWAIVLLVIAGMAGAYHTPARAAWMRLLPDAYRG
FT                   RAFGIARTALRTSQGGGMALAGVVAHAVGSVTATIAGAGGVGLLLAAQATVAWRRARAK
FT                   AGPDAVTT"
FT   gene            388223..388399
FT                   /locus_tag="Amir_0357"
FT   CDS_pept        388223..388399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34326"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34326.1"
FT                   /translation="MGRAEQWGSRGVSAEELVARHRALPKVDYELMRRETDEFFGTEDR
FT                   IGDGDDPWERTRG"
FT   gene            complement(388670..390100)
FT                   /locus_tag="Amir_0358"
FT   CDS_pept        complement(388670..390100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0358"
FT                   /product="membrane bound O-acyl transferase MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase MBOAT family
FT                   protein; KEGG: ppw:PputW619_0881 membrane bound O-acyl
FT                   transferase MBOAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34327"
FT                   /db_xref="GOA:C6WGL1"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL1"
FT                   /inference="protein motif:PFAM:PF03062"
FT                   /protein_id="ACU34327.1"
FT                   /translation="MSFATPLFLWFFVPAVLTAVLVAPRGWRNGIVAVASLLFYVTGAG
FT                   GTTLLLLACMVVNYLAGLRLAPDGPLAADKRRVLLVGVIGFDLAVLLVWKYLGFATEQL
FT                   AAIASIVGADLPVVHLALPIGISFYTFHHISYVVDVYRGERPALREPVSFITYIAMFPQ
FT                   LVAGPIVRWREIADQLPQERTHRLDDIAAGFPRFALGLCKKVIVADSLAPLVDAAFATP
FT                   SDEMTWSVAWLGAIGYALQLYFDFSGYSDMAIGLGRMLGFRLPENFARPYSSVTITEFW
FT                   RRWHMSLSRWFRDYLYIPLGGNRRGTWTTYRNLSIVFVLTGFWHGANWTFLVWGVFHGA
FT                   LLIVERRFGWAEAPQGPKALLGRRALTFLLVVVGWVFFRSPDLGTAFSVLGNMLVPDFD
FT                   GLPDAVAVAATNQRIALLVLALVVVLLPNHPVTGPYLESARTRVATGLRVAVMTVGALY
FT                   AAILVAGGTFSPFLYYQF"
FT   gene            complement(390193..391158)
FT                   /locus_tag="Amir_0359"
FT   CDS_pept        complement(390193..391158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0359"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   3; PFAM: tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding; KEGG: afw:Anae109_2230
FT                   RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34328"
FT                   /db_xref="GOA:C6WGL2"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL2"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ACU34328.1"
FT                   /translation="MAGNSKRRGAMRTPGSKKGAVVGSGGQKSKGLQGKGPTPKAQDRP
FT                   NHPAYRKANAAAKANAVRQQRRKAADAAPETVAGRNPVVECLRAGIPATALYVALGIDA
FT                   DDRVAEAVQLAASRGISVLEVQRGELDRITGGAMHQGLGLQVPPYEYAEPRDLLRAAKE
FT                   SGRPPLLVALDGVTDPRNLGAVVRSAAAFGAHGVVLPQRRSASMTAVAWRTSAGTAARL
FT                   PIAVATNLTRQLREWAEAGLMVIGLDADGDVDVDGLDLATGPLVVVVGSEGRGLSRLVR
FT                   ETCDQTVSIPMASNVESLNASVAAGVVLAEVARRRRLDAR"
FT   gene            complement(391164..392558)
FT                   /locus_tag="Amir_0360"
FT   CDS_pept        complement(391164..392558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0360"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="KEGG: aeh:Mlg_1810 cysteinyl-tRNA synthetase;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA
FT                   synthetase class Ia; Cysteinyl-tRNA synthetase class Ia
FT                   DALR; tRNA synthetase class I (M)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34329"
FT                   /db_xref="GOA:C6WGL3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL3"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ACU34329.1"
FT                   /translation="MSLHIYDTASRELREFRPQISGTASIYVCGATVQGVPHIGHVRSG
FT                   LNFDVLRRWLARTHERVVLVRNVTDIDDKILVKSAQHDRTWWDWAFEHERAFDDAYEAL
FT                   GCLPPTYAPRATGHVTQMVELMRRLIDAGHAYAANGDVYFSVSSFPEYGKLSGQRVDEV
FT                   QQGESELTGKRDPRDFTLWKAAKPGEPSWPTPWGDGRPGWHLECSAMATEYLGSTFDVH
FT                   GGGIDLIFPHHENEQAQSRAVGDGFARYWMHNAWVTLSGEKMSKSLGNTVSIPAMLEQV
FT                   RAPELRYYLVGPHYRSTIEYSPTALDEAVTAYRRIESFLRRVVERTGAVDAGGELGEDF
FT                   VSSMDDDMGTPGALAAVHKRVREGNTALESGDDTGARAAASSVRAMTAVLGLDPLSERW
FT                   SASAGRESGTSRALKALVDRVLADRVAARKERDFARADALRDSLLAAGIAVEDTPDGPL
FT                   WTLKDS"
FT   gene            complement(392625..393236)
FT                   /locus_tag="Amir_0361"
FT   CDS_pept        complement(392625..393236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0361"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   2 (HAD-like)"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 2 (HAD-like); HAD-superfamily hydrolase, subfamily
FT                   IA, variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: haloacid dehalogenase-like hydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34330"
FT                   /db_xref="GOA:C6WGL4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL4"
FT                   /inference="protein motif:TFAM:TIGR01493"
FT                   /protein_id="ACU34330.1"
FT                   /translation="MTIRAVLFDFSNTLFRLEHPSFALHGELMRALTAPFGLPDGFAVD
FT                   ADTWERRDLDPVAHREAHVEVLASAGAEDPDGFYESLLSPTRWQAYPDTAVALGTHLRT
FT                   AVVSNIGWDVRAVFARHGVLGRVDEFVLSYEEGVVKPDPKLFEVACERLGVEPGEALMI
FT                   GDSEEADGGARAVGCRFELVEPLPTQERPDALLDAISRHA"
FT   gene            complement(393471..393938)
FT                   /locus_tag="Amir_0362"
FT   CDS_pept        complement(393471..393938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0362"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /note="KEGG: eli:ELI_06290 bifunctional 2-C-methyl-D-
FT                   erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-
FT                   erythritol 2,4-cyclodiphosphate synthase protein; TIGRFAM:
FT                   2C-methyl-D-erythritol 2,4- cyclodiphosphate synthase;
FT                   PFAM: MECDP-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34331"
FT                   /db_xref="GOA:C6WGL5"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL5"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ACU34331.1"
FT                   /translation="MRVGIGTDVHPVEPGRDCWMVGLLWEGADGCAGHSDGDVAAHALC
FT                   DALLSAAGLGDLGAVFGTSDPRWSGAHGVEFLAEARRLVEAEGFVVGNAAVQVIGNAPR
FT                   VGKRRAEAQKVLSEVLGGPVSVSGTTTDGLGLTGRGEGVAAVATALLLPKG"
FT   gene            complement(393935..394627)
FT                   /locus_tag="Amir_0363"
FT   CDS_pept        complement(393935..394627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0363"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   bcr:BCAH187_A0116 2-C-methyl-D-erythritol 4- phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34332"
FT                   /db_xref="GOA:C6WGL6"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL6"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ACU34332.1"
FT                   /translation="MGVVALVPAAGRGERLGFGMPKALVPVGGVPLLVRAIRGLFESGR
FT                   VRHVVVAAPPSDVDQVRTVTAPLAPAGGAVHVLAGGAERSDSVRLALEHALAEVPDVRV
FT                   VLVHDAARAFTPPTVVRDVVDAVLAGHPAVIPVLPVADTVKRVDTKGVVVDTPDRSLLR
FT                   VVQTPQGFDAATLRAAHESGLHATDDAGLVERLGVPVVTVTGHQDAMKVTTPFDLAVAE
FT                   ALLVGGTG"
FT   gene            complement(394663..395151)
FT                   /locus_tag="Amir_0364"
FT   CDS_pept        complement(394663..395151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0364"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG:
FT                   bcb:BCB4264_A4827 transcriptional regulator, CarD family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34333"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL7"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ACU34333.1"
FT                   /translation="MVFKVGETVVYPHHGAALIEAIETRVIKGEEKKYLVLKVAQGDLT
FT                   VRVPADNAEIVGVRDVVGQEGLDKVFEVLRAPHTEEPTNWSRRYKANLEKLASGDVNKV
FT                   AEVVRDLWRREKDRGLSAGEKRMLAKARQILVSELALAEGTDEDKAEVLLDEVLATAS"
FT   gene            395536..396153
FT                   /locus_tag="Amir_0365"
FT   CDS_pept        395536..396153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0365"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: YALI0C03894p"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34334"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34334.1"
FT                   /translation="MAAVNGASGDVGVIAVRDAQLQFPVEEGRYATGGSAPLVVTIVNN
FT                   GTELDRLTSVTSTATGEAELSGDVELEPTTSIVAETAENAPGSSSARPTTTSAPSSASA
FT                   PSSGQPSSGQSSASSASSAPQSAASQSSQPSAAPSSGRPSSAPEATAEPGEVRIVLPDF
FT                   KQDVRPGQTIKVTFRFEKAGQLTLDVPIGATPEARVEQKSEH"
FT   gene            396591..397979
FT                   /locus_tag="Amir_0366"
FT   CDS_pept        396591..397979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0366"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: ppd:Ppro_0422 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34335"
FT                   /db_xref="GOA:C6WGL9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGL9"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ACU34335.1"
FT                   /translation="MAKNVRAARPVYRCAECGHEVSKWVGRCPECQAWGTVEERGVAAP
FT                   ARFLAGATSGDARPIGQVDIESSRASATGVGELDRVLGGGLVPGAVVLLAGEPGVGKST
FT                   LLLEVAHQWASTVGRCLYVTGEESAGQVRLRADRTGNLHDEIYLAAESDISAVLGQVDA
FT                   VKPSMMIVDSVQTMSSLSIDGMPGGVSQVRAVTSGLISVAKERNLPIILVGHVTKDGSV
FT                   AGPRVLEHLVDVVLQFEGDRHSTLRLLRGIKNRFGAADEVGCFELRDDGIVGVPDPSGL
FT                   FLNRREQDVTGSAVTVVVEGKRPLLGEVQALVAPTSLPAPRRAVSGLDSARVAMVMAVL
FT                   EKRGRVPLGNKDVFAATVGGMRLVEPSVDLALALAVASAAVDQPLPHDLVVVGEVGLSG
FT                   ELRRVNGVGRRLSEAARLGYTRALVPPDAGPLPKETRALVANDLGEALRLLKITGKRGS
FT                   SKDE"
FT   gene            complement(398370..399224)
FT                   /locus_tag="Amir_0367"
FT   CDS_pept        complement(398370..399224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0367"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   bur:Bcep18194_B2467 XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34336"
FT                   /db_xref="GOA:C6WGM0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM0"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACU34336.1"
FT                   /translation="MAQNNAELADFLKRARAQGDPERAGLPPDGRVRRVPGLRREEVAR
FT                   LAGVSTDYYTRLEQGRRIVPSPAVVDALGRALGLDDAGQAHLRDLIGVGGPVGRRRTTG
FT                   AQRLRPGVHQLFDSLDGVPALALGRRTDVLAANRLARALFTDFEAIPAPRRNYARWMFL
FT                   DPAARALFADWEAQARNAVESLRLEVGRDPGDRATLALLAELRELSPEFDRWWEQHRVH
FT                   QRTHGSKRLTHPLVGELTVEYETVALPGDPDTTLFLYTTAAGTASRQALDLLASWTLTA
FT                   LAR"
FT   gene            399383..400234
FT                   /locus_tag="Amir_0368"
FT   CDS_pept        399383..400234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0368"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: reh:H16_B1910 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34337"
FT                   /db_xref="GOA:C6WGM1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34337.1"
FT                   /translation="MTTPTTWFVTGASKGLGLELVRQLLAQGANVAATSRSADRLRAAL
FT                   ADADADTTRLLPLAVDLADEADVQRAVTAAAERFGRLDVVVNNAGYGYLAAVEETTAQA
FT                   VRDMLDVQVVGVWNVLRAALPVMREQRSGRVVNVSSVLGLVSLPGWALYCAGKFALEAM
FT                   TEALAGEVAGHGIEVTLVEPGYFRTSFLSPDSLALPETTTDHYPQIRRMVADHRALQGS
FT                   QLGDPARGAAEIIARASVAGAPLRQVLGSDSHAYATAKVDALRANLAAEADSAPRTDHP
FT                   AA"
FT   gene            400283..400516
FT                   /pseudo
FT                   /locus_tag="Amir_0369"
FT   gene            complement(400639..403167)
FT                   /locus_tag="Amir_0370"
FT   CDS_pept        complement(400639..403167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0370"
FT                   /product="trehalose-phosphatase"
FT                   /note="TIGRFAM: trehalose-phosphatase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: glycoside hydrolase
FT                   15-related; trehalose- phosphatase; KEGG: nmu:Nmul_A2309
FT                   glycoside hydrolase 15-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34338"
FT                   /db_xref="GOA:C6WGM2"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM2"
FT                   /inference="protein motif:TFAM:TIGR00685"
FT                   /protein_id="ACU34338.1"
FT                   /translation="MTAEALPAELRRAIVQLARTPRLLVACDYDGTLAPIVENPEDARP
FT                   LPEAVGALRSLAGLHETTTAVISGRALRDLATLSRLPAEVHLVGSHGSEFDVGFVHALD
FT                   ADARALHRRLEDELEKLVDGSEGVSLEIKPASIAVHVRRAPAEVGERVLEAVRTGPCTW
FT                   GGVQVTEGKAVVELAVVQTDKGHALDVLRHRVSATASVFVGDDVTDEKAFARLSGPDVG
FT                   IKVGDGETLAQYHITDSPDVSMVLALLLEERRNWLHGDQAVPIERLTMLANERSVALVT
FT                   PDARVNWLCHPEPDSAAVFADLLGGPSAGHFTIKPEHGSLPLGQRYVPGTMVVETRWSR
FT                   LLVTDYLDHDLPGHRTDLVRRISGSTNAVITFAPRPEFGQVPVRLLRERDGLRVAGTSE
FT                   PMVLRSPGVDWEITSDGVQETAVAVVRPREGAAILLELRCGTDDLSESTLGEPERRARA
FT                   GGFWSDWAATLKLPSVEPELVLRSALTLKGLVHHETGAIMAAATTSLPEELGGIRNWDY
FT                   RYCWLRDAALTAQALVSVGSLTEAEAFLGWVHGVLDTLPGPERLHPLYTLQGTMLGAEA
FT                   VIDTLPGYAGSRPVRVGNLANQQVQLDVFGPVVDLVAELASARGALTDEDWRMVQAMAE
FT                   AVARRWHEPDHGIWEERHAPRHHVYSKVMCWVTLDRAVRLAEQYGRALDPSWPVLRDTI
FT                   ATDVLKNGWSDVAQSFTTAYDGDDLDAASLHVGLAGLIDPADERFQATVTAIEAELRSG
FT                   STVYRYRRDDGLPGDEGGFHLCAAWMIESYLLTGRRTEAEELFAQMVDAAGPTGLLPEE
FT                   YDPIAERSLGNHPQAYSHLGLIRCAQLLAK"
FT   gene            complement(403246..404682)
FT                   /locus_tag="Amir_0371"
FT   CDS_pept        complement(403246..404682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0371"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /EC_number="2.4.1.15"
FT                   /note="PFAM: glycosyl transferase family 20; KEGG:
FT                   scl:sce0488 Alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34339"
FT                   /db_xref="GOA:C6WGM3"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM3"
FT                   /inference="protein motif:PRIAM:2.4.1.15"
FT                   /protein_id="ACU34339.1"
FT                   /translation="MSSIGENGADFLVVANRLPVDLERLPDGTQRWKHSPGGLVSALEP
FT                   FLRVHSGAWVGWPGVADADVEAFEEDGLQLHPVSLSSAEVTDYYEGFSNGTLWPLYHDV
FT                   VERPAFHRRWWNTYVRVNQRFADVTAKVAAHGATVWVQDYQLQLVPAMLRELRPDLRIG
FT                   FFLHIPFPPVELFMQLPWRTEIIRGLLGADLVGFHRPGGAQNFLWLARRLVGLEPSRGA
FT                   VGVRTRPGVVQVGDRTVRVGAFPISIDSSALDALARSKEVQARARQIREDLGNPKKVLL
FT                   GVDRLDYTKGIDVRLRALNELLEDGRVAPEDVVMVQLATPSRERVEHYKQMRGDIERMV
FT                   GRLNGEFSRVGRPVLHYLHQSVDRKELTAFMLAADVMVVTPVRDGMNLVCKEYVASRHD
FT                   LGGALVLSEFAGAAAELTSAFLVNPHDLDGVKKALEDALALDPAEGRRRMRALRRQVLT
FT                   HDVDRWARSFLEALGAQTAV"
FT   gene            complement(404791..406185)
FT                   /locus_tag="Amir_0372"
FT   CDS_pept        complement(404791..406185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0372"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   rpt:Rpal_1546 protein of unknown function DUF1212"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34340"
FT                   /db_xref="GOA:C6WGM4"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM4"
FT                   /inference="protein motif:PFAM:PF06738"
FT                   /protein_id="ACU34340.1"
FT                   /translation="MSTRRKRYREPATLPDLWRPVEGPSLPDAPVVHLVLDLALRVGEV
FT                   QLASGAGAADVAATVSAVAQAYGMPRVEVDVTFTAITVSCHRGTSAAPVTSLRVVRSRG
FT                   LDYTRLDTLEDLIRRIAENEVTAEEAYAELDRITTAPHPYPRWVATAAWAGMAASVALL
FT                   VGGGLLLALSAALVTALVDRVGRLLNRRSLPFFFQQAAGGVLATAFALALYATDLLPGV
FT                   RPSLLVATGIVVLLSGLSLVGTVQDAITGYNVTAAGRFVEIVMLTSGLIAGVALTLRAG
FT                   VQLGVLTTMADPLPALISTVPLQLATGAATSMFFALASYARPKALMVAACAGAVGTTSY
FT                   GLLAVTGLNTIVCAAAAATLVGFVGALVSRKLRTPPLVVAVAGMVPLLPGWTIYRGLYQ
FT                   LTADGDPAGLSTLVYAGGTALALASGVALGEFLGEPVRTGFGRLERRLAGPRLSGPLWP
FT                   TRRRSE"
FT   gene            406208..406471
FT                   /pseudo
FT                   /locus_tag="Amir_0373"
FT   gene            406492..406567
FT                   /locus_tag="Amir_R0017"
FT                   /note="tRNA-Thr2"
FT   tRNA            406492..406567
FT                   /locus_tag="Amir_R0017"
FT                   /product="tRNA-Thr"
FT   gene            407108..408085
FT                   /locus_tag="Amir_0374"
FT   CDS_pept        407108..408085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0374"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: ajs:Ajs_2855
FT                   ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34341"
FT                   /db_xref="GOA:C6WGM5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM5"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ACU34341.1"
FT                   /translation="MAVLRIHFTDADLARTRVARDPDPLWETVLGLYRLANDDVPVFEP
FT                   WRNRARLAVVERGAQAQVRMVRQLVPREGYFPDFLTPAEGRHGVAAGLEAVRGTPSLRL
FT                   LGDIAYAARSRPLPAWAHRVARSDRDALDELVSALKGVHDVLVRPAWEDAQAAVAAERA
FT                   ALGRTILDAGVDAALETLRPTLRWNPPVLEADYPKPLDVRLGGRGALLVPSYFCWGNPV
FT                   ALVDPALPPVIVYPVRHPANWTPDRSRSLGALLGRTRAAVLAALTGTATTTELAARLRL
FT                   SPASASEHVGVLRDSGLVVSRREGRTVLHSLTPLAQSLLEGRRA"
FT   gene            complement(408188..409822)
FT                   /locus_tag="Amir_0375"
FT   CDS_pept        complement(408188..409822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0375"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: aba:Acid345_1672 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34342"
FT                   /db_xref="GOA:C6WGM6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACU34342.1"
FT                   /translation="MGNPTDRSATTGAGWWTNARVSVKILLAVGVVALVALVTGAVSWV
FT                   RLDTLNEQVQGIKNESMVRQANLLRVQNATAAMYRGMYLFGTADSAEGKAEGEKLVKDA
FT                   ESELDAAGSAYTSTPSTSAGWRQQVELYGASWNTYRGLLNVVLFGDAAPAGVTVPTSVA
FT                   ELGKAFTDSENGMNSAIDALSALEQAEGQAAAEAADSTVASARLWTVGVLVVGLALALL
FT                   LALLTGRSIGRRLERVRDVLASMADGDLTGSAPVDSRDEVGEMAVAVNRATENVRGAVS
FT                   ALAGSAQALAVNSRQLSSSADRIAGSAQDTAGRTDELAETSEEVSRNVQTVAAGAEQMG
FT                   AAIQEISQSASDAADVAAQAVQAAAVTNATVAKLGESSVEIGNVVKVITSIAEQTNLLA
FT                   LNATIEAARAGEAGKGFAVVANEVKDLAQETARATEDISRRVEAIQADTGGAVTAIEEI
FT                   GQIIARINDYQLTIASAVEEQTATTQEMNRGINEAAVGTTRIAGSISTVAGATRTTSAT
FT                   VVETQGAAMELSRMSAELQEQVDRFRI"
FT   gene            complement(409989..411551)
FT                   /locus_tag="Amir_0376"
FT   CDS_pept        complement(409989..411551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0376"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with GAF sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; GAF domain
FT                   protein; SMART: chemotaxis sensory transducer; GAF domain
FT                   protein; KEGG: aba:Acid345_1672 methyl-accepting chemotaxis
FT                   sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34343"
FT                   /db_xref="GOA:C6WGM7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACU34343.1"
FT                   /translation="MPFTSNRVRAELARALAALAEAEQDTAAVTAVVKALDGVKSSRDA
FT                   AKAALDVVRQRFGWVYGSYWQVDGTGGALRFAVESGDAGEEFRAVTREASFAEGVGLSG
FT                   RAWRSRDLVFVGDLGTLRDCVRAPVAQKVGVKSGICFPLTENGRVVGTMDFFSLEELNP
FT                   SKQRLEVLRSIGLLVAQAMERVVDVERQAASALDIQAVNAVLRGLGSATSEEEATRQAL
FT                   DTVRSEFGWAYGSFWAVDPTGQELRYVTESGDAGEEFRKITREASFRQGVGLAGRAWKS
FT                   REMLFVPDLADMTDCVRAPAARRVGVKSGVCLPLVVHGAVVGTMDFFSLSEIELTESRA
FT                   DALRNTAFLVSQSLERIRETTRISSAGAELVTSIEEVERNVVQATGVAAEAATLTSGAN
FT                   QAVGRLAQSSNEVGDVVKVINSIAEQTNLLALNATIEAARAGDAGKGFAVVANEVKDLA
FT                   QGTARATEDVARLISAIQSDASSVVTSLAEIEHIVDRINETQTMIGGVLTEQAAVTRDI
FT                   VGA"
FT   gene            complement(411724..413376)
FT                   /locus_tag="Amir_0377"
FT   CDS_pept        complement(411724..413376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0377"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; KEGG: mxa:MXAN_6334 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34344"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM8"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACU34344.1"
FT                   /translation="MAVPRRTTAAVALAAAALAAAPHAVAHAAPPAERVEQVAAAAPAA
FT                   SRCGPMDVVFALDDTGSMGGALNNIKTSINAVVGDVVSASGGDYRLGLVTFKDSINVVT
FT                   GLAAGNAGTVTGYVTNVLAASGGGGEPEASDEALRTAVSLRPAAGIPQNADFTGPWRSN
FT                   ARKFVVLVTDARPGGFDDAFTAADQASATAVANSALAAGVKLSAVYVPTSPSMTPTIAP
FT                   IMQNYATTTSGVYVQAQADGSGTADAIRKALSDCRRTDVFMRDQTTDNGVEVNPNGSVW
FT                   ASPDIKVCPTTADCATTYQPPVGSTSWIHVRLNNPGPYGSGTGAGTLKLYWVNPSGSTV
FT                   WNEATGGDWTFIGQQAATVPAGTTVVKVPWTNVPGPGHFCLLARWVSANDPMTHVEGAN
FT                   TAQNAKNNNNIAWRNVDTVRVRPTVPGRTSFTLGNAVEKEIRTDLLFTSPGKPFVGAGK
FT                   VVVDLGRELFERWQASGGQARGIERVGESAVQVLDPKQAALIGIAVRPGERFTAGLEFH
FT                   GGEPGGEYLLHVVQRLGDEELGGVAYQVLVEKE"
FT   sig_peptide     complement(413290..413376)
FT                   /locus_tag="Amir_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.789 at
FT                   residue 29"
FT   gene            complement(413875..415284)
FT                   /locus_tag="Amir_0378"
FT   CDS_pept        complement(413875..415284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0378"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   gbm:Gbem_2673 heavy metal sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34345"
FT                   /db_xref="GOA:C6WGM9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGM9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU34345.1"
FT                   /translation="MRELVTGRRMRLGTRLALGLGALALAVFGLVGALVVTSMEDYLAR
FT                   KLDAQMKSTQIAQEKDFKENGDVLGPVYGWYYAVYEVRDGVAAPLPTHKLPDDDRPMAK
FT                   VATLVTGSQPVFKTVHFEGEGTYRVRGCPAGNGTVLVSAAPMDDLTTTVQQLTMVLVAL
FT                   FALALVALVVVGRAVLRRGLQPLSEMARTAHDITSHDLTDSARLPVRSEGSYGGVEVAE
FT                   LRTAFNTMLEHIDSSLAARTAAEQRLRRFIADASHELRTPLTSIRGYADLFRYAAANAP
FT                   EEREAHLEKLRAEAARMSVLLEELLLLARLDSAEAELPVRPENGDLVELVGQAVDAFRV
FT                   ARPGHPVALAVAHPRVPMRFDAGRLRQVLDNLLTNAAVHTPKGTAVSVSVDVVGGDAVV
FT                   RVSDSGPGIPARDQERIFDRFYRVDHSRTRDRGGSGLGLAVARSLVEAHRGRLDLESRP
FT                   GSTTFTITLPR"
FT   sig_peptide     complement(415183..415284)
FT                   /locus_tag="Amir_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.552 at
FT                   residue 34"
FT   gene            complement(415284..415985)
FT                   /locus_tag="Amir_0379"
FT   CDS_pept        complement(415284..415985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0379"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: bat:BAS2056 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34346"
FT                   /db_xref="GOA:C6WGN0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU34346.1"
FT                   /translation="MENGSPVRLLVVDDEPHIADLVATVARYEGWQAVTAGSGEAAIRA
FT                   ALDFQPDIVVLDLMLPDVDGFTVLDRLRGEGAMVPVVFLTARDGTADRVAGLTRGGDDY
FT                   LVKPFSVEELMARLRAVLRRSTGPSWKRSVLKVADLVLDEDTREVRRGDRLVTLTPTEY
FT                   ELLRYLMRRSPTVLTKAQILDHVWEYDFGGRSNVVELVVSHLRRKLDVEGDEPLIHTVR
FT                   GVGYVLRRAPS"
FT   gene            416139..417482
FT                   /locus_tag="Amir_0380"
FT   CDS_pept        416139..417482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0380"
FT                   /product="Ferric reductase domain protein transmembrane
FT                   component domain"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   FAD-binding 8 domain protein; KEGG: ank:AnaeK_0310
FT                   oxidoreductase FAD/NAD(P)- binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34347"
FT                   /db_xref="GOA:C6WGN1"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN1"
FT                   /inference="protein motif:PFAM:PF01794"
FT                   /protein_id="ACU34347.1"
FT                   /translation="MTTLQAQAPAVRPRAAARTGLHAVLGANAAVVAVLFAQAGFGSNA
FT                   LILLGRLTGLYAALVLAFQLLLVARLPWFDRRLGMDRLTAWHRVTGISVVWLLVAHVVF
FT                   ITTGYAQLASLPPLDELVHLATTVEGVLRAVVAVVLVLVVGGASARWARRRLAYETWHF
FT                   IHLYAYLAVVLAFSHQVAAGTTFTSSPLATAYWWALWGAALAAVLVGRVGLPLWRNLRH
FT                   RLRVAAVVPESDDVVSIHITGRDLDKLPARAGQFFLWRFLERGRWWQANPFSLSAAPDG
FT                   RSLRLTAKALGAGSASLRSLKPGTRVFAEGPYGAFTALHRTRPNALLIAGGVGVTPVRA
FT                   LLEEIGGHAVVVYRVSERRDAVLLDELRGLARAKGAVLHVVTGATADHAPDAQPLGARA
FT                   LGAAVPDVRERDVFVCGPSRMTDAVLASLRELGVPANQVHAERFTLAR"
FT   gene            417520..417927
FT                   /locus_tag="Amir_0381"
FT   CDS_pept        417520..417927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0381"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG: mlo:mll6621
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34348"
FT                   /db_xref="GOA:C6WGN2"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN2"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ACU34348.1"
FT                   /translation="MKRAIPVLLLTIAGLVPLWRYEPRAETTTVAAAEVPADSGAGSGS
FT                   GSTAAGRVVAGEVQETRYGQVQVQLTYEGDRITAVTMLKQPGSAPTRQAVPVLVEETLE
FT                   AQSAEVDSVSGATTTSAAYVRSLQSAIDSAE"
FT   gene            417932..418645
FT                   /locus_tag="Amir_0382"
FT   CDS_pept        417932..418645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0382"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: mlo:mll6620
FT                   thiamine biosynthesis lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34349"
FT                   /db_xref="GOA:C6WGN3"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN3"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ACU34349.1"
FT                   /translation="MRHVEQVMGFPVSVNVPDGDGHGAAVADVFEWLHEVDARFSPFKP
FT                   GSEVSRLGRGEDVEPSPDLAHVLAVSEWYREATGGAFAVRRGGVLDPCAVVKGWAVERA
FT                   ADLLRSAGVPRFVLNAGGDVATEGGPWRVGVRHPDHPDRFCAVLEVDGLAVATSARYER
FT                   GDHIVDARTGEPVTSLLSLTVVARSLEVADATATAAFALGREGVAWAASRPGCEVHAVD
FT                   ADRRVHRTPGLPLAP"
FT   gene            complement(418924..419154)
FT                   /locus_tag="Amir_0383"
FT   CDS_pept        complement(418924..419154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34350"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34350.1"
FT                   /translation="MLVLAEHGRHAHRATDDGDVVLGLLPEEIGRQERPPRSDSGRPGF
FT                   EIPGGNRALVRSERLPVRLGERVGRARRASV"
FT   gene            complement(419414..420451)
FT                   /locus_tag="Amir_0384"
FT   CDS_pept        complement(419414..420451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0384"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   dol:Dole_0265 ADP-ribosylation/crystallin J1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34351"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN5"
FT                   /inference="protein motif:PFAM:PF03747"
FT                   /protein_id="ACU34351.1"
FT                   /translation="MPREPMAVVDRGAACLLGGALGDALGAPVQYLGLPDIQRDHGPDG
FT                   VLEPPWPALVTDDTQLTLFSADGYLRAWVRGKRTGEWEPVDEVWNSYRRWLVTQQFAAP
FT                   DEGATGLLAQGRLYASRSPGLTCLRALAADVPPTPEAPINESSGCNGVTRTAPAGFAPH
FT                   PDIAYDLGCRFAALTHGGTGGWVSGGAFALLIHLLAVRGRPLREAVDQVIGRVLRDDPY
FT                   TANALNRAVVYAEEQRATGGPVRVDRLGSGWTGPEALAIAVHTVLVYPKRSQVVDALRT
FT                   AANHSGGSDATASLTGNILGALHGTAGLPREWLAGLELVDVLAALGADLGCSVSGLEFD
FT                   ESLYA"
FT   gene            420623..423445
FT                   /locus_tag="Amir_0385"
FT   CDS_pept        420623..423445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0385"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain; NB-ARC
FT                   domain protein; transcriptional regulator domain protein;
FT                   KEGG: scl:sce8759 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34352"
FT                   /db_xref="GOA:C6WGN6"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN6"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ACU34352.1"
FT                   /translation="MGDRSRCGLEFGVLGPLRVVADGGPIAIGRRGVRALLAVLVLEAN
FT                   RVVPIDELVDRLWGDEPPATARTIVHGYVSRLRKVLDAADPAGSARILTTPPGYQLAVD
FT                   PWRLDHHRARRLISSARGKPATSRAPLLRDALRLWRGPVLADVPNAPGSDLAELRLVAL
FT                   EERAAAELELGHHLEVVGELRQLVAEHPFRERLVAQAVLALYRSGRRADALDAYQRFHR
FT                   RLVDELGIDPGPDLRALHERVLRDDPALLPARAPETPGVAPRPGVVVPAQLPAAASGFV
FT                   GRDEELAWLDRLCDTRDRDATTTAVLDGPPGIGKSELAVAWGHRRAAQFPDGLLFAQLG
FT                   GHADDERARVGPDEVLARFLLALGVPADAVPRGTADRVGLYRSVLAGRRVLVVLDDARD
FT                   AEHVRLLLPPGSGSLALVTSRLRLGSLVVSAGARVLTLDVLAEDESARLVDEAVGKPLS
FT                   EQEPDAVRDLARLCGNLPLALRIAAARLVSSPEWAVASLVDALADDSTRLRALDLADAD
FT                   AGGGVGVARALALSYRELPDELAEVFRAAGLVPGRRVTAQAVAALCRTDAGTAARRLAE
FT                   LADAHLLLERGRGDYALHDLVRLYARELLADVPPERTAAALGRLLDHYLAACDRARRLL
FT                   RPATDGLDPGQSDHRAARPATSGQALLWFDKEWPNIVALARAGAERGLHRRVWQLVRLV
FT                   HTRCAVRAVDDGWSELAAIGLASARAEGDPRGEVLVLHAAHSVALRTGPAPGPLADARR
FT                   AHRIAEGLGEARYLVLALDQLASALLATGETGAAITRYREAVEAARRDGDVLGEAHVLN
FT                   NLAQAEQAAGRRETAARHQFQAAELFHRTGDQRGHALAVGNLAELYAELDLLVEAEESA
FT                   RQAVQLAVGGTMRYEEAFGRQVLGAVLARRGERSAARAELVESLRLFERLGSPRAASVR
FT                   IALDGLGGVF"
FT   gene            complement(423636..424412)
FT                   /locus_tag="Amir_0386"
FT   CDS_pept        complement(423636..424412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0386"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   bcb:BCB4264_A2458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34353"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN7"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ACU34353.1"
FT                   /translation="MQELDSYVAVGDSFTEGLDDPAPHGGYLGWADRLAAMISSRQRGF
FT                   RYANLAIRGRLLQAIVEEQVPVAVALKPSLVTFCAGGNDLLMPGADPDAVAEVYEIAVA
FT                   ELRATGAEVVIFTGFDPRHAPVLRSLRGKVAIYNSHLWSVAERYNCKVVDLWSMTVLHD
FT                   IRAWGPDRLHLAPEGHQRVALRVAELLGHEQEEQWRTPWPVVAEDDWMTQRRQDLKWAR
FT                   EHVVPFITRHLRGASLGDGVVPKRPELLPISSGENN"
FT   gene            complement(424515..424955)
FT                   /locus_tag="Amir_0387"
FT   CDS_pept        complement(424515..424955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34354"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34354.1"
FT                   /translation="MVSSRDPMVTVSRRSGSEGRVGAVVEVVISVALVVVVDVTCGTFV
FT                   TTTLDVSVTVLGVALVGSTPPPWSIGGPSPAGAEDVRLGSIRCPSAGFGGPSSSRTAVV
FT                   MPVSAAISANVTAGRGSRGTVGKATCGHPAKRPLPTPCPTIE"
FT   gene            425108..425854
FT                   /locus_tag="Amir_0388"
FT   CDS_pept        425108..425854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34355"
FT                   /db_xref="GOA:C6WGN9"
FT                   /db_xref="InterPro:IPR016566"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34355.1"
FT                   /translation="MHPGSMTDTRQESLAELLGGRSGALDASLPPAVFALGWLLGERSI
FT                   GAGALAAVLCGVVIGAYRLARGGKPRAVVVSLTLVVLAAYVALRTGRAEDFFLLRILLN
FT                   VGSALVWAASIVLRWPLLGVVVGLVTGQKLKWRKDPDLMRAYRYASWPWVGQYLLRVAV
FT                   FGGFWLAGQVVALGVAQVALSWPLQVVCVVVSWWVIRRSLPADHPGLRHPRVPGEPAEP
FT                   AQAAGPAVENPAPATGSAVEKPERVD"
FT   gene            complement(425911..426903)
FT                   /locus_tag="Amir_0389"
FT   CDS_pept        complement(425911..426903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0389"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   sme:SM_b21003 putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34356"
FT                   /db_xref="GOA:C6WGP0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP0"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACU34356.1"
FT                   /translation="MELGIYSFGDLAPRSGGEPADVARRLADLVDQVRTADGAGLDVVA
FT                   IGEHHRREFTVSAPEIVLAALAGVTSSIRLASGVTVLSTQDPVRVFQQFATLDQLSGGR
FT                   AEVIVGRGAFTESFPLFGHDLRDYDELFDTKVKALLELTRSRELPVVNGVDVVPRPLQP
FT                   ELPVWIGVGGTPQSAIRAGVLGTPMFLAFFTGPETSRGTAELYRRAGEQAGHDPASLRL
FT                   ASGGHMFVGRTSQGAKDDFYPYYSDYFSLHPRMRDGMPRGVYDEWLRAGLLVGSPQEVV
FT                   DKILRHREVLGVDRYVGQFDVGGMPVAMTNRSLELFLTEVVPAVRAETA"
FT   gene            427020..427901
FT                   /locus_tag="Amir_0390"
FT   CDS_pept        427020..427901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0390"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: acr:Acry_2830 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34357"
FT                   /db_xref="GOA:C6WGP1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU34357.1"
FT                   /translation="MELRHLKHFVALAEESSFTRAAERELIVQSGLSSSIRSLERDVGS
FT                   ELFVRGSRPVRLTAAGRALLPGARRTLQESERAKQLVRDVRGLVAGPFTIGTLPLHNRD
FT                   VSCRFVNWLASFATAHPGLDISVRQPGRDRALALVAEGGLDCAVVTGAPARLPGLRATR
FT                   LSTQPVVALLASGHPLAGRDGLALADLAGERFVDTYPGHESRDLVDLAFAERGLTRRIS
FT                   CEVVDLPMVFNLTRAGLGVALVPARTDLPAEGVVAVPLREEGLVHTVDLVLPKDPATSP
FT                   AAAAFAAHVAAG"
FT   gene            complement(428065..429006)
FT                   /locus_tag="Amir_0391"
FT   CDS_pept        complement(428065..429006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0391"
FT                   /product="ATPase BadF/BadG/BcrA/BcrD type"
FT                   /note="PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG:
FT                   slo:Shew_1116 ATPase, BadF/BadG/BcrA/BcrD type"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34358"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP2"
FT                   /inference="protein motif:PFAM:PF01869"
FT                   /protein_id="ACU34358.1"
FT                   /translation="MSFVVGVDGGGTSTRALVVGADGTRLGAGVAGGSNPNSVGSGTAA
FT                   ANLRLALEGALSGVDAGAVVAGVLGMAGSSKLTDPGVDALFRAAWAGAGLRCPMRVVTD
FT                   CEAAFAAGTPAPDGTVLVAGTGSIAARVRGRRVVGTVGGHGWLLGDEGSAFWLGREAVR
FT                   AALRALEAGELDGLARAVLERAGVDEGPGAWARLITAANAGPPVALAGYAPLVTAAAGA
FT                   PGEVVAARIVDGCARVLADLAAAARTAEEVAPVVLVGSLVGAPVLGERLRAELAARVDG
FT                   EVVVVREAAVGAAWLAALESGVEDGWRERALG"
FT   gene            complement(429003..432230)
FT                   /locus_tag="Amir_0392"
FT   CDS_pept        complement(429003..432230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0392"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: glo:Glov_1721 peptidase S8 and S53
FT                   subtilisin kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34359"
FT                   /db_xref="GOA:C6WGP3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034213"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP3"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACU34359.1"
FT                   /translation="MRLHRRAATAAALAAALAAPLAPLGHAAPDHPRPHRVTAFVELVG
FT                   VPAVDAAATARSDPREAARAARARTGNNADAVLDAVRSVDRGAARVGVTVNAVPGVVLT
FT                   AEPAVLRWVAGMPQVRSVRQAVPKRVDNAGAVRLTGAAAVWRAVGPSLPGHGGAVAGDG
FT                   LREGLRGEGLRIGVVDTGVDYTHADFGGSGGYDDVDRAGPWEPNAKVVGGYDFAGDDYD
FT                   ANDPERGTPAPDPNPVDCQGHGTHVAGTAAGYGVSADGSTFTGAHSGLSDDDLAAMRIG
FT                   PGAAPAAQVYALKVFGCEGSTNVVSQALDWALDPDGDGDPSDHLDVVNLSLGSDFGAVD
FT                   DPDSAFVRKLVRHGVVVVASAGNAGDLYDAGGSPGSTPEAVTVANTRDASVLLDGVGLP
FT                   GGSAEAGGSDEPGGSDEAGGSDGAGGGEEVLPGQYGKEFTGYADLDVELPVAPVADAGN
FT                   ADGCAPIDQDLSGRLVWLEWDDSDSTRECGSAVRADHARDAGAAGAVLSSGRTAFGAGI
FT                   AGNADVPMFQLTGPATDRVRPLLADGSLRLRLAGSLRDAAPTVVETLADTVTPSSARGS
FT                   RLAGGAKPDLAAPGDTIVSALVGSGSGGVSKGGTSMAAPHVAGLAALVRQAHPDWTVEE
FT                   VKAALVNTASARVVSGDDRTTGLTEATTRVGAGRVDARAAVRTGLLAVVPEDPGAVGVS
FT                   FGTVEAGAPVELTRTVELVNKTGEDLAAVAAYRAATEVPGAEVEVLPRTARVPAGGTAR
FT                   VSVRLRVDPAALRKVGDPTLEVEQRGHARQFLAEVSGRVVFRAGAQDAVLPVYAAPRPV
FT                   SALTARPAPGGVELVGRGLDQGEGAGAYRSLVSAFELHGRSPELPPCGSELLTGCLAAG
FT                   SARGGDLRYAGASAADGVLSFGIATWGTWTGLGAGGTTPVVGVDVDRDGAEDYRVQVAR
FT                   PSDGSGKVVADLWWARTTRVSDDEVVDERPVNGWHGEVDSAVMDSDVLALPVSLEALGV
FT                   ALGDGPVRYRVRTRGWALPAGTEDGVVDRFDGWFDVDPAGSRVALPVGSVARDGLLVPV
FT                   RGAGEVLVLHHHNGGGSRAEVVVYSGE"
FT   sig_peptide     complement(432147..432230)
FT                   /locus_tag="Amir_0392"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.940 at
FT                   residue 28"
FT   gene            432351..433205
FT                   /locus_tag="Amir_0393"
FT   CDS_pept        432351..433205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0393"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylatedecarboxylas
FT                   e"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rle:RL0016 putative FAA hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34360"
FT                   /db_xref="GOA:C6WGP4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP4"
FT                   /inference="protein motif:PRIAM:4.1.1.68"
FT                   /protein_id="ACU34360.1"
FT                   /translation="MQLMRLGEPGSERPAVRADDGTVHDLSGLTADVDGAFLASGGIAR
FT                   ARAALDQGLLPRLAVQGVRVGPPVAGIGKIVCIGLNYRDHADETGQAPPAEPVVFLKAA
FT                   DTVVGPDDEVLLPRRSVKTDWEVELGVVIGRTARYLDSAEEALDHVAGYALSHDVSERE
FT                   FQLERGGQWDKGKSCETFNPLGPFLVPADEVPDPQDLGMRLRVNGLLRQDSSTRRMIFP
FT                   VAELVRYLSWFVVLRPGDLINTGTPAGVALGLPEPKPYLREGDVVELEIDGLGAQRQRV
FT                   GQA"
FT   gene            433205..434617
FT                   /locus_tag="Amir_0394"
FT   CDS_pept        433205..434617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0394"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: xca:xccb100_4271 phosphopyruvate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34361"
FT                   /db_xref="GOA:C6WGP5"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP5"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACU34361.1"
FT                   /translation="MPTPEPGAPATEPAAPPATRKITVPGGAAPPAAIPPAATITAVDV
FT                   VDVRFPTSRELDGSDAMNPDPDYSAAYVVLRTDSGPEGHGLVFTIGRGNDVQAAAIRAL
FT                   APHVVGRPVPEDAAALAALSADLVGDSQIRWLGPEKGVAHMAVGAVVNAAWDLASRRAG
FT                   LPLWRFLSGMSPEELVGLVDFRYLTDALTPDEALTLLRDAQPGRSTRAEELQRCGYPAY
FT                   TTSPGWLGYPDDKLADLAARAVADGFDMIKLKVGADLSDDIRRMGLARSVVGPSVRIAV
FT                   DANQRWDVGAAIGWVRELAPFDPYWVEEPTSPDDVLGHRAIAEAVAPVRVATGEHVANR
FT                   VVFKQLLQAGAVDVVQLDACRVGGVGELLAILLLARKFGVPVCPHAGGVGLCELVRHLA
FT                   MVDYVAVSGSLDGRVLEWVDHLHEHFTDPAVVRDGRYLAPTAPGFSAQLKESSVRDHRY
FT                   PDGPVWAGTGER"
FT   gene            434593..435363
FT                   /locus_tag="Amir_0395"
FT   CDS_pept        434593..435363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0395"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bpe:BP1923 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34362"
FT                   /db_xref="GOA:C6WGP6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34362.1"
FT                   /translation="MGGDGGAVNDFDGLVAAVTGGASGIGLATARLLAGRGAVVYALDL
FT                   DPEVPEPLRGLRTDVADDASVRAALAELTAETGRLDVLVANAGIGAQGDVAAADDAEWL
FT                   RVLDVNVVGVARVVRAALPHLRRSPSAAVVTTGSIAAHAGLPQRAVYSASKGAVHALTL
FT                   AMAADHLREGVRFNAVAPGTADTPWVGRLLASAPDPVAERAALEARQPHGRLVAAEEVA
FT                   AAIAHLASPLSGSTTGTVLAVDGGMHGLRLRPEP"
FT   gene            435360..436289
FT                   /locus_tag="Amir_0396"
FT   CDS_pept        435360..436289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0396"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: xac:XAC4184
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34363"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP7"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACU34363.1"
FT                   /translation="MTGAVTGPSRLGFGAAPLGNLYEPVADADAEAAVRAAWEAGVRYY
FT                   DTAPHYGLGLSERRLGAALAGVPRADLVLSTKVGRLLEPVDPVGDDLANGFAVPAHSRR
FT                   VWDFSADGVRRSLESSVDRLGVDRVDVVYLHDPDHHWRQAIDEAYPALADLRDQGVVRA
FT                   VGVGMNQWRVPERFVRETDVDVVLLAGRHTLLERGATGLLDLCAERGVEVVAAAPFNSG
FT                   LLAERVVPDGATHDYAPAPPELLARARALARTCAAHGVDLPAAALQFPLRHPAVRSVLV
FT                   GMRSAAQVRANAAALAAPAPDALWEELA"
FT   gene            436286..437110
FT                   /locus_tag="Amir_0397"
FT   CDS_pept        436286..437110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0397"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mes:Meso_1610
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34364"
FT                   /db_xref="GOA:C6WGP8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP8"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACU34364.1"
FT                   /translation="MIVDAHHHVWDLAVRDQPWITGRMSRIRRDFTVHDLAGAAPEVTT
FT                   TVLVQTVAGPAETPELLALADREPLVGAVVGWLDLTGDVPAQLAALRSLPGARWLRGVR
FT                   HQVQVEHDPDWLIRPDVLRGLAAVAADGLVYELLTLPHQLPAARRAAAALPQLTFVLDH
FT                   CSKPPVGGDLREWAAEVRALAARPNVLCKLSGLVTEADWANWSVTDLRPVCATVLEAFG
FT                   PRRLMFGSDWPVCLLAASHAEVLAAARELTADLSAAERAALFSTTATLAYRL"
FT   gene            437177..438277
FT                   /locus_tag="Amir_0398"
FT   CDS_pept        437177..438277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0398"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: beta-lactamase; KEGG: bcz:pE33L466_0099
FT                   D-stereospecific peptide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34365"
FT                   /db_xref="GOA:C6WGP9"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGP9"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ACU34365.1"
FT                   /translation="MRTTITALAAAALLLAATAPAQAAPAVPPLNRTALAAAVAGLPDG
FT                   EASGALVRVSGRAGSWTGSGGVSRLGTTRPVSPEGRFRIGSATKLLTAAAVLRLDERGV
FT                   LDLDDTVQQHLPDLLPAAFEPITVRQLLNHTHGIAGNGLPHKSTGWFAENRYRTWDPRE
FT                   VVELGVAKGPLHRPGDEQRYGNQGYLVAGLVIEAATGRPYADSVRDLVIRPLGLRDTYL
FT                   PGAETGIRGEHSHGYQLREDGSHWDVTGANPTFQWAAAEAVSSARDLDRLINALMFGDL
FT                   IGERSRAEMLTLPLPGAAHGLGVNRIELGGVVLWGKTGDRPGYNTGVAVTEDGSRTIVY
FT                   SVNTLDMEAGELPPVAQRIITAALTP"
FT   sig_peptide     437177..437248
FT                   /locus_tag="Amir_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(438344..439018)
FT                   /locus_tag="Amir_0399"
FT   CDS_pept        complement(438344..439018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0399"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   csa:Csal_0365 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34366"
FT                   /db_xref="GOA:C6WGQ0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ0"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACU34366.1"
FT                   /translation="MAVTDDAILRVREMIVSGELKPGDRLPREAVLAERLGLSRNSLRE
FT                   AVKALSLVRVLDVRQGDGTYVSSLRADELLGALSFVLDLHRGEESLLEVVQVRRILEPA
FT                   ACALAAQRVTAEDAAALRALCDAAEAAETVEELVEHDLAFHRAVAAHSGNAYLAQLLDT
FT                   LAGPTVRARIWRGIAQAGAKSRTVAEHRAIVDALAAGQPEVARSWSTVHIAGVEQWLLV
FT                   LA"
FT   gene            complement(439140..440183)
FT                   /locus_tag="Amir_0400"
FT   CDS_pept        complement(439140..440183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0400"
FT                   /product="Glutamine--fructose-6-phosphate transaminase
FT                   (isomerizing)"
FT                   /EC_number="2.6.1.16"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: sus:Acid_1598
FT                   glutamine--fructose-6-phosphate transaminase (isomerizing)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34367"
FT                   /db_xref="GOA:C6WGQ1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ1"
FT                   /inference="protein motif:PRIAM:2.6.1.16"
FT                   /protein_id="ACU34367.1"
FT                   /translation="MTEHQPGGHMAAEIDQQPAIFADLVSRRAEIAAVAEAIRGRAPRF
FT                   VLFAARGSSDHAALYAKYLTEVLLQLPAGLVSPSTTTLYGARPDLRDVLLVTVSQSGGS
FT                   PDLLEVTQSARERGALTVAVTNTPESELNGVAEMSVDVGAGVEHAVAATKTYSATLLAL
FT                   YLMVDAVRGGSGAEVAGIGELARAALDGSVDPVEEAVRRYRFVDRVLTTGRGYSLPSAL
FT                   EAALKLAETSYLAARAYSGADLLHGPVAAVDAETAVLAVTSAGLGGDALHDVLDVVHGR
FT                   GADVVAVGSAAEKAPAALRIPVPETAEEVAPILEILPVQRLAHGLALARGGDPDSPRGL
FT                   NKVTRTR"
FT   gene            complement(440530..441351)
FT                   /locus_tag="Amir_0401"
FT   CDS_pept        complement(440530..441351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0401"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: jan:Jann_3555
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34368"
FT                   /db_xref="GOA:C6WGQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34368.1"
FT                   /translation="MRAKRISANAVALVVALFFAFPTYWMVATALKPRKDLLSTDYDLV
FT                   PKTVTGDNFASAWNKPGFLESLGNSLLVTLSAVAAALVVGLLAALALSRMRFRGRRGFV
FT                   MMMLIAQMAPFEALLIPMFLMMRDLDLLDKLPSLTLIYFAVTLPFCAWTLRGFVNGIPL
FT                   ELEEAAMVDGCGRWGAFRRVTLPLLGPGLVATSVFAFVTAWNEFLYALSLINDQSKQTL
FT                   PVWLSGFKSNFGTDWGGAMAASALFTLPVLVFFLIVQRKMVTGVTAGAVKG"
FT   sig_peptide     complement(441259..441351)
FT                   /locus_tag="Amir_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.943) with cleavage site probability 0.767 at
FT                   residue 31"
FT   gene            complement(441348..442340)
FT                   /locus_tag="Amir_0402"
FT   CDS_pept        complement(441348..442340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0402"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0419 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34369"
FT                   /db_xref="GOA:C6WGQ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34369.1"
FT                   /translation="MTAVDTTGAGASTGNVPPAPPRSAKGGGGRRRGSAFDRALPYLLL
FT                   APALVAILWLIGFPVLSVLLTSFRRLNLRELTRGQVVWTGLDNYTEVLGDPDFWLVTGR
FT                   TVAFTAAVVGASVLAGLLLAVLMRQVSPLVRIVLQVAMLLAWAMPLLAATTVYQWIFDQ
FT                   EYGILNKTLVQLGFDSYAGYSWFSTGLSTLGVVGLMITWQAVPFLAFSLYAGLIGIPRD
FT                   QYEAAGIDGASPWQTFRAVTWPELRPLLMMVTFLSVLWDFKVFAQIWAFRQGGPDGAST
FT                   TLAVYQYLVGISQSHFGVAAAVSVVMMLLLAAVTFQYLRRLVRSQEGEL"
FT   gene            complement(442348..443628)
FT                   /locus_tag="Amir_0403"
FT   CDS_pept        complement(442348..443628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0403"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mlo:mll4149 sugar ABC transporter, (sugar- binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34370"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ4"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU34370.1"
FT                   /translation="MKGWRGLAVGATALSVALAGCGTSSDSGSGEGGDKTLTVWLMDGS
FT                   AAPALTDALHQEFESAHPGVKVKYEVQKWGGIQEKLTTALTGKTPPDVIELGNTQTAKF
FT                   ASEDTLEDLSGDVSSLAGDQWLAGLEDSLTWDGKQYGMPFYAANRTVVYRTDLFQAAGI
FT                   TAAPTSRDEWVAAVEKLKAANASDPEFQSLYLPGQSWYVLLSFIWDEGGDVAKKDGDKW
FT                   AGALDSAEAKAGLEFYKKLVDASGTKAPKDTDEATPQQMEVFGTGKVGMMIGLPWELAG
FT                   AVKADPTLEGKLGAFPIPSKTAGKTAPVFLGGSNLAIPAGSANPDLAKDYLKLLSSKKY
FT                   QDLLAEGGSVPGTSTDTTKLETTPVGKALAAAAPNGKVTPTTPTWAGVEAGQNPLKDML
FT                   TAYLTGAKSLDQATADANAALTKTLAG"
FT   sig_peptide     complement(443554..443628)
FT                   /locus_tag="Amir_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.224 at
FT                   residue 25"
FT   gene            443873..444622
FT                   /locus_tag="Amir_0404"
FT   CDS_pept        443873..444622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0404"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: bcy:Bcer98_2752 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34371"
FT                   /db_xref="GOA:C6WGQ5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ5"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACU34371.1"
FT                   /translation="MLETSLESRSRAQREPKYWGLKRHLLDLLRAMPPGSPIPTERSLA
FT                   SEFDVSRTTVRQALAELTVEGRLLRVQGKGTFAAEPKVAQRLQLSSYTQDMLAQGRQPS
FT                   SRLIDASEQPAEAELARLLGVRAGAKVLRLHRLRLADGEPMAIETTHLALGRFRGLRRY
FT                   LSPGGSLYQVLRERFGTEMGHAEETIETALASPEEAELLGADIGLPMLLLSRHSYDTEG
FT                   NPVEWVRSVYRGDRYKFVATLNRPVEG"
FT   gene            complement(444671..445618)
FT                   /locus_tag="Amir_0405"
FT   CDS_pept        complement(444671..445618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0405"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: aba:Acid345_2084 pyridoxal-5'-phosphate-
FT                   dependent enzyme, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34372"
FT                   /db_xref="GOA:C6WGQ6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR027278"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ6"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ACU34372.1"
FT                   /translation="MDLVTLEDIRAAAERISGAVLRTPLLPWGDGLWLKPESLQPVGAF
FT                   KIRGAYNALARLTPEDRARGVVAYSSGNHSQAVARAAREFGVPAVIVIPDNAPEVKVEA
FT                   TRALGAEVVRVPMAERESRALELAAERGAVLVPPFDHPDVIAGQGTIGLEIVADLPEVA
FT                   TVLVPVSGGGLLSGVAVAVKALRPDARVIGVEPELAADAGESFAAGRRVDWPAEDRART
FT                   IADGLRAQPSERTFAHIRAHVDGFAAVSEARIRAAVRELAVRARLVVEPSGATTLAAFL
FT                   ELRERGELGDGPVVAVLSGGNVDPALLAEVLREA"
FT   gene            complement(446394..447158)
FT                   /locus_tag="Amir_0406"
FT   CDS_pept        complement(446394..447158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0406"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: scl:sce0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34373"
FT                   /db_xref="GOA:C6WGQ7"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ7"
FT                   /inference="protein motif:PFAM:PF02900"
FT                   /protein_id="ACU34373.1"
FT                   /translation="MPVLYLGHGAPPLADDARWTGELHAWSEDLPRPEAVLVVSAHWEE
FT                   APLTLGATTPVPLTYDFWGFPQKYYEVTYDAPGAPALADEVTRLLGGDDRVARDPERGL
FT                   DHGAYVPLKELFPAADVPVLQVSMPTLDPRELFDLGRGLAPLREQGVLLVGSGFMTHNL
FT                   SCVDFRRGPDYAAPGWSEEFDDWAGRALAAGDVDGLLDFARKAPAAGVAHPRTEHLAPL
FT                   FVALGASLDQSAPRTAVEGFWYGLSKRSMQFG"
FT   gene            complement(447158..447916)
FT                   /locus_tag="Amir_0407"
FT   CDS_pept        complement(447158..447916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0407"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: pca:Pcar_0607 thiamin biosynthesis protein;
FT                   TIGRFAM: thiamine-phosphate pyrophosphorylase; PFAM:
FT                   thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34374"
FT                   /db_xref="GOA:C6WGQ8"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ8"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ACU34374.1"
FT                   /translation="MPGLDATQIRRRLADARLYLCTPHRPDLAEFADAALAGGVDVVQL
FT                   REKGMEARQELAALEVLAEACARHGALLAVNDRADVALAAGADVLHLGQDDLPVPLARR
FT                   VVGEEVVIGRSTHDVAQASAAAVEPGVDYFCTGPCWPTPTKPGRPAPGLDLVRAVAGWD
FT                   AARASAAGGPGGLGASGAGRPGAGAPGAGAAPPARPWFAIGGIDRHRLPEVISAGARRV
FT                   VVVRAITESSDPRAAAAWLKIQLSGVPSSP"
FT   gene            448503..449510
FT                   /locus_tag="Amir_0408"
FT   CDS_pept        448503..449510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0408"
FT                   /product="glycine oxidase ThiO"
FT                   /note="TIGRFAM: glycine oxidase ThiO; PFAM: FAD dependent
FT                   oxidoreductase; KEGG: azc:AZC_3554 putative glycine oxidase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34375"
FT                   /db_xref="GOA:C6WGQ9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGQ9"
FT                   /inference="protein motif:TFAM:TIGR02352"
FT                   /protein_id="ACU34375.1"
FT                   /translation="MARKRVTVLGGGVIGLSIAWRAAQAGFAVAVRDRGSAHAGSWVAG
FT                   GMLAPVSEAWPGDEAVLALGLESIRLWPGFARELGVRLNTAGTLLTAVDAADAAVLDQH
FT                   AAHLAAHGLEFQVLGAAGLREREPGLGPSVRSGLSIPGDLAVSARTLLAALRTACAEAG
FT                   VRFTGAAESEVDGSTTVIAAGAWSAELHPALRDVIHPVKGEILSLLARPGALEAPERTI
FT                   RAQVRGRAVYLVPNETRSGLLVGATQYEAGFDPTVRVRGVLDLLTDAEEVWPALTEYAL
FT                   AETSVGFRAGSRDNTPLIDWLEPGVLAATGHHRNGVLLAPVTARRVVELLGEAA"
FT   sig_peptide     448503..448580
FT                   /locus_tag="Amir_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.948) with cleavage site probability 0.755 at
FT                   residue 26"
FT   gene            449507..449704
FT                   /locus_tag="Amir_0409"
FT   CDS_pept        449507..449704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0409"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: mms:mma_0316 thiamine biosynthesis
FT                   protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34376"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR0"
FT                   /inference="protein motif:TFAM:TIGR01683"
FT                   /protein_id="ACU34376.1"
FT                   /translation="MRARLNGVLRDLPDGATVADAVTALGAPTTGVAVAVDGEVVPRAA
FT                   WDRPLREHARVEVITAVQGG"
FT   gene            449707..450495
FT                   /locus_tag="Amir_0410"
FT   CDS_pept        449707..450495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0410"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   rce:RC1_3100 thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34377"
FT                   /db_xref="GOA:C6WGR1"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR1"
FT                   /inference="protein motif:PFAM:PF05690"
FT                   /protein_id="ACU34377.1"
FT                   /translation="MTEPDRIAPAPDPLRIADREFTSRLITGTGGATNLTVLERALRAS
FT                   GTELTTVALRRADGSGGTGVLQLLRRLGIDLLPNTAGCRTAAEAVLTARLAREALGTSW
FT                   VKLEVHADDRTLLPDPVETLDAARRLVADGFTVLPYTNDDPVLALRLEDAGCAAVMPLG
FT                   SPIGTGLGIRNPHNLELIVARASVPVILDAGVGTASDAAVAMELGCAAVLLATAVTRAQ
FT                   DPELMASAMRSAVRAGRWARLAGRAPKRFWAHASSPAPDA"
FT   gene            450580..450999
FT                   /locus_tag="Amir_0411"
FT   CDS_pept        450580..450999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0411"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bcm:Bcenmc03_5734 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34378"
FT                   /db_xref="GOA:C6WGR2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR2"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34378.1"
FT                   /translation="MTDLEDATARLYLTIGRLSRLLRRTGSPGLGPGAVSALATLARCG
FT                   PMRLGDLANKEGVAPPTLSRIVATLVEAGYVRREPDPQDGRAWLASPTDEGVAMVSGVR
FT                   SARVQELRARLESLSPEHRDALVGALGALEALVEE"
FT   gene            complement(451015..451833)
FT                   /locus_tag="Amir_0412"
FT   CDS_pept        complement(451015..451833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0412"
FT                   /product="O-methyltransferase domain protein"
FT                   /note="PFAM: O-methyltransferase domain protein; KEGG:
FT                   mlo:mll3178 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34379"
FT                   /db_xref="GOA:C6WGR3"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR3"
FT                   /inference="protein motif:PFAM:PF02409"
FT                   /protein_id="ACU34379.1"
FT                   /translation="MDRVRVALTGAQETMLATLYGRALDSARPHSVLNDGAAAEAVARL
FT                   DYDFPGTGLTMTSAVGVAIRAWQLDRWLRGFLAEHPRATVLHLACGLDTRAHRLSPGPD
FT                   VRWVDVDLPDVVAVREKVLPPPGGDYRLVGASATSPELWESIPDDRPTAVVFEGLSMYL
FT                   SGAEVEGMVRRAVGRFPSGELMFDVYGTIGIRLQKLVPPVRRAGAVLRWGLDDPTGPEA
FT                   WGLKLVESVRSTEMPMLDRLPLAGRVQLRIVGLIPRLRDAGRAVRYRFPA"
FT   gene            complement(451917..452123)
FT                   /locus_tag="Amir_0413"
FT   CDS_pept        complement(451917..452123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0413"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34380"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR4"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACU34380.1"
FT                   /translation="MIGMLEGAKWKKSLRSGNSGGNCVEMACGTSSARAIRDSKNPAHG
FT                   ALVLDGDTAARFLDGLKAGRFGR"
FT   gene            complement(452143..452997)
FT                   /locus_tag="Amir_0414"
FT   CDS_pept        complement(452143..452997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0414"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34381"
FT                   /db_xref="GOA:C6WGR5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR5"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34381.1"
FT                   /translation="MVDRSAQHHTAVYKRKLGEVLETCREEAGLSRADAAAVLDCSTSK
FT                   IRMIESGGVAVKTPELRELLTAYNITGERRADIETLGEHARQRRGRTTWGGAVPERLKR
FT                   FFDKEETAVTIDSYSPWVLQGLAQTEAHARAVIQTNSLLSPKDVDRLVQARLARQERLH
FT                   AQDAPKIRWAVDESVLRRPIGGAEVMRAQLEHLAALCRKDIGELRVIPNSVGAHAGCGF
FT                   PFVVLVDAEGNRSVYVENLTDGSWIEDLDRVTRYEITMREIMDCALSTEESLRLVDTVL
FT                   AQL"
FT   gene            453216..453383
FT                   /locus_tag="Amir_0415"
FT   CDS_pept        453216..453383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34382"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR6"
FT                   /inference="similar to AA sequence:KEGG:NCU04095"
FT                   /protein_id="ACU34382.1"
FT                   /translation="MGPEDLTPRHGGRTAEPLPIAGPLPIPGPPPIPEPLPIPGPPPIA
FT                   GRPRTSGPVG"
FT   gene            453387..453620
FT                   /locus_tag="Amir_0416"
FT   CDS_pept        453387..453620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34383"
FT                   /db_xref="InterPro:IPR031795"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34383.1"
FT                   /translation="MPSRAFKWLPHDRSRHAVERGRHPGEDTRTLCGVDVTVPVQELPR
FT                   THWYWPTCVDCDAAWRGHEGIPAFPRTGEARR"
FT   gene            453617..453964
FT                   /locus_tag="Amir_0417"
FT   CDS_pept        453617..453964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34384"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34384.1"
FT                   /translation="MTDHPSRVPSRGGGARARLAREARSHAPRMYAIAYEAADGGGGGI
FT                   AAYGLQFADRAETVGVADGHRSSSETAAHARALYARFGAPDDLTAHLVWLDATAPVRPA
FT                   PARRPRTARRR"
FT   gene            complement(453918..454655)
FT                   /locus_tag="Amir_0418"
FT   CDS_pept        complement(453918..454655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0418"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bph:Bphy_4607 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34385"
FT                   /db_xref="GOA:C6WGR9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGR9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACU34385.1"
FT                   /translation="MPGVLQDKVAVITGGSSGIGLAMAHRFAAEGARVFVTGRDAARLD
FT                   AAVAEIGDAATGVRADVADPAALDALYERVRAEAGRVDVLVANAGLAADAPLGEHTEEG
FT                   VDLTLAVNVKGTLFTVQKALPLLSAGASIIVIGSSNSTRPNPLLAVYSASKAAVRNLVR
FT                   NWAAQSKDRQFRINVLSPGPTRTPGLMSAGGPMIEQYVREQVPLGRMAEPEEIASAALF
FT                   LASDASSFVTGVELFADGGQAQV"
FT   gene            454677..455330
FT                   /locus_tag="Amir_0419"
FT   CDS_pept        454677..455330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0419"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bxe:Bxe_B1146
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34386"
FT                   /db_xref="GOA:C6WGS0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGS0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34386.1"
FT                   /translation="MDRPKPSRLWTIESRTGSFGAVPRPRKFDETQVLELAREQFWTTG
FT                   FAGTRMDDIARVTGLGKGSLYGAFGDKEALFRRVFDDWCGAIVVLAEENLTGPDEGALA
FT                   RLEAYVRFVAANTAADVGRRGCFQAKGTAELAASDESVADRSATTMRALLGLLSREITA
FT                   AQRCGDLAPDADPDALASLLLVVVRGVEAVGKAGLGAEAVTSAADTALALLPRP"
FT   gene            complement(455336..456040)
FT                   /locus_tag="Amir_0420"
FT   CDS_pept        complement(455336..456040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0420"
FT                   /product="putative hydrolase protein"
FT                   /note="KEGG: rec:RHECIAT_CH0002869 putative hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34387"
FT                   /db_xref="GOA:C6WGS1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGS1"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0002869"
FT                   /protein_id="ACU34387.1"
FT                   /translation="MSTPTVVLVHGAFADSSSWTDVVRGLRAQGVPVVAVANPLRGLES
FT                   DARYVASVANSVTGPVVLVGHSYGGALITRAARDVAGAKALVYVAAFQPDTGESALELA
FT                   NRFPGAKLGPDTLDVLVHEGAPELSIKPGDFREVFAADLPESATTVLAATQRPVAEAAL
FT                   AGGLDGEPAWRSLPSWALVANQDNAIPAASQEFMAERAGSTTTRVDASHAVAVSRPEVV
FT                   AELVLAAVRATS"
FT   gene            456177..456746
FT                   /locus_tag="Amir_0421"
FT   CDS_pept        456177..456746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0421"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: smd:Smed_4442
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34388"
FT                   /db_xref="GOA:C6WGS2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WGS2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34388.1"
FT                   /translation="MTTAPVRDEHPRERLLRTAARLFYAEGVHAVGVDRLVKQASVTRA
FT                   TFYRHFPAKDDLVAAYLAEESLRIREGMAALTDGRPPRAALVAMLAEVGDATCADGFRG
FT                   CQFLNAAAEHPDPAHPVRAVVDDHRRWFAGRLRDLAAEAGCQDPDHVARVLVLLRDGAL
FT                   SGGDLDDPALVRATLRRAVEAVVPER"
FT   gene            complement(456953..457957)
FT                   /locus_tag="Amir_0422"
FT   CDS_pept        complement(456953..457957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0422"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   cak:Caul_0434 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34389"
FT                   /db_xref="GOA:C6WHT8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHT8"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACU34389.1"
FT                   /translation="MTGTMKAVRLHEHGGPEVLRLDEVPVPEVGPGEVRVRVRAVGLNP
FT                   PDWYLREGMTKIPPELRPRLDLPLIPGTDVSGVVEEVGEGAGWAVGDEVFGMLRFPSPG
FT                   GSAYAEQVVAPATDLARKPAGVDHVQAAGAPMAGLTAWQFLIALGHEVAPPFQPRPHHP
FT                   VPLGSGTTVLVNGAAGGVGHFAVQLARWRGARVVAVASGSHGEFLRGLGADVVVDYTRE
FT                   RAEDLVDEVDLVLDAVGGEATGRFLPLVRRGGALFPVFPGPYDVAEAARREVTVSATQV
FT                   RASGAQLAELGALLGSGEVRVGVDSVFPLADAAAAHARAERGHIRGKIVLVVD"
FT   gene            458084..458638
FT                   /locus_tag="Amir_0423"
FT   CDS_pept        458084..458638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0423"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cak:Caul_0435
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34390"
FT                   /db_xref="GOA:C6WHT9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHT9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34390.1"
FT                   /translation="MRADARKNRDHLLAIADAVITEQGADVSMRDLARRAEVGLATLLR
FT                   HFPTRDALLDALLRAGFDELTTLADRLEARLPPGEALKAWLREFVACAHTYRGAVTTMM
FT                   GAIEDPDSALHASCVAMRGSGARLLERAQAAGQARTDLTGPDLFALGGALIWLHDQPTS
FT                   APRADHLLDVVAAAILTPEKP"
FT   gene            complement(458684..459514)
FT                   /locus_tag="Amir_0424"
FT   CDS_pept        complement(458684..459514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0424"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /note="TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1; KEGG: sfu:Sfum_1692
FT                   phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34391"
FT                   /db_xref="GOA:C6WHU0"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU0"
FT                   /inference="protein motif:TFAM:TIGR00097"
FT                   /protein_id="ACU34391.1"
FT                   /translation="MERPSVVETPKKVLTIAGSDSGGGAGLQADLRVLAACGVHGMTAV
FT                   TAVTVQNSLGVSGVVEIPAEQVAAQIRVVATDIGVDAAKTGMLASAPIIEAVAAACDEV
FT                   GIGSGGTPFVVDPVSASMHGDPLLTDAALEALRVLLFPRATLVTPNLDEVRLLTGVDVR
FT                   TREEQREVAKVLHGMGPQWVLVKGGHMRGDPECLDLLYDGREFHEYVGPRYDVLHTHGS
FT                   GDTLASSICSRLARGVGVVDAVRFGKDFVVRSVLAAYPLGAGVGPVSPLWRLAE"
FT   gene            complement(459516..461159)
FT                   /locus_tag="Amir_0425"
FT   CDS_pept        complement(459516..461159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0425"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC; KEGG: bsu:BSU08790
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34392"
FT                   /db_xref="GOA:C6WHU1"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU1"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ACU34392.1"
FT                   /translation="MTALGDGSVRPSVTTGPIRGSRKVHRDAEDGVRVPFRRVELTDGD
FT                   HFDLYDTSGPYTAGDVDVREGLEKIRAGWISAREPVNGAATQLAWARAGVITPEMRFAA
FT                   LRESLAPEFVRDEVAAGRAVIPANRNHPESEPMVIGKGFLVKVNANIGNSAVTSSVEEE
FT                   VEKMVWATRWGADTVMDLSTGKRIHETREWIIRNSPVPVGTVPIYQALEKVGGDPAALS
FT                   WEVYRDTVVEQAEQGVDYMTVHAGVLLRYVPLTARRVTGIVSRGGSIMAAWCLAHHEES
FT                   FLYTRFAELCEILRQYDVTFSLGDGLRPGSIADANDEAQFAELRTLGELARVARAHDVQ
FT                   VMIEGPGHVPLHKIAENVRLEQEWCDGAPFYTLGPLATDVAPAYDHITSAIGAAQIGAL
FT                   GTAMLCYVTPKEHLGLPDRDDVKTGVITYKIAAHAADLAKGHPGAQAWDDALSRARFEF
FT                   RWEDQFNLSLDPDTAREFHDRTLPAEPAKTAHFCSMCGPKFCSMRITQDVRRYAEERGL
FT                   STVEAIEAGMAEKAHEFDDRGGKVYLPVVD"
FT   misc_binding    complement(461149..461277)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 46.85"
FT   gene            461485..462102
FT                   /locus_tag="Amir_0426"
FT   CDS_pept        461485..462102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34393"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34393.1"
FT                   /translation="MWLLDWQELLSAEQLAEGGSGERELAERVLADPVGRHAWTCVDWA
FT                   MTLVTCSQCGAEPTAGPWDCVRCAVTESARWQWDHTATPGAITPAEHALRAARAALRAP
FT                   HRRRSPVVDAWRLLLPFLVAGHGATSADVSRLRAQVIGGSYAELAACGSAVELTGFVEL
FT                   PWRRTSPTGDHQPQPQPHRRRPRQQLEAAPDAGAPQVAPDPV"
FT   gene            complement(462297..462884)
FT                   /locus_tag="Amir_0427"
FT   CDS_pept        complement(462297..462884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0427"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: pmr:PMI2825 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34394"
FT                   /db_xref="GOA:C6WHU3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU3"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACU34394.1"
FT                   /translation="MAVHPIRIAGDPVLHNPTRPVDEHDDELRALIADMYETMAAANGV
FT                   GLAANQIGVDLRLFVYDCPDDEGVRRRGEVVNPVLQTSDVPLGMPDPDDDYEGCLSAPG
FT                   ESYPTGRASWAKVTGTDGNGDPVEVEGTGFFARCLQHETDHLDGYLYLDRLVGRHKRAS
FT                   KKMIKANGWGVPGLSWDPATSEDPFADDEDED"
FT   gene            463048..463332
FT                   /locus_tag="Amir_0428"
FT   CDS_pept        463048..463332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34395"
FT                   /db_xref="InterPro:IPR021678"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34395.1"
FT                   /translation="MDAALAHPAAPGGLDGREREILAFERQWWKYAGAKEQAVRELFDL
FT                   TPTRYYQLLNALIEKEEALAADPMLVKRLLRLRSGRRRARAARRLGVDG"
FT   gene            463329..463991
FT                   /locus_tag="Amir_0429"
FT   CDS_pept        463329..463991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0429"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34396"
FT                   /db_xref="GOA:C6WHU5"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34396.1"
FT                   /translation="MSNPESSGSAQPARAAGYALLGLAGVALVLGVVTLFTGSDDDPQA
FT                   QQQQPAPSASAPAEPGPSSEPPAGEPSASEPPASESAGAPTTTTGQPPATTTEQQPQPQ
FT                   PPAQQPGDQSQGTPATRPSVRVYNNSNISGLAARASDDIGKSGWAVQATGNYPDGIIET
FT                   TTVYYRAGTAEEDAAKQLAQSIRARVMPRFDGIKDAHDGVIVIVTNDYQGPGGKAGS"
FT   gene            complement(464055..464762)
FT                   /locus_tag="Amir_0430"
FT   CDS_pept        complement(464055..464762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0430"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   mes:Meso_0568 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34397"
FT                   /db_xref="GOA:C6WHU6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU6"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACU34397.1"
FT                   /translation="MSTQGTVSPARRRGLADEVADRIREGILTGAYEPGRQLREVELST
FT                   VMDVSRGPVREALRLLEHEGLVHVTWHRGATVTRFSRRDVAELDSLRGALECLAVHEVA
FT                   HRATEEDFAALDRAAEALARAVGAHELAQRDVDFHDAVFAAAHHDRLTRSWGCIRRQVH
FT                   LFLLTRISRDEGLRGGCAEEHRELVAALRTRDAATASALLGEHRRRVFELSDDDDWSDL
FT                   LCPDDCGGERREG"
FT   gene            464849..465946
FT                   /locus_tag="Amir_0431"
FT   CDS_pept        464849..465946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0431"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   gme:Gmet_2577 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34398"
FT                   /db_xref="GOA:C6WHU7"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU7"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ACU34398.1"
FT                   /translation="MSTLFSTLTLRSLDIPNRVWMSPMCTYSAAPSGPEAGVPTDFHLT
FT                   HLASRAAGGAGLVMAEATGVRADGRISPWDLGLWNDAQQEAFARITAAISAHGAVPAIQ
FT                   LAHAGRKASTNKPWLGGGSVADTEHGWQPVGPSPAPFHGLPVPRELTTGEIAALVEDFA
FT                   ASARRALAAGFKVVEVHGAHGYLINSFLSPISNQRTDEYGGTTENRMRFALEVVDAVRA
FT                   VWPEDLPVLFRTSATDWTAEQGGVGWAEDDTVLLAKELQQRGVDLLDVSTGGMAHDAVI
FT                   PVESHYQVRFAAKVREATGLPTGAVGLITEPARAEEVVATGQADAVLLGRELLRDPYWA
FT                   HHAAQELGVDSNWPEQYGYAVRPRR"
FT   gene            466404..468608
FT                   /locus_tag="Amir_0432"
FT   CDS_pept        466404..468608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0432"
FT                   /product="Microtubule-severing ATPase"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: mrd:Mrad2831_5798 AAA family ATPase, CDC48
FT                   subfamily protein; PFAM: AAA ATPase central domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34399"
FT                   /db_xref="GOA:C6WHU8"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU8"
FT                   /inference="protein motif:PRIAM:3.6.4.3"
FT                   /protein_id="ACU34399.1"
FT                   /translation="MITLTARLSPSALDTRRGVVRMHREVLDALGLRQWDAVRLTGARV
FT                   SAALAAAAPDGSPVGVVLVDDITLSNLGVTEGAELVVTPVEVSAARTITVAGSRLASTA
FT                   LTPETLRMALTGKVLTVGDAVSLLPQDLAPPPGADVSATRRKLSAAIGTTWTNELLTIT
FT                   SADPGGVVAVRPSTLVAWRDATAPAPAQAAPPAVDAGITPVTPPPPPAEALPVADLVGQ
FT                   QDAARRLAEWLDLVLTQPELLTRLGAAPRLAALVSGPEGVGKATLVRAVAHAAGTRVVE
FT                   VSAPAIAVLEANATARALADAITQAQSQPGSPAVLVLTDVEALLPAATPPPVATVVLDA
FT                   LRAALAATPLVVTSASPELIDPRLRVPDLVDRELVLPLPDGATRRELLRALLREVPLEP
FT                   DVDLAEVADRTPGFVAADLVAVRREAAVRSALRQRQEAEPRVAQEDLLGSLDTVRPISM
FT                   STSDTLRTGGLTLDDVGDMAEVKQALTEAALWPLQYPDSFARLGVEPPRGLLLYGPPGC
FT                   GKTFLVRALAGTGKLNVLSVKGAELMDKFVGESERAVRELFRRAAEAAPALVFLDEVDA
FT                   LAPRRGQSSDSGVADRVVAALLTELDGVEPLRDVIVLGATNRPELVDPALLRPGRLERL
FT                   VYVPPPDAEARVEILRSASRNTPLAEDVELTALADDLDGYSAADCAALIREAALTAMRE
FT                   SLSATAVTAEHLAKARGVVRPSLDPAQLASLAAYAESRKA"
FT   gene            468892..469416
FT                   /locus_tag="Amir_0433"
FT   CDS_pept        468892..469416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0433"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 4 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 2 domain protein; KEGG:
FT                   scl:sce7901 ECF family RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34400"
FT                   /db_xref="GOA:C6WHU9"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHU9"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU34400.1"
FT                   /translation="MDRQDFTRIARERAVPWRRVAYLICGDWGRAEDLVQAALLRMYKH
FT                   WHRIEPRGLEAYARKVISRLALDEAKRASRRKEVLGEVPDRPAAQFDEEVDGAPEVRAA
FT                   LKAMPPRQRAVIVLRFYADLDVAATAKALGITQGTVKSQCSRGLDSLRAALGPHHAALA
FT                   TRTPERTGGSR"
FT   gene            469413..470174
FT                   /locus_tag="Amir_0434"
FT   CDS_pept        469413..470174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0434"
FT                   /product="DnaJ domain protein"
FT                   /note="KEGG: mxa:MXAN_3349 DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34401"
FT                   /db_xref="GOA:C6WHV0"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV0"
FT                   /inference="similar to AA sequence:KEGG:MXAN_3349"
FT                   /protein_id="ACU34401.1"
FT                   /translation="MNVRKDFFDHAIGRGEPPVELDFEAIEREGADALRRRRRVVPALA
FT                   MAGVAAVAGGIMALATGAGSTGGLVEQGSGGGDPIPATPAPPSRHSQDAGPSSAATDPS
FT                   PAGSTPPDTGSAPSSTAAGSPQVHRADAWTLEPTAVATADRFPICFSKASMAGYGQAGG
FT                   PETVLVRPVPTSSVAPTPDGVDRFDIALDVCRQFWTDNTRGWRAPDAPVPALVRCVLVL
FT                   PQSPEHGSIGVYPGDEGTCRELGFPVATPAK"
FT   gene            complement(470346..471323)
FT                   /locus_tag="Amir_0435"
FT   CDS_pept        complement(470346..471323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0435"
FT                   /product="CDP-diacylglycerol/serineO-phosphatidyltransfera
FT                   se"
FT                   /EC_number="2.7.8.8"
FT                   /note="KEGG: mag:amb0603 phosphatidylserine synthase;
FT                   TIGRFAM: CDP-diacylglycerol/serine O-
FT                   phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34402"
FT                   /db_xref="GOA:C6WHV1"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="InterPro:IPR012616"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV1"
FT                   /inference="protein motif:TFAM:TIGR00473"
FT                   /protein_id="ACU34402.1"
FT                   /translation="MASTAPGVRLLPNAITVLAMCAGLSAVHFAIRGMYGAAIASIAAA
FT                   ALFDGLDGRLARMLDATSKMGAELDSLADSISFGVAPAMVLYVWKFDPDRFGWVVSLVF
FT                   AVCMVLRLARFNTLLDVEQPPYAKEFFVGVPAPIGGLLLLLPLTLDEQLGRSGWWSSTP
FT                   VVAVWTVTVALLLVSRIPTLSIKTIKVPQRLVAPLLVVVALVAAALITFPLAVLVVIEV
FT                   VYLAHLPYAVRRYRWLAKHPEAWEVPPADRRAIRRAHGVAARRLGLRQPMRNRVAGAAR
FT                   RAVRRPRRVDADDVPGPVGSDGAESRRENGGGRRAWRQLGLRRK"
FT   gene            complement(471327..472040)
FT                   /locus_tag="Amir_0436"
FT   CDS_pept        complement(471327..472040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0436"
FT                   /product="phosphatidylserine decarboxylase related protein"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: rce:RC1_1432 phosphatidylserine decarboxylase-
FT                   like protein, putative; TIGRFAM: phosphatidylserine
FT                   decarboxylase related protein; PFAM: phosphatidylserine
FT                   decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34403"
FT                   /db_xref="GOA:C6WHV2"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033175"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV2"
FT                   /inference="protein motif:TFAM:TIGR00164"
FT                   /protein_id="ACU34403.1"
FT                   /translation="MTVDRDKHNSGAVSHFIELAKGIVPPMHPAGRPFVAGAAAATLLL
FT                   RRISKPAGVVGALVTAWVAWFFREPKRTTPTRAGLAIAPADGTVSHVVEALPPAELGLG
FT                   SEPMTRISVFLSVFDVHVQRVPVTGVVRQVSYHAGKFLSADLDKASEENERNTVWLTSE
FT                   EGHEIVVVQIAGLVARRIVCEVSEGDAVAAGSTYGLIRFGSRVDLYVPRGSRVLVEAGQ
FT                   RTIGGETVLAELPGN"
FT   gene            complement(472257..473768)
FT                   /locus_tag="Amir_0437"
FT   CDS_pept        complement(472257..473768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0437"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: sfu:Sfum_1032
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34404"
FT                   /db_xref="GOA:C6WHV3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV3"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACU34404.1"
FT                   /translation="MRAVLAVGLLIGFFVLFTALTVGLCALTVYGFATGREFNAIKIAL
FT                   IAVPLVLILISALYKALKARGEVEGAPLTREAQPGLWAVVDELAAVAGTRGPDEIRLVG
FT                   AVNAAVSEQAPMLGLRAGRRTLLIGLPLLAGLTASELRSVLAHELGHYGGGHTKLSALT
FT                   YRAKEALVHVVDGLDDTFLQRPFAWYAKLYARVAASVNRRQELDADTASVTAAGREAAQ
FT                   SALRKLPVLGAAWNGYQAQFLSLGAQAELTPPVMAGFHAYLSEPERRGRMDEARAELLA
FT                   REPESVFDSHPPIRERVGRMATLPSPEVERDDRPAWTLLSGATADLERSIMVGGGFGPT
FT                   ADWDEVVSVVAREHGERRAGLLAVAGARAGLPGEVSLDDALAALASTGQRDALLGHLLS
FT                   AELLGGEVPEEQRAQVLAGLLGAVLEHELVAAGVGAYEADWDKRWVVRLEDGRAVDGPP
FT                   LFAEVLGGPERAAEAWKRAADVLGTRRARVTRVQRIAEDLVVPTA"
FT   sig_peptide     complement(473673..473768)
FT                   /locus_tag="Amir_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.945) with cleavage site probability 0.448 at
FT                   residue 32"
FT   gene            complement(473915..475120)
FT                   /locus_tag="Amir_0438"
FT   CDS_pept        complement(473915..475120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0438"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: MoeA domain protein domain I and II; MoeA
FT                   domain protein domain IV; molybdopterin binding domain;
FT                   KEGG: afw:Anae109_1445 molybdenum cofactor synthesis
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34405"
FT                   /db_xref="GOA:C6WHV4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV4"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACU34405.1"
FT                   /translation="MDGVSNALTGVAAHKARIADLIGVAPVVELPLADCLGLVLASDAV
FT                   APVALPPFDNSAMDGYAVRVADLAELPVVLPVPEDIPAGRTDVVPLEPGTAHRIMTGAP
FT                   VPPGADAVVQVEWTDAGVRSVRIDRGVRLGQNVRWAEDDVKVGEVALRAGRVLGAAQLG
FT                   LVSALGIPALPVRRRLRVLVLSTGSELVAPGEPLLPGQIYESNGLMLAAAVREAGGEAE
FT                   QLRFVPDDVDRFRAVVEERIGGFDLLLTSGGVSAGAYEVVKDALTGRGVEFTKVAMQPG
FT                   GPQGSGRYLGVPVATLPGNPVSAQVSFEVFVRPALRAAMGFVDVERPTAVARLRGSISS
FT                   PSGRTQFRRGAYDAGSGQVVTPVGGPGSHLLSSLALSNCLIEVPAEVDELADGDEVLVR
FT                   LL"
FT   gene            475190..475798
FT                   /locus_tag="Amir_0439"
FT   CDS_pept        475190..475798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0439"
FT                   /product="protein of unknown function DUF124"
FT                   /note="PFAM: protein of unknown function DUF124; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34406"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV5"
FT                   /inference="protein motif:PFAM:PF01987"
FT                   /protein_id="ACU34406.1"
FT                   /translation="MQVRTRHTPGYGVARLLLAPAEPVLVERGSVLGTSYGVGFDTRAK
FT                   GKGVRAALCTAGPEGGWVDVAPGVPGDLHVVDLDGKSGWCFAGDAWLACAGTVGLDPAA
FT                   PPLRALHGGDAGFLNYAFGTGPLVLACAGAVDVVTLEPGELVTLHSGHVLAFADTVQCR
FT                   LRAVSPDLPQSVRDGEGLALDFAGPGLVLTRTRKPRRRS"
FT   gene            475930..476136
FT                   /locus_tag="Amir_0440"
FT   CDS_pept        475930..476136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0440"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: ank:AnaeK_2630 cold-shock DNA-binding
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34407"
FT                   /db_xref="GOA:C6WHV6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV6"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACU34407.1"
FT                   /translation="MAVGTVKWFNSEKGYGFIAADGGPDVFVHYSAIMMDGFRTLAEGD
FT                   RVEFEIQAGRDGRSQASDVRKAS"
FT   gene            476271..477605
FT                   /locus_tag="Amir_0441"
FT   CDS_pept        476271..477605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0441"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; protein of unknown function RIO1;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; KEGG: ade:Adeh_1074 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34408"
FT                   /db_xref="GOA:C6WHV7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV7"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACU34408.1"
FT                   /translation="MSEDLSGRRLGHYRIDGVLGRGGMSVTYKATDVRLGRKVALKVIG
FT                   EHLTADAEFRERFVDEARNTSAIDHANIVPLYDFDEVDGLLYIAMRLVDGQDLATHIKD
FT                   GPLAPSRALVLLEQVAEALDMLHGKGLVHLDVKPANVLVTTKEATREHVYLADFGLTRR
FT                   GATGHRTRTGDFLGSPTYAAPEHLRGEPLDGRTDQYALACMVFACLTGRPPFQGGVQDV
FT                   IQGHLGSEIPPITSLVSLPPAVDDVLRKGTSKDPAQRFATCHEFITAVTAALGPAAQQT
FT                   TPPRPAGAPAPQQHAGQQHAGPASGGFPAQQGGYPQRPGYQQHQHQQQYPPSEPIRLRP
FT                   PTPVGVSAFSDTKQPRPAWFVPALAGAIAVVVIVILVLVLKPEDEPTRPPSSLPASSGP
FT                   ASPGQALASAPLPGPVLPASALPGAAGVPSAVIGDAQSPSVPPSA"
FT   gene            477845..479467
FT                   /locus_tag="Amir_0442"
FT   CDS_pept        477845..479467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0442"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: bcb:BCB4264_A0298 chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34409"
FT                   /db_xref="GOA:C6WHV8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV8"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ACU34409.1"
FT                   /translation="MAKMIAFDEDARRGLERGMNILADAVKVTLGPKGRNVVLEKKWGA
FT                   PTITNDGVSIAKEIELEDPWEKIGAELVKEVAKKTDDVAGDGTTTATVLAQALVREGLR
FT                   NVAAGANPLGLKRGIEKAVEAVTEQLLKTAKEVETKEQIAATASISAGDSTIGELIAEA
FT                   MDKVGKEGVITVEESNALGLELELTEGMRFDKGYISGYFVSDPERQEAVLEDPYILLYG
FT                   SKIASVKDLLPLLEKVMQSGKPLLIISEDVEGEALATLVVNKIRGTFKSVAVKAPGFGD
FT                   RRKAILQDIAILTGGQVITEDVGLKLDTADLSLLGKARKVVVTKDETTVVEGSGDAEQI
FT                   QGRVNQIRAEIEKSDSDYDREKLQERLAKLAGGVAVIKAGAATEVELKERKHRIEDAVR
FT                   NAKAAVEEGIVAGGGVALLQAAEAAFAGLKLEGDEATGANIVKVAVEAPLKQIAVNAGL
FT                   EGGVVVEKVKGLPVGHGLNAATGVYEDLLAAGVPDPTKVTRSALQNAASIAALFLTTEA
FT                   VVADKPEKAGAAPAMPDAGGMDF"
FT   gene            complement(479947..480444)
FT                   /locus_tag="Amir_0443"
FT   CDS_pept        complement(479947..480444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34410"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34410.1"
FT                   /translation="MNNDIDPRDDHRGNNEDTAVLAELRRLVYELDPPPASLVERIQFA
FT                   VALEDLDVEVARWERSASLTGVRGVGQQGTITFTVDDLTLMVNFTSMGARHRIDGWLVP
FT                   AGEHTVEVRVADHGSTTTKADDVGRFVVPDVPAGTTQIIVHLADGAGGVAGKTVVTPTI
FT                   VL"
FT   gene            complement(480441..481046)
FT                   /locus_tag="Amir_0444"
FT   CDS_pept        complement(480441..481046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0444"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; KEGG:
FT                   sus:Acid_3132 ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34411"
FT                   /db_xref="GOA:C6WHW0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW0"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACU34411.1"
FT                   /translation="MGELRMTGERPPWEGLDGTDRHEVCVIAARSGDRRALDVLIHDLT
FT                   PLVWHVARGHGLDRSTAEDVVQTVWLALLRNLGRITQPRALAGWLVVATRREAQRTWTP
FT                   SRRESSLSDEMAEQQESHIGLPEDAALVDDRDQRLWRAFGKLSQRCQELLRLTVLAGRA
FT                   EYRAVAEALSMPRGSIGPTRGRCLGTLRAHLEAEGGSR"
FT   gene            481427..482101
FT                   /locus_tag="Amir_0445"
FT   CDS_pept        481427..482101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0445"
FT                   /product="CutC family protein"
FT                   /note="PFAM: CutC family protein; KEGG: bcj:BCAL0655 CutC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34412"
FT                   /db_xref="GOA:C6WHW1"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW1"
FT                   /inference="protein motif:PFAM:PF03932"
FT                   /protein_id="ACU34412.1"
FT                   /translation="MLEIIALTPADAAAAQAGGADRLELVADMVSDGLTPSAEVLRDVL
FT                   STTDLPVRVMLRDAPGFAPADPPSLRRAAALLREAGATEFVLGFLGDGGAVDRGACADL
FT                   LAELEGCAWTFHRALDNAADPEAAWPVAVGLGCDTVLAAGSARGVAEGIPVLERLAARQ
FT                   AADGVRLLVGGGLKREHVPGLARAGATSFHVGGAVRARGWDGPVSEPLVREWATLVAEA
FT                   RG"
FT   gene            482648..483922
FT                   /locus_tag="Amir_0446"
FT   CDS_pept        482648..483922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0446"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rle:pRL100263 putative substrate-binding component of
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34413"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACU34413.1"
FT                   /translation="MRFLVAAATTALLLTGCAPVQSGPAPEGGDERAGQLRVWLFDEVN
FT                   RAPKEAVVARAVAEFEAAHEGVTVDVQHIQVASRAERFKAAFSDPASAPDVAEFGNTDL
FT                   AGYVAGGGFAPLDLGDWPDAADLAPRIAETGEVDGQLYGLPWYVGVRALYYRTDVFREL
FT                   DLQPPATLADLAPTARAIRAARPDLLGISAGGKYTYGALPFLWAAGGDVARERDGRHTS
FT                   ALTTPESLAGLRRYTELLADDICPPAQCAANGGDASVEAFRAGKAAMVIGGDFNRKSVD
FT                   DSTAGGKYAVVPLPGETAGSIAPAFAGGNLLGVLKGTRRRTLATEFVQLLGGKRYQREM
FT                   FDAMGNLPTFTDVQAEVAAANPALEPFTRTLEAGTRFVPATPDWAKVDAQGVLPTLIQE
FT                   VATGAKGLDAAAADAAARMNDAFGS"
FT   sig_peptide     482648..482716
FT                   /locus_tag="Amir_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            483919..484830
FT                   /locus_tag="Amir_0447"
FT   CDS_pept        483919..484830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0447"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mxa:MXAN_7294 putative
FT                   sugar ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34414"
FT                   /db_xref="GOA:C6WHW3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34414.1"
FT                   /translation="MTVHSGRSDTRTALAYLAPALLVLVGLLGYPVYQLVVISLFDYGQ
FT                   EQVSGGAPLTFLGLGNYAELLRDSRFWSVLGQTAGFAALCVAGTLLVGATLAVVATRVR
FT                   PWARALLFLTALGAWSTPAVAGSTIWLFLFDASFGFVNEALTALGVEGARDFPWLYGKW
FT                   TAFGVVAAEVVWCSFPFVMLTLYAGIRSIPGEVLEAAALDGASTWRAARSVVLPLLRPL
FT                   LVIVTIQSVIWDFKVFTQVYVMTSGGGIAGRNLVLAVHAYQQAFAASEYGMGAAIGVVT
FT                   TALLLLLTAGYLRALRRGGEPL"
FT   gene            484827..485660
FT                   /locus_tag="Amir_0448"
FT   CDS_pept        484827..485660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0448"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rlt:Rleg2_3667
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34415"
FT                   /db_xref="GOA:C6WHW4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACU34415.1"
FT                   /translation="MRRWAWEAVAVGASLVVAFPLYWMVLTALKPAAEVVSAEPRPWTL
FT                   APSPDSFTRALTVESFGRYLANSLVVAVAVVLLSLVVSFLAATALTRFRFKGRTTMLVM
FT                   LLVVQMVPVEALTIPLFFLVRQVGSAVPVLGLNHLGSLVLVHLAFSLPFAIWMLRGFVA
FT                   AVPVELEEAATLDGASRTRFLWRVLFPLVAPGLVATSALSFIHAWNDFLFAKTFIISAE
FT                   ENQTLPLALQVFVRPDQNDWGAIMAGSTLMTLPVLVFFVLVRRNLVGGLAGAVKS"
FT   gene            485657..487000
FT                   /locus_tag="Amir_0449"
FT   CDS_pept        485657..487000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0449"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="PFAM: Glycoside hydrolase, family 20, catalytic
FT                   core; KEGG: nar:Saro_2417 beta-N-acetylhexosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34416"
FT                   /db_xref="GOA:C6WHW5"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW5"
FT                   /inference="protein motif:PRIAM:3.2.1.52"
FT                   /protein_id="ACU34416.1"
FT                   /translation="MTLLPEPVSVVWGGGTVPWSTPVVRRAPGPAEGYRISISAGGVHV
FT                   DASDDAGEFYAHQTLRQLRGPDAFRAAPIRPDGPVPVCEIVDHPEHRWRGCMIDVARHF
FT                   LPKHDLLRYVDLLAAHKLNVLHLHLTDDQGWRVESERFPRLHEVGGWRPDSRWGDRRGG
FT                   LSTGRPHGGCYTRDDLREVVAYAAARHVTVVPEIDVPGHSQAAIAAYPELGVDGGGVWT
FT                   DWGVNPRVLNGSQSTVDFYRAVFDELLEVFPGEVVGFGGDEAPGGDGRFVRLIAEHLVA
FT                   RGRRPYGWDEVLDVEGLPEETVIAAWRSEEAVERALERGLDVVACPERHAYLDYRQSED
FT                   ADEPIPVGTVLTTEDVRAYRPVAGVLGAQANIWTEHLDSPRRLDYAAFPRLSAFAEVVW
FT                   NPAPVDGAGFAARLGAHLPRLAALGVEYRPPGGPLPWQRLPGVPGHPR"
FT   gene            complement(487001..487255)
FT                   /locus_tag="Amir_0450"
FT   CDS_pept        complement(487001..487255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0450"
FT                   /product="phage shock protein C, PspC"
FT                   /note="PFAM: PspC domain protein; KEGG: cbc:CbuK_0644
FT                   stress-responsive transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34417"
FT                   /db_xref="GOA:C6WHW6"
FT                   /db_xref="InterPro:IPR007168"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW6"
FT                   /inference="protein motif:PFAM:PF04024"
FT                   /protein_id="ACU34417.1"
FT                   /translation="MTNNSLNDAAAKLGEATAQATTKVKQFRRSRTDRMIAGVCGGAAK
FT                   MLGIDAALLRILLVAATLFGVGAGAILYLAAWIFVPEEA"
FT   gene            487494..488600
FT                   /locus_tag="Amir_0451"
FT   CDS_pept        487494..488600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0451"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   msl:Msil_0236 protein of unknown function DUF182"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34418"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW7"
FT                   /inference="protein motif:PFAM:PF02625"
FT                   /protein_id="ACU34418.1"
FT                   /translation="MRDVLPDLVRRVAAGEVVGVGTVVATFSSAPRPPGAAMLVGADGA
FT                   AVGSVSGGCVEGAVHELALGVVGGGAPVLRRFGVSDDDAFDVGLTCGGIIDVYVEAVSA
FT                   AGFPELPLVDASVRAGEAVAVATAVEHPTRAGARLVVWPDRVAGGLGSARVDDAVADDA
FT                   RGLLAAGRSGVLRYGPDGQRRGEGLSVFVNSFEPPPRLLVFGAIDFAAAMARLGAFLGY
FT                   RVTVCDARPVFATAARFPQADEVVVDWPHRYLAAEAAAGRVDRRTAVAVLTHDPKFDVP
FT                   LLEVALRLDLGYVGAMGSRRAHHDRTARLRAAGVGEAELGRLSSPIGLDLGARTPEETA
FT                   VSIAAEMIALRWGGGGARLTTTEGAIHR"
FT   gene            489427..490365
FT                   /locus_tag="Amir_0452"
FT   CDS_pept        489427..490365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0452"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bca:BCE_2879 mandelate racemase/muconate
FT                   lactonizing enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34419"
FT                   /db_xref="GOA:C6WHW8"
FT                   /db_xref="InterPro:IPR010196"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="InterPro:IPR041338"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW8"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACU34419.1"
FT                   /translation="MLVYSIPMRTRFRGITVREGVLLEGERGWGEFCAFLDYSDAECAP
FT                   WLACAVEAAEEGWPAPVRERVAVNCTVPVVSPERAHALVSASGCGTAKVKVADPGAPLA
FT                   EDLERVAAVRDALGPGGAVRVDANAAWDVDTAVTAIRALDRAAGGLEYVEQPCRTVEEL
FT                   AAVRRRVDVRIAADESIRRAEDPLRVAVAGAADVAVIKVAPLGGVRRALRVAEACGLPC
FT                   VVSSAVETSVGMAAGLALAGALPELDFACGLGTLPLLDGDVATASLVPVDGWLPVPTAP
FT                   PVPDRAERFAADPETTLRWRERLARVGRPRG"
FT   gene            complement(490565..492217)
FT                   /locus_tag="Amir_0453"
FT   CDS_pept        complement(490565..492217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0453"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; KEGG: SSL2; DNA helicase; K10843
FT                   DNA excision repair protein ERCC-3"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34420"
FT                   /db_xref="GOA:C6WHW9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032438"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHW9"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACU34420.1"
FT                   /translation="MTDGPLIVQSDKTLLLEVDHPAADEARAAIAPFAELERAPEHVHT
FT                   YRVTPLALWNARAAGHDAEQVVDALVRFSRYPVPQPLLVDVVDVMGRYGRLQLSTHPAH
FT                   GLVLQSLDRAVLEEVLRHKKIKPMFGARIDDDTVVVHASERGRLKQLLLKVGWPAEDLA
FT                   GYVDGEAHPIELVEEGWQLRDYQRLAAQAFRAGGSGVVVLPCGAGKTMVGAAAMAEAGA
FT                   TTLILVTNTVAGRQWKRELVARTSLTEDEIGEYSGERKEIRPVTIATYQVITRKSKGEY
FT                   KHLELFDSRDWGLIVYDEVHLLPAPVFRMTADLQSRRRLGLTATLVREDGQEGEVFSLI
FT                   GPKRFDVPWRDIEAQGWIAPAECTEVRVTLTDAERLGYATAEPEERYKLCSTARTKLPV
FT                   VKAVLDKHPGEPALVIGAYLDQLEELGEALGAPVVQGATKNKEREELFDAFRRGELSTL
FT                   VVSKVANFSIDLPEASVAVQVSGTFGSRQEEAQRLGRLLRPKADGRQAHFYSVVSRDTL
FT                   DTDYAAHRQRFLAEQGYAYRIVDADDLLGPKIG"
FT   gene            492343..492873
FT                   /locus_tag="Amir_0454"
FT   CDS_pept        492343..492873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0454"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34421"
FT                   /db_xref="GOA:C6WHX0"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34421.1"
FT                   /translation="MSSDDARNDTGGKPAPNRRVLAIAAVAVVVLAVAGYAVHVLTGPG
FT                   SSAGECVRITGADGDSLAVTPDDCDADLANFRVGKVVDGADAPCPEEGVYTEARGQGSS
FT                   TLCLLPNMVEGACYGPDDRGFGGLVKSACAGEATIKVTKVIEGSTDTSGCPDGAGMSYP
FT                   EPPITFCVVPADL"
FT   gene            492929..493387
FT                   /locus_tag="Amir_0455"
FT   CDS_pept        492929..493387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34422"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34422.1"
FT                   /translation="MRESGWLIGAAALVLAGGWLLAAPTAGEDLPSAGDCASFVGTADA
FT                   PGYAALDCGAEQANARVLGVADVADACPGSDARPTAGGAVCLGPNLVAGHCYRDDLQMG
FT                   LVRVTCDTFGAVKVLKVANSTFPCEEGDLLTLGDRSIAFCVTRAADSR"
FT   sig_peptide     492929..493012
FT                   /locus_tag="Amir_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.991) with cleavage site probability 0.561 at
FT                   residue 28"
FT   gene            493478..494566
FT                   /locus_tag="Amir_0456"
FT   CDS_pept        493478..494566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Prp2; proline rich protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34423"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34423.1"
FT                   /translation="MTTPPEGPQDPWQPSWRPEPERRPEHSGPAVTPPQRAAQPVFPSQ
FT                   DAPWGAPTGHDRSPDPWPAARPAARPGAADPGPGPRHDPRTEPETPPTGLAQFGFTGEP
FT                   ADRSAFTVNGRISRKSEFAGQRDPARFPDFHRDERSAPPPSDDSLGYAVLVQPLGPGSA
FT                   PAPEVRYRQPWQPTHQEQHPHGPVPAHGTGLARRTKIVLALAAVVPLAAIVALSFGGED
FT                   RRTAVAGAEAGDCLKVNEVSRDGADVEMVDCAAGDAAYRVAVNLPETDRCPPGDYDEYI
FT                   RGGAGNRGFRLCLMLNATDGDCFKEEGGIAASKTTKVRCGSGATYKVAKAHSGTVDELV
FT                   CEFDENPRVYPTPPTTLCITDP"
FT   gene            complement(494631..495632)
FT                   /locus_tag="Amir_0457"
FT   CDS_pept        complement(494631..495632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0457"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems periplasmic components"
FT                   /note="KEGG: twin-arginine translocation pathway signal;
FT                   K02051 sulfonate/nitrate/taurine transport system
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34424"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX3"
FT                   /inference="protein motif:COG:COG0715"
FT                   /protein_id="ACU34424.1"
FT                   /translation="MPTPARVLRRAAALIVCATTLSACGLLPGTSGDETPALERNTLRI
FT                   GVLPVVDVAPLKLALNDKLFERAGLQVQLVDVSSEDEGLKQLDSTLDITWGSHVKLFSK
FT                   VAEGTELQIQGEAYQAGANSMALVTTNPQYDSAEKIKARSANRKPKIAVDSTKDLGALT
FT                   TTSVLQTAGIQSSGVEMVTMPFSQMVNDLRADKVQAAWMIEPYITKAQREVGARVITDT
FT                   ATGPTQDFPMSGYASSKKFADANPQTLKLFRSVLQEAQQAASDDKLAVQDVLTSYIDVD
FT                   QQTAALVSIGTFPVSLNSVRLQRVADMMDTADVLVGKLDVQVLLPEGTASTG"
FT   sig_peptide     complement(495534..495632)
FT                   /locus_tag="Amir_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.973) with cleavage site probability 0.507 at
FT                   residue 33"
FT   gene            496042..499320
FT                   /locus_tag="Amir_0458"
FT   CDS_pept        496042..499320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0458"
FT                   /product="putative sensor with HAMP domain"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; Nitrate and
FT                   nitrite sensing domain protein; SMART: ATP-binding region
FT                   ATPase domain protein; KEGG: mag:amb3383 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34425"
FT                   /db_xref="GOA:C6WHX4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU34425.1"
FT                   /translation="MGDGLAALRDGTVTESTGTGLTTGVRQGEARTASWRLQNWRLPTK
FT                   LGAVLLIPTVAALALGGLRVQSDLANATQFSRLANQVQLETAVADLVHQLQRERDLSTW
FT                   YVASSKQIESVALDRQLVRVSDAVETLKSKIIDLSGDLAPETVERFRGTAEQLTRLNSL
FT                   RSAVRETQYPSDAVLRVYSESVESLLDLGEQAIGGIDDPELARLHLATNAMARIKEQES
FT                   QKRGILFDVFQRGSFAANQERALLAVNAELDAARNDFRKSATPDQAKIYDDTVTGLIID
FT                   TANNMQETALNLAGTTSGFGDISPKGWDVSSTLTVNKTRQVEVMLIEQLQRLSDERTGE
FT                   ARAAAFYDSGVVLGALLMALVMALFVARSILNPLRLLRRTALDVADKGLPEAVEKILAD
FT                   PNPQEAAKTAIAPVPITTREEVGQVARAFDAVHGEAVRLAAEQAMLRDNVNAMFVNLSR
FT                   RSQALVERQLNLIDRLEQDEQDPDQLASLFELDHLATRMRRNSENLLMLSGTDLSRRLT
FT                   RPVPVAEVLGAAVSEVEQYARVQVGQTPELTVQGRAVNDLVHLIAELLDNATAFSDPVT
FT                   KVTVRTARTRKGELAIEIQDRGVGMSDQDLRDANERLANPPDVDVAVSRRMGLYVVARL
FT                   AKRHDVKVRLRGNEDIEGGTTALVTVPEALVTSAGQTAHPMGADLIGSPSAPAPSAFPS
FT                   PNTAQRASGIAGAFGGGNGTAGVTSRHDEESSYPAVSFMSTDVDADATRAPYRAEVPQE
FT                   TSAEISQASWLPMVEEQPPAVARDAQNEPTGTFGSPTLFTAYEDRDAPQADHEHGYQTT
FT                   QFPAVDDSANAFAPFAAPLPEPEPEPEPEPEPEPVVFQRSSAPRASAPARPVVDDTPTE
FT                   RLPIYEAVLSQWFQSVGSETSAATTQAVPPAPAAPAPRPARQDVQPEPQREEAPLPTRK
FT                   PRPVSEQAQEAAAPSSAIENGLPKRQPGSQSNMSKRTLETSRVSEPEAVQAEPAAKASP
FT                   ASVWQSPADEGWQAAQSLLSSTPDATTQAGLPKRKPKAQLVPGSAAPLAGATQQPQQPP
FT                   LPPRSADVIRGRMSSLQQGVRRGRHALIDAYAGDMSSRQDEEQE"
FT   gene            499317..499736
FT                   /locus_tag="Amir_0459"
FT   CDS_pept        499317..499736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0459"
FT                   /product="Roadblock/LC7 family protein"
FT                   /note="PFAM: Roadblock/LC7 family protein; KEGG:
FT                   pna:Pnap_2813 roadblock/LC7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34426"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX5"
FT                   /inference="protein motif:PFAM:PF03259"
FT                   /protein_id="ACU34426.1"
FT                   /translation="MTTAAQPGSFGWLITDFVRRVPGVAHSVVVSADGLLLAGSQGLPR
FT                   DRAEQLSAVASGLVSLTTGAARCFEAGTVNQTVVEMERGYLFLMSISDGSCLAVLAAPN
FT                   CDIGLVAYEMTLLVERVGQQLTPELRAQLQGVVRR"
FT   gene            499962..500510
FT                   /locus_tag="Amir_0460"
FT   CDS_pept        499962..500510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0460"
FT                   /product="protein of unknown function DUF742"
FT                   /note="PFAM: protein of unknown function DUF742"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34427"
FT                   /db_xref="InterPro:IPR007995"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX6"
FT                   /inference="protein motif:PFAM:PF05331"
FT                   /protein_id="ACU34427.1"
FT                   /translation="MAQREVEDSSYDYDDVPNRFDIDGYGSGLFGGPGADLFGAHGLPE
FT                   SVPEQLPYTTGPQPVVRQEEHPAAESGSLVRPYTRTGGRTRPDYDLAIEALISTSERGL
FT                   ERDAAVLPEHRSICGLCTDTRSVAEVAALLRLPLGVARVLIGDMASMGLVLIHQGGMVV
FT                   GDKPSIDFLERVLSGLRRL"
FT   gene            500491..501099
FT                   /locus_tag="Amir_0461"
FT   CDS_pept        500491..501099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0461"
FT                   /product="protein of unknown function ATP binding"
FT                   /note="PFAM: protein of unknown function ATP binding; KEGG:
FT                   nmn:NMCC_1665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34428"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX7"
FT                   /inference="protein motif:PFAM:PF03029"
FT                   /protein_id="ACU34428.1"
FT                   /translation="MGFAGSSPNAAAEGARKPTTSAKIVVAGGFGVGKTTFVGSVSEIV
FT                   PLTTEAVMTEASAGVDDLSATPNKVTTTVAMDFGRVSLDSDLILYLFGTPGQHRFWFMW
FT                   DDLVRGAIGAIVLVDTRRLADAFASIDFFDDRQLPYVVGVNCFDGLLHHRIEDVREALT
FT                   IDQSVPIVTCDARNRQSTKQTLITLVEHAMRQWMSVRAG"
FT   gene            complement(501188..502924)
FT                   /locus_tag="Amir_0462"
FT   CDS_pept        complement(501188..502924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0462"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_2082 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34429"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34429.1"
FT                   /translation="MAIFRRGALVLAVAAATCAFSAGNALATPVAPEASTGAEAERTAP
FT                   GATERLLDLDGDIDLSLSLGGDDHWCHWWTLDDLQDVLGDSPVWSVGDLEDLLDGTTVV
FT                   LDPSDLDDLFDNVLDHTHAVDVDDLLGGNGLLGDIDLDVDAVLGSGGGLLDLGDLLGDG
FT                   DLLGDDLLDLDAVLDLDLNSGNDGLLGGLLGDGDGLLGIDGLLDDGLLDLDAVLDLDLD
FT                   GLLDLDDLLDIDLDADVDADLSIGGGNDGVIVLPGTGSGSGLPSLPGVSGGDSTSGGDT
FT                   APGTVVPGATLPGAVTGLPGTVTDTVEDVTDAVGGIGEVAGDAGEVAGDLTDTAGDIVS
FT                   GAGDLVSGAGDIVDTATTGVQDVLSGASNAVTSATDLASSIAQAATNPITSIAGSNPAT
FT                   APTLPAVTAPTAPVASNPLGTVTSAVGSVLGSVKPVTATVSGSGSLTGSLTGGDSKEGV
FT                   PAQQQPVEQAVEAVQPAVAEVAPAATDIVMTTTAAPMAEAQEDVTEVASDGRLSAAEWL
FT                   WLIHHHDNDGLLGDLLDDLLGLDLDIDADVDLDLGGHGHGGLLGLGGHHGGLLGGLLNI
FT                   GG"
FT   sig_peptide     complement(502841..502924)
FT                   /locus_tag="Amir_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.961 at
FT                   residue 28"
FT   gene            complement(503041..505284)
FT                   /locus_tag="Amir_0463"
FT   CDS_pept        complement(503041..505284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_2891 response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34430"
FT                   /db_xref="InterPro:IPR032830"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34430.1"
FT                   /translation="MSGTTLADWLRAQDDKVLVALLRARPDLATPPPADTSVLATRLGS
FT                   RSSVARACEDLDSLALTALEALLVLDADRAPVPISALRALFKPHRVTVARPVALLRSRG
FT                   LLWGPDSALRVPASARDAVSPFPCGLGRSAPSLADVDLSGLDEGESRVLAALATGRPTG
FT                   QTKDAAHVVSLERATSPIQKLLARGLLVRRDQSTVELPREVGLAVRGDRPLGDVVAEEP
FT                   ALRTQALDPGRVDGTGAGAVLELVRHVEGLVGSWSQEPPAVLRSGGLGVRELRRVAKDL
FT                   DVTEERAALLVELAVAAGLVGDSAGLEPEWVPTAQADPWLAAGPEQRWAVLAQAWLELG
FT                   RLPGLVGGRDDRDRPLNPLAPELARAAAPKDRRRVLEALAELEPGTAVPDVAGLAATLA
FT                   WRAPRRGGRLRDELVRWTVEEGTALGVLALGAATGAGRALLGEGAAAAAKRLADALPDP
FT                   VDHVLVQADLTVVAPGRLEPELAGEMALVADVESAGHATVYRVDERTVRRALDSGRTAD
FT                   DLHELFRSRSRTPVPQSLTYLVDDTARKHGRLRGGPAGSFLRCDDPVLVAEVLAHPASD
FT                   ALELRRIAPTVLVSPLPLAEVLAGLRGAGFAPVAEDAGGQVVDLRAGGRRITGRGRRKS
FT                   PPPPTASPEQLAELVRQLRAGDRAATTTAGARVTVPGNLGSGPSVTLAVLQQAAREGGE
FT                   VLVDFVDGHGTAASRVIKPQVVGGGVLEGVDVGYGEVRRFPLHRITSVAIVHK"
FT   gene            505350..505535
FT                   /locus_tag="Amir_0464"
FT   CDS_pept        505350..505535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0464"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34431"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34431.1"
FT                   /translation="MAKARPERIDPQWPEAPAGHKHAVSELASDVQGALSPFGGTAFPQ
FT                   PLEELGYHHPSTTINR"
FT   gene            505641..507044
FT                   /locus_tag="Amir_0465"
FT   CDS_pept        505641..507044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0465"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: sat:SYN_00517 NAD-dependent malic
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34432"
FT                   /db_xref="GOA:C6WHY1"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY1"
FT                   /inference="protein motif:PRIAM:1.1.1.38"
FT                   /protein_id="ACU34432.1"
FT                   /translation="MPVPGPGYSITVRLEAPPSASAAGDLTSAVGRAGGVITAFDVVES
FT                   HNDRVIIDLTCNALSANHAKDITDTLEQLPGIVVRKVSDRTFLVHLGGKIEISSKVPLR
FT                   NRDDLSRAYTPGVARVCQAIAENPEDARRLTIKRNTVAVVTDGSAVLGLGNLGPAAALP
FT                   VMEGKAALFKKFAGVDAWPVCLDTQDTEEIIRAVELIAPVYGGINLEDIAAPRCFEIEA
FT                   RLREKLDIPVFHDDQHGTAIVVVGALRNALRVVGKDISECKIVVCGVGAAGSAIIRLLL
FT                   KQTPGDVVAVDVDGIVHRDRPGMDPNLASVAESTNKENVSGRLHDALVGADVFIGVSAP
FT                   NLFGAEQVATMNSDAIVFALANPDPEIDPMEAQKHAAVVATGRSDFPNQINNVLAFPGV
FT                   FRGLLDANANTITDEMLLAAATAIADVVDGDRLNASFIVPSVFDTTVAPAVAEAVRKVA
FT                   SELKAAERA"
FT   gene            507285..507758
FT                   /locus_tag="Amir_0466"
FT   CDS_pept        507285..507758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0466"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: eli:ELI_06520 molybdopterin cofactor biosynthesis
FT                   MoaC region"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34433"
FT                   /db_xref="GOA:C6WHY2"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY2"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ACU34433.1"
FT                   /translation="MSQFTHIDASGAARMVDVTDKPATARTAVATGVLRTTAEVVRLLA
FT                   ADDLPKGDALATARIAGIMAAKRTSELVPLCHPIALSGVKVDLELGEAEVRVTATVRTA
FT                   DRTGVEMEALTAVSVAGLALHDMVKAVDPAASMDAVRVERKEGGKTGLWERPA"
FT   gene            507755..508237
FT                   /locus_tag="Amir_0467"
FT   CDS_pept        507755..508237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0467"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; KEGG:
FT                   sfu:Sfum_0070 molybdenum cofactor synthesis domain"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34434"
FT                   /db_xref="GOA:C6WHY3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY3"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACU34434.1"
FT                   /translation="MSAPRAARVVTASNRASAGVYADRGGPLIVGWLRERGYDVPDPAV
FT                   VPDGEPVAEALRAAVADGVAVVITTGGTGISPTDRTPEATRSVLDFEVPGLADAIRTSG
FT                   WPAVPGSVLSRGVAGVAGRTLVVNLPGSTGGVKDGLAVLDAVLEHAVEQVGGGDHR"
FT   gene            508234..508659
FT                   /locus_tag="Amir_0468"
FT   CDS_pept        508234..508659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0468"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   scl:sce2941 molybdopterin-converting factor chain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34435"
FT                   /db_xref="GOA:C6WHY4"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY4"
FT                   /inference="protein motif:PFAM:PF02391"
FT                   /protein_id="ACU34435.1"
FT                   /translation="MTEVLRAAVTEDPISVDEHAKLVEHASAGAVVTFSGVVRDHDHGR
FT                   SVRELEYHGHPSAGDVVAEVVSDVAGRFEGVRAVAVSHRVGPLAIGDVALAVAVSAAHR
FT                   GAAFAVCSELVDEVKRRLPVWKRQVFADGSDEWVNCP"
FT   gene            complement(509101..509775)
FT                   /locus_tag="Amir_0469"
FT   CDS_pept        complement(509101..509775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0469"
FT                   /product="Transglycosylase domain protein"
FT                   /note="PFAM: Transglycosylase domain protein; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: vei:Veis_4083
FT                   peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34436"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY5"
FT                   /inference="protein motif:PFAM:PF06737"
FT                   /protein_id="ACU34436.1"
FT                   /translation="MAVYRGKHRFQSLRANAAVRGIAKVAVAGVIVGAPLAMAGTASAQ
FT                   GSGVNWDAVAACESGGNWSINTGNGYYGGLQFSPSTWSSHGGSGMANQASRAEQIRVAE
FT                   NVMKTQGIGAWPVCGPKGLGGGAAPARTAPAPQQAAPAPQKQSTPQKRATAPVQQQAAP
FT                   VVVALPQSNPNGDYEIKAGDTLSKIASELKVEGGWAKLHELNKQYIPNADLIMSGMKIA
FT                   TK"
FT   sig_peptide     complement(509641..509775)
FT                   /locus_tag="Amir_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.978) with cleavage site probability 0.865 at
FT                   residue 45"
FT   gene            complement(510138..510401)
FT                   /locus_tag="Amir_0470"
FT   CDS_pept        complement(510138..510401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0470"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: ade:Adeh_1120
FT                   molybdopterin synthase subunit MoaE / molybdopterin
FT                   synthase subunit MoaD"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34437"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY6"
FT                   /inference="protein motif:PFAM:PF02597"
FT                   /protein_id="ACU34437.1"
FT                   /translation="MVELTVRYFAGARAAAGVPAETVAVPGAGSGTTVAHVLDVVRAKH
FT                   GANLTRVLAASSFLLDGIAVRDHAAAVSAGAELDVLPPFAGG"
FT   gene            complement(510403..511428)
FT                   /locus_tag="Amir_0471"
FT   CDS_pept        complement(510403..511428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0471"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: sus:Acid_6425 GTP cyclohydrolase subunit MoaA;
FT                   TIGRFAM: molybdenum cofactor biosynthesis protein A; PFAM:
FT                   molybdenum cofactor synthesis domain protein; Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34438"
FT                   /db_xref="GOA:C6WHY7"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY7"
FT                   /inference="protein motif:TFAM:TIGR02666"
FT                   /protein_id="ACU34438.1"
FT                   /translation="MRSAPHVTARPESPSLIDRFGRVATDLRVSLTDKCNLRCTYCMPA
FT                   EGLDWLRGPELLSDEELVRVIGIAVTRLGVTDVRFTGGEPLLRRGLEDVLAATTALEPR
FT                   PRTSMTTNGISLATRAAGLKAAGLDRVNVSLDTLDRERFRELTRRDRLPDVLAGLAAAR
FT                   EAGLEPVKINSVLMRGVNDDEAVALVEFAVEHGYQLRFIEQMPLDPQHGWDRSEMVTAQ
FT                   EILDALGTRFALAPVLARGAAPAERWVVDGGPSVVGVIAAVTRPFCAACDRTRLTADGQ
FT                   VRNCLFSGAETDLRALLRSGASDEEVAERWRGNAWAKAEGHGIDGDGFAQPDRPMSAIG
FT                   G"
FT   gene            511563..512024
FT                   /locus_tag="Amir_0472"
FT   CDS_pept        511563..512024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0472"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bja:bll4976 transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34439"
FT                   /db_xref="GOA:C6WHY8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34439.1"
FT                   /translation="MSEHDVPAEELERFSAHARETGALTALLHGRAAERMGLSTTDEKC
FT                   LGLALAGDVPVTAGRMAELSGLSTGAVTGVIDRLERAGYVRRVRDPHDRRKVLVEVSGP
FT                   RAGEVAVLFREAAEVLEAALRRFTPEERAVVERYQLALLEAVRGRVADA"
FT   gene            512044..512832
FT                   /locus_tag="Amir_0473"
FT   CDS_pept        512044..512832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0473"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   csa:Csal_0794 HAD-superfamily hydrolase, subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34440"
FT                   /db_xref="GOA:C6WHY9"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHY9"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACU34440.1"
FT                   /translation="MGWNYLMDMDGVLVHEEHPIPGSGEFVAELTAAGIPFLVLTNNSI
FT                   YTPRDLRARLSRTGLEVPETAIWTSALATARFLDSQRPGGSAFVIGEAGLTTALHEVGY
FT                   VLTDRDPDYVVLGETRTYSFTAITKAIRLVEEGAKFIATNPDATGPSREGSLPATGAVA
FT                   ALIERATGREPYYVGKPNSLMMRSALRALGAHSENTLMIGDRMDTDVRAGLEAGLRTIL
FT                   VLSGISADSTAELYPYRPTRVLNSIADLVGHSADPFGELG"
FT   gene            512991..513695
FT                   /locus_tag="Amir_0474"
FT   CDS_pept        512991..513695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0474"
FT                   /product="protein of unknown function DUF1503"
FT                   /note="PFAM: protein of unknown function DUF1503; KEGG:
FT                   scl:sce8705 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34441"
FT                   /db_xref="GOA:C6WHZ0"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="InterPro:IPR024344"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ0"
FT                   /inference="protein motif:PFAM:PF07398"
FT                   /protein_id="ACU34441.1"
FT                   /translation="MAERGDGLEAVVRGRFDAPVPACPGWLVGDLVRHVAEVELWWAAA
FT                   LPAGGAAPDVDGVRREVGELFAGAGPDGPRAVSARVEDGAPVWAWWSPTGRTPAAEVLR
FT                   RVAHELVVHHHDARAAVGEPLAAPPEPAEDGVAEFTERLLGGDLARPGVVGLRAVDTGR
FT                   TRSVGSAGDGLRLLTADEADRVRAGGGAEGALSGTAELLHLALWRRAPLERLEVGGSTG
FT                   LARAALAASRLG"
FT   gene            514093..514917
FT                   /locus_tag="Amir_0475"
FT   CDS_pept        514093..514917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0475"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: serine/threonine
FT                   protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34442"
FT                   /db_xref="GOA:C6WHZ1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ1"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACU34442.1"
FT                   /translation="MPAPPRAVAYRRCVERQLYVVGDVHGHLAELTRALNAAGLVDDSG
FT                   DWSGGDAELWFLGDFVDRGPDGIGVIDLVMRLSAQAGESGGRVDSLVGNHEVLLLGMHR
FT                   FGDEDVPGAPTPRSFAKSWNLNGGLRSDQDRLTPEHVEWLTSRDVVHLVDGHLLMHSDT
FT                   LAYLEWGGTVDEVNEAVRAILTGDDLAQWWECWRKMTTRYAFRGPEGGVVAGELLKLMG
FT                   GAEIVHGHSVFADQLGVMPEEVDGPLRYADDRVLAVDAGLYSGGPCLVVELR"
FT   gene            complement(514951..515325)
FT                   /locus_tag="Amir_0476"
FT   CDS_pept        complement(514951..515325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0476"
FT                   /product="protein of unknown function DUF307"
FT                   /note="PFAM: protein of unknown function DUF307; KEGG:
FT                   rpa:RPA0774 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34443"
FT                   /db_xref="GOA:C6WHZ2"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ2"
FT                   /inference="protein motif:PFAM:PF03733"
FT                   /protein_id="ACU34443.1"
FT                   /translation="MRLVLNLIWLVISGFWLAVGYAIAGVICCVFIITIPWGLASFRIA
FT                   NYALWPFGRDVVDRHDAGAASLLGNIIWIVVAGWWLAIGHIVTGLALCVTIIGIPMGIA
FT                   NFKLIPVSLMPLGKVIVDRP"
FT   sig_peptide     complement(515251..515325)
FT                   /locus_tag="Amir_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.764) with cleavage site probability 0.731 at
FT                   residue 25"
FT   gene            515358..516356
FT                   /locus_tag="Amir_0477"
FT   CDS_pept        515358..516356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0477"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; homoserine
FT                   dehydrogenase NAD-binding; Oxidoreductase domain; KEGG:
FT                   similar to dimeric dihydrodiol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34444"
FT                   /db_xref="GOA:C6WHZ3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ3"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACU34444.1"
FT                   /translation="MLRTVRWGIVATGGIADVVTADLLALEGSEALAVSSRKLERAREF
FT                   ATKHGIPRAYGSVEELVADPDVDVVYVATPHAQHRSAARLALEAGKHVLCEKPMTLTVE
FT                   DTRELVELARERGLFLMEAIWTRFNPLIRQVRAAVADGEIGDVRSVRADFGFALPFEPG
FT                   HRLWNPELGGGSLMDLGLYPVSIAQMLLGDPTTIQVTGSLAPSGVDAEAALLLGYESGA
FT                   HALLTSTLTTSPGSYATVFGTEGRIDLHQPAHCPTRVVINDVERTAELEGSGYVPQLRE
FT                   VADRVRAGDTESPDMSWADSLSIARVLAEGVARLGVRYPQPDRDVTPPTAG"
FT   gene            complement(516334..517299)
FT                   /locus_tag="Amir_0478"
FT   CDS_pept        complement(516334..517299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0478"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bbt:BBta_0237
FT                   OmpA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34445"
FT                   /db_xref="GOA:C6WHZ4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR040611"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34445.1"
FT                   /translation="MITCLYKGPALVPKLSVVTEFTGTARPEATPAAALRPPAAPPVPR
FT                   RAPCGEPTVPLARADARPLAPDTGPRPPESPAAHAHQPESHAAHPHQGLAAPPDAAAPP
FT                   DAAAPRPARREPATAPIPAAPTEPPGPIIDAAVALVAEHGARGLRVADVASRAGVSRQT
FT                   VYNEHGNKQRLVEAVALVKTTEFVDAARACLARAPGAVEGVAEAVRQVHALTRLDPLAR
FT                   SVLTGTDADDMLPMLTTRGGWVLDLVVPAIGEHLARHRPDLPPARVAFAADVLTRLALS
FT                   HLLTPDHGADGEVDRAVDLAVEAVTGVAVALLGPSPRWAG"
FT   gene            517475..518131
FT                   /locus_tag="Amir_0479"
FT   CDS_pept        517475..518131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0479"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: afw:Anae109_2037 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34446"
FT                   /db_xref="GOA:C6WHZ5"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ5"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ACU34446.1"
FT                   /translation="MPLTIGFDLDMTLIDPRPGMAAVMEAVRAESGYPIDGAHFAANLG
FT                   PPLDVSFRGYGVPEEDVPVLVARFRALYPEIVIPATVALPGAAESLDAVRELGGTTVVV
FT                   TGKYRANAALHLAAFDWEVDHLFGELWSTGKAEALKLHGASAYVGDHVGDVRGAKAAGA
FT                   LSVCVVTGPCDERELVEAGADVVMPDLTGFPAWLRENADRLRATGRAALEAERPA"
FT   gene            complement(518202..518405)
FT                   /locus_tag="Amir_0480"
FT   CDS_pept        complement(518202..518405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34447"
FT                   /db_xref="GOA:C6WHZ6"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34447.1"
FT                   /translation="MTTARMMPLAVGLFAIGVVALVAMFAVGSPGLPGWVFALGLLCSP
FT                   AGLALGVITVIRDSRRPRARQG"
FT   sig_peptide     complement(518319..518405)
FT                   /locus_tag="Amir_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.869 at
FT                   residue 29"
FT   gene            518534..518929
FT                   /locus_tag="Amir_0481"
FT   CDS_pept        518534..518929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0481"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: bcy:Bcer98_3497 cold-shock DNA-binding
FT                   domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34448"
FT                   /db_xref="GOA:C6WHZ7"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ7"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACU34448.1"
FT                   /translation="MRAVPTGKVKWYDSEKGFGFVTQDGGEDVYVRKSALPEGVDALKA
FT                   GQRIEFGMAEGRRGPQALSVRLVDPAPSVAEARRRPADELNVVIEDLIRLLEQRVQPEL
FT                   RRSRYPERKSAKLVADALRAIARDLDP"
FT   gene            complement(519009..519494)
FT                   /locus_tag="Amir_0482"
FT   CDS_pept        complement(519009..519494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34449"
FT                   /db_xref="InterPro:IPR024495"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34449.1"
FT                   /translation="MRRAVVLTALPLLLATGCGAPPHPEVTFYADGRTVVVAPTQYCDL
FT                   DSENCDVDPSAAGVLRVRPGKPVQISVPAQLADSVWAVAFTYRDAAGVTQEPMRSKVFT
FT                   PNNPQHAYTLQLPNDTDQLESVEVQQLGTRIEGSTTAAVDFVARGTWVLSVDDRQRG"
FT   sig_peptide     complement(519435..519494)
FT                   /locus_tag="Amir_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.781) with cleavage site probability 0.599 at
FT                   residue 20"
FT   gene            complement(519518..521248)
FT                   /locus_tag="Amir_0483"
FT   CDS_pept        complement(519518..521248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0483"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mrd:Mrad2831_4876 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34450"
FT                   /db_xref="GOA:C6WHZ9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WHZ9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34450.1"
FT                   /translation="MSPSDDRDHPRGDHPREDETRPERGGAGRERSDSAPWETYDPDGY
FT                   DRLSRERGRGRAERDHYDREAYDERGRERGGADRDTVPTGQAGPRRTKPIPGRDERTRP
FT                   THKPTQLPRKLTVTRVALYRARLLSSVGLGRLRTAAHADGAGESGLSSLTYAVMLGLAA
FT                   DAALAVALANALFFSAGVDESRTRAGLYLLVAAVPFALLAPLLGPALDHLRRGRRWALA
FT                   GSCALRVAAAVVLALHFDGWALYPAALVSVLLSRSFTALREAITPEVLPPEVERARADA
FT                   RLTAFGLVAGVVSGLAAIGLVNTFGPPGALWLSAALCVANTWCCLRVPARAEVAEGGTP
FT                   GARGQGAAGRDAKGPDAKGPDAKGQDAKGRERGRRALGRAVVAALWANGSIRVLAGFLV
FT                   LFAAFLVRAEVEYDPVQQLLLLGVVVAAAVAGGLLGGVVGARLPAGSPDRVLIGCVGAA
FT                   LASALLAAALPGLTTVAVVGLVGAAAGTLAKATLDAVARDELPERSPALVRPEALLRLG
FT                   WVFGGALGVLLPTEQWIGFAVVSLLLALGLAQVVLTWRGRSLLPRIGGDRQAGAGAADG
FT                   "
FT   gene            complement(521305..522084)
FT                   /locus_tag="Amir_0484"
FT   CDS_pept        complement(521305..522084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0484"
FT                   /product="glutamine cyclotransferase"
FT                   /note="PFAM: glutamine cyclotransferase; KEGG:
FT                   sus:Acid_3566 glutamine cyclotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34451"
FT                   /db_xref="GOA:C6WI00"
FT                   /db_xref="InterPro:IPR007788"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI00"
FT                   /inference="protein motif:PFAM:PF05096"
FT                   /protein_id="ACU34451.1"
FT                   /translation="MVPVVVVAVLSGCSSGGDGVRSTEPAGPSTPATARPEVLGTIPHD
FT                   PAAFTQGLEVSGDALYEGTGLEGRSSIREVDPATGEVRRKLDLPSPLFGEGITVVGERI
FT                   WQLTWRDGVAIERDRASLAEVRRVPYEGEGWGLCLDGDRLVMSDGTADLTFRDPATFEE
FT                   RGRVAVTRAGEPLEDLNELECVDGRVWANVWQTDEVVRIDPVTGAVDLVADLSSLRPEG
FT                   VPASDVLNGIASVPGSDEFLVTGKNWPSMFRVRLPPG"
FT   gene            522145..523071
FT                   /locus_tag="Amir_0485"
FT   CDS_pept        522145..523071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: GL17023 gene product from transcript GL17023-
FT                   RA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34452"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI01"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34452.1"
FT                   /translation="MRHNPPVTATPTQQPQPVLADPAAVRLARDAAQEEAGSEHVGAHV
FT                   GVLVEDETSVTHFFEADHAGYRGWRWAVTLATAGEGSPVSVSEAVLLPGNDALVAPQWV
FT                   PWNERVRAGDLGVGDLLPASPDDPRLAPGYVGSEDPAVEEVALEVGLGRVRVLSREGVL
FT                   DAAERWRGGDFGPRSEMARSAPAACGTCGFYLRVAGALGAAFGVCGNELTPADGHVVHV
FT                   EYGCGAHSEVEVEGGSAVPVADVVYDDALLEVEVNEPVGRSDNDTADAAAGGATAGEGD
FT                   TPGAVDEVERVSDGSGATGVSGRATSR"
FT   gene            523068..525896
FT                   /locus_tag="Amir_0486"
FT   CDS_pept        523068..525896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0486"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_3709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34453"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34453.1"
FT                   /translation="MSADHFGTEALRESVLAAWRGSPTRFREDANAEEDLRLGGYRDRL
FT                   LVELAQNAADAAGAEPGVLRLSFVDGEFRAANTGAPLTADGVTALASLRASAKSSDAVG
FT                   QFGVGFAAVLAVTDAPRVVSTSGGVAFSAARTREAVPELASKRGGDVPVLRLVWPTDEA
FT                   GPPEGFATEVRLPLTAVDGDALLRECAEQAPDLLLALPGLRRVEVGSRAWDRAEDGDKV
FT                   VITGPDGERAWLVHRVGGELPERFVQGVESRPVWSACWAYPVDGALDGEVLHAPTPTDE
FT                   KLSLPARLIATLPVEPSRRRVLVGPAAEHVLAMAARAYPALVAALPAVERTALVPLPGF
FT                   PLSEVDGVLRQGVLAALRDAEWLPKADGGWTSPRRAKVLDSPSEDLVDLLEDVVPGLLD
FT                   AELVLPEHARALAALDVPRMPVAEVVAALAGIGGEPGWWHDVYTALQPWADVDSSAREE
FT                   LGALPVPLADGRLVSGPRGVLMLDEPIDFERTGLRVAHPEAVHPLLLRLGAVEAGAAEV
FT                   LDSDAVRDAVRHSGDDPDEDLVHGVLSLVARAGGRPWLGELVLPEAGGGWRRADELLLP
FT                   DAPLREVLADDAPFGVLDAEFAADWPRDVLSAVGAADGFTVLVDDEPTGPDHDLADEAD
FT                   WWDAADEPPSRVVGVRDLDLVAEGKWTRALELMASDPEVWRAVARRDGYAGWWLARYAR
FT                   IDGRAPRAWRLPGAVELEGLYDPVGSELPAHVLAAAGVRTELVVHDEDDVVDLLARLGD
FT                   AERVVPDALVLKAHAALAEVAPDVREGAVEPPDHVRVLTGAVVSADDVVVPDLPWLLAV
FT                   LPGEQVLAADGGAAELAELLELPLASEEVVGSLRSEGDEVVWAELGAVRVACALLGVEL
FT                   PRGTVVVHDELVVHAEGEEHEVPWWVDGEVVHAADTPEGLARALAWTTGRWADRHTFAA
FT                   LITEPTPAVLLG"
FT   gene            complement(526006..526251)
FT                   /locus_tag="Amir_0487"
FT   CDS_pept        complement(526006..526251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0487"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34454"
FT                   /db_xref="GOA:C6WI03"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34454.1"
FT                   /translation="MAELPPPPPLPPRLTDPVPPIVVGSALWLVALVVTLLIGAPAVVV
FT                   WTCAAGGALGVIGFGIFAWQRSAARRGSRTAQSGLQ"
FT   gene            526391..527830
FT                   /locus_tag="Amir_0488"
FT   CDS_pept        526391..527830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0488"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: acp:A2cp1_3490 xanthine/uracil/vitamin C
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34455"
FT                   /db_xref="GOA:C6WI04"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI04"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ACU34455.1"
FT                   /translation="MGLDGFFKITERGSSVGREVRGGVVTFVAMAYIVVLNPLILGSFS
FT                   ADDPSAKTDITGAILPVPQVAAVTALVAGVMTILFGLIANYPFALAAGLGINSFVAVTL
FT                   APQMTWPEAMGLVVVNGVVVLLLVLTGVRTAVFNAVPNELKAAIAVGIGLFICFIGLVD
FT                   AGFVRRIPDAAGTTVPVGLGIGGSIASWPTLVFVVGLLVTGILVARKVRGAILIGVLST
FT                   AVFSIVLEALVKAGPSAGTNPKGWNLGYPAVPDSFFSLPDLSLVGEFSFGAWTRLPALA
FT                   AALLVFTLVLTDFFDTVGTMTGLGKEGELIKEDGQLPNVSKALLVDGVGAVAGGAASAS
FT                   SNTVFIESASGIAEGARTGLANVVTGLLFLVAMFFTPLYEVIPVEAAAPALVIVGALMV
FT                   AQVKEIDFSDFSIALPAFLTIVVMPFTYSIANGIGAGFISYVLLRALTGRARSVHPLMW
FT                   GTAVAFVVYFGIGPIQALIMN"
FT   gene            527995..528441
FT                   /locus_tag="Amir_0489"
FT   CDS_pept        527995..528441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0489"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bvi:Bcep1808_5100 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34456"
FT                   /db_xref="GOA:C6WI05"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI05"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACU34456.1"
FT                   /translation="MRYANYVAETDDHGLASRLRLAIIRLNRRLRAQRVNSTISLTQVS
FT                   ALSTLHKCGPLTPGELAAKEGVQPPSMTRVIAALEELGFATRRPHPTDGRQAIVELSPS
FT                   GMQYINAEVSAREAWLDQHLAELTPEDRAVLSRAAEIIDRMAGQ"
FT   gene            528446..529831
FT                   /locus_tag="Amir_0490"
FT   CDS_pept        528446..529831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0490"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: bpy:Bphyt_5813 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34457"
FT                   /db_xref="GOA:C6WI06"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI06"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34457.1"
FT                   /translation="MPAYAEGSQTDRPDRDTALPPPKRKRPGTFSSLKVRNYRLYASGQ
FT                   VVSLVGLWMQRVAQDWLVLELSGGDPVALGLAAALQFAPTLLLSLWAGVLADRLDKRRL
FT                   LLVLETGLGLCALALGLLEVLGAAELWHVYLLCLLLGAVSAVETPVRQSFVVEMVGRDQ
FT                   LTNAVALNSMTFNLARMVGPAVAGGLIVVVGGTGWVFLINAASFVAVIAGLLLMRPAEL
FT                   HRGEPVPREPGQLREGLRYVRKRPDLVILLFLVFFVSTFGLNFYVTLAVLARNTFGGDA
FT                   DAYGLLSTLLAVGTLAGATLAARRSTRGAKPRPVLLVVGALAFGVLEIVAGLMPTLWLV
FT                   GLVLIPVGVAMMTFTTTANATVQLSVTPAMRGRVMGLYMLVFLGGNPVGGPVMGWLADH
FT                   FTARAPLVVGGAVSIVAALVGALVLARRGGMPLPVVRLSRRRAGPDQAVPAAATPAAAT
FT                   PDA"
FT   gene            529828..531102
FT                   /locus_tag="Amir_0491"
FT   CDS_pept        529828..531102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0491"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: gdi:GDI0684 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34458"
FT                   /db_xref="GOA:C6WI07"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI07"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34458.1"
FT                   /translation="MTATGAPPAPRRAGAFSSLRLRNYRLYASGQLVSLVGLWMERVAQ
FT                   DWLVLQLSGGDPIALGVATALQFGPVLALSMWAGVLADRLDKRLLLIGLQSGMAVLALV
FT                   LGLVDLSGVAQLWHVYLLCLAGGVLSAVEAPVRQSFAVEMVGREQVANAVALNSMTFNA
FT                   ARMIGPAVAGGLIVVVGTGWIFLIRAASFAGVLAGLALMRAAELHRGAPVAKARGQLAE
FT                   GLRYLRGRPDLVAVMLVVFLVGVFGLNFHVSLALLASDTFGGDADAYGLLTTTMAVGTL
FT                   AGAAMAARRSAPGPRLLVGGAAAFGVLELLSGLMPTMLTAALALIPVGAAMMTFTTTAN
FT                   STVQLAVAPGMRGRVMGVYMTVFMGSAPLSGLLTGWVADRFDARAPLVLGGAVSVLAAL
FT                   LGALVLARANRMGDTSSQNSEVRLT"
FT   gene            complement(531287..531916)
FT                   /locus_tag="Amir_0492"
FT   CDS_pept        complement(531287..531916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0492"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34459"
FT                   /db_xref="GOA:C6WI08"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI08"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ACU34459.1"
FT                   /translation="MAQYVLPDLDYDYGDLQPAIIGEINELHHSKHHAAYVKGANDTLE
FT                   QIDEARDKSAFGSIVGLETTLAFHLAGHALHQVWWKNLSPNGGDKPSGELAAAIDEHFG
FT                   SFDGLRAQLNAAAGSIQGSGWGILAWEPVGQRLITQQLKDHHSNLSIATTPLLVFDIWE
FT                   HAYYLQYRNLKADYIGALWNIVNWDDVNARFEAARAGQNGLLLPTR"
FT   gene            532020..533633
FT                   /locus_tag="Amir_0493"
FT   CDS_pept        532020..533633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0493"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: scl:sce6528 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34460"
FT                   /db_xref="GOA:C6WI09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI09"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34460.1"
FT                   /translation="MSALAARNLSLSFGPRTVLSEVDLDVPAGERVGLVAPNGVGKSTL
FT                   LKVLAGELTPERGTVTASGPVAHLTQETAVEPGESLRDHLARRTGVADAEAAFERAAQA
FT                   LAEGAPGAEDAYATAFDRWTAVGAGDFAERADEVCQRLGLPADLLDARGSGELSGGQSA
FT                   RLRLASVLLVRADVLLLDEPTNDLDADGLELLEAHVLGTRAAVVLVSHDREFLSRTITA
FT                   VAELDEFTHGLTAFGGGWDAYLAERDAAARRAQEDYDEYAAKKDALTRRARTAKEWSRA
FT                   GVRRNAKSDERDKFIKFFAKQGAENTAGKGAAADRALERLEEVEEPRKPWELRLTLPAA
FT                   SGGSRVAFTLRGAVVSRGDVTLGPVDLTIGAGERWRLTGPNGSGKSTLLGAILGRVPLD
FT                   AGERSEGSVVVGEIDQVRGAFSGATPVLDVVVAATGLAEAEARTLLAKFRVGADVVLRP
FT                   AGTLSPGERTRAALALLQARGTTCLVLDEPTNHLDLAAIEQLEQALAEYAGTVLLITHD
FT                   RRLATSVGVDHALDVRSLAR"
FT   gene            533638..534048
FT                   /locus_tag="Amir_0494"
FT   CDS_pept        533638..534048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34461"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34461.1"
FT                   /translation="MGTEEDWPVEQTWSMRNTHWHAYVEHTSLDSASPRAERLERAPEE
FT                   VLTTPTEVAAWLEVNLRSATKPEETGKKRAKDERDFSDSHRVHVSLASRGESIYTGVKG
FT                   MLTLAVEAVTPDDCRSSHDGADVAPLKAGRRR"
FT   gene            complement(534080..535573)
FT                   /locus_tag="Amir_0495"
FT   CDS_pept        complement(534080..535573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0495"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   scl:sce0051 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34462"
FT                   /db_xref="GOA:C6WI11"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR016602"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI11"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ACU34462.1"
FT                   /translation="MGRDVSTRTFTGEDRRHYRERVQRCLDALGTMLAEDCFSFPRQQM
FT                   GLEIELNLADRAGLPAMRNAEVLEKIDDPAFTLELGQHNLELNVPPRELAGDHTLGLER
FT                   DLRALLGVADAKAQDAGASLVMIGVLPTLRPEHFDRRWLSHNPRYSLLNDQIFAARGEE
FT                   LVLSLEGAPLPGRDAERLLSRSESILPEAACTSVQLHLQVAPEDFAAHWNAAQCLAGVQ
FT                   VAIAANSPFLLGRALWHETRIPLFQQATDTRPQELQNQGVRPRVWFGERWITSIFDLFE
FT                   ENVRYFPALLPETGDEDPVDVLGSGGTPRMTELRLHNGTVWRWNRPVYDVVAGVPHLRI
FT                   ENRVLPAGPTVLDTLANAAFFYGAQRALSSMDRPLWTQMSFQAAEENLYAGARHGMNAQ
FT                   LYWPGIGWVPPDELVLRRLLPLAHEGLRDCGVSDEARERYLGVIEARCLAGRTGALWQR
FT                   EVVAGLEERGAGREGALAGMLARYVERMHEGEPVHTWSV"
FT   gene            535700..536551
FT                   /locus_tag="Amir_0496"
FT   CDS_pept        535700..536551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0496"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   mes:Meso_2208 tRNA/rRNA methyltransferase (SpoU)"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34463"
FT                   /db_xref="GOA:C6WI12"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI12"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACU34463.1"
FT                   /translation="MQVTGLRFRPLDYERHSQCETVRVAEVIEIDDPDDPRLDDFRDLS
FT                   TADRRPDRPGGRGLVIAEGVVVVERLLASPYPVRAVLGVRRRVEALGELPAPAYVASAD
FT                   VMARVVGFHLNRGVLAAADRAPQPSLDELATGRRLAVLEGVGDHENLGALFRNAAALGI
FT                   DGVVLGPGCSDPLYRRSVRVSMGHVLRVPFAAVDDWPGGLKLLQDKGFVVAALTPRVGS
FT                   VELPDAGLRGRRVAVLLGSEGPGLTEEAIGAADVAVRIPMSPGVDSLNVATAAAVAFYA
FT                   IA"
FT   gene            536593..537243
FT                   /locus_tag="Amir_0497"
FT   CDS_pept        536593..537243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0497"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34464"
FT                   /db_xref="GOA:C6WI13"
FT                   /db_xref="InterPro:IPR024244"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI13"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34464.1"
FT                   /translation="MELRVQEGRAVLAGHDGAEEREVDPRSLPLGAGLADALHEWAKVA
FT                   EAVLRADSASEAPAGELVTRRGRQLAVRLAADMGTSVEFTDPVTGESQRVEAPSPEEEA
FT                   RGRHAATSTATGLSAVPGVGQHASVVDEPTPWGTGLTVTVFTAAVVAVTVVSLSLGLNE
FT                   TSGWLAVLANALVVGGISPSVWLGRKVPVWRWVSYGVVVGVVAAWVALLAALL"
FT   gene            537256..538983
FT                   /locus_tag="Amir_0498"
FT   CDS_pept        537256..538983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0498"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; dienelactone hydrolase;
FT                   phospholipase/Carboxylesterase; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34465"
FT                   /db_xref="GOA:C6WI14"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI14"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACU34465.1"
FT                   /translation="MELTAELVVSGLRVGGPAVSPDGRSVVFAARGVGDGAEERPEGLR
FT                   WCGEPAELVFRVGGQLCAVGASGPARVLADLPEGVRWHLPLASGEVALAVPGLGGASRL
FT                   SLLDPVSGVSRAVDLGDRHVAEAAQRPGGGPLAVLTWEGPGYDPGLLRPRLHLVELEGL
FT                   AVRDLGPVAAGAEGLAWWRSGDRWRLAHLALTPPGLQAGMAVFDAEVPESGAIVEHVNR
FT                   TAGMAACPLELVQVERGAPLVLVAAGLDTEVHRLGADGLTLLARHEARVERLAADGAGE
FT                   VVAAVVSRADAPPDVCSGPVGGDLTRVSDSRPELRGIRWGERRRLSCVAVDGVELDGLL
FT                   VLPPGKAEADGPFPMVVLPHGGPYDRHADGFALDWHPSAQWLAHAGFAALLPNPRGGSG
FT                   RGHEFAAAVAGRAGHEELGDLLALLDHVVGLGVADPERVGIAGWSHGGYLAAWAVATTD
FT                   RFAAALVGAGVSDWGRQGAEGEWGAFDAALACGEAEEHDPVARAGGIRVPVLVVHGAED
FT                   VNVPVSQAELLRDALVEHGVEHELVVYEGEGHVIEGVEQQVDLLERTREWFTRWLGVR"
FT   gene            complement(539369..540679)
FT                   /locus_tag="Amir_0499"
FT   CDS_pept        complement(539369..540679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0499"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF894 DitE; KEGG: lpp:lpp1608
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34466"
FT                   /db_xref="GOA:C6WI15"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI15"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACU34466.1"
FT                   /translation="MRRLLGKIAIDTRPLGIPAYRRLWVSTIVTAVGSQLTAVAVPKQV
FT                   YDITGSSAWVGVAAGVALVPLLVFGLYGGAVADVVDRRKLLLVTNTGIAVTSVLLWVQA
FT                   AVGMSSVWPVIALLGLQQVFFAANAPARTASIARLVPPEMIPAATSLGATVMTFGGVFG
FT                   PMAAGALMPVLGLPTLYLIDAVALTATIWAVWKLPPLPPLNAPSRHAGLRDVVDGFKYL
FT                   AVQKVLLASFLLDIIAMVFGMPRALFPEMAEQTFGDPPGGGWALGWLFAAMPLGGLLCG
FT                   LLSGWTSRISRHGAGVVLAVIAWGLFMLGFGLSNALWLAVLFLALGGAADIVSMVFRNA
FT                   ILQTAASDDMRGRMQGVFIVVVAGGPRLADLAHGTTGALIGPGPASAVGGVLVVIATVA
FT                   AAFLLPVVWRYRFTPEQLGPPAGKAGPAGPVGPAGKV"
FT   gene            540751..542352
FT                   /locus_tag="Amir_0500"
FT   CDS_pept        540751..542352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0500"
FT                   /product="polysaccharide lyase family 8"
FT                   /note="PFAM: polysaccharide lyase family 8; polysaccharide
FT                   lyase 8 alpha-helical; KEGG: vvy:VVA1636 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34467"
FT                   /db_xref="GOA:C6WI16"
FT                   /db_xref="InterPro:IPR003159"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012970"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR038970"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI16"
FT                   /inference="protein motif:PFAM:PF02278"
FT                   /protein_id="ACU34467.1"
FT                   /translation="MSDLDVVRARLRPPHQPGPGLPPLPDGTWADIDYADHDAADFPPL
FT                   EHLRRALSLPDGQRLKALEAWRRLAPRSDNWWYNEIGAPRLVGDALLGADLDRAQRATW
FT                   GTWLAEQAGPVPMTGQNLVWAQGIELRRGLVEDDPELVRRAVARMSEVLRTGDGEGIQE
FT                   DLSFHQHGPQLYSGGYGASLVADLALWVRAVHGTPWAFGAAEVRLLADFLVDGQQWAVH
FT                   GGGFDFTTMGREIARADAHHRTADLRAAVLRLLECDPPRTAELTAFDDRLAGHGAPLVG
FT                   TRWYPRSDYLVHRRPGWSLSVRMSSGRTVPTECLNGENLLGRHLGDGVAALRLGDQAED
FT                   GYRSVLPVWDWARLPGVTTEQGRSLRPRPDQPRGGGEAIGWSDGENGVAALRLAGVEGF
FT                   TEGWKTWFCFADAVVALGAGITAPDAVGPVVTTIDQRLADHGSVTYVPMTTGHFSGVER
FT                   RTGSWRDLSGVESGRPVEADVFVMGFDHGPRPENASYACLIAPGDELPEVEVLANRVDR
FT                   QAVRCGSVVLERSMAG"
FT   gene            complement(542596..543255)
FT                   /locus_tag="Amir_0501"
FT   CDS_pept        complement(542596..543255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0501"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /EC_number="1.4.3.5"
FT                   /note="KEGG: rpi:Rpic_0717 pyridoxamine 5'-phosphate
FT                   oxidase; TIGRFAM: pyridoxamine 5'-phosphate oxidase; PFAM:
FT                   pyridoxamine 5'-phosphate oxidase-related FMN- binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34468"
FT                   /db_xref="GOA:C6WI17"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI17"
FT                   /inference="protein motif:TFAM:TIGR00558"
FT                   /protein_id="ACU34468.1"
FT                   /translation="MSEATTSITLPAMRVSYERSALGEGDLAATWHEQLQLWLDEATNA
FT                   GLLEPNAMVLATADPSGRPSSRTVLAKGLDERGLVFFTNYTSAKSHDLMATRYASTTFP
FT                   WYGLQRQAHVRGTVEKVSHAETTEYWESRPRGSQLGAWASPQSRVVTGRPTLESALNKI
FT                   ERQFTDTERVPVPPHWGGWRIRPEEVEFWQGRQDRMHDRLRFRLGRDGWETERVAP"
FT   gene            complement(543312..544157)
FT                   /locus_tag="Amir_0502"
FT   CDS_pept        complement(543312..544157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0502"
FT                   /product="urease accessory protein UreD"
FT                   /note="KEGG: scl:sce6547 urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34469"
FT                   /db_xref="GOA:C6WI18"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI18"
FT                   /inference="similar to AA sequence:KEGG:sce6547"
FT                   /protein_id="ACU34469.1"
FT                   /translation="MKAFARLVAERNPNGRTVIREMRSATPLTLVPARGARSDAHALVH
FT                   LVSSITAPLGGDELELRITVGPGAALVLRGVAATVALPGHRPGGSRSRVLLEVAEGGSV
FT                   EHLPEPTVVTARADHEAVLEAELAEGARLRAREVLVLGRLGERPGRLTTTTSVRRGGPL
FT                   LRQSLTIGDERGGPDTVDTSPAGLAGRRVIGAEVLCWGEDPAGPVSGDWWSLVPLARGG
FT                   SLATALGDTVIEVERALTGACGSHPGSSELLTRSRARFRADGHTLRVRSHRPGGSAQDR
FT                   "
FT   gene            544235..544771
FT                   /locus_tag="Amir_0503"
FT   CDS_pept        544235..544771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34470"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI19"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34470.1"
FT                   /translation="MSRTTTALVATAAILAAGGAAGASASAGASPEPVAAAASVPTCRS
FT                   AGLDIAFGEVQGTAGTTYREIALVNRGLRPCALRGFPGVSYVDQQGDQVGPAAERVGGP
FT                   GEVLVLPRGGTATADVGFVRVGNFDPEVCHPVPVWGVRVFPPDGTEPLYLPLDGEHGCA
FT                   DARVGSHLTVASVRS"
FT   sig_peptide     544235..544324
FT                   /locus_tag="Amir_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.424 at
FT                   residue 30"
FT   gene            complement(544741..545454)
FT                   /locus_tag="Amir_0504"
FT   CDS_pept        complement(544741..545454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0504"
FT                   /product="urease accessory protein UreG"
FT                   /note="TIGRFAM: urease accessory protein UreG; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: scl:sce6551 urease
FT                   accessory protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34471"
FT                   /db_xref="GOA:C6WI20"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI20"
FT                   /inference="protein motif:TFAM:TIGR00101"
FT                   /protein_id="ACU34471.1"
FT                   /translation="MSADHGHGHGHAHPVNFDPTDAGHDPHVPAPDARRAVRIGIGGPV
FT                   GSGKTALTAALCRALGGRVDLAVVTNDIYTTEDADFLRRAGVLPTERIEAVQTGACPHT
FT                   AIRDDITANLDAVEELEQRFPGLELVIIESGGDNLTAVFSRGLADAQVFVVDVAGGDKV
FT                   PRKGGPGVTTADLLVINKTDLAPLVGADLGVMTADAHRMRGELPVIAQSLVETPDAPAV
FT                   AEWVLGQLRTLATVR"
FT   gene            complement(545444..546106)
FT                   /locus_tag="Amir_0505"
FT   CDS_pept        complement(545444..546106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_0974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34472"
FT                   /db_xref="GOA:C6WI21"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI21"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_0974"
FT                   /protein_id="ACU34472.1"
FT                   /translation="MELAALLLVDSRFPGGGHAHSGGLEEAVSRRLVTDEATLRGFLLG
FT                   RLRTAGALAAVFAAAAARAPDLAALLELDVELDARTPSPAQRRASRAQGRGIARAARRA
FT                   WPSERLEELLRAEPRPHHPVLTGLLVGDPGDAARVIAYQSASGPATAAIRLLGLDPFGV
FT                   NAVLAGLADDLGAVVADAVARAADPPAGLPAPGSTGLDLMAEAHDRHHQEEVRLFVS"
FT   gene            complement(546215..547912)
FT                   /locus_tag="Amir_0506"
FT   CDS_pept        complement(546215..547912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0506"
FT                   /product="urease, alpha subunit"
FT                   /note="TIGRFAM: urease, alpha subunit; PFAM:
FT                   amidohydrolase; Urease alpha-subunit domain protein; KEGG:
FT                   ank:AnaeK_0975 urease, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34473"
FT                   /db_xref="GOA:C6WI22"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI22"
FT                   /inference="protein motif:TFAM:TIGR01792"
FT                   /protein_id="ACU34473.1"
FT                   /translation="MTRVDRERYAELLGPTTGDRVRLADTDLLITVTDDLCRGAGSGDE
FT                   VIFGGGKVIRESMGQGMATRAEGAPDLVITGAVVLDHWGVVKADVGVRDGRITAIGKAG
FT                   NPDVMDGVHPDLVIGPSTEVLSGNGKILTAGGVDCHVHFICPQIVDTALASGLTTLIGG
FT                   GTGPAEGTKATTVTPGAWNLGRMLAAMDHMPVNVLLLGKGNTAREDALREQLLGGAGGF
FT                   KLHEDWGTTPVAIDTALRIADESGVQVAIHTDTLNEAGFLESTLDAIAGRSINAYHSEG
FT                   AGGGHAPDIIQVVSEPNVLPSSTNPTRPHTVNTLEEHLDMLMVCHHLNPSVPEDLAFAE
FT                   SRIRPTTIAAEDVLHDLGAISMISSDSQAMGRVGEVITRTWQTAHVMHGRRGELAENLR
FT                   ARRYVAKYTINPAIAHGIDHEVGSVEAGKLADLVLWEPKFFGVRPSVVLKGGFIAWAAM
FT                   GDANASIPTPQPVLARPMFGAHAAARGSVHFVSQQAVDADLADLLRLSRPLVPVRGTRA
FT                   VGKADMVLNDALPHVRVDPDSFAVTVDGELVEPEPVERLPMAQRYFLF"
FT   gene            complement(547909..548220)
FT                   /locus_tag="Amir_0507"
FT   CDS_pept        complement(547909..548220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0507"
FT                   /product="urease, beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: atu:Atu2405 urease subunit beta; TIGRFAM:
FT                   urease, beta subunit; PFAM: Urease beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34474"
FT                   /db_xref="GOA:C6WI23"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI23"
FT                   /inference="protein motif:TFAM:TIGR00192"
FT                   /protein_id="ACU34474.1"
FT                   /translation="MRPGEIIPGEEPVELNPGRPRTTLVVVNGGDRPVQVGSHYHFAAV
FT                   NPGLLFDRDAAWGKRLDVPAGTAVRFEPGVEREVVLVPLAGRRVVPGLRPEHAGELDR"
FT   gene            complement(548279..548581)
FT                   /locus_tag="Amir_0508"
FT   CDS_pept        complement(548279..548581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0508"
FT                   /product="urease, gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: oan:Oant_0332 urease, gamma subunit; TIGRFAM:
FT                   urease, gamma subunit; PFAM: Urease gamma subunit region"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34475"
FT                   /db_xref="GOA:C6WI24"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI24"
FT                   /inference="protein motif:TFAM:TIGR00193"
FT                   /protein_id="ACU34475.1"
FT                   /translation="MHLTPHERDKLLVHVAADVARRRLERGVALNHPESVALITSHVLE
FT                   GARDGRTVGELMASGRHVLTREQVMDGVPEMIDSVQVEATFPDGTKLVTVHDPIS"
FT   gene            548814..549929
FT                   /locus_tag="Amir_0509"
FT   CDS_pept        548814..549929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0509"
FT                   /product="Citrate (Si)-synthase"
FT                   /EC_number="2.3.3.1"
FT                   /note="PFAM: Citrate synthase; KEGG: pzu:PHZ_c0162 citrate
FT                   synthase GltA"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34476"
FT                   /db_xref="GOA:C6WI25"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI25"
FT                   /inference="protein motif:PRIAM:2.3.3.1"
FT                   /protein_id="ACU34476.1"
FT                   /translation="MVQQAEQDGFKPGLEGVVAFRTEIAEPDRDGGALRYRGVDIEELA
FT                   GRVTFGDVWALLVDGAFGAGLVPAEPFPIPVHTGDVRVDVQAALAMVAPIWGFQPLLDI
FT                   PEREARDQLARASVMALSYVAQSARGTGRPAVPQHRVDQCATITDRFLTRWRGEPDPAH
FT                   VRALDAYWVSAAEHGLNASTFTARVIASTGADVAAAMSGAIGAMSGPLHGGAPARVLPM
FT                   IEAVERKGDARGYVRGVLDRGERLMGFGHRVYRAEDPRARVLRRTCKELDAPRYEAAAA
FT                   LEQAALAELRERRPDRAIETNVEFWAAVVLDFAEVPPAIMPAMFTCARTAGWSAHILEQ
FT                   KRTGRLVRPSAAYIGPEARSVESVEGWDEIA"
FT   gene            550082..550912
FT                   /locus_tag="Amir_0510"
FT   CDS_pept        550082..550912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0510"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sus:Acid_0079 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34477"
FT                   /db_xref="GOA:C6WI26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI26"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34477.1"
FT                   /translation="MTAAISARGLRKSYGDFEAVRGVDLEVAEGEVFALLGPNGAGKST
FT                   TVEILEGLRPRTGGEVSVLGADPATAPRSWRAGIGVVQQAATDLADITVAEAVHHHARY
FT                   YPDPRDPDEVVALVGLADKARTRAGRLSGGQRRRLDVALGIIGRPRVLFLDEPTTGFDP
FT                   EARRQFWGLVRDLAREGATILLTTHYLDEVEALADRLAVIAGGRLVAEGTPTTVGGRDR
FT                   AKALVTWVDPDGVQRSRATTDPVALVVELNALGPVADLTVTRPTLEDVYLELIA"
FT   gene            550909..551709
FT                   /locus_tag="Amir_0511"
FT   CDS_pept        550909..551709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0511"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: mxa:MXAN_1598
FT                   ABC transporter, permease protein, ABC-2 family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34478"
FT                   /db_xref="GOA:C6WI27"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI27"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACU34478.1"
FT                   /translation="MRTAALGLARGGLELRQFFRNTAGFLFTFALPVFLLLLLGSIFSG
FT                   MTPSGADFTQEQEFTAGMLGAGIISTTFITLGAGIAQDRENGTLKRLHGTPLPLASYFI
FT                   GKIVMVLVLSLAEAVLVLITGVLVFDVDLPTDPARWFTFAWVFALGTVSCALLGIAVSS
FT                   VAGSARSAPTVLNLPYVGLQFVSGVFISIAVLPQWMVVLGSLFPLKWVAQGFRSVLLPE
FT                   GAAVVEVAGAWEHGRIALVLAGWCVAGLVLCAASFRWTNGRSGG"
FT   sig_peptide     550909..551064
FT                   /locus_tag="Amir_0511"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.671) with cleavage site probability 0.414 at
FT                   residue 52"
FT   gene            551682..552701
FT                   /locus_tag="Amir_0512"
FT   CDS_pept        551682..552701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0512"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase dimerization and
FT                   phosphoacceptor region; ATP-binding region ATPase domain
FT                   protein; KEGG: sus:Acid_1273 integral membrane sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34479"
FT                   /db_xref="GOA:C6WI28"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI28"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACU34479.1"
FT                   /translation="MDERAKWGLITGAGLLVAACGALLPDVTAERHWAAVAVIAVIAAW
FT                   VLLQPRQLYLIGLHALTVTAMWLSPGATFLLFAVLPEVYRRIPLRPAFWVMLAFVVPPW
FT                   LLSWARTGDPTSMLLVLLPTALFSQLFGWVIRTLAEQNLVIAELSHEAGVAAERERLSA
FT                   EIHDTLAQGFTSIVTLVQAARADPVRADDHLDLALRTARENLAESRALVAALAPAALEG
FT                   SLADALRRQVERVADFGVRAEFAERGAGEVPRAVEVVLLRAAQEALTNARRHAARVRVE
FT                   LDVLPDSVRLTVRDDGPGYRGAPEGFGLRGMRARLEQVGGTLTRSDDDGAVLVAEAPR"
FT   gene            552766..553395
FT                   /locus_tag="Amir_0513"
FT   CDS_pept        552766..553395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0513"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; SMART: response
FT                   regulator receiver; regulatory protein LuxR; KEGG:
FT                   sus:Acid_2683 two component LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34480"
FT                   /db_xref="GOA:C6WI29"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI29"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU34480.1"
FT                   /translation="MDGSEAVGGPVIRVLLVDDHPVVRQGVRGMLAPATDLEVVGEAAS
FT                   GDEAVRLVRADPPDVVLMDLRMPGGDGVEATARIGALSRVVVLTTYETDADILRAVEAG
FT                   AVGYLLKDASPEDLVAAVRAAARGETVLAPSVAGRLVRRTPALSPREVEVLRLVGRGLS
FT                   NAEIGRQLFIGEATVKTHLLRVFSKLDVSDRTAAVTTAMRLGLLGH"
FT   gene            553647..554780
FT                   /locus_tag="Amir_0514"
FT   CDS_pept        553647..554780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0514"
FT                   /product="phosphoserine aminotransferase"
FT                   /note="TIGRFAM: phosphoserine aminotransferase; PFAM:
FT                   aminotransferase class V; KEGG: mmr:Mmar10_0555
FT                   phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34481"
FT                   /db_xref="GOA:C6WI30"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR006272"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI30"
FT                   /inference="protein motif:TFAM:TIGR01366"
FT                   /protein_id="ACU34481.1"
FT                   /translation="MTQTADPTSLVLPADLKPSDGRFGCGPSKVRPEALRALAAEGADL
FT                   MGTSHRQKPVKSLVGEVRSGLRALFSLPEGYEVVLGNGGTTAFWDAAAFGLVRERSQHF
FT                   TYGEFSSKFAKVTKDAPFLGEPVVVKSEPGTAPEITFAEGVDLVGWAHNETSTGVAVPV
FT                   SRPAGSDGALVAIDATSGAGGLPVKAEDFDVYYFAPQKCFASDGGLWLSLMSPAALDRV
FT                   REIGASGRWVPEFLSLTTALDNSTKDQTYNTPSVATLFLLNEQLKWLNGNGGLDWAVSR
FT                   TADSSSRLYSWAEQTSYTSPYVADPAHRSQVVGTVDFADEVDASVVAKVLRANGIVDVE
FT                   PYRKLGRNQLRVAMFPAVEPEDVSTLTEAVDWVVGQL"
FT   gene            555000..555815
FT                   /locus_tag="Amir_0515"
FT   CDS_pept        555000..555815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34482"
FT                   /db_xref="InterPro:IPR021421"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34482.1"
FT                   /translation="MRTLRVVGLDEDGKSIVLEDPERGERFVLPADERLRAAARGDLTR
FT                   LGQIEVETESQMRPREIQARIRAGESVDQVAAIAGIPAHRVERFAYPVLLERSRIADLA
FT                   QRAHPVREDGPDVQTLGEVVAHSFGLRGQEYVDVSWDSWRGEDGRWVVQLHWTAGRSDN
FT                   RAHWAFHPGAHGGTVTALDDAAVDLMDPNPNRVRSLRAVTHLARAALDVEGRPLAEPEI
FT                   LVREERPVVEEPIVVDGELAEDQPSAKRKKNHPIVPSWEDVLLGVRSRG"
FT   gene            556396..556770
FT                   /locus_tag="Amir_0516"
FT   CDS_pept        556396..556770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34483"
FT                   /db_xref="GOA:C6WI32"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI32"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34483.1"
FT                   /translation="MLGRVVVGAALGAGLGAAWMWLRDRIVSGRVCTQEDWGCLELYLV
FT                   MIPVGLVAAVLISWAVFAAAHVGRPLGTAAVSVAFAAALALLTVWFEIPGDVLLTSAVG
FT                   FVLASPVTARRPVVHTAARG"
FT   gene            556763..557443
FT                   /locus_tag="Amir_0517"
FT   CDS_pept        556763..557443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to hedgehog protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34484"
FT                   /db_xref="GOA:C6WI33"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI33"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34484.1"
FT                   /translation="MAEASRLEAGASTDSFTHRFRLRRATANPRTEDTPVSETISPRTT
FT                   TSTPPPTPTPTSTSTPTDEVTAAHSTPVDTRPRPTIRERGSRAGGFAFSALLRVVLSGV
FT                   VGAALCAAWIAAHQAGLLHRALGEASASLPDFLLLLFVGLPLALVASALLAGPLLWLLG
FT                   VRPAWPIVLLGPVVLAAAHYFDVPNLLAGTGDQWVVLAILAGLSYALAGLLTIPTMLMR
FT                   SRKS"
FT   gene            complement(557503..557742)
FT                   /locus_tag="Amir_0518"
FT   CDS_pept        complement(557503..557742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0518"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34485"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34485.1"
FT                   /translation="MEIGFLLSEPAMAFPAGRLMAVRGGRLSVLAPDGWRPVPGRRPDG
FT                   ARPVSREGAAEWCAREGRDAGVLDVVPGPGDDRG"
FT   gene            557855..559624
FT                   /locus_tag="Amir_0519"
FT   CDS_pept        557855..559624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0519"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG: rce:RC1_1837
FT                   ABC transporter, ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34486"
FT                   /db_xref="GOA:C6WI35"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI35"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34486.1"
FT                   /translation="MNDQRTSTAATLRRLWPYLRPVKNPIAVSTGAAVLAMLCGLGIPL
FT                   VTQRVVDGPIAHRDLSALPWLIGLVLALGLAEALLFYTRRKVIARPASTVELAMRTDLY
FT                   TRLQALPVSFHDRWQSGQLLSRATSDLTTVRRFVAFVLVFLLVNTTVIVIGLGVLFWLS
FT                   PLLGLVALVSTLPLIALSYLFETRYKVAARLSQDQVGDLTTTVEESVLGIRVLKAFGRG
FT                   PHLAARFQRQARELRGTELVKVRVFAALWAALLVLPELSIAGQLAVGAFGITSGTMTAG
FT                   TLIAAIAVSAYLRWPVDSIGWLLSETNQTAAAVERYFEVLDEPVAITSPPSPKPLATPV
FT                   RGHLRFEGVRFGHPGSDDEVLRGVDLEVRPGETVALVGATGSGKTALTALVPRLADVTG
FT                   GRVTLDGVDVRELDLAELRRVVGTAFEEPVLFSASVTENVVLGGGDASPHAVREALRVA
FT                   RAEEFVDALPWGPDTRIGEQGLSLSGGQRQRLALARAVAGRPAVLVLDDPLSALDVHTE
FT                   AEVEAALRRVLRDVTALVVAHRSSTVQLADRVAVLSGGRITAIGTHRELLAGNTEYRHL
FT                   LSTLADEDEEVRV"
FT   gene            559621..561579
FT                   /locus_tag="Amir_0520"
FT   CDS_pept        559621..561579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0520"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG: bha:BH1126
FT                   ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34487"
FT                   /db_xref="GOA:C6WI36"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI36"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34487.1"
FT                   /translation="MSASTGNAEDPTGTRTGTAQDPTTPAQDPTTPAQAPTTTAQDPTT
FT                   PPPTVDGWRGVAAEEVDAPDHATGTRLRARSRRLLGSLLRPHAGLVALSLALMVVENLV
FT                   LLAGPLLIAAAIDRGVPAALDGDPTTLAWCVGGYAASGLAATVLRYAFVRLIGRIGQDV
FT                   LLDLRLRVFRHVQRLSVSFHERYTSGKVISRMTNDVDSLQNLLDEGLDGFFNAMLSVFA
FT                   ISVVLFALDVPMALFVLSGFLPLVLLVRWFQARSAAAYRGTTGSIAKVVVQLVETMNGI
FT                   RAVQAFRREPRNERIMADLNGAYRDANVTALTVVATFTSAVRAIGNISLAVLLAWGAWR
FT                   VAEGTLELGVLAAFTLYVRRFYDPMDNIAMFTNAYAAATAALEKLSGLLDERPSVPDPV
FT                   DPVPLGPVRGEVRFEGVEFRYPASDSLVLPRFDLRVPAGQTVALVGATGAGKSTLAKLV
FT                   ARFYDPTGGAVWLDGADLRSVSDADLRRAVVMVTQENFLFEGTVADNIALGRPDATREE
FT                   VVAAAVAVGAHDFIGELPDGYDTDVSKRGGRLSSGQRQLVAFARAFLADPAVLVLDEAT
FT                   SSLDVPTEWTVQSALETVLASRTAFIIAHRLSTVLIADRVLVVDGGRVVEDGTPEELIG
FT                   ERGRFARLHEAWRESLA"
FT   gene            562328..562894
FT                   /locus_tag="Amir_0521"
FT   CDS_pept        562328..562894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0521"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gdj:Gdia_1592
FT                   regulatory protein TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34488"
FT                   /db_xref="GOA:C6WI37"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI37"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34488.1"
FT                   /translation="MRRRGAELERAVLDAATAELLESGYRALTMERVAKRAGTNKNALY
FT                   RRWPHRAALAAAAYRALVADTTRTPDTGDLRADVLALLRGLAADLASPRGEVLTGMVAG
FT                   IAAEAPELLAELRELGAQAGSGVWLTVLGRAVARGEARPEALLPRVAGLPLVLLRNEFL
FT                   TGGPPTDEALVEIVDQVYLPLVRVR"
FT   gene            563263..564681
FT                   /locus_tag="Amir_0522"
FT   CDS_pept        563263..564681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0522"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bpt:Bpet1644 amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34489"
FT                   /db_xref="GOA:C6WI38"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI38"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACU34489.1"
FT                   /translation="MGESAGKTERPAQPEQPAQPAQPELNRAIGPKLLLFFVVGDILGT
FT                   GVYALTGNVAGKIGGALWLPFLIAFAVAFLTAFSYLELVGKYPKAAGAALYAHRAFGVQ
FT                   FLTFMVAFAVMSSGITSAASAALAFGRTYLQSVLREFSSDSVTVSASLVAVLFILGLAV
FT                   VNLRGVSESVKANVVLTCIEVSGLLIIIVIGALAVASGDGDPSRLVQIDPAPGQSALIA
FT                   ITSATSLAFFAMVGFEDSVNMAEECRDPVRIFPRAVLWGMGIAALIYVLVAVTSSLLIP
FT                   ADELAASGSNALLKVVQVGAPSFPLWVFSLIGLFAVINSALINMLMASRLVYGMAGERI
FT                   IPRFFGVVHPTRRTPWVSVLFTTGVAIALVLTTDIAKLGGTTALLLLVVFAIVNVAVLV
FT                   LRKDRADHEHFRAPTIVPVLGALTCAYLASPLSGRPSADYLVALYLLLAGLVLWLINRV
FT                   THGVVEVDPAKLGK"
FT   gene            564778..565650
FT                   /locus_tag="Amir_0523"
FT   CDS_pept        564778..565650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0523"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: sfv:SFV_3620
FT                   putative aldose-1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34490"
FT                   /db_xref="GOA:C6WI39"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037480"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI39"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ACU34490.1"
FT                   /translation="MLEIAHGGARAVIAKVGAGLKSFEVDGVPYVETYDGEPPMGSGAV
FT                   LVPWPNRTAGGTWVLDGAEQQLEIGETARGNAIHGLVRHAEWTVVEHTGSLVSLEVGVE
FT                   GQGWPVPLRTTITYALDDEGLTVSHGVHNLGSARTPFGVGTHPYPRAGKSSTDTSTLTL
FT                   AATTVLPLDPERMIPSGPAVPVSGESDFRAARLLKGVELDTPFGGCEPVDGLVRHQLRG
FT                   PDGGVEVWADPDFKWVQVYTPDNFPGRGRAVAIEPMTCPPDALNSGVDLLWLAPGESWA
FT                   GRWGLRPLA"
FT   gene            565670..566863
FT                   /locus_tag="Amir_0524"
FT   CDS_pept        565670..566863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0524"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   bha:BH3008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34491"
FT                   /db_xref="GOA:C6WI40"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI40"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACU34491.1"
FT                   /translation="MSVAITGGYVVPVIGEPIENGTVLVIDGKIAAVGASVEVPDGVPT
FT                   VDAKGSWVLPGFVEAHGHIGVHEEAEGWAGQDTNEMTDPNGARLRALDAINPADMGFAD
FT                   ALSGGVTTAVIKPGSGNPIGGQTVAIKCWGRTTDEMLVREPISVKSALGENPKRVYGDQ
FT                   KKLPSTRQGVAAVIRDAFTAAQDYVARRDAAEGPFDRNPTHEVLAKVLSGELPWCQHCH
FT                   RADDIATALRLADEFGYRLVINHGTEGHLVADLIAERGVPVIVGPLFTTRSKVELRQRT
FT                   LRTPGVLARAGVKVAITTDHPVIPINFLVHQATLAVKEGMDRTAALESITTNPAAILGL
FT                   DDRVGALKPGLDGDVVIWSGDPLDVMSRATKVFVSGREVYSYEDGEGKVADPFYREG"
FT   gene            complement(566946..568091)
FT                   /locus_tag="Amir_0525"
FT   CDS_pept        complement(566946..568091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0525"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; Acyl-
FT                   CoA dehydrogenase type 2 domain; KEGG: bat:BAS5190 acyl-CoA
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34492"
FT                   /db_xref="GOA:C6WI41"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI41"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACU34492.1"
FT                   /translation="MPAERLLPTTESEDLIALVREIARDELAPKAGLHEEEGRFPRDAF
FT                   RLLGGVGLLGLPYPEDFGGSAQPYEVYLQALEEVATAWMSVAVGLSVHVMSSYALVNFG
FT                   TPEQRAKWLPDALGGELLGGYALSESHAGSDAAALSTRAVREGDEYVVRGTKAWITHGG
FT                   VADFYTLMARTGEPGGRGVSCFFAPGELDGLSAAAPERKMGLTGSVTAQLTFDGARFGA
FT                   DRLIGAEGDGMRIALSALDSGRLGIAACAVGLAQAALDEAVAYARGRSQFGRPIIEFQG
FT                   LEFLLADMAAAVDSARATYLDAARRRDRGLPFTRQAAVAKLVCTDAAMKVTTDAVQVLG
FT                   GAGYTRDFPVERYMREAKVLQIFEGTNQIQRVVIGRALRKA"
FT   gene            568174..568770
FT                   /locus_tag="Amir_0526"
FT   CDS_pept        568174..568770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0526"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rme:Rmet_3794
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34493"
FT                   /db_xref="GOA:C6WI42"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI42"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACU34493.1"
FT                   /translation="MTSIVGRPLTPRQVDLLGKLESLVLAEGFAHFTLDDLAARLHCSK
FT                   STLYALAASKEQLAVRVVRRYFKGAAEHIERRVADLKDAPAKVGTYLAVAAEELRRASA
FT                   RFLADVADYAPTRSTYERNARAAAARLREFIQEGVRDGVFRDVQAVLIAEMAGVLIENI
FT                   QTGVLPRRAGVTDAEAFTALGELLLDGLRRERSQG"
FT   gene            568767..569705
FT                   /locus_tag="Amir_0527"
FT   CDS_pept        568767..569705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0527"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: sit:TM1040_3042
FT                   PfkB"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34494"
FT                   /db_xref="GOA:C6WI43"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI43"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACU34494.1"
FT                   /translation="MIVVAGEALVDLVPTSEGNLAPRLGGGPFNVAVAVGRLGVPVSFL
FT                   SRVSRDLFGDRVVERLTASGAATDLVTRGPEPTTLAVVGLADDGSARYTFYVEGTADRL
FT                   VADPGPLPSDVRAVSFGTLSMVLEPGASAYEAVLRRESARGALTALDPNIRASLIPDAD
FT                   AYRARFRSWLPDVGLLKVSVEDARWLADLPEDAPEDDVLAAARQWQSEGPAVVVLTRGG
FT                   DGLAVLTGSGEVIHVPPVAVQVVDTIGAGDTVQGALLAWLHDHDALSAEAVRGLDGASW
FT                   IRALSYAGAAAAITCSRAGAEPPFKRELEMT"
FT   gene            569976..571289
FT                   /locus_tag="Amir_0528"
FT   CDS_pept        569976..571289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0528"
FT                   /product="citrate synthase I"
FT                   /EC_number="2.3.3.1"
FT                   /note="KEGG: scl:sce8281 hypothetical protein; TIGRFAM:
FT                   citrate synthase I; PFAM: Citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34495"
FT                   /db_xref="GOA:C6WI44"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR010953"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI44"
FT                   /inference="protein motif:TFAM:TIGR01798"
FT                   /protein_id="ACU34495.1"
FT                   /translation="MSDATTAPNDPRTVALRHDGGEHEMQLVRATEGASGIDLGKLLAK
FT                   TGLVTLDSGFVNTASCSSEITYIDGDAGILRYRGYPIEQLAEKSNFLEVSYLLINGELP
FT                   TEAQLADFSSKISRHTLLHEDLKRFFDGFPRDAHPMPVLSSAVSALSTFYQDSLNPFDT
FT                   KQVEMSTIRLLAKVPTIAAYAYKKSVGQPFLYPDNSLGLVENFLRMTFGFPAEPYDVDP
FT                   DLVKALDLLFILHADHEQNCSTSTVRLVGSSEANLFASISAGINALFGPLHGGANSAVL
FT                   EMLEKIRNEGGDVASFVKKVKNKEDGVRLMGFGHRVYKNYDPRAAIIKRTADDILGKLG
FT                   GDDQLLDIAKALEEAALSDDYFVERKLYPNVDFYTGLIYRAMGFPTKFFTVLFALGRLP
FT                   GWIAHWREMINDPATKIGRPRQIYIGSPARDFVPMTER"
FT   gene            571555..572820
FT                   /locus_tag="Amir_0529"
FT   CDS_pept        571555..572820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0529"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="PFAM: DNA photolyase FAD-binding; DNA photolyase
FT                   domain protein; KEGG: cvi:CV_3481 deoxyribodipyrimidine
FT                   photo-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34496"
FT                   /db_xref="GOA:C6WI45"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI45"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ACU34496.1"
FT                   /translation="MTSSTVVWFRRDLRVEDHPALLEAADRADRALALFVLDPKLLRPS
FT                   GKPRTDFLHRCLKSLDDRLGGRLMVVEGDPVEVVPAVAREIGAETVHVSADTGPYGRRR
FT                   DEAVGEEVELVEAGSPYAVKPGRVRKADGTPYRVFTPFYRAWADHGWRRPADTDASTVD
FT                   WIKPPRSTRPRAKALPDVAELWERFRDERLPDYHRTRDIPGVDGTSRFSAFLRWGVVHP
FT                   RTLLDDLGQDEGSKVFRSELAWREFYADVLWHHPASARHNLDRRFDRIELDEDRDHFDA
FT                   WRQGRTGYPIVDAGMRQLLEEGWMHNRVRMITASFLVKDLHLPWWWGARHFMEHLVDGD
FT                   LASNQHNWQWAAGSGTDAAPYFRVFNPITQGQKFDPKGDYIRRYVPELRDVAGKAVHQP
FT                   RDPIVDHAHERQVALDRFAAIK"
FT   gene            complement(572906..573550)
FT                   /locus_tag="Amir_0530"
FT   CDS_pept        complement(572906..573550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0530"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: tgr:Tgr7_2171 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34497"
FT                   /db_xref="GOA:C6WI46"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI46"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACU34497.1"
FT                   /translation="MRVVLAEDGVLLRAGVEEVLRRFGIEVVASVGDAPALLDAVAAGS
FT                   PDLVLTDVRMPPGDGDDGLRAAVRLRADDPRLPVVVFSQYVAGEYAEELLSSGDGQGVG
FT                   YLLKDRVVDVAEFVDVLRRVAAGGTVIDHEVVRSLLGRRRDPLARLTGREREVLALVAE
FT                   GMANSAVGRRLGVTEAAVHKHVGSILLKLGLPPGVEGNRRVLAVLAYLRAS"
FT   gene            complement(573565..574854)
FT                   /locus_tag="Amir_0531"
FT   CDS_pept        complement(573565..574854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0531"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerization and phosphoacceptor region;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   mmr:Mmar10_2544 putative signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34498"
FT                   /db_xref="GOA:C6WI47"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI47"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACU34498.1"
FT                   /translation="MDESRDVVGALRRKGFLVSVWPWRALLHALTTPLVAAVAALPLAP
FT                   VGVLWAAVVVKVVRGEVVGGVVPVAALLLGAVLAAALPVLSAPVAWAERWRLVLLGDDR
FT                   LAAVRQAPGLGAWVRSRYLTAAAWRETGYAVLLALAGTGLGGVLLLAGGVPLAMLLAPL
FT                   LVTPDSPLVVLGWRAVTPADGLWFTAAGIALAPVLAYAVGLLGAGHLVVGRVLLRGDEA
FT                   LRAELAEVAGSRARLVDRFDAERRRIERDLHDGAQERLVGLTLRLGLAKAELPENEDVA
FT                   AAHDQAKRLMVELRELVRGIHPAVLTDRGLGAALAELADRSVVPVTLRAHLPTRPPAHL
FT                   ESVAYFVVAEAVANAVKHSGAGEVRVRAGIEGGGVVVEVLDDGRGGADPAAGSGLTGLA
FT                   DRVAVVGGALSLSSPVGGPTVLRATLPLSG"
FT   gene            complement(575005..576246)
FT                   /locus_tag="Amir_0532"
FT   CDS_pept        complement(575005..576246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0532"
FT                   /product="ABC-type Na+ efflux pump permease component"
FT                   /note="KEGG: scl:sce9075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34499"
FT                   /db_xref="GOA:C6WI48"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI48"
FT                   /inference="protein motif:COG:COG1668"
FT                   /protein_id="ACU34499.1"
FT                   /translation="MSAPSPGRALSPVRAVFLVARREFLSKVRTRSFVIGTVVIIAAMA
FT                   GFVALQALLFTSASTSVVGLNGQATVLAQPLEETARSLGREVEVVDVPDSAAGEELVRS
FT                   GDLDALVLGAPDALRVLVKDGLDPSLANAVDLIVKQQVLAAQLAEAGLDPARVQQNVAD
FT                   ARVRVVALDPEDPMVGQRLVIGLVIAGLLYYSLLVYGTMVAQGVVEEKSSRVVEILLST
FT                   LRPAQLLMGKVIGLGAVGLAQLLLIGAIGLGLASAAGVVAVDGPTGGALLIGVLWYLLG
FT                   FFLYATVFAAAASLVSRQEEVQSVLTPITMLIVIAFVVGFNLLVRDPASRLVAVLSVLP
FT                   PFAPILMPGRMAIGAAPAWQVVLAVALALGAAAGVVWVGGKVYANAVLRTGARVRLRDA
FT                   LRSPRGAAQGSARG"
FT   gene            complement(576243..577196)
FT                   /locus_tag="Amir_0533"
FT   CDS_pept        complement(576243..577196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0533"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH1166 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34500"
FT                   /db_xref="GOA:C6WI49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI49"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACU34500.1"
FT                   /translation="MSQGLRGLPPHGSPSRGLLEVDRVSKRYGDVVALREMTFEVRAGE
FT                   LFGFVGSNGAGKTTTMRIALGVLEADSGQVRWNGAPIDLRTRRSIGYMPEERGLYPKMR
FT                   VLEQLVYLAELHGVAPGEALRSAELWVERLGLRERRRDEVQKLSLGNQQRVQLAAALVH
FT                   RPEVLVLDEPFSGLDPVAVDVMSQVLREQAAAGVPVVFSSHQLDLVERLCDRVGIVRGG
FT                   AMVACGTVDELRAGGVERLVVEAPGAPPGWADVVPGVLSARHEGARTVVELAPGADDQV
FT                   VLGAALATGPVHEFSRQRPSLTELFRSVVTSEESAA"
FT   gene            complement(577222..577482)
FT                   /locus_tag="Amir_0534"
FT   CDS_pept        complement(577222..577482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0534"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: gdi:GDI1973 putative
FT                   HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34501"
FT                   /db_xref="GOA:C6WI50"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI50"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34501.1"
FT                   /translation="MSPVRRGSEQPIHNRIGVLRAERGLSRADLAEAVEVNPQTIGALE
FT                   RGDHYPSLDLALRICEVFGLPVEAVFGRAPFEPLSTQVYRR"
FT   gene            577666..578109
FT                   /locus_tag="Amir_0535"
FT   CDS_pept        577666..578109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   lpn:lpg2755 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34502"
FT                   /db_xref="GOA:C6WI51"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI51"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACU34502.1"
FT                   /translation="MEPDQWLAQYGQKIEQAKREAAQTEAKLGGVGGSATSPDGLITVT
FT                   VNASGALTDLILRPALRGEDPERIAAAVLKAVAEAQRAAAGQVVEIVSELVGDSPALEF
FT                   VKSRMPNGYSGDGTDPVEPAPEVQRRDTRPDDDYFTNPPDVMA"
FT   gene            578130..578438
FT                   /locus_tag="Amir_0536"
FT   CDS_pept        578130..578438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34503"
FT                   /db_xref="GOA:C6WI52"
FT                   /db_xref="InterPro:IPR022536"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34503.1"
FT                   /translation="MFDSFNVSPEQIRGHAGTVDQLTQRMVTATQTADPSLATDAFGIF
FT                   GSFLAEFLLKQAGVSQDILGQAAETVADMCQGLKEVADLYENVDLDNAFGFTGKARG"
FT   gene            578435..580219
FT                   /locus_tag="Amir_0537"
FT   CDS_pept        578435..580219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0537"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted gene, 100041170"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34504"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34504.1"
FT                   /translation="MTPQAGTDVSTAQQRDPANLVGDVKGTADAIERGDWVAAGLGMAN
FT                   AAMSVVGLAGNPMGGLVSAGFSWAVQHVSFLKEPFDALLGNPQAITKMSDSWANAAKQV
FT                   ESIVADYRRTSVEETKGWRGRSADGYRAAATKHSSGLETLAKAAKGISTAAKGAGELVG
FT                   TVRKTIMDLIGKAVSEMVMKIIQWLSVSWLTFGASIAAAIGDIVRMACDYAKKFVDFLQ
FT                   KLATSLKKLIDMIKSVAQIAQTAKQVLQAITAMTHSNSAGAAGAGAAGNPRLSAGGLGL
FT                   TGEQLANMDRGANTRYSENGSGSTWTSGANGAGGGAAVNQPGALGPGAGAGAGSGYDGG
FT                   YGGAGGRPVVSQPPVVGGGFGGVGGGAGGSYGGSTGGSSVSRPPTVGGGVGGSGGSGGY
FT                   GGSGGGAGGSAGGHWEPGRWVPAGSGVTGVTPLPARDVTHATNTTPTIPPLTTPPIPTV
FT                   KPFGGDLGGGGGAGGGAGGGGGPMPSFGGGGGGFGGGGSAGGLGGAGGATPQPMQAGGA
FT                   SGVLPSGAAGGPAPGAPGGAPAGGARGAGGGMGMMGGAPMAPMGGQEGGKDHQRKVRIQ
FT                   GDPLAEEPPKAAKPVIGE"
FT   gene            580973..582172
FT                   /locus_tag="Amir_0538"
FT   CDS_pept        580973..582172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0538"
FT                   /product="N-isopropylammelide isopropylaminohydrolase"
FT                   /EC_number="3.5.99.4"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: bac:BamMC406_5450
FT                   N-isopropylammelide isopropylaminohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34505"
FT                   /db_xref="GOA:C6WI54"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI54"
FT                   /inference="protein motif:PRIAM:3.5.99.4"
FT                   /protein_id="ACU34505.1"
FT                   /translation="MPGDLLIRSVRPWPADPGAPTVDVLCSNGTLTAFGPHLPAPPGAT
FT                   VVDGRNGVLLPAFTDAHAHLDSTRLGLPFRPHSAGPGLTALVDNDRRHWRADEPVADRA
FT                   TRTLGRTIASGATHVRSHAQVDVDSGLERLEGVLAAREAHRDRALVQVVAFPQCGILRE
FT                   KGTADLLDAALRAGADLIGGLDPASVDRDPVKHLDTVFSLAEKHQCGVDLHLHDDGTLG
FT                   AFQIELVCERVAALGMRGEVTISHAFALSTVDDHRQGLLVDLLAEHDVAVTTVAPGARD
FT                   PLPLHRLRRAGVRLGLGQDGIRDHWSPYGDGDMLGRAWQLAYRGGFRRDDQVEMCVDIA
FT                   TRGGAAVLGARLGLTEGSPASVVVVPGDTVTAAVMDRAPRALVVHAGRVVARDGELVRT
FT                   "
FT   gene            complement(582162..583166)
FT                   /locus_tag="Amir_0539"
FT   CDS_pept        complement(582162..583166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0539"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; KEGG: pzu:PHZ_c1983 alcohol dehydrogenase, zinc-
FT                   containing"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34506"
FT                   /db_xref="GOA:C6WI55"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI55"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACU34506.1"
FT                   /translation="MTTAHEIHLAARPKGFPTESDFALVEVPVPAPGDGELLVRNLLMS
FT                   VDPYMRGRMRDAKSYVPPYALDAPLDGGAVGEVVESRSPDFAPGDVVLHGLGWREFAAV
FT                   PASGARKVDPDAAPLGAHLGVLGMPGLTAWVGLLEVAGMREGDAVFVSGAAGAVGQVAG
FT                   QVARLRGAKRVVGSAGSPEKVRYLVDELGFDAAFDYRDGDVAGQLAAAAPDGVDVFFDN
FT                   VGGEHLEAAITAFTTGARAALCGAISAYNAEEAPAGPRNLGLLVGKRATLRGFIVSDHA
FT                   HLREEFTREVGGWIAEGKLRYRETVTEGGLANAPAAFIGMLRGENTGKALVRF"
FT   gene            complement(583222..583977)
FT                   /locus_tag="Amir_0540"
FT   CDS_pept        complement(583222..583977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0540"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bur:Bcep18194_A4874 GCN5-related N- acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34507"
FT                   /db_xref="GOA:C6WI56"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR013653"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI56"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACU34507.1"
FT                   /translation="MRLHHPSELSARGALIRWSAQVLVPGRDGRAFSRGDAVAVLAPAL
FT                   NRHDRLVLDGSPDDVRALLDEHYAPGLSPLVTSELAAGLGVPVRAAFGWMERADPGDLP
FT                   ERAPECAWLPESDWPEVTALLGAASPHSYVWPGEPGATRWAGIRVGGVLAAVAADAWST
FT                   DGVGFIGGVATHPGFRRQGLSSVLCAFVTAELLERHGGCALMVDRNNPTAIGVYTRLGY
FT                   AYRELSVLDPDVARSGEPKAGGVAGKSAA"
FT   gene            complement(584070..584606)
FT                   /locus_tag="Amir_0541"
FT   CDS_pept        complement(584070..584606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0541"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_2517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34508"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI57"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34508.1"
FT                   /translation="MIGGPVAMTAFSASGRVPGQGPGPGSDVGPGMGSGTAQGRGAGSA
FT                   PVPGVNSGFGGALSAAERYKEVVELAGDAVERMRQVDRERVAQLIEALAESQIRMAAAI
FT                   DREKVAELGVDELWQQAVEALWEERSIESIGQRPRPDQTVPPRDQLEYDNEVELAYRGL
FT                   VESLAKRSLFRGGKS"
FT   gene            complement(584603..587401)
FT                   /locus_tag="Amir_0542"
FT   CDS_pept        complement(584603..587401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0542"
FT                   /product="cell divisionFtsK/SpoIIIE"
FT                   /note="PFAM: cell divisionFtsK/SpoIIIE; KEGG: bpt:Bpet4245
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34509"
FT                   /db_xref="GOA:C6WI58"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI58"
FT                   /inference="protein motif:PFAM:PF01580"
FT                   /protein_id="ACU34509.1"
FT                   /translation="MSRRDDRLWRIRASLERFHGAVAAALGNAAREQRGIAAERARDMV
FT                   EVMVRGQGVDRALADPVLAGPLRNPLFGPVLAHAMADRVEAFRDWSEQGPDRLAEIVGE
FT                   ASPGAASQPHEAWLGGTGTADGSEGVPELWRIGDGEVPSAPEPRRFPVAVPLLDQAHLH
FT                   VASAPESRATAESLVEGLLLRVLSHFQPGLVQVHVWDVGQLTGSLPGLYPLTRAGLLTV
FT                   HDPARLHELLDELSDTIRRVHTGVLVEGHQSIRAVSGRRAEPWRIAVLLGNRQALKEEH
FT                   QQQLQRVARNGLACGIQLFIVDIPITVNSPVETVRVAADHTATCTMTGKHVRVLLDPPL
FT                   PRHAVPRACAAIAEKREERRSRFGTFADLLPEEPWQERSAAGVVAPVGFFDGDPVPVAL
FT                   GDTSPHALIGGPSGSGKTNLLYAMLGSLAARYSPDELELYLLDFKEGVSFAQFAPGRKD
FT                   PSWLPHARLVGVNVNTDREFGVALLRFLADEMRRRADAAKRHEVTKLEQLREEDPEGRW
FT                   PRVVAVIDEFQYLFGERDQVTAQATQLLEDVARRGRSQGIHLVLSSQDVAGIEGFWGKS
FT                   AIFEQFTVRIALPKARRVLAEPQNDAAVELPRWHAVVNHESGVRPGNRVARVPDATKRG
FT                   TFDALQAELHRMRPEELPEPILFDGSRVPVLGGLADFQALRPGEASPTVLLGQVIDVAG
FT                   SAAKVRFARTPGRNTAVIGSMAEDAAGVLAGAALSLARQHFEGGARFTVACLVDDARPH
FT                   ADRLVKRLRGQGFEVAEVPLKDFREVPEDERRGFREVVDEHAKRLREINAGTFEGDVVP
FT                   EYLVVYGVDAAQSLLEVKDEKTRATGVDSFRLLLKHGPENRTHLLGWWRGAQRLKNSLP
FT                   PGVYDDIGSWIAFDVQGKELLSFGPEQVMSWSPRPRRGLFFDRFEHSRPQVVIPFDTGE
FT                   ES"
FT   gene            complement(587403..587654)
FT                   /locus_tag="Amir_0543"
FT   CDS_pept        complement(587403..587654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34510"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34510.1"
FT                   /translation="MTSVAEVRLALEQVAEGLQDAYRLAREAQDLLVDAVDVLAEAGEN
FT                   HHEELVPPAFLRAREAFPDELELIVSSLELVQRLAAEL"
FT   gene            complement(587651..587911)
FT                   /locus_tag="Amir_0544"
FT   CDS_pept        complement(587651..587911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34511"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI60"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34511.1"
FT                   /translation="MASIEEVRAAIAQAVDKANESAKALQQAASLAEDAQALLNSATQG
FT                   SAQSDVESANAQFAQVASGVSDLQKYLENGISQAESINSRL"
FT   gene            complement(588061..589773)
FT                   /locus_tag="Amir_0545"
FT   CDS_pept        complement(588061..589773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0545"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34512"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI61"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34512.1"
FT                   /translation="MSGQDLELVITVVVTAHDERQALDACAGLLRRIGGRIVQTRDCSD
FT                   EEPGCWSLTVFKESGESAEHSVPAALTRAVRRFVRGLGEHFPTPKVACEPPTAWTVLDD
FT                   VHLLGPLVQGAERVLVEAWAGGDPLRRSPVPAPREERPPAPVPIAPAAAPAPRSAEPVI
FT                   PAQPDTAPPDAPEQDAEPPRAEPLALPEATPTAEPQTAPEPAEPQAPLATPEPVEPTAP
FT                   QEPLATPGPFAPAESQEPPATHEPLAPASAATPLEPSSFPVSPETPEPSSTPVSPEAPA
FT                   HPAAPVSPEAQVSPAGPVPPEAPPVPAPSPAPAAPRRPAGPTGSAPTWAGAAAAWPTPV
FT                   WPAPVWPAPVPTARPERGVVAPPPPGFPPGVEIPAISAVPAAPTGPAAPTGPAEPTGPA
FT                   EPAAPAEPAAPAEPSTTPFPVLPPAPPQPLPEPAPLPTPQDEPAPAPPEPLSDSPVRLI
FT                   LEIRAIADPTSPPEEQARSVARPLVPAGKITRVAPGGRLLAVHVDLGASEAPPTSALLD
FT                   AAAAMTPDGWSGVERVGISAVVRWSAGPTPTTGVTSLELTATPLSAFQWTEPA"
FT   gene            590316..590795
FT                   /locus_tag="Amir_0546"
FT   CDS_pept        590316..590795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34513"
FT                   /db_xref="InterPro:IPR025734"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI62"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34513.1"
FT                   /translation="MTGHTVLWDPVRLTAAEFAGCWEQLDLGEPPGALGLSDVDPVWPA
FT                   EVLVGLRRKGIALRGARLERQLRALARRDYAVDVDGCRVRVRASVVGSIGVLAERRGDE
FT                   VVLVSVPHYAVPAELLARLPESASVEVTRDGALVGASRCGPRDEAAELIERTRPG"
FT   gene            complement(590868..591659)
FT                   /locus_tag="Amir_0547"
FT   CDS_pept        complement(590868..591659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0547"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: spe:Spro_0615
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34514"
FT                   /db_xref="GOA:C6WI63"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI63"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACU34514.1"
FT                   /translation="MIESNVPGRAGELVVRTWPNLEATWLAVLVHGCGEHAGRYGHVAE
FT                   ALVAAGALVVAADQAGHGASEGERALVEDLGTLVGDVDTVIGAAGVDLPVVLVGHGVGG
FT                   LVAARYAQDHQDRLAALVLSAPVLGAWEGLDALGGDDLSGTEVDPAELSRDEEVGRAYA
FT                   ADPLVWHGPVPRPTLEAVERAIDEVNFGPVLDRVPVLWLHGGADRLVPEADTRTGADRL
FT                   RGARFEERVYPGARHEVLRETNRDEVLGDVVDFARRALGGS"
FT   gene            complement(591709..592527)
FT                   /locus_tag="Amir_0548"
FT   CDS_pept        complement(591709..592527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0548"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dvm:DvMF_0511 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34515"
FT                   /db_xref="GOA:C6WI64"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI64"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU34515.1"
FT                   /translation="MDTRLLRTLLVLARTGSFTATAAELHLVQSSVTSQVKVLERHLGA
FT                   RLFDRLPQGARLTEAGRKAVENARDVLSAEQRLLDAVRGSTEVEGDVRIGAPESVCAYR
FT                   LPQRIADAALRWPGITVHLSPAGTKEVLLGVRRGTLDLGLALDDGLVAPGLSAHPVGVE
FT                   PIELVAAPGAVAEDRYFLLEEGCSYTDRFVRELRGRRPQITRFGSIEAVRSCVVAGLGW
FT                   TVLPRVAVAEQLESGALRRLGELPDSTLYLVTDPRRTLPAAVRAVAEAVL"
FT   sig_peptide     complement(592459..592527)
FT                   /locus_tag="Amir_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            592602..593429
FT                   /locus_tag="Amir_0549"
FT   CDS_pept        592602..593429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0549"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   aha:AHA_2368 putative phenazine biosynthesis protein PhzF"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34516"
FT                   /db_xref="GOA:C6WI65"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI65"
FT                   /inference="protein motif:TFAM:TIGR00654"
FT                   /protein_id="ACU34516.1"
FT                   /translation="MSNVLRYAAFTTTPTGGNPAGVVLDARGLTPERMLATAAEVGYSE
FT                   TAFLLPGPDPRRFAVRYFSPEAEVPFCGHATVAAAVALGLPGAIALDTAAGEVLVDVDG
FT                   GTATLTSVPTRTRPAPDADVDAALAALRWSRADLDPELPVRWAFGGGWHLVVAVRDRAV
FT                   LAALDYDFPALRALLAGADALTAQLVHRRAPDLFDARDPFPVGGVVEDPATGAAAAAFG
FT                   GYLRELGQLPDGGRFVLHQGVDMGRPSELVVVAEPGAPGVRVTGAAVPIDALG"
FT   gene            593919..594908
FT                   /locus_tag="Amir_0550"
FT   CDS_pept        593919..594908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0550"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bcm:Bcenmc03_5299 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34517"
FT                   /db_xref="GOA:C6WI66"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI66"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACU34517.1"
FT                   /translation="MPELELRHLRAVCAIAEEGSLTKAASRLGLTQPAMSAQLRTVERI
FT                   VGGRLFERTPGGSVPTELGRQVVGSARLVLDEVGGLVRLARERSSGADRGPLLVGSVPT
FT                   LFFGDLVTELRRAVPGVEIRTETMQGGSELLEKLVAGQFHVAVLDWFEGLDTRELRGVE
FT                   VRRLVSEPHFVALPEWDRLARQDEVDLAELADRDWVTPPDQFIGNRLQIVAACAGAGFT
FT                   PRFTHHANEASSARGLVASGAVCFALPQSRGGDGIVVKPLKGSPLLIDVLVATRRDGPV
FT                   AGRAHEVYACAARAYRALLPRNPAFEKWWADHPEAHAELDTALLVDPA"
FT   gene            complement(594981..595796)
FT                   /locus_tag="Amir_0551"
FT   CDS_pept        complement(594981..595796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0551"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NmrA family protein; short-chain
FT                   dehydrogenase/reductase SDR; KEGG: mxa:MXAN_5100 NmrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34518"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6WI67"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACU34518.1"
FT                   /translation="MTTLITGATGHLGALIADHVLTRIPASELAVSTRSPEKAEALSAR
FT                   GVDVRKADFDDAESLRAAFAGVDRLVLVSADGPDRIAQHTRVVEAAKAAGVSFIAYTSV
FT                   VDADTSTLSLAPDHAATERVIRESGIAFAFLRNGMYHENYTQALGHGVVAHAAGDGRNA
FT                   SASRHDLAEAAAVVVTGEGHEGKVYELTGPSAWTFAELAALAGDEAKPVTAQERIAGLV
FT                   GFGLPDFVAELLTDIEVNIGRGALERVTDDLPTLLGRPATPIAEAVANR"
FT   gene            595883..596269
FT                   /locus_tag="Amir_0552"
FT   CDS_pept        595883..596269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0552"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   mxa:MXAN_5099 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34519"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ87"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACU34519.1"
FT                   /translation="MDGMATTGDVYDRNCPSRQIASHATSQWGGLVLGKLLEGKLRFSE
FT                   LRRAVVGVSEKMLAQTLQALERDGLVLREVHPVIPPHVDYSLTPAGAQLAARVRGLYDW
FT                   IEDNLPDLCAARDAYDAKRAGTTV"
FT   gene            596361..597458
FT                   /locus_tag="Amir_0553"
FT   CDS_pept        596361..597458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0553"
FT                   /product="AIG2 family protein"
FT                   /note="PFAM: AIG2 family protein; KEGG: pae:PA4164
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34520"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ88"
FT                   /inference="protein motif:PFAM:PF06094"
FT                   /protein_id="ACU34520.1"
FT                   /translation="MGGIRKHTASGAALALPFTDDRHPAEPYPGARPGACFVHLDGAGW
FT                   PVDPDPMTDSGWRVSPDGVDLDEWLAGHGEPPMAERTPVLAYGSNANPAKVTWLREELG
FT                   LTGPAVVLRARCEGLAAVWASGLRKVDGQRPATLAAMPDVTEEHAVWFATAEQLRVLDR
FT                   CEGRGLRYRLVRVHSGRVTLFDGSVVDSVLAYTGAGRRRMPLLSAGEPVRCAEVDQVGA
FT                   RWLGGRPAPDDGLDVTPVHGYPAPDEWPDRLFAYGTLQPGQSAWGLVEPLTSGSPEPAR
FT                   ASGTLHDTGLGYPALRPGGGGANVPGHVLRLTSPEEALPVLDKYEGDEYRRVRVTLPDG
FT                   RVCWTYLWRGPVDGFAELPEGWVRR"
FT   gene            597634..598308
FT                   /locus_tag="Amir_0554"
FT   CDS_pept        597634..598308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0554"
FT                   /product="peptidase C14, caspase catalytic subunit P20"
FT                   /note="KEGG: rpc:RPC_3182 peptidase C14, caspase catalytic
FT                   subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34521"
FT                   /db_xref="InterPro:IPR025326"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ89"
FT                   /inference="similar to AA sequence:KEGG:RPC_3182"
FT                   /protein_id="ACU34521.1"
FT                   /translation="MRRRLIAVCGVALAGVLAACGGGARPAAEQGELTGALTTEAAPSS
FT                   AATGSSGPGASVEGAPNSADPGGGADPVPPSEPGGQPPGAGGRCTAASLTGRFQPTDAG
FT                   AGNRHGMFVVTNTGDRTCTLTGYSGLQLLDAAGGPVPTDLVRTGRPAPEPVVVEPGASA
FT                   SADLRWTVVPTGDEPVEGPCEPQPASAAAIPPDETQPLTVTWPGGPVCGGGKIEISPFR
FT                   AA"
FT   sig_peptide     597634..597693
FT                   /locus_tag="Amir_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.410 at
FT                   residue 20"
FT   gene            complement(598611..600047)
FT                   /locus_tag="Amir_0555"
FT   CDS_pept        complement(598611..600047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0555"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hha:Hhal_1735 putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34522"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34522.1"
FT                   /translation="MVNGSVVGSGPVGSGAVGLEARVGALLDEALALYRDSPRAVSWLR
FT                   GHRARFAEPVRVAVAGGHGTGKSTLVSALVGEELTAPPTATAWYRDGARPAAWVGAHEV
FT                   PVVRRDDGVRVEAGGAERVVVEWPARSLRDLVLVDTRPDAPVELVFGEADAVLHLTRHV
FT                   RDEDLERLRAGHDHPIARAAPVTTLLVLARADEIGGGRIDALSSAKQIARRCRRDPAVR
FT                   GLCQDAVAFAGLLAVASRTLRDEEFAALGALSGLARAELDGHLLSADRFAGEDFPVALG
FT                   ASARQRLLDRLGLFGVRLCTTLIRQGFDTRVKLTGQLAQRSGLGELREAIGAHLTERRG
FT                   ALKARSALLGLDVVLRAEPRPGSVGLLGALERVVAGAHDFRELRLLAALAGGRVSLPGE
FT                   LGEEATRLVGGAGTGAAARLGAEEQGLSGRELRHLLLDVLGRWREHAASPVLDNAQRRA
FT                   AGVVVRSCEGVLVERGGVAG"
FT   gene            complement(600103..601911)
FT                   /locus_tag="Amir_0556"
FT   CDS_pept        complement(600103..601911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0556"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   scl:sce0387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34523"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ91"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACU34523.1"
FT                   /translation="MSAPWLDVLDDTIRACAARNRPDLAARLREKRASQLDPRIRVLVV
FT                   GESKQGKSQLVNALINAPVCAVGDDVTTAVPTFVQHAETPSATLLRGGSIADTPTERIP
FT                   VPIDQVARAVSGRAGGEVLAAEVGIPRELLASGLVLIDTPGTGDPRGARAASTYAALLQ
FT                   ADAVLMVTDATAELSASELELLRRVLAACPNVTVVLTKTDLSAQWRQVLQRDRAHLARA
FT                   GVGAKVLPVSSALRLRAARTGDRELNAESGFPELLACVQRDIVAAADVLGRRSVAAAAA
FT                   SAVKQLVAPLKEELASMGARGPEDTIAALHEAQRRVDELRRRSARWQTVLADEMADLVS
FT                   DVEYDLRDRTRGILREVDRTFETADPGKVWDEFEPWLRTSLTEAATTNFAWLLERAEWV
FT                   AEKVARSFPVHRDDLLPESVFPDDLLDRVAEMDAPTLERFTASQKFFTGLRGSYGGVLM
FT                   LGLVTSLAGMPLINAVSLGAGALFGGRSVLEEGEQRLKRRQAAAKQSVQRHVDDFFVKF
FT                   SKDCRDAARHVQRSLRDHFSTIAEELQETLLESARSARRAVQDDATERERRTREAKGEL
FT                   DGLVQLYQRVQAVAGVGAATPLSITA"
FT   gene            complement(602010..602867)
FT                   /locus_tag="Amir_0557"
FT   CDS_pept        complement(602010..602867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0557"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcj:BCAS0321a hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34524"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34524.1"
FT                   /translation="MVATPDTLHDFVLDLLSNPSALAAFQVDAEGCLAAAGLSDVTALD
FT                   VQEVIPLVLDFAPSAGLPALDGIVAGDLDLDLEGSVSAIAQLQAVTQQLTGVVGAGSDL
FT                   NLGAVGALTADASGVGLLGGNGDLGLGLGADVATSVDATVATSFSAVGDVTATLDGATT
FT                   AVTQTAAGVDTTVDATLSGAVDTLDGTVGSALPGLDGVTSPLFDTVGSVHGSVSAVADQ
FT                   AFGALGGGGLDLGATLEPVGDLTQHVTATVSATAHNAGVGGVTDAVGHATAPIAESPLG
FT                   DLLF"
FT   gene            603113..604432
FT                   /locus_tag="Amir_0558"
FT   CDS_pept        603113..604432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0558"
FT                   /product="molecular chaperone-like protein"
FT                   /note="KEGG: hha:Hhal_0145 heat shock protein 70"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34525"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ93"
FT                   /inference="protein motif:COG:COG0443"
FT                   /protein_id="ACU34525.1"
FT                   /translation="MSYVLGVDAGSTRTSAAVCHLGGAGRSEAEVVGLGGPGGGVATCL
FT                   QLTADGDFAVGEPGDPRWTASDFVRRVGDDVPVVLGADPCTPQELVGLLVAHVARRVAE
FT                   REGEPPAHVVLSHPPGWGPHARALVHAALRDAGLARVTLLPEPLAVAADHAENHRGRTG
FT                   LLAVLGVGSHATTSALVRLAPNGEHELLAWSEEADRWAGADLDDLVFAHVAAELGGLDP
FT                   AQPHLLPAVARLRRDCESAKRVLSGVPVTAVPVHLPDGRVDVELTRERFEELARPGVEL
FT                   AVRGLERLCRGHRPDAIALVGGTARTPLLASAVTAAVPGRLVLAAAPETCAVRGAALAG
FT                   RRLLLGPDTGPDHGETSVLVHGDDPSLRFPVGQLAWDDAESAAPPPRPPVEITPLDLPT
FT                   PLSVKRVVRRGLAPIGRSRRRGGRSEPDPRHRTRHDEDGR"
FT   gene            604441..606807
FT                   /locus_tag="Amir_0559"
FT   CDS_pept        604441..606807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0559"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; SMART: regulatory protein LuxR; KEGG:
FT                   ank:AnaeK_3854 tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34526"
FT                   /db_xref="GOA:C6WJ94"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ94"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACU34526.1"
FT                   /translation="MTTPPKPVLDTAARALLDEIAANPGAVLRLGVLAPGGHGKTTLLR
FT                   EVERALAQNGADVTAVDDAHLLGDDELRALRALVERGDTSVVVAYRPWPRSRALAALAE
FT                   SLGRVRPAHLPAPLTREQVRHALPPSTGRALVDFVHQQTGGVPRFVARLSGLTSPELTP
FT                   DVIASFRADLDWLDPDAQKFLLAAEAGAALRLDLLRSLLGGDADRVADVIDAARATGLL
FT                   APDGTLLPVARTAVAALSRTDRRIAVRRALAESQLRAGGPVLDLVRPLLTAPGPELSEL
FT                   FKAAAAEALPSDPALAARLLAAIGTPTPEVAVRHATASAMAGDLDSALRLADRVVAAGD
FT                   QTHRGAAAEVAAIALAHRGQLARSTELHRWSPSATSTAFAHIGQIGVGALPAAPLPPAP
FT                   PTLLGGAASLMAHGVLESVTGSPTTALSTLVRASGLLEPAGAGVLLPDSPAALAALVAL
FT                   HSGEPVVAESALDRAVASGLGGSLMAVRHRLLRAWIAMGRGNLERARETITALRRANRP
FT                   LEPRDWIFAVALEIGIARRNSDLPTLKRTWEQACEAVLRHPVDLYTFLPLGEFAAAAAR
FT                   LRDQHRLAPHLAAAEDLLRGLGNPALWAVPLHWSGLHAAVIAEEIPAAEEHAAALAAHR
FT                   DSGRYCAIVSSAAESWLDVLAGKVDPDQVERAARGLHAAGQWWDAARLAGQAAIRTSDR
FT                   QAMVRLLDCARLLQGRPLGGRKPVEPETGQETGKLSDREREVAELVVGGLTYKQVGDRL
FT                   FISAKTVEHHVARIRQRLGCTSRAELLDQLRQIVG"
FT   gene            complement(607000..607530)
FT                   /locus_tag="Amir_0560"
FT   CDS_pept        complement(607000..607530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0560"
FT                   /product="small integral membrane protein"
FT                   /note="KEGG: hch:HCH_05440 small integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34527"
FT                   /db_xref="GOA:C6WJ95"
FT                   /db_xref="InterPro:IPR018681"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ95"
FT                   /inference="similar to AA sequence:KEGG:HCH_05440"
FT                   /protein_id="ACU34527.1"
FT                   /translation="MRFLARVGGPRAAVVVLTAVAGVYMALVAFNNVTDYGSNHAFVQH
FT                   VFAMDTTFGAPSAAWRAITSPALVTVAYVLIIAWEALTAVVLLVGLGAWLSGRSRLGSL
FT                   LSGTGFGMQVLLFGLGFIVIGGEWFLMWQSKQWNGLAPALQNVVIAGFGLVLVHVAGRG
FT                   EPVVERADAGRAG"
FT   sig_peptide     complement(607435..607530)
FT                   /locus_tag="Amir_0560"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.754) with cleavage site probability 0.435 at
FT                   residue 32"
FT   gene            complement(607655..611689)
FT                   /locus_tag="Amir_0561"
FT   CDS_pept        complement(607655..611689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0561"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; SMART: WD-40 repeat
FT                   protein; KEGG: scl:sce4551 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34528"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ96"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /protein_id="ACU34528.1"
FT                   /translation="MVGNGHGSGPRTAFAERFALLYAEAGDPPLKRVTASVARSRRVDE
FT                   QGRPVRVTAQRVSDWRRGRNVPARFSALSVVLEVLIGEARKQRPTPPIPELHDLEAWRE
FT                   LWEQALASPVAAVESGPAEMPEESGVCPYRGLAAFQPEDSSWFFGRERSTAALVTRLDN
FT                   STEYGGIVVLVGASGAGKSSLVRAGLIPSIREGALADPSSATWPSAVMTPGAKPLAELV
FT                   ERVPELSAVLPPGGLPDDPPTERGAGPRSLGVIDFAERVRAAVAEHARARGGERLVLVV
FT                   DQFEEAFTLCGDDAQVQLFVQALAAACTPERPGGHAPALVVLGVRADFYGRCLAIPELA
FT                   DALQERQMVLGPMTSAELREAVARPARAAGLQLEAGLVELMLRDLGVRAGRTPVHGARG
FT                   AYDAGALPLLSHALLATWQRRQAGRLTIAGYRAAGGIQGAVAATAERAWADLPPAAQGA
FT                   ARPLLLRLVRIGADTHDTRRRSTRQELVGQAGDPAAAEEALEVLARARLVTLDAGSVEI
FT                   THEALIQAWPRLRGWIDQDREGELLRQRLEEDAAAWAEQGRDSSLLYRGARLEAARHWA
FT                   TRHRADGAGPTGATGDFLAVSGQHHRRGVWALRGGAALVVVLALIAGVAAVVAVRQRDD
FT                   AVFRQVVAEADKLLDRDPSLSAQLALVARGMRPSALDLGTRLISSGGAPLATPLTGHTG
FT                   AVYLTTFSPDGRTLATASYDRTVRLWDVTDRDDPKPLGEPLTGHGDWVSSAVFSPDGRT
FT                   LASAGKDGSVRLWDVADRARPRQLSTAESPGRDTVYLVAFSPDGRTLASAHADRAVRLW
FT                   DVTDPSAPKQVAELAGHGQQVRTVAFSPTGLLASGSDDATVRLWDVADPSAPRQAGEPL
FT                   GGFDSTVHSVAFSPDGRTLAAGSEDRSIRLWDVTDPAAPEARGRPLALHLAPVWSVAFS
FT                   PDGRVLASGAADSTARLWNVTDPARVQPLGKPLAGRSGTVFAVGFSPDGRALATGSLDP
FT                   VVRMWSLPSTVLVGHAARTVGPRFAPDGRALLTGSEDGTVRAWDLAGPGGPDAPTPIGD
FT                   RRDAGEPVRAVVLGEDGRTMVTAGPKAVRLWDVRPGAEPEPLGEPLPLRTRFSSPLALR
FT                   GNLLVTADEDDTVLLWDLSDRARPRQLGEPLTGHDGYVNVALLTPDGRFLVTGSADSAL
FT                   RVWDVSDPARPRAAGRFPGHDGPVRAGALSPDGRVLATAGDDKLVRLWDFSDPTAPRAL
FT                   GAPLAGHEEAVVAVVFTPDGRTLASGGEDARLRLWDTSAPALARPIGEGVVGHDSALRD
FT                   ISVSPDGSVVATSSADGTVRLWHLDADWARRRICARTGGVLTEDAWREHVPQLDYAPPC
FT                   R"
FT   gene            complement(612309..612665)
FT                   /locus_tag="Amir_0562"
FT   CDS_pept        complement(612309..612665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to zinc finger protein 607"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34529"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ97"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34529.1"
FT                   /translation="MGRVGPVGCGSAGRPASAAWIVASFAVPVLPVPPSAPRPPPRRPR
FT                   ARVRARVRTRARLVVVRFPRAVGTGGRRFGELVRPIVRRVIRAGPGPGCGRRPAMGVGA
FT                   RSGEVPTTVSQVVW"
FT   sig_peptide     complement(612609..612665)
FT                   /locus_tag="Amir_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.795) with cleavage site probability 0.761 at
FT                   residue 19"
FT   gene            612716..614470
FT                   /locus_tag="Amir_0563"
FT   CDS_pept        612716..614470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0563"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AlkA domain protein; helix-turn-helix- domain
FT                   containing protein AraC type; SMART: helix-turn-helix-
FT                   domain containing protein AraC type; KEGG: scl:sce6205
FT                   putative regulatory protein Ada"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34530"
FT                   /db_xref="GOA:C6WJ98"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ98"
FT                   /inference="protein motif:PFAM:PF06029"
FT                   /protein_id="ACU34530.1"
FT                   /translation="MGAHAPADRHTTTHPPATDRPPATTGRATRGGAPTADRAPIGSRI
FT                   PTAGQPAAASRVPADASAPTTSRAATSHAGANAVAPAAGRTPVGRASADAGGPTAGRGA
FT                   AGRVPAAAGAPAASHAAASRASAGAGAPAAGRAAPGPAPAEVGAPATGHTTAPRPRAPH
FT                   PFADHPTAPPTTDLVDPTWGPRSDPVARALRMIVDGVVDREGVPGLATRLGYSVRQVER
FT                   RLLAELGSGPLAIARARRARTARLLAETTALPMTEIAVAAGFASVRAFNETVRELFGRS
FT                   PTDLRGGRRAPGGVPGAVVLRLPFRGPLHAPSLFGPLVANAVPGVEEWRDGAYRRTLRL
FT                   PRGHGVVSLRPRADHVECDLTLTDSRDLPVAISRCRRALDLDADPAEVDGALRADPALR
FT                   PLVDAAPGTRVPGVVDGAECAVRALLGEGTGTGAAMGAGANAGWAHRVVREAGEAVPDP
FT                   AGGGLTHLFPTPQALLDLDPALLPPPARAPLTALLTALVGGVDLGAGADRAEARSALRC
FT                   AGERVLDAVLTRSLGDPDGFCPDDPAVRAAAGGIGLPVTAAALADRSRAWRPWRAYATR
FT                   YLLGRAPT"
FT   gene            614627..614773
FT                   /locus_tag="Amir_0564"
FT   CDS_pept        614627..614773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34531"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJ99"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34531.1"
FT                   /translation="MDGDPPLSTDQLFSHLESHDAHFPVPASAEPSYEDLFHEPPATID
FT                   ASS"
FT   gene            complement(614904..615737)
FT                   /locus_tag="Amir_0565"
FT   CDS_pept        complement(614904..615737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0565"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   scl:sce6070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34532"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA0"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ACU34532.1"
FT                   /translation="MPALSPDAPAPVYIDTTKASIARVYDAFLNGKDNYEIDREVLRRV
FT                   QQVTPEAATLAVDNRGFLIRATRFLASQTGITQYLDCGSGLPTAENTHQVVQRLQPEAR
FT                   VVYVDNDPVVLAHGRALLEENDQTHFSAADIFDPEAILDDPVVREHIDFSKPVALLQLG
FT                   TMHHHNGTSPTSREIMAKYVDALPSGSFVALSHFLDPETEELSRLARRMEQAFLHSPMG
FT                   SGKFITRAELLGLFDGLELVEPGLVICADWWPDGPQLKELAPVSRCIAGAVGWKR"
FT   gene            615946..616830
FT                   /locus_tag="Amir_0566"
FT   CDS_pept        615946..616830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0566"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34533"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34533.1"
FT                   /translation="MATGEPRLPSGERDSGPTALRIVLGAQLRRLREAAEITRAQAGYQ
FT                   IRGSDSKISRLELGRVGLKERDVSDLLTMYGMVDEDARQKFLAMVRRSNEPGWWHRYTD
FT                   LMPDWFQDYVGLEEAATRILSYETHFVPGLLQTEDYARAIASHGRPELAGPEVQRRVTL
FT                   RMSRQKVLARPGAPRLWVVIDESVLHRPIGGRQVLLDQLDHLLEVTKQPLVTLQVVPFP
FT                   LSGYAAEGPFTMLRFGEPDLPDIVYVEHLAGALYLDKPEELEIYGRVFDRLTVDAETPD
FT                   RSRQALVKARAAL"
FT   gene            616934..617221
FT                   /locus_tag="Amir_0567"
FT   CDS_pept        616934..617221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0567"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34534"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA2"
FT                   /inference="protein motif:PFAM:PF04149"
FT                   /protein_id="ACU34534.1"
FT                   /translation="MHVQMHCLRSFGPKGWSMASRVHNGMSAASLQGVVWRKSARSGAL
FT                   GNCVELAHVDGGIAVRNSRFPDGPALVYTREEVAAFVAGAKDGEFDDLLG"
FT   gene            617205..617510
FT                   /locus_tag="Amir_0568"
FT   CDS_pept        617205..617510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34535"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34535.1"
FT                   /translation="MTSSADQGGRTAGQLRQLIARGFQFLHPRDARGELAAVVGVRAHH
FT                   TVIDVVRLHDADNAVATRMPADESNVLFPSRFSWRSRGSATAVLEELLELPDDRMT"
FT   gene            complement(617909..619162)
FT                   /locus_tag="Amir_0569"
FT   CDS_pept        complement(617909..619162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0569"
FT                   /product="membrane-bound lytic murein transglycosylase
FT                   B-like protein"
FT                   /note="KEGG: hypothetical LOC586091"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34536"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA4"
FT                   /inference="protein motif:COG:COG2951"
FT                   /protein_id="ACU34536.1"
FT                   /translation="MAVEDSDGLTPAATPESPPRGREADRAAGAEPAPPATTGAKGIPV
FT                   NVLEAYREAERSLAGSCNLRWYHLAGIGKVESGHARGGRADPAGETAPQILGPVLDGGE
FT                   FAAIRDTDGGRHDGDRTWDRAVGPMQFIPSTWQRYAADGNGDGASSPHNIHDSAVAAGK
FT                   YLCSGGMDLAKQSDLDAAVFRYNHSRTYVVAVETWMRAYSDGAVEVPALPPGADEDEGG
FT                   SDGGKPEGAGASGESSSTAPESAAPESASEAAASEAAAAESAAADSSAPGSSAPDSSAP
FT                   DSSAPDSSAPDSSAPDSSAPGSAGSPAPDQQAPAAPDAVGANPQGQAVQGGQAANSAPQ
FT                   QAGAPPVETKRPAAPEPQQVDRCLVLVQEHAQASRPVAPTADEVRQAGCTAEQVAAIER
FT                   LFELSTPVDSPVEKSARE"
FT   gene            619562..625705
FT                   /locus_tag="Amir_0570"
FT   CDS_pept        619562..625705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0570"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; LPXTG-
FT                   motif cell wall anchor domain protein; PFAM: Cna B domain
FT                   protein; Pericardin like; KEGG: gme:Gmet_2043 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34537"
FT                   /db_xref="GOA:C6WJA5"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR033764"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA5"
FT                   /inference="protein motif:TFAM:TIGR01451"
FT                   /protein_id="ACU34537.1"
FT                   /translation="MPEIGMARRLTAAMISTGLALGGTLVATGVAEATVVTNFTPVYEK
FT                   SVYGDFVQTGNGNMGCPTGADPASLNSLSFTDCVTAQGGTATGNNGRESHYMKYVDADG
FT                   GGNVATYNSSIAKVNIPAGATIDYARLHWGGNTGVFRNATDATGNRGCAPGYTSSASTF
FT                   PAGNPATAQISMAIGAGTPLTIGPDSYVADDAPTLVQNEAQQYVAWTDVKSLLGPAVTG
FT                   SDVNLTIGNIWTPQGYGCHAGWSLTAVYALPNPTGGAIKRSIQIKNGYVKQHASEGNYT
FT                   TSLETLDGASKTTGSRLGVTAFGGHQNLTSDALSYKGTALTEPRLNNSTNFFASTATNQ
FT                   VTPSVVNNFSVDAKVAVPTNVAVGDRSGAVVVGSGSDTFVLSSLAMSVPTPGIYITATP
FT                   RTTPPYYQGDSVIYDVVVGTSDNQTITNVGVSNTDQAFGDCNRPSTATLTSGNPTLSYS
FT                   CTVPAGTANFNNTIQAVGANAFLEPVSDSKTITATVSTIGLSLTKTADKATYSAGETIT
FT                   FTVTAANTGNTALTNVAIADAKVNACAKNQATLAAGAQLVSTCTATAPIAGDANTATVS
FT                   ATDARGGTVNNTATANAYSEGAISGRVFADRDDNGAFDAPMGDTNLVNVGISLTGTETN
FT                   GGAPVSLNTVTAPDGTWSFANLKAGNYTVTKDPTPDYDPGKRTPGNAATAPLNTETFTV
FT                   ALPGGQSSTGNLFAVIPTSSLSGFVYEDSNNNGVKDTGEKGIQGVAIALSGIDDGGNAA
FT                   NWNTSTDVDGAYTFKALRQGNYNLSETQPAGWTDGKDTPGSAGGTRDAPDSIVNIQLDP
FT                   RVTAIDYLFGEYKGTSIAGKVVDDKDMGIAGVKLTVTGGAGPLEATTDAGGAFSFTLAP
FT                   GTYTLTEEQPLGYAQGTDTVGTTGGTHSAENTFSAIVLKSGDAGTGYVFKEKRGSLTGY
FT                   VYEDKNGNGNKDAAEPGIANVSVKMTGTDAMSRPVNTTMTTNSQGLYTFAGVVGGTYSL
FT                   TETQPEGYENGVDKAGTVGGDYTPPDTISDISFPAGADATGYLFGEYKFGSIYGEVLND
FT                   KGNPIANVKITLENDERAPIGQMTMTDEFGQFVFEDIVPGTYKLVEEQPAGYADGPDTA
FT                   GTGGGDTSVADTIGLIPVGSGDILTGYQFTEKRGSLAGYVYEDTNNNGLKDTGEKGIQG
FT                   TELTLTGTDAQGKAVNLTATTDAAGLYKIEFIVGGTGYTLSEKQPAGYVTGKNKVGSQG
FT                   GTLTAPDKVTGITFSAGAAATGYLFGELTPASLAGDVVNEKGEGIAGVTVVLTGTDDMS
FT                   TTVNKSAVTTAGGKYAFNSLRPGTYNVTETQPDGYGQGTATPGSAGGTALGADEITGVV
FT                   ITSEAKATGYRFSEKRGSLSGVVFDDRDNDGVRDDGEPGIQGVTLTLKGNSEWCAVGEP
FT                   DGTDTETDNGTGTPTPDTGTDPGTGTDPGTGTDPGTGTDPGTGTDPGTGTDPGTGTDPG
FT                   TGTDPGTGTDPGTGTDPGTGTDTGTDPGTGSGGTPDTGVGAGGTPDTGGGRVDPTDATA
FT                   DATTADGEMTTMADPAVSAGDAAPTCAVTLTATTDASGVFSFAGLVGGTYDLMETQPAA
FT                   YADGKDTAGTAGGTVTAPDAIMGIVLAGGVDATGYLFGERAGVITGTVWVDANGDGKID
FT                   TTELGRIAGAKVDLMQGDSTTPLASATTTTEGTYEFKDVPAGDYSLMLTLPMGYGATTP
FT                   TTVKVTTTTTSGTNVDFGVQKGAIGDFVWDDLNRNGLQDAGEPGIAGVKVNLLDEQGEV
FT                   KSSTTTNASGKYMFGDLDEGTYRVQFTVPTGRTFTAQNAGAPEKSSAVDRSNGLSGPIV
FT                   FKVADSKVMQNMNVDAGVVDRITDLGVTLTADNPSPQVGSQVVITSKVVNTGTVPVNGA
FT                   IATITIPQGLTINGVDGGAPQAQGVAMARAARADEGWTCAVNGQQVVCTTPDVIQPGAS
FT                   SLPITITTTANSAFTTTNATALVTLADGTGDDNPANDGATTPALSTETPSTGGPNTGGG
FT                   TTQQPMPPMPPNGMGNMPLAWTGSEIRPVLIGGLALLLAGLGTLFLGKRRRKQGM"
FT   sig_peptide     619562..619663
FT                   /locus_tag="Amir_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.956) with cleavage site probability 0.541 at
FT                   residue 34"
FT   gene            625950..626150
FT                   /pseudo
FT                   /locus_tag="Amir_0571"
FT   gene            626473..631002
FT                   /locus_tag="Amir_0572"
FT   CDS_pept        626473..631002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0572"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; KEGG: rso:RS05482
FT                   putative rhs-related transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34538"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA6"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACU34538.1"
FT                   /translation="MDNPLVAAPRSDTTAVTGIGIAESSVDLANGIADGNWVEAGLGGA
FT                   GVGLEVLSMVIDPVGTVASYGVGWLMEHVQPLKEALDWLAGDPPVIRSFSETWGNVAAE
FT                   VRAVAEELGGQDAPGWEGAAAQAFRGANAETADAIAGAGVLAEGVGIGVMVMGEVVAAV
FT                   RELVRDLVAELVGRLISWALEAVATLGLATPVIVAQATTAISRMCSRIADLVRKLVRTI
FT                   SNVAPRIRSVVDKLGEIMQKLGRLGRRADTPSGPDTPNLAGGRPATPDAPSGTTSPSGT
FT                   TSPSGTTSPSGTTSPSGTPAPSSTTTPSGTSSPDPAPTGTSPGGTTTTSGAAPSPARPD
FT                   SATPDSTSPSARDQAGADPKASARPTSGRPTCGDPVDVVSGQVLLPQTDVALGGALPLL
FT                   LTRTHLSGHRAGARFGTSWASTLDQRLEVDEEGVCFVTEDGMVLLYPHPGATPVLPVEG
FT                   PRWPLSSTGDGGYEVVDAEAGLTRRFTPSAGGPLPLGSITDLNGNRVTVDHDVDGVPTD
FT                   VRHSGGYHVSVRSTGGLVTSLVLAGPEDITLIRYGYDAERRLTEVVNSSGAALRFSYDD
FT                   DQRVVGWQDRNGMWYRYGYDDRGRCVLNEGADDYLSGTFAYLDGRTVYTDALGNRTEFH
FT                   LNRAHQVVREVDAGGGVVVSEWDRHDRLLSRTDQLGRTTTHRYDEDGNLVALVRPDGRE
FT                   STATYDAGRMPLVVEDVDGAVWRREYDPRGNLLAVTDPSGARTRFDRDERGNAVAITGP
FT                   LGEVRRIDYDLAGLPVAITDAEGGRTGYRRDRFGRVREVTDPLGSTTTLGWTVEGRLAS
FT                   RTLPDGSVERWRYDGEGNPVEHVDAAGAVSRTGYTGFDQPAWHVGPDGARLEFGYDPNL
FT                   RLTSVVNARGQAWTYRYGPTGALVVETDFDGRSTTYVHDATGQLTAKVNGAGERIAYEH
FT                   DELGRLRAKRTPHGDTTYDHDPAGRLIRAVSRDADVLVERDLLGRIVAETVNGRTLRSE
FT                   HDASGNRVRRVTPTGAVSEWEHDGTGRATALLAGGRRTAFGYDAAGREVQRLVGDSTRL
FT                   GQVWDANHRLLAQDLTARGARVQRRDYRYRADGNLLAVDDLLAGPRRYELDPAGRVTSV
FT                   LGSGWSEGYAYDRAGELTWATGPGETSGARSYAGTLIRRAGDVHFEHDAQGRVVVRAHR
FT                   TLSGRERTWRYGWDAEDRMVSATTPDGARWAYRYDGLGRRVAKERLDAGGAVVERVDFV
FT                   WDGLVLVEQITAGTALTWDYEPGSHRPLTQVERVLAAPQEWVDARFHAVVSDVVGMPSE
FT                   LLDDAGALVWRSQRTLWGAVLAELAGGPDCPLRFAGQYHDRETGLFYNVHRYYDPETAR
FT                   YSSPDPLGLLAGPNPHAYVVNPLRLTDPLGLSGCERARKIADRVVERAQQGRVREASNY
FT                   HGRLSRERELEILSNPDGVYHSTGSGGRLIFRQGDDILITEGPGSSAGQLVTSYGPSGP
FT                   RGESGASIFGGAPSDPGLPVTHDMIVEGRIPVPGGGTLPAAVQVLPRP"
FT   gene            631013..631729
FT                   /locus_tag="Amir_0573"
FT   CDS_pept        631013..631729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34539"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34539.1"
FT                   /translation="MDFEVARGEPLPHVPRLVLDTRAVLVGPYGSAVEHERHVLDTAGA
FT                   GGWPDTEDDEYRFDRDTGTLVSALLHIPDAQTSALPWHIPPGEPAALRTQAAQPRPPAP
FT                   THWLSPDTSTLVCAYASHPAPLPPLHRVDTAPDFALLLLPDNTLSGWLLAHPDRHVTTA
FT                   WEQATPELPDEPFRAAFTTYFSLTTPEAVEALEDGAPNVLSQLSELRDTIPLSEGVHSR
FT                   RAALHHAVEGLLDFYG"
FT   gene            631738..632154
FT                   /locus_tag="Amir_0574"
FT   CDS_pept        631738..632154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0574"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34540"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34540.1"
FT                   /translation="MTTREDLHALLTTPDLPHPERTRRVRALTDVEDHITQTPSMTPIL
FT                   CKALSLRSRAAPNEDILQVLAEIKAPTSLPCLREALHWQPEWDEFDQVGVKALWAINAV
FT                   NTAEARRLVAGAAERGPEAVRDWARRKLDQHPAE"
FT   gene            complement(632186..632659)
FT                   /locus_tag="Amir_0575"
FT   CDS_pept        complement(632186..632659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0575"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bbt:BBta_3942 putative
FT                   NUDIX-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34541"
FT                   /db_xref="GOA:C6WJA9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJA9"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACU34541.1"
FT                   /translation="MARTDHYDDPNAPEATRIVVAVTAFVQDQQGRLLMIRRTDNGLYS
FT                   IPGGAQDVGETIGRTVVREVKEETGVDVEPVDVIGVYSDPAHVVSYTDGEVRQEFSICF
FT                   RATLVGGELRTSGESSEVCWIGRDELAALDIHPSIRLRIEHGFGARDRPYFAT"
FT   gene            633802..636642
FT                   /locus_tag="Amir_0576"
FT   CDS_pept        633802..636642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0576"
FT                   /product="transcriptional regulator, SARP family"
FT                   /note="PFAM: transcriptional activator domain;
FT                   Tetratricopeptide TPR_4; TPR repeat-containing protein; NB-
FT                   ARC domain protein; transcriptional regulator domain
FT                   protein; Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: scl:sce5225 protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34542"
FT                   /db_xref="GOA:C6WJB0"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB0"
FT                   /inference="protein motif:PFAM:PF03704"
FT                   /protein_id="ACU34542.1"
FT                   /translation="MEFGLLGPLAISHEGSPITLTKAVPRATLAVLLLHHGHPVAVERI
FT                   IDVVWSEADGPPLTARSMVQRSVNSLRELFKVDPETTLRTRPGGYELTCREGALDLRRF
FT                   EDLVDQADGCGSLREMAAVLREALRLWRGDPLSDVTNRGLESFKTGLTERRLTVVERCI
FT                   ELELQLGRHQEIVAELQSWTDTHPFRESLLALLMLALHRGGRTTDALAAYADFRARLAE
FT                   EVGTDPGTAVRMLHERILNNDHTLAAPVQRGVDTAIPQTATDHADTPSQPAWVVPRQLP
FT                   AGPRWLVGRDEQLAQLGQALAARETGQMAGAGTPVVVVVDGMAGIGKTALALTFAHQVS
FT                   DRFPDGQLYLNLRGFGPAGTPMAAGEAVRTCLDALAVAVDDIPTSLQAQAGLYRSLIAN
FT                   RRMLVVLDNAADAEQVRPLLPASPASMVIITSRRRLESLVATDGAIPLALEVLNAAQAY
FT                   ALLEAGVGAARLAAEPDEVDELIARCAGLPLALRIVLARALTRPGFALAALVSTLRAAQ
FT                   DRLGSFDGGDPVTNLRVVFSWSYRDLPADTAWVFRSLAVHPGPEMSESSIASTSGLSRP
FT                   ATRAALAELVQLHLLQERALGRFSLHDLIRLYAVDHLHGDGDEVIGRARQRLADHYLHS
FT                   AHRAAMLLYPSRDPITIAAPLPGVCLDEFAGELEARAWFGTEHAVLLAVLHDAARHGLH
FT                   AHAWQIPWSMVDYLDWGGHWRDYIATQQIALDASAALGDLNGQIRAHRGLGRAHLRLGD
FT                   IETARGFLTRSLQLSRQSNDPLGEAQTHLILAWMHEQDGDFRSALGHAEQALEGMRAGH
FT                   DGRGVANALNTVGWYHTLLGQHSTALRYCGQALEQHEQLDDPQGHADTWDSLGHAHRGL
FT                   QDLPQAITCYTRAVELYRTIQHGYDEATTQASLAETLLLSGDKDRARATWEHALTLLAP
FT                   LDPDEADAIRSRLTAL"
FT   gene            636814..637278
FT                   /locus_tag="Amir_0577"
FT   CDS_pept        636814..637278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0577"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: xcv:XCV0585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34543"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34543.1"
FT                   /translation="MNTLYRLITATATGIGLAVLAGASATATAATPADGPAAPTTTSAA
FT                   AQFEMALAPSQTRQLPAGLAVPDATVTAEGIGVLAQGGFDRDHWWIKISKAEVIAIGAN
FT                   AVCRAVFRTAGGVVCPPIVAAVNWLVAQFPNAGGFWAELYTNGRVRAGTW"
FT   sig_peptide     636814..636903
FT                   /locus_tag="Amir_0577"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.976 at
FT                   residue 30"
FT   gene            637607..637975
FT                   /locus_tag="Amir_0578"
FT   CDS_pept        637607..637975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34544"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34544.1"
FT                   /translation="MDGTNVFGDDVPELIDPRLLGADDEDRTLRAGATYVPGRYQDGRT
FT                   DIVDVEVVPTNDGHNVILAYSSLPRLVECMGEQQPWVELPATIDPASLQLGTGADMVLW
FT                   DQELPQELRREDGAHGQR"
FT   gene            637962..638327
FT                   /locus_tag="Amir_0579"
FT   CDS_pept        637962..638327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34545"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34545.1"
FT                   /translation="MDSGKFRVDLDELRPIGRLLADAQQDLREQCERMPHQVTDAGRST
FT                   AALDAALVALLGGAAELLSSLGSAHDSLSGTYEEYRDTEDRNVIGQQRLAGLDALFTPT
FT                   RHPWAGNTAGHPSTEHP"
FT   gene            638324..639445
FT                   /locus_tag="Amir_0580"
FT   CDS_pept        638324..639445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34546"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34546.1"
FT                   /translation="MIAPISGPQMPLPQPPRPIMGGHTLATRVDGDIRQLWDKIAWLTG
FT                   VAFEIARVQDTLHAARAASLQAWDGRAADRARDKLGRDGATAGDLAAAARRVVQALTVF
FT                   VYELEAVVESMAQARDLARSAGYRLTADTIQFPLPIVDPAATGPGRTITALVTAARRKE
FT                   AAAHQAIQTDVAKEKTFFEAFLTPTRMLGVARGVFTTSMVTYLAKPAPAVGQFTAAELT
FT                   ARLNTAVAFADNTTGGLRHTALSQAFDLAPRIPAAELNAPLTLGPARLVGNDMPYAKAV
FT                   LKPLHVPGGVLGLAGTGLSIMHGTPPTTAAAAGAGGWAAGAAASGLTEVLLTAATAARF
FT                   GALAAGPIGWAAFVVGTAVSAGVGYAIEHHWSD"
FT   gene            640633..641100
FT                   /locus_tag="Amir_0581"
FT   CDS_pept        640633..641100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pca:Pcar_0786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34547"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB5"
FT                   /inference="similar to AA sequence:KEGG:Pcar_0786"
FT                   /protein_id="ACU34547.1"
FT                   /translation="MTENRAAKREIRELQQITGLSYTEITRLKRVFDEVLEREPHLNLN
FT                   GFGLSWFGTQTLAERREQARAWRDELRRSAADVIEVCQWLRENIRPIKTPQQRSYGLKH
FT                   LVEQNIGKYVSNGELIAAALMAGYPMGPIDGPNTVFGMSQRDVNRLRAGAR"
FT   gene            complement(641552..641809)
FT                   /pseudo
FT                   /locus_tag="Amir_0582"
FT   gene            641901..642743
FT                   /locus_tag="Amir_0583"
FT   CDS_pept        641901..642743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0583"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG: similar
FT                   to F57G4.9"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34548"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:C6W8S8"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACU34548.1"
FT                   /translation="MAKPLVAELSTKKVLHRQGLHVLFYRAALPLSHQTLTFVSGLVRA
FT                   HRKQLGSVWRKLNPGQQALLVLVYLRKGETFADLAAGFAVSTSTCWRYVNETVELLAQR
FT                   SPKLREALRKAKRQGMAHVVIDGTLIPIDRIAADRPFYSGKHKIHGVNLQVIASPDGTI
FT                   LWVSGDLPGSTHDTAAARIWNILAALRHAGLIALGDKGYHAYDPTDRHVITPYKGRNKP
FT                   ESQKDANRAHARLRGPGERANAQLKTWRILRKLRCCPRRAGRLAKAIHVLQNYEATTG"
FT   gene            complement(642722..642826)
FT                   /locus_tag="Amir_0584"
FT   CDS_pept        complement(642722..642826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34549"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34549.1"
FT                   /translation="MCARLITDYAMYSVTMSSEPLLDALSLFHPVVAS"
FT   gene            complement(642843..643604)
FT                   /locus_tag="Amir_0585"
FT   CDS_pept        complement(642843..643604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0585"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG: similar
FT                   to F57G4.9"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34550"
FT                   /db_xref="InterPro:IPR027805"
FT                   /db_xref="InterPro:IPR027806"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB8"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACU34550.1"
FT                   /translation="MLVYPSAIDLSSSHLQFLARELTTHRRRIGSRWRRLDPGRQALLV
FT                   LAHLRCGDTYTRLAVGFGVGLATVCRYIHEAVELLAALAPDLADAAKVASRKAYVILDG
FT                   TLLLIDRVAADRPYYSGKHKRHGMNVQVLADPAGRLLRVSPALPGSVHDLTAARIHGIV
FT                   DALAAADIPCWADKAYRGAGGPVRVPYRGKWHNLSPGQQAVNRSHARIRAPGERAVSTL
FT                   KTWRLLRRLRCSTTHITNLTRAVLTLHLNAG"
FT   gene            complement(643644..644723)
FT                   /locus_tag="Amir_0586"
FT   CDS_pept        complement(643644..644723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0586"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34551"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34551.1"
FT                   /translation="MPLLNEMPLERANQIFRHPIHQEGVSTLERLITALRQCRSAEDFY
FT                   DFQQDLLARVLEVQEHRAACRRVAKLLRQGKAVPADAPELRSADPATSPETWDLEADVC
FT                   ERVDRQLRSVADGLAWRVFSYDRRVIIALSRNQHPGPMAGKKGLAAERAFVIDWWRDEG
FT                   RFVLLHDLTSCLTIGDATSFKEIGNEYEAYLHEIKSDPNRIVSRQARRQRMAEEAIRSG
FT                   GQLPGDLPGRLVPLDIPYKTHLNLLGTAFDLARDRGVQGMKVPGGRALVASDIVRGYDL
FT                   WSEREFIDRTAAEHLQAVKRARILDVGHLVWARSDDLVARSPTMPPWSIYPLSPSLSPF
FT                   QPGVVGLRSCWRRGEAPGR"
FT   gene            complement(644853..645092)
FT                   /pseudo
FT                   /locus_tag="Amir_0587"
FT   gene            645528..646220
FT                   /locus_tag="Amir_0588"
FT   CDS_pept        645528..646220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0588"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppr:PBPRA2228 putative carboxynorspermidine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34552"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34552.1"
FT                   /translation="MQIVDGLTYNGATRLKKRSMLPNAAGIYIWTLQLGHHLTRAEMSA
FT                   DLMVEAISAPFKQVRENRFDSGKLGHYRRVQLYDEPASLSPSSMARLAALLDGGSAELS
FT                   WSLMCATLFQRPLYVGKALNFRDRLPCHFGYKSKFSRLLREHGMSVNDCAVVLCPVTID
FT                   GLAADEDDDRDDLTDSVEGVPPLMEDGDDLEPEEYVPPGKAELNNVIQFAESLVIRTSH
FT                   PLFNERMD"
FT   gene            646222..648237
FT                   /locus_tag="Amir_0589"
FT   CDS_pept        646222..648237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34553"
FT                   /db_xref="InterPro:IPR017642"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34553.1"
FT                   /translation="MTALSKFGGAAAPAWTSDFQFVRGEYAIGGEQVPYFCTTMKVEEA
FT                   RKYLNLARELAVDPADPINIEELMQRDIDSDRANSEIAEYLKQPARIKFFNSLTIVLVP
FT                   VEKDGRSKKAFDENVPLPQDLVTEDFDVIQAGPVVARLLTGTNVGYLRWQPEHVRAIII
FT                   DGQHRFMALNAVHDEQPTTLKPHVTSIPVLILVLDSRAGFVPPAGGPSEITTASRSIFT
FT                   DLNKHAVKVTPEREYLLDDRSVTAVCMRALITPGLRSEELPSTASWPAQIPLAAVDWVR
FT                   TNRSKFDDGFSITTLQVLHQLVDDVVDSRKPSASTDYEAMKAWTDQLTARLELEAVPGW
FT                   SVDALDTRLKTDELEEAPFALLNSEVKAAALGFRDSVGKVITAVLLAGLPYAELLSRYR
FT                   EVGLLGGTQELWLGQGTEGRNAYKAAYAEDPSPAASQIAAEVKGRYRLAYQVVFQRGFV
FT                   LAAREIDSNRAVLAPLWNVDSGSREDLLAAWILRFNNLARQTLTREGLWTGAAVNSDGT
FT                   IDYTQVSKTAIMGLVVLATTMGLPVGESGGAEQSNDDIRAMLRPSSSGDAVLLAADPFA
FT                   LAEANEIHVAGARRWLQALALGSRRQDGTAPLLRAAASAYRKGVRRYVLGLSKVDGRVL
FT                   TKESLEKMIKIHGARRLAHFAELLAPAADSVPIAES"
FT   gene            complement(648541..649371)
FT                   /locus_tag="Amir_0590"
FT   CDS_pept        complement(648541..649371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0590"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: swi:Swit_5329 phosphoadenosine phosphosulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34554"
FT                   /db_xref="GOA:C6WJC2"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC2"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /protein_id="ACU34554.1"
FT                   /translation="MTGANSSKVRHVLGISGGKDSSALAIYMRDRVPDMEYFFCDTGAE
FT                   LPETYEYLNRLEAALGKSIVRLNAARDFDHWMEVYQGTLPSPQMRWCTKNLKIKPLEEW
FT                   VGDDKVISYVAIRADENRLGYVSTKPNIDAVFPFREDGIDKDGVMRILDEAGIGLPGYY
FT                   EWRTRSGCYFCFFQRKHEWVGLKERHPELFDKAVAYEEKVRYRHTAMQGRNYTWSQGES
FT                   LHELIDRKDEIEAKHTAALERASKRIKPNRPLLEVLSDALDTDDDEAGCSVCHL"
FT   gene            complement(649368..652946)
FT                   /locus_tag="Amir_0591"
FT   CDS_pept        complement(649368..652946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0591"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_5328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34555.1"
FT                   /translation="MTVAAPSPPSRDTRTAIPEFPAGIALVGSQMRSTNLERDVRDALQ
FT                   SPYIGARAVDVLERITSAIADLRRTRAWSFTGPYGSGKSTLSNLIDALLGHDDSRRDEA
FT                   ERILTGTSPALAQRLAAARAERTNTGFLGAVATARREPLVSTLARALETAASRRWGKRA
FT                   PKAIASALANCSHPATTGAKQIMAAITAMTAEQPLLLIIDEFGKTLEHLAGHSEFASPE
FT                   HDLFLLQELAEHCAGPNGLPVYLLTLQHLSFLDYASRTSDLETREWAKIQGRFEDITFL
FT                   PHHGDSLQLLRRRLDHSAVSPAGKALIQVCADAAAREWKEHGLNILAELDSKDFADLYP
FT                   LHPLTAIAAPILAAQIGQHDRSLSGFLNSGEPNTVRDALTAHSRTDAERASTVRLPQLY
FT                   DYFLNAGRTSLLASPNASRWIEIDARIRDANGLPDSDQDLLKTIGVLNLIDADGALSAT
FT                   NEMIHFALRDPDDLVDAAAYAALEEQIADLVRRGFLVYREFSGEYRLWQGTDVDIDGRL
FT                   KEITSHLDEASVIQRLSAYVPSSVVAGRHSQVTGMLRVFVTAVSGPETSHVDAPDEMTE
FT                   PADGLVVFHLGTSTKRPVVDSTLPVVFGTTLNPDIVLSAATHLVALKELQQQALDHVAL
FT                   REVTDRAVQAEATFREIFQAAFYPPATDATWSTWHAGLPADQDPNTAQLMARSLSGLVS
FT                   QVCDEVYSQTPHIRNEMLGRHALTSQAARARSDLLDAMLTSSGKQDLGFPTDKYGPERA
FT                   MYRGVLAYLGLHRQNGAVQAEQTSDSLFPYGFSAPGDKDPERYAKPVWEALQQALTEAT
FT                   ERTSLDHVVRVVMSPPFGVKAGVWPLLVVTALLIRRHDVALFEEGTYLPRLTQDIVERL
FT                   EKVPSRFQVKYTPVSSGQRASVVKKLLVSLKVEPARSQALRNPDMLSVTRALLERVMVL
FT                   NKYARQTKQISSDALAVRKALVGSQDPDDLLFKALPKALGRGPIGPAARADAAAVDEYV
FT                   TRLTAAVDEIAAIDSKLRAKVVETLAHEFRLPSELHELRSTLAARLRGFADVALSAELK
FT                   GFVDFVLSDSLSDEDWLDPIVVRLTNSALGDWDDREAAMFPRRAREMAAALDRVGHLHR
FT                   TTDASAQEENLEAQLLTLTDKAGVEQRTLIYMPARSRAKAENLAADALKRAEKALGPDG
FT                   ARILLAALAQRVAEATTVAPETKEQA"
FT   gene            complement(652943..654061)
FT                   /locus_tag="Amir_0592"
FT   CDS_pept        complement(652943..654061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0592"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_5327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34556"
FT                   /db_xref="InterPro:IPR025248"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34556.1"
FT                   /translation="MADTRLAAAAHSSFARHETFAPRFGWLHKAYMRVKDNPGTFIAED
FT                   APVELGVGKNMVNAMRYWSKTFKLTREHLSEDGKTKAHIASPTWEARWLLDEDGADPYL
FT                   EDPGSLWLLHWWLVSSRPGAKCWAPTWYTAFHLAPFSRFSVVEMTQVVMRHVNFSFPEG
FT                   PVEASVTKDVDCLTKMYARTPAEQPAARTTDTKTGAKSNFEDLLACPFRELDLLTPVGS
FT                   RGNQQWQFTTGTRNSLPASVLVYACLDYAARDTSSSGSISLARLANEPGGPGRAFRVRE
FT                   PEIVAALDKVAAERADVSRVDAVGQRSMSFSGDPFVLAWDVLDEQYGYVTHRPGFPTRR
FT                   EWDQKYPMLAKVAMAESQQQKHQPLALMEEIA"
FT   gene            complement(654119..655288)
FT                   /locus_tag="Amir_0593"
FT   CDS_pept        complement(654119..655288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0593"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; aromatic amino acid
FT                   beta-eliminating lyase/threonine aldolase; KEGG:
FT                   afw:Anae109_1098 aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34557"
FT                   /db_xref="GOA:C6WJC5"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC5"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACU34557.1"
FT                   /translation="MEQSPVIYLDYNATAPTRPEALAAVVDAMHYVGNASSIHLPGQSA
FT                   AQRVDSARRQVAELLNCSPGEIIFTSGATEANNLALRAAHSSGRRLVTSNVEHPAVLET
FT                   ARDLTADQPGSLILLEVDADGLVDLAALENALGHGDIGLVSLMAANNETGVLTDLAPVV
FT                   TAAHAVGALVHTDATQMVGRLPIDLADLDVDLLSLSAHKFGGPQGIGALFVRRTASIPF
FT                   RPQVTGGGQERGWRAGTLNVPGIAGVGAAAAAVHRSLAEETARIGRLRDLLEHAVSASI
FT                   DGYRVNGHRVARLPGVSSITFPGAPADAVMAAMPHVAVSDGSACASGAPSPSHVLLAMG
FT                   INRHDADCTLRFSLGYATTEDHIMQAADATAHAVKLVRASMDACTPIPG"
FT   gene            655826..657403
FT                   /locus_tag="Amir_0594"
FT   CDS_pept        655826..657403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0594"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   DEAD/DEAH box helicase domain protein; helicase domain
FT                   protein; SMART: DEAD-like helicase; helicase domain
FT                   protein; KEGG: nha:Nham_3708 helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34558"
FT                   /db_xref="GOA:C6WJC6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC6"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACU34558.1"
FT                   /translation="MSYVRRQLGKDLCALLDLVEGGTASDERLRAVALVAIDAEQLVSD
FT                   ESGRKELLALLPADKQLELAKRLDADTSGPKNVLNAVNDLTWTIEQRRELLEFLGFTID
FT                   RAPTRTPLFRQDAEPLYGLFPHQRRAAARIKELIYDGPRRAVLHLPTGVGKTRTGMNLI
FT                   CDHLRDREPTLVVWLAHGQELLEQAAAEFEHAWSQLGNRPVSVVRMWGNAPTTLDDVAD
FT                   GVVILGLEKAVSAAKGSPEFLHTLASRSSLTVFDEAHQIIAPTFQRVVDALTIRPDASL
FT                   LGLTATPGRTWADIAQDERLSDFFLRQKVMLEIEGYSNPVTALIDQGYLAKPTMRTVAS
FT                   DAGLHLSARDRQMLARSFDIPAGIVDALAHDEQWNLKVVQTIMDLLAREHRRILVFAAS
FT                   VDHCRLIAAVLSAVSLDAEFITGESSPRHRKQVITRFKGTGRRPMILCNFGVLTTGFDA
FT                   PAASAAVIARPTKSLVLYSQMVGRVIRGPKAGGTSTCEIVTVVDPELPGFGDVAEAFTN
FT                   WEDVWEPA"
FT   gene            657388..659277
FT                   /locus_tag="Amir_0595"
FT   CDS_pept        657388..659277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0595"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpe:RPE_2170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34559"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34559.1"
FT                   /translation="MGARVTSDDSNYRIVTPALTVKAMRDSGYKNTAYALAELIDNSID
FT                   AGATLVEVFACESPVQVSSRTRQRVETIAVLDNGKGMDSETLRRALKYGDGLGDDRKRI
FT                   GRFGMGLPNSSMSQCTRVEVWSWTNGPGNALYTYLDLAEINDGRDAVPDPIHVQGGVPE
FT                   YWRDLSDGLLSDTGTLVVWRNLDRVNWYGAAATLKNTSELIGRVYRHFLHEDKVDIRMA
FT                   PVRDGEVVAGAYYAAPNDPLYLMKSTCAPTPFDDKPMFEPFNMGNENEPGVTYFPITVE
FT                   GIEHKVKVRAAIARPEARRPDVADHPWPAGASPNKDAGNHPWGKHAGRNIGISLVRQGR
FT                   ELDLDSSWAIGYDPVERWWGVEVEFPPALDEIFGVTNNKQTATIFSSLAHFDWQAEAEA
FT                   DETFKAFKDRLAELGDPRLQLFDLALYLETKLLRTMRRQLKQQTVGRRKSKKRHDDEVT
FT                   SKATDAVKRRRDEGHTGKTDQLEDGVTNQDKRQEQVDALTQRHHLDEDTAQSMVDEALE
FT                   KDWRVRWISSYQDTHAFFSIDLMAGMLQVIFNNSHPLHDQLLAVLEEVPEDATDSDLKY
FT                   RLRRAADTFKLLLFSWARMEDEIPNDRQREKIADARRDWGRYARDFIDGEADE"
FT   gene            659274..660161
FT                   /locus_tag="Amir_0596"
FT   CDS_pept        659274..660161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0596"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bbr:BB2173 bifunctional riboflavin kinase/FMN
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34560"
FT                   /db_xref="GOA:C6WJC8"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="UniProtKB/TrEMBL:C6WJC8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34560.1"
FT                   /translation="MTEPDHVWRQIEVLLRSAGATALLVAPFIKKRVFEAALAVIPPSV
FT                   QRIDCVTRWTPSEVAAGVSDPEILDAANKDGRVHVALCPSLHAKIYSVDDRCLIGSANL
FT