(data stored in ACNUC7421 zone)

EMBL: CP001634

ID   CP001634; SV 1; circular; genomic DNA; STD; PRO; 2302126 BP.
XX
AC   CP001634; ABZD01000000-ABZD01000023;
XX
PR   Project:PRJNA29419;
XX
DT   10-JUN-2009 (Rel. 101, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 7)
XX
DE   Kosmotoga olearia TBF 19.5.1, complete genome.
XX
KW   .
XX
OS   Kosmotoga olearia TBF 19.5.1
OC   Bacteria; Thermotogae; Kosmotogales; Kosmotogaceae; Kosmotoga.
XX
RN   [1]
RP   1-2302126
RX   PUBMED; 21914881.
RA   Swithers K.S., Dipippo J.L., Bruce D.C., Detter C., Tapia R., Han S.,
RA   Goodwin L.A., Han J., Woyke T., Pitluck S., Pennacchio L., Nolan M.,
RA   Mikhailova N., Land M.L., Nesbo C.L., Gogarten J.P., Noll K.M.;
RT   "Genome Sequence of Kosmotoga olearia Strain TBF 19.5.1, a Thermophilic
RT   Bacterium with a Wide Growth Temperature Range, Isolated from the Troll B
RT   Oil Platform in the North Sea";
RL   J. Bacteriol. 193(19):5566-5567(2011).
XX
RN   [2]
RP   1-2302126
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Noll K.;
RT   "Complete sequence of Thermotogales bacterium TBF 19.5.1";
RL   Unpublished.
XX
RN   [3]
RP   1-2302126
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Schmutz J., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Noll K.;
RT   ;
RL   Submitted (03-JUN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 0970adb96db955e8e2a473e25fe8aeff.
DR   BioSample; SAMN00001868.
DR   EnsemblGenomes-Gn; EBG00001173277.
DR   EnsemblGenomes-Gn; EBG00001173278.
DR   EnsemblGenomes-Gn; EBG00001173279.
DR   EnsemblGenomes-Gn; EBG00001173280.
DR   EnsemblGenomes-Gn; EBG00001173281.
DR   EnsemblGenomes-Gn; EBG00001173282.
DR   EnsemblGenomes-Gn; EBG00001173283.
DR   EnsemblGenomes-Gn; EBG00001173284.
DR   EnsemblGenomes-Gn; EBG00001173285.
DR   EnsemblGenomes-Gn; EBG00001173286.
DR   EnsemblGenomes-Gn; EBG00001173287.
DR   EnsemblGenomes-Gn; EBG00001173288.
DR   EnsemblGenomes-Gn; EBG00001173289.
DR   EnsemblGenomes-Gn; EBG00001173290.
DR   EnsemblGenomes-Gn; EBG00001173291.
DR   EnsemblGenomes-Gn; EBG00001173292.
DR   EnsemblGenomes-Gn; EBG00001173293.
DR   EnsemblGenomes-Gn; EBG00001173294.
DR   EnsemblGenomes-Gn; EBG00001173295.
DR   EnsemblGenomes-Gn; EBG00001173296.
DR   EnsemblGenomes-Gn; EBG00001173297.
DR   EnsemblGenomes-Gn; EBG00001173298.
DR   EnsemblGenomes-Gn; EBG00001173299.
DR   EnsemblGenomes-Gn; EBG00001173300.
DR   EnsemblGenomes-Gn; EBG00001173301.
DR   EnsemblGenomes-Gn; EBG00001173302.
DR   EnsemblGenomes-Gn; EBG00001173303.
DR   EnsemblGenomes-Gn; EBG00001173304.
DR   EnsemblGenomes-Gn; EBG00001173305.
DR   EnsemblGenomes-Gn; EBG00001173306.
DR   EnsemblGenomes-Gn; EBG00001173307.
DR   EnsemblGenomes-Gn; EBG00001173308.
DR   EnsemblGenomes-Gn; EBG00001173309.
DR   EnsemblGenomes-Gn; EBG00001173310.
DR   EnsemblGenomes-Gn; EBG00001173311.
DR   EnsemblGenomes-Gn; EBG00001173313.
DR   EnsemblGenomes-Gn; EBG00001173314.
DR   EnsemblGenomes-Gn; EBG00001173315.
DR   EnsemblGenomes-Gn; EBG00001173316.
DR   EnsemblGenomes-Gn; EBG00001173317.
DR   EnsemblGenomes-Gn; EBG00001173318.
DR   EnsemblGenomes-Gn; EBG00001173319.
DR   EnsemblGenomes-Gn; EBG00001173320.
DR   EnsemblGenomes-Gn; EBG00001173321.
DR   EnsemblGenomes-Gn; EBG00001173322.
DR   EnsemblGenomes-Gn; EBG00001173323.
DR   EnsemblGenomes-Gn; EBG00001173324.
DR   EnsemblGenomes-Gn; EBG00001173325.
DR   EnsemblGenomes-Gn; EBG00001173326.
DR   EnsemblGenomes-Gn; EBG00001173327.
DR   EnsemblGenomes-Gn; EBG00001173328.
DR   EnsemblGenomes-Gn; EBG00001173329.
DR   EnsemblGenomes-Gn; EBG00001173330.
DR   EnsemblGenomes-Gn; EBG00001173331.
DR   EnsemblGenomes-Gn; EBG00001173332.
DR   EnsemblGenomes-Gn; EBG00001173333.
DR   EnsemblGenomes-Gn; EBG00001173334.
DR   EnsemblGenomes-Gn; EBG00001173335.
DR   EnsemblGenomes-Gn; EBG00001173336.
DR   EnsemblGenomes-Gn; EBG00001173337.
DR   EnsemblGenomes-Gn; EBG00001173338.
DR   EnsemblGenomes-Gn; EBG00001173339.
DR   EnsemblGenomes-Gn; EBG00001173340.
DR   EnsemblGenomes-Gn; EBG00001173341.
DR   EnsemblGenomes-Gn; EBG00001173342.
DR   EnsemblGenomes-Gn; EBG00001173343.
DR   EnsemblGenomes-Gn; EBG00001173344.
DR   EnsemblGenomes-Gn; EBG00001173345.
DR   EnsemblGenomes-Gn; EBG00001173346.
DR   EnsemblGenomes-Gn; EBG00001173347.
DR   EnsemblGenomes-Gn; EBG00001173348.
DR   EnsemblGenomes-Gn; EBG00001173349.
DR   EnsemblGenomes-Gn; EBG00001173350.
DR   EnsemblGenomes-Gn; EBG00001173351.
DR   EnsemblGenomes-Gn; EBG00001173352.
DR   EnsemblGenomes-Gn; EBG00001173353.
DR   EnsemblGenomes-Gn; EBG00001173354.
DR   EnsemblGenomes-Gn; EBG00001173355.
DR   EnsemblGenomes-Gn; EBG00001173356.
DR   EnsemblGenomes-Gn; EBG00001173357.
DR   EnsemblGenomes-Gn; EBG00001173358.
DR   EnsemblGenomes-Gn; EBG00001173359.
DR   EnsemblGenomes-Gn; EBG00001173360.
DR   EnsemblGenomes-Gn; EBG00001173361.
DR   EnsemblGenomes-Gn; EBG00001173362.
DR   EnsemblGenomes-Gn; EBG00001173363.
DR   EnsemblGenomes-Gn; EBG00001173364.
DR   EnsemblGenomes-Gn; EBG00001173365.
DR   EnsemblGenomes-Gn; EBG00001173366.
DR   EnsemblGenomes-Gn; EBG00001173367.
DR   EnsemblGenomes-Gn; EBG00001173368.
DR   EnsemblGenomes-Gn; EBG00001173369.
DR   EnsemblGenomes-Gn; EBG00001173371.
DR   EnsemblGenomes-Gn; EBG00001173372.
DR   EnsemblGenomes-Gn; EBG00001173373.
DR   EnsemblGenomes-Gn; EBG00001173374.
DR   EnsemblGenomes-Gn; EBG00001173375.
DR   EnsemblGenomes-Gn; EBG00001173376.
DR   EnsemblGenomes-Gn; EBG00001173377.
DR   EnsemblGenomes-Gn; EBG00001173378.
DR   EnsemblGenomes-Gn; EBG00001173379.
DR   EnsemblGenomes-Gn; EBG00001173380.
DR   EnsemblGenomes-Gn; EBG00001173381.
DR   EnsemblGenomes-Gn; EBG00001173382.
DR   EnsemblGenomes-Gn; EBG00001173383.
DR   EnsemblGenomes-Gn; EBG00001173384.
DR   EnsemblGenomes-Gn; EBG00001173385.
DR   EnsemblGenomes-Gn; EBG00001173386.
DR   EnsemblGenomes-Gn; EBG00001173387.
DR   EnsemblGenomes-Gn; EBG00001173388.
DR   EnsemblGenomes-Gn; EBG00001173389.
DR   EnsemblGenomes-Gn; EBG00001173390.
DR   EnsemblGenomes-Gn; EBG00001173391.
DR   EnsemblGenomes-Gn; EBG00001173392.
DR   EnsemblGenomes-Gn; EBG00001173393.
DR   EnsemblGenomes-Gn; EBG00001173394.
DR   EnsemblGenomes-Gn; EBG00001173395.
DR   EnsemblGenomes-Gn; EBG00001173396.
DR   EnsemblGenomes-Gn; EBG00001173397.
DR   EnsemblGenomes-Gn; EBG00001173398.
DR   EnsemblGenomes-Gn; EBG00001173399.
DR   EnsemblGenomes-Gn; EBG00001173400.
DR   EnsemblGenomes-Gn; EBG00001173401.
DR   EnsemblGenomes-Gn; EBG00001173402.
DR   EnsemblGenomes-Gn; EBG00001173403.
DR   EnsemblGenomes-Gn; EBG00001173404.
DR   EnsemblGenomes-Gn; EBG00001173405.
DR   EnsemblGenomes-Gn; EBG00001173406.
DR   EnsemblGenomes-Gn; EBG00001173407.
DR   EnsemblGenomes-Gn; EBG00001173408.
DR   EnsemblGenomes-Gn; EBG00001173409.
DR   EnsemblGenomes-Gn; EBG00001173410.
DR   EnsemblGenomes-Gn; EBG00001173411.
DR   EnsemblGenomes-Gn; EBG00001173412.
DR   EnsemblGenomes-Gn; EBG00001173413.
DR   EnsemblGenomes-Gn; EBG00001173414.
DR   EnsemblGenomes-Gn; EBG00001173415.
DR   EnsemblGenomes-Gn; EBG00001173416.
DR   EnsemblGenomes-Gn; EBG00001173417.
DR   EnsemblGenomes-Gn; EBG00001173418.
DR   EnsemblGenomes-Gn; EBG00001173419.
DR   EnsemblGenomes-Gn; EBG00001173420.
DR   EnsemblGenomes-Gn; EBG00001173421.
DR   EnsemblGenomes-Gn; EBG00001173422.
DR   EnsemblGenomes-Gn; EBG00001173423.
DR   EnsemblGenomes-Gn; EBG00001173424.
DR   EnsemblGenomes-Gn; EBG00001173425.
DR   EnsemblGenomes-Gn; Kole_R0001.
DR   EnsemblGenomes-Gn; Kole_R0002.
DR   EnsemblGenomes-Gn; Kole_R0003.
DR   EnsemblGenomes-Gn; Kole_R0004.
DR   EnsemblGenomes-Gn; Kole_R0005.
DR   EnsemblGenomes-Gn; Kole_R0006.
DR   EnsemblGenomes-Gn; Kole_R0007.
DR   EnsemblGenomes-Gn; Kole_R0008.
DR   EnsemblGenomes-Gn; Kole_R0009.
DR   EnsemblGenomes-Gn; Kole_R0010.
DR   EnsemblGenomes-Gn; Kole_R0011.
DR   EnsemblGenomes-Gn; Kole_R0012.
DR   EnsemblGenomes-Gn; Kole_R0013.
DR   EnsemblGenomes-Gn; Kole_R0014.
DR   EnsemblGenomes-Gn; Kole_R0015.
DR   EnsemblGenomes-Gn; Kole_R0016.
DR   EnsemblGenomes-Gn; Kole_R0017.
DR   EnsemblGenomes-Gn; Kole_R0018.
DR   EnsemblGenomes-Gn; Kole_R0019.
DR   EnsemblGenomes-Gn; Kole_R0020.
DR   EnsemblGenomes-Gn; Kole_R0021.
DR   EnsemblGenomes-Gn; Kole_R0022.
DR   EnsemblGenomes-Gn; Kole_R0023.
DR   EnsemblGenomes-Gn; Kole_R0024.
DR   EnsemblGenomes-Gn; Kole_R0025.
DR   EnsemblGenomes-Gn; Kole_R0026.
DR   EnsemblGenomes-Gn; Kole_R0027.
DR   EnsemblGenomes-Gn; Kole_R0028.
DR   EnsemblGenomes-Gn; Kole_R0029.
DR   EnsemblGenomes-Gn; Kole_R0030.
DR   EnsemblGenomes-Gn; Kole_R0031.
DR   EnsemblGenomes-Gn; Kole_R0032.
DR   EnsemblGenomes-Gn; Kole_R0033.
DR   EnsemblGenomes-Gn; Kole_R0034.
DR   EnsemblGenomes-Gn; Kole_R0035.
DR   EnsemblGenomes-Gn; Kole_R0036.
DR   EnsemblGenomes-Gn; Kole_R0037.
DR   EnsemblGenomes-Gn; Kole_R0038.
DR   EnsemblGenomes-Gn; Kole_R0039.
DR   EnsemblGenomes-Gn; Kole_R0040.
DR   EnsemblGenomes-Gn; Kole_R0041.
DR   EnsemblGenomes-Gn; Kole_R0042.
DR   EnsemblGenomes-Gn; Kole_R0043.
DR   EnsemblGenomes-Gn; Kole_R0044.
DR   EnsemblGenomes-Gn; Kole_R0045.
DR   EnsemblGenomes-Gn; Kole_R0046.
DR   EnsemblGenomes-Gn; Kole_R0047.
DR   EnsemblGenomes-Gn; Kole_R0048.
DR   EnsemblGenomes-Gn; Kole_R0049.
DR   EnsemblGenomes-Gn; Kole_R0050.
DR   EnsemblGenomes-Gn; Kole_R0051.
DR   EnsemblGenomes-Gn; Kole_R0052.
DR   EnsemblGenomes-Gn; Kole_R0053.
DR   EnsemblGenomes-Gn; Kole_R0054.
DR   EnsemblGenomes-Gn; Kole_R0055.
DR   EnsemblGenomes-Tr; EBT00001740123.
DR   EnsemblGenomes-Tr; EBT00001740124.
DR   EnsemblGenomes-Tr; EBT00001740125.
DR   EnsemblGenomes-Tr; EBT00001740126.
DR   EnsemblGenomes-Tr; EBT00001740127.
DR   EnsemblGenomes-Tr; EBT00001740128.
DR   EnsemblGenomes-Tr; EBT00001740129.
DR   EnsemblGenomes-Tr; EBT00001740130.
DR   EnsemblGenomes-Tr; EBT00001740131.
DR   EnsemblGenomes-Tr; EBT00001740132.
DR   EnsemblGenomes-Tr; EBT00001740133.
DR   EnsemblGenomes-Tr; EBT00001740134.
DR   EnsemblGenomes-Tr; EBT00001740135.
DR   EnsemblGenomes-Tr; EBT00001740136.
DR   EnsemblGenomes-Tr; EBT00001740137.
DR   EnsemblGenomes-Tr; EBT00001740138.
DR   EnsemblGenomes-Tr; EBT00001740139.
DR   EnsemblGenomes-Tr; EBT00001740140.
DR   EnsemblGenomes-Tr; EBT00001740141.
DR   EnsemblGenomes-Tr; EBT00001740142.
DR   EnsemblGenomes-Tr; EBT00001740143.
DR   EnsemblGenomes-Tr; EBT00001740144.
DR   EnsemblGenomes-Tr; EBT00001740145.
DR   EnsemblGenomes-Tr; EBT00001740146.
DR   EnsemblGenomes-Tr; EBT00001740147.
DR   EnsemblGenomes-Tr; EBT00001740148.
DR   EnsemblGenomes-Tr; EBT00001740149.
DR   EnsemblGenomes-Tr; EBT00001740150.
DR   EnsemblGenomes-Tr; EBT00001740151.
DR   EnsemblGenomes-Tr; EBT00001740152.
DR   EnsemblGenomes-Tr; EBT00001740153.
DR   EnsemblGenomes-Tr; EBT00001740154.
DR   EnsemblGenomes-Tr; EBT00001740155.
DR   EnsemblGenomes-Tr; EBT00001740156.
DR   EnsemblGenomes-Tr; EBT00001740157.
DR   EnsemblGenomes-Tr; EBT00001740158.
DR   EnsemblGenomes-Tr; EBT00001740159.
DR   EnsemblGenomes-Tr; EBT00001740160.
DR   EnsemblGenomes-Tr; EBT00001740161.
DR   EnsemblGenomes-Tr; EBT00001740162.
DR   EnsemblGenomes-Tr; EBT00001740163.
DR   EnsemblGenomes-Tr; EBT00001740164.
DR   EnsemblGenomes-Tr; EBT00001740165.
DR   EnsemblGenomes-Tr; EBT00001740166.
DR   EnsemblGenomes-Tr; EBT00001740167.
DR   EnsemblGenomes-Tr; EBT00001740168.
DR   EnsemblGenomes-Tr; EBT00001740169.
DR   EnsemblGenomes-Tr; EBT00001740170.
DR   EnsemblGenomes-Tr; EBT00001740171.
DR   EnsemblGenomes-Tr; EBT00001740172.
DR   EnsemblGenomes-Tr; EBT00001740173.
DR   EnsemblGenomes-Tr; EBT00001740174.
DR   EnsemblGenomes-Tr; EBT00001740175.
DR   EnsemblGenomes-Tr; EBT00001740176.
DR   EnsemblGenomes-Tr; EBT00001740177.
DR   EnsemblGenomes-Tr; EBT00001740178.
DR   EnsemblGenomes-Tr; EBT00001740179.
DR   EnsemblGenomes-Tr; EBT00001740180.
DR   EnsemblGenomes-Tr; EBT00001740181.
DR   EnsemblGenomes-Tr; EBT00001740182.
DR   EnsemblGenomes-Tr; EBT00001740183.
DR   EnsemblGenomes-Tr; EBT00001740184.
DR   EnsemblGenomes-Tr; EBT00001740185.
DR   EnsemblGenomes-Tr; EBT00001740186.
DR   EnsemblGenomes-Tr; EBT00001740187.
DR   EnsemblGenomes-Tr; EBT00001740188.
DR   EnsemblGenomes-Tr; EBT00001740190.
DR   EnsemblGenomes-Tr; EBT00001740191.
DR   EnsemblGenomes-Tr; EBT00001740192.
DR   EnsemblGenomes-Tr; EBT00001740193.
DR   EnsemblGenomes-Tr; EBT00001740194.
DR   EnsemblGenomes-Tr; EBT00001740195.
DR   EnsemblGenomes-Tr; EBT00001740197.
DR   EnsemblGenomes-Tr; EBT00001740198.
DR   EnsemblGenomes-Tr; EBT00001740199.
DR   EnsemblGenomes-Tr; EBT00001740200.
DR   EnsemblGenomes-Tr; EBT00001740201.
DR   EnsemblGenomes-Tr; EBT00001740202.
DR   EnsemblGenomes-Tr; EBT00001740203.
DR   EnsemblGenomes-Tr; EBT00001740204.
DR   EnsemblGenomes-Tr; EBT00001740205.
DR   EnsemblGenomes-Tr; EBT00001740206.
DR   EnsemblGenomes-Tr; EBT00001740207.
DR   EnsemblGenomes-Tr; EBT00001740208.
DR   EnsemblGenomes-Tr; EBT00001740209.
DR   EnsemblGenomes-Tr; EBT00001740210.
DR   EnsemblGenomes-Tr; EBT00001740211.
DR   EnsemblGenomes-Tr; EBT00001740212.
DR   EnsemblGenomes-Tr; EBT00001740213.
DR   EnsemblGenomes-Tr; EBT00001740214.
DR   EnsemblGenomes-Tr; EBT00001740215.
DR   EnsemblGenomes-Tr; EBT00001740216.
DR   EnsemblGenomes-Tr; EBT00001740217.
DR   EnsemblGenomes-Tr; EBT00001740218.
DR   EnsemblGenomes-Tr; EBT00001740219.
DR   EnsemblGenomes-Tr; EBT00001740220.
DR   EnsemblGenomes-Tr; EBT00001740221.
DR   EnsemblGenomes-Tr; EBT00001740222.
DR   EnsemblGenomes-Tr; EBT00001740223.
DR   EnsemblGenomes-Tr; EBT00001740224.
DR   EnsemblGenomes-Tr; EBT00001740225.
DR   EnsemblGenomes-Tr; EBT00001740226.
DR   EnsemblGenomes-Tr; EBT00001740227.
DR   EnsemblGenomes-Tr; EBT00001740228.
DR   EnsemblGenomes-Tr; EBT00001740229.
DR   EnsemblGenomes-Tr; EBT00001740230.
DR   EnsemblGenomes-Tr; EBT00001740231.
DR   EnsemblGenomes-Tr; EBT00001740232.
DR   EnsemblGenomes-Tr; EBT00001740233.
DR   EnsemblGenomes-Tr; EBT00001740234.
DR   EnsemblGenomes-Tr; EBT00001740235.
DR   EnsemblGenomes-Tr; EBT00001740236.
DR   EnsemblGenomes-Tr; EBT00001740237.
DR   EnsemblGenomes-Tr; EBT00001740238.
DR   EnsemblGenomes-Tr; EBT00001740239.
DR   EnsemblGenomes-Tr; EBT00001740240.
DR   EnsemblGenomes-Tr; EBT00001740241.
DR   EnsemblGenomes-Tr; EBT00001740242.
DR   EnsemblGenomes-Tr; EBT00001740243.
DR   EnsemblGenomes-Tr; EBT00001740244.
DR   EnsemblGenomes-Tr; EBT00001740245.
DR   EnsemblGenomes-Tr; EBT00001740246.
DR   EnsemblGenomes-Tr; EBT00001740247.
DR   EnsemblGenomes-Tr; EBT00001740248.
DR   EnsemblGenomes-Tr; EBT00001740249.
DR   EnsemblGenomes-Tr; EBT00001740250.
DR   EnsemblGenomes-Tr; EBT00001740251.
DR   EnsemblGenomes-Tr; EBT00001740252.
DR   EnsemblGenomes-Tr; EBT00001740253.
DR   EnsemblGenomes-Tr; EBT00001740254.
DR   EnsemblGenomes-Tr; EBT00001740255.
DR   EnsemblGenomes-Tr; EBT00001740256.
DR   EnsemblGenomes-Tr; EBT00001740257.
DR   EnsemblGenomes-Tr; EBT00001740258.
DR   EnsemblGenomes-Tr; EBT00001740259.
DR   EnsemblGenomes-Tr; EBT00001740260.
DR   EnsemblGenomes-Tr; EBT00001740261.
DR   EnsemblGenomes-Tr; EBT00001740262.
DR   EnsemblGenomes-Tr; EBT00001740263.
DR   EnsemblGenomes-Tr; EBT00001740264.
DR   EnsemblGenomes-Tr; EBT00001740265.
DR   EnsemblGenomes-Tr; EBT00001740266.
DR   EnsemblGenomes-Tr; EBT00001740267.
DR   EnsemblGenomes-Tr; EBT00001740268.
DR   EnsemblGenomes-Tr; EBT00001740269.
DR   EnsemblGenomes-Tr; EBT00001740270.
DR   EnsemblGenomes-Tr; EBT00001740271.
DR   EnsemblGenomes-Tr; Kole_R0001-1.
DR   EnsemblGenomes-Tr; Kole_R0002-1.
DR   EnsemblGenomes-Tr; Kole_R0003-1.
DR   EnsemblGenomes-Tr; Kole_R0004-1.
DR   EnsemblGenomes-Tr; Kole_R0005-1.
DR   EnsemblGenomes-Tr; Kole_R0006-1.
DR   EnsemblGenomes-Tr; Kole_R0007-1.
DR   EnsemblGenomes-Tr; Kole_R0008-1.
DR   EnsemblGenomes-Tr; Kole_R0009-1.
DR   EnsemblGenomes-Tr; Kole_R0010-1.
DR   EnsemblGenomes-Tr; Kole_R0011-1.
DR   EnsemblGenomes-Tr; Kole_R0012-1.
DR   EnsemblGenomes-Tr; Kole_R0013-1.
DR   EnsemblGenomes-Tr; Kole_R0014-1.
DR   EnsemblGenomes-Tr; Kole_R0015-1.
DR   EnsemblGenomes-Tr; Kole_R0016-1.
DR   EnsemblGenomes-Tr; Kole_R0017-1.
DR   EnsemblGenomes-Tr; Kole_R0018-1.
DR   EnsemblGenomes-Tr; Kole_R0019-1.
DR   EnsemblGenomes-Tr; Kole_R0020-1.
DR   EnsemblGenomes-Tr; Kole_R0021-1.
DR   EnsemblGenomes-Tr; Kole_R0022-1.
DR   EnsemblGenomes-Tr; Kole_R0023-1.
DR   EnsemblGenomes-Tr; Kole_R0024-1.
DR   EnsemblGenomes-Tr; Kole_R0025-1.
DR   EnsemblGenomes-Tr; Kole_R0026-1.
DR   EnsemblGenomes-Tr; Kole_R0027-1.
DR   EnsemblGenomes-Tr; Kole_R0028-1.
DR   EnsemblGenomes-Tr; Kole_R0029-1.
DR   EnsemblGenomes-Tr; Kole_R0030-1.
DR   EnsemblGenomes-Tr; Kole_R0031-1.
DR   EnsemblGenomes-Tr; Kole_R0032-1.
DR   EnsemblGenomes-Tr; Kole_R0033-1.
DR   EnsemblGenomes-Tr; Kole_R0034-1.
DR   EnsemblGenomes-Tr; Kole_R0035-1.
DR   EnsemblGenomes-Tr; Kole_R0036-1.
DR   EnsemblGenomes-Tr; Kole_R0037-1.
DR   EnsemblGenomes-Tr; Kole_R0038-1.
DR   EnsemblGenomes-Tr; Kole_R0039-1.
DR   EnsemblGenomes-Tr; Kole_R0040-1.
DR   EnsemblGenomes-Tr; Kole_R0041-1.
DR   EnsemblGenomes-Tr; Kole_R0042-1.
DR   EnsemblGenomes-Tr; Kole_R0043-1.
DR   EnsemblGenomes-Tr; Kole_R0044-1.
DR   EnsemblGenomes-Tr; Kole_R0045-1.
DR   EnsemblGenomes-Tr; Kole_R0046-1.
DR   EnsemblGenomes-Tr; Kole_R0047-1.
DR   EnsemblGenomes-Tr; Kole_R0048-1.
DR   EnsemblGenomes-Tr; Kole_R0049-1.
DR   EnsemblGenomes-Tr; Kole_R0050-1.
DR   EnsemblGenomes-Tr; Kole_R0051-1.
DR   EnsemblGenomes-Tr; Kole_R0052-1.
DR   EnsemblGenomes-Tr; Kole_R0053-1.
DR   EnsemblGenomes-Tr; Kole_R0054-1.
DR   EnsemblGenomes-Tr; Kole_R0055-1.
DR   EuropePMC; PMC3187421; 21914881.
DR   EuropePMC; PMC3236047.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01315; CRISPR-DR2.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   RFAM; RF02005; group-II-D1D4-6.
DR   SILVA-LSU; CP001634.
DR   SILVA-SSU; CP001634.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083512
CC   Source DNA and bacteria available from Kenneth Noll
CC   (kenneth.noll@uconn.edu)
CC   Contacts: Kenneth Noll (kenneth.noll@uconn.edu)
CC             David Bruce (microbes@cuba.jgi-psf.org)
CC   Quality assurance done by JGI-Stanford
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Kosmotoga olearia TB 19.5.1
CC   GOLD Stamp ID         :: Gi03108
CC   Greengenes ID         :: 359964
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Fresh water
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2302126
FT                   /organism="Kosmotoga olearia TBF 19.5.1"
FT                   /strain="TBF 19.5.1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:521045"
FT   gene            103..1446
FT                   /locus_tag="Kole_0001"
FT   CDS_pept        103..1446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: gbm:Gbem_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78730"
FT                   /db_xref="GOA:C5CH91"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CH91"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACR78730.1"
FT                   /translation="MSNRIISILKKRLARKTWDNWFTTFQVKKVTDDKIIFSVGNLFIK
FT                   DWLQSKYGSVISKAIKEAYGKNLDYEIVYETTEPEAFNKSNESYKGPLVKKKPLLISNL
FT                   NANYTFENFVVGPENRVLYEVSLEISRNPGRYNPFFVYGMVGLGKTHLLQAIAHKIMEL
FT                   HPEMRVLYITSEQFMNDMIDSIKYGSVRDFREHYRKKADVLLIDDIQFLIGKNGVQKEL
FT                   FHTFNELYDAGKQIVICSDRNPEELNGFHDRLVSRFQMGMVMEICPPEKDTRFKIAKKF
FT                   AERESVSLPDDVAQLLADSVDGNLRILRGVIIKLIVQSSINKERIGAALTNQILAAFNK
FT                   TTVSIKRMKEEDLIMSTIEAVMGVSPEEIKGTSRKQNIVLSRQLLMYILKRHHGKSIKE
FT                   ISKITGKRHSTVIHSIKKIEMSVIKGNTVVKEKLAKILNTMATSSAAG"
FT   gene            complement(1460..2434)
FT                   /locus_tag="Kole_0002"
FT   CDS_pept        complement(1460..2434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0002"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; NADP oxidoreductase coenzyme
FT                   F420-dependent; KEGG: gbm:Gbem_0008 NAD-dependent
FT                   glycerol-3-phosphate dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78731"
FT                   /db_xref="GOA:C5CH92"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CH92"
FT                   /inference="protein motif:PRIAM:1.1.1.94"
FT                   /protein_id="ACR78731.1"
FT                   /translation="MRISVIGAGSWGSTMAKVLADSGHDVMLWVREPDLLELLREERRS
FT                   YFVKSLHLPSNVALTGKLNEALEYADVIFNAVPVQYISTVFGERNLANKSIVNLSKGLE
FT                   MSTHRRPSQIFESFGAKTVSTLSGPSYAEEVAREIPTSVVVAAKDIEFARFVRDLYNVK
FT                   YFRVYSNDDLIGVEIAGGIKNVIAIAAGIIDGLGGWNNSKAALITRATVEMARLGVALG
FT                   GKPETVAGLAGVGDLIVTCTGVYSRNRKVGEELAKKRKIDEILSSMKMVAEGVATCRAI
FT                   YHLSRKLNIELPIVEQVYAVLYEEKEPKKAIEELMTRKKKDER"
FT   sig_peptide     complement(2372..2434)
FT                   /locus_tag="Kole_0002"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.937) with cleavage site probability 0.909 at
FT                   residue 21"
FT   gene            complement(2431..3375)
FT                   /locus_tag="Kole_0003"
FT   CDS_pept        complement(2431..3375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0003"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="KEGG: aeh:Mlg_0033 tRNA
FT                   (guanine-N(7)-)-methyltransferase; TIGRFAM: tRNA
FT                   (guanine-N(7)-)-methyltransferase; PFAM: putative
FT                   methyltransferase; Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78732"
FT                   /db_xref="GOA:C5CH93"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5CH93"
FT                   /inference="protein motif:TFAM:TIGR00091"
FT                   /protein_id="ACR78732.1"
FT                   /translation="MCQDFTKFYVEPRLMNLPMDLDALFTRSAPLFLEVGFGNGEFLIE
FT                   NALNRQGHNFLGIELSVISMVKIMKRLSRENIENVKVMMVDAKFGVRELFPDESVDGLY
FT                   MNFPCPWPRERHSGKRLNTVDFLLSVAAVLKKGGMVQLYTDSLEFAEVFAENLGQTSCF
FT                   IKIELIKNPPQVNTRYERKWKREGREIYKVTAEKLKTPMLRRIAGGDEMPHTWIKELKP
FT                   ENLKKILNSPIKKDIGVFVYKSMLKDLDDDRYLVETIAIDGDFQQHFYVEIHKRNKGWL
FT                   VKLDSHGLPFRTPAVKKAVYELGKILEKRRGAL"
FT   gene            3606..4154
FT                   /locus_tag="Kole_0004"
FT   CDS_pept        3606..4154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0004"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: mxa:MXAN_5070 hypoxanthine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78733"
FT                   /db_xref="GOA:C5CH94"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C5CH94"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ACR78733.1"
FT                   /translation="MELSPSRIRILFSEEDLDRIVKKVAEDINNYYKPLTDEITAICVL
FT                   KGSVHFYSDLLKRLDLKVRYNFVHVSSYSGMHTTGKIRVKTWVDESLTNRYVLVVEDIL
FT                   DTGNTLRYIINYIWKQKPKDVKLVSLFEKTVHKHGVNLDFVGEKIGDVFVIGYGLDYNE
FT                   IYRNLPYVGYIPDEENEEG"
FT   gene            4132..4449
FT                   /locus_tag="Kole_0005"
FT   CDS_pept        4132..4449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78734"
FT                   /db_xref="UniProtKB/TrEMBL:C5CH95"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78734.1"
FT                   /translation="MRKTKKGNSTIFITVILIFALVAVVSAGILRIGSEIVRLRQGFVD
FT                   IAIKRITLESAKELLDFSKTYQTPLNLTLNEYELKSYFKDGEWWVEIQWDDTVEILREY
FT                   P"
FT   sig_peptide     4132..4215
FT                   /locus_tag="Kole_0005"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.861 at
FT                   residue 28"
FT   gene            4561..6924
FT                   /locus_tag="Kole_0006"
FT   CDS_pept        4561..6924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0006"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: gsu:GSU1326 ATP-dependent DNA helicase RecG;
FT                   TIGRFAM: ATP-dependent DNA helicase RecG; PFAM: DEAD/DEAH
FT                   box helicase domain protein; helicase domain protein;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78735"
FT                   /db_xref="GOA:C5CH96"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028993"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="InterPro:IPR036845"
FT                   /db_xref="UniProtKB/TrEMBL:C5CH96"
FT                   /inference="protein motif:TFAM:TIGR00643"
FT                   /protein_id="ACR78735.1"
FT                   /translation="MLLEDYLDRCEKLLEKFLSGKVDTIELIQEIKRGAELLEPEELSA
FT                   NEGLKDYIGKFVSYYLPLASLPNERQHLRVKNGFTMINKLRGKFLLTSFDESTSAIPVK
FT                   VSSLNFDIKYAKGVGERRAKILKKLGIETVKDLLWWLPRDYEDRRRIVPLSSIVADRKV
FT                   TIRAKLQNFSVKKVKEYVIISAVVSDGFGQIILKWFNQEYITDRLIKEREYLITGIPKK
FT                   TPFGPYEMNSPEIEEITGRVPREILPLYSLSAGISQKVMRKIVRKNITNVRLLKEFIPA
FT                   EVIKERNLLPRHHAMYTVHFPKSLYELKESRRRLAYEELFLFEVAVLYNREKLKTTKGG
FT                   ISKSISGKLAERFIDSLNFVLTGDQMRAFEEIREDMKAPTPMNRLLQGDVGSGKTVVAE
FT                   LAIIDNFEAGYQSAMMVPTTVLATQQHQKLVKDLEPLGIKVELLVGSQKKSQQEEIKKR
FT                   IAIGEVDVVVGTHALIQENVKFKDLGLVIIDEQHRFGVKQREALMNKGALVDTLVMTAT
FT                   PIPRTLALTAYGDLDISTITEMPPGRAPIRTMLISEKRLPELYAFIRDEVNHGHQAFFI
FT                   YPLIEESEQMDLKAATDEAERLQKEVFPDIGVELLHGRMSDEEKNRIMHRFKNKEAMIL
FT                   VSTSVVEVGIDIPTATVMVIEHPERFGLAQLHQLRGRVGRSSLKSYCMLVLNSNISGEA
FT                   LDRLRKFAGTQNGFKLAEIDLSLRGPGEFMGTRQHGLPDFLVADIVKDSELLIMARNDA
FT                   MELLKRDPNLEKHNRIIEEIKERFGENISLIEVG"
FT   gene            6924..7487
FT                   /locus_tag="Kole_0007"
FT   CDS_pept        6924..7487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0007"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function methylase putative; putative RNA methylase; KEGG:
FT                   sat:SYN_00910 adenine-specific methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78736"
FT                   /db_xref="GOA:C5CH97"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5CH97"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ACR78736.1"
FT                   /translation="MLTITGGNWKGRKVEVTPRLITRYTPQFARKALFDIIDVEGLRVL
FT                   DLFSGSGIIAFEALSRSATNAVCIDSSRVSCNTIKKNALKLGCQEKLRILCADFRRAIP
FT                   KLEKSGERFDFIFADPPFGENYIPELLEVLERNAGIFSENACLVIESSKKERELVKKYS
FT                   GDASCLYDTREYGNVFLSFLKVVK"
FT   gene            7484..7960
FT                   /locus_tag="Kole_0008"
FT   CDS_pept        7484..7960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0008"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   mxa:MXAN_0365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78737"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="UniProtKB/TrEMBL:C5CH98"
FT                   /inference="protein motif:PFAM:PF01927"
FT                   /protein_id="ACR78737.1"
FT                   /translation="MKFFADRMLGKLAKKLRLLGFDTLYFNNIEEKSILELLHEEERIL
FT                   LTRDRSLHSRALKAGIDSYLLKSNHWNSQLRSVIQRFRLTEDNFHLFYRCSECNAELEE
FT                   ADAASVSGLVPDFVLYTNDKFMRCPGCGRIYWKGTHLEKIIKSLQSVINLTRKD"
FT   gene            7968..10667
FT                   /locus_tag="Kole_0009"
FT   CDS_pept        7968..10667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0009"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: sus:Acid_1646 PAS/PAC sensor signal
FT                   transduction histidine kinase; TIGRFAM: PAS sensor protein;
FT                   PFAM: ATP-binding region ATPase domain protein; PAS fold
FT                   domain protein; PAS fold-4 domain protein; histidine kinase
FT                   A domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; GAF domain
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78738"
FT                   /db_xref="GOA:C5CH99"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CH99"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACR78738.1"
FT                   /translation="MSSRLREYLAKLQNLIRKLDEVCSSDFSVFVFEKYKKRLKEFNPG
FT                   RDYYVMDFPEVQELLNTKKAISKQVKLRKGDRFESKEGIFVPLIKDELIGAVAVWDTNF
FT                   QLTDAFLEAVSKITDMIFLLSAVSSGAEATRRLELVKELTDVFESTYNESELLHKTIGI
FT                   TRKMVKARYGFYCRKFGEVFAIDSASCDVCEKEFENWSFKFSEDLLLKLGEGKVFISPK
FT                   TAGEYLSIFPEDFEVRSFILVPLDVEDKIEGLIIITDRESEEAEFRPHRYLDEEDLEMV
FT                   QDISNRLTVAISRIRLMETLEKEVEELNKLKKINEDLIDLQRNQLLKMSAVHKIAQSIR
FT                   RPLKKDRIIKIVLLGITSSAGLNFDRAIFLEKDQTSPFIIPRYTITREIEYELSRDIPL
FT                   SGIYGNFSQYLLEASNYELPYFSNFSDTRRISYSGNLLLERVVLRRKALHITPEMWKHR
FT                   YEELFQLRTIIDSDDFVLIPIAGEQSVQGMLVVDNSLSGRPILSSDLEILGLLADSCGL
FT                   ALELSNNYERLLEMTRSLERERNLSDYYRNFVSNILQSLESSIIVCDRDGKITEMNRRA
FT                   EELFGLSREKCLGVPLKTVCDQLSELHSLIAEVLKVGETVTLSDHRLEDFNDRIFDIRI
FT                   TPLVNKRSEEIIGIILSLDDVTERFNLEKELRFREKMAALGEMSAKVAHEIRNPITIIS
FT                   GFTRRIARTRDREKIQQYVEILNRELERLETIVNDVLDYSRRAKKKENIESVNALELCQ
FT                   EIANGFKDLAKKKGISLIVEGDEETVFVGNKNRMKQVIINLVQNAIEASEDNGIVKIEV
FT                   EFAQENVRISVWNKGKEIPPEILRRVFEPFFTTKTFGTGLGLSICKRIVEEHGGNITAQ
FT                   SDSNGTIFVVSLPSRRYANGDEKNNDRR"
FT   gene            10636..10995
FT                   /locus_tag="Kole_0010"
FT   CDS_pept        10636..10995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0010"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: geo:Geob_1006 response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78739"
FT                   /db_xref="GOA:C5CHA0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHA0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACR78739.1"
FT                   /translation="METKKIMIVDDEENMRFLLTEELGEEGFHVITAASAEEALDLFEK
FT                   HPDISLVTIDIEMPGISGLELAGMLRNKKPDLKIVLLTAYTHYKQDMASWAADAYVVKS
FT                   TDLREFKETIKKLLD"
FT   gene            11010..13775
FT                   /locus_tag="Kole_0011"
FT   CDS_pept        11010..13775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0011"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   sfu:Sfum_0122 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78740"
FT                   /db_xref="GOA:C5CHA1"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CHA1"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ACR78740.1"
FT                   /translation="MDYKDTLNLPKTSFSMRANLVRKEPEQLKKWEEMDLYKYVQKNRE
FT                   GAPLFVLHDGPPYANGNIHVGTALNKILKDFIIKYKTMQGYNAPYIPGWDTHGLPIEHR
FT                   VASELGEKAKELSKSTIRKKCRKYAEKYVKIQREQFKRLGVRGDWENPYLTFDPKYEAS
FT                   VLKVLSKLVKSGNVYRTLKPIYWCTSCETALAEAEVEYHDHKSYSIYVKFQDKNKPNRF
FT                   FVIWTTTPWTLPANVAIALNPNFDYCEVKVKDEIWILAEGLLEQAMKAMGIESYEIIST
FT                   KKGSEFEGEVAQHPFMNRDSVIVMADYVALDAGTGCVHTAPGHGEEDYGTGLRYRLPVI
FT                   SPVNDQGIFTKEAGKYAGLFVFDANPIIVEDLRKSGHLVGEGKIEHSYPHCWRCKNPVI
FT                   FRATEQWFIDVDKNDLRQKALSEIEKTEWHPSWGQNRITAMVQDRPDWCISRQRSWGIP
FT                   IPAFRCQDCGESILDGKVIDHFAGIVEEKGTDVWFEWSESDLLPEGYTCPKCGSKNLKK
FT                   QEDILDVWVDSGSSFEAVVKVMDELRFPADVYIEGSDQHRGWFQSSLLLSVGTEGVAPF
FT                   KSVITHGFINDEQGRKMSKSLGNAVDPQEINNKYGAEILRLWVASSNYQEDIRISMNII
FT                   QQQIENYKKIRNTLRYLLGNLSDYSPQDSVPYEELLELDKWAIMKLHKLIRDVTRYYDR
FT                   YEFYKVFQSILKFIITDMSAFYLDIIKDRLYVEGKTSPERRSAQTVLFEILVALNKMLA
FT                   PILTFTSEEVYAHLPEAARNYKTIQVENWPEYKEEYIDSSLEERWEKLINLREDVLKAL
FT                   EIARAEKLIGNSLDAKVTLQIRSKDIDEIVRQYSREFIADLFIVSQVEFAESVEGFNGE
FT                   YAVVKVDRAEGEKCQRCWKYSIETGADPELPDMCPRCVAVLRKYGSDYEL"
FT   gene            13900..17469
FT                   /locus_tag="Kole_0012"
FT   CDS_pept        13900..17469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0012"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   ppr:PBPRA0349 putative periplasmic protein involved in
FT                   polysaccharide export"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78741"
FT                   /db_xref="GOA:C5CHA2"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHA2"
FT                   /inference="protein motif:PFAM:PF02563"
FT                   /protein_id="ACR78741.1"
FT                   /translation="MLKKGSLFLLVALLVSFNLVFGGYLIREGDILSITVYGHEELSSE
FT                   VVVGPDGFISVPPIGSVRVSGKILEEVEKVLSSRFRDILITKPQVTISIVKYAPYDYNV
FT                   LGEVNRPGRVSLSQSSVTISELLASVGGPKETADLSKSFVIKKNGEKISIDLSELLSEG
FT                   KNADFVLYPGDSLFIPSGISSWIKAVGEFKNPGVIKYYDGITLTEVIAQVGGVTDKADI
FT                   ENISVLNRIGNSVQRKEYNLTKIFSGKSADPILKPGATVIIEDSSGKAVRVLGEVRIPG
FT                   TVPYKKGITLLEVIGETGGITQLAGDKVLIIGKDTKRQFSVELDKLLSGSSEDIELEPG
FT                   DTVVISRSDEKYTYIVSPEMSERVDFSIYENLTLRNVLVKAGIYYPDRDITISILQPRD
FT                   EKGLKVSMKDLQNKDYPLKPGTLVVLPLIRNTVYVLGEVKHPGPVVIESYEKATLNTVI
FT                   SKAGGLTENASEIQLIKDNKKTIFDLNESLESQTEIESGSIVYVEKLPERFVYLISPSV
FT                   GGKVDFSREEKMSLRSLLSKYNLLDFESEEKLILLTGDGEKTEVKLTDLRNKDVPLSSG
FT                   TVIIYPDTRVKIYILGEVRSPGVFAINPGDTHTLSAAISMAGGVLDTGDPRNIRVTYPN
FT                   GESRIYNLKEILNGSEADPQLKSGATVYISRYVPVTVNVLGEVNRPGVVEFDPWETPTL
FT                   LLAISKAGGLKETAAQEIKIAHDDQTYIWLSLIENQDVPLESGVTIYVPEDRGRYVYIS
FT                   GKVMKPGRVDFDKFEPFTLSRAIAKSGGLLESADNFVKIIEPDGKIKKFDIEETEKGKD
FT                   LKLVAGSIIVVPEKIKRITIIGAVRDPGTYVFTRNERTTPADIIARAGGIPDLSKVREI
FT                   RILSKDGKPVSYNEFVESAKELEDGSIVYVKPVDVLRFSVIGAVKSPGSFDYSSNEPPT
FT                   LLTLISRAGGALDEADEIHIIYRSGKIESFDVSKLITQGSFTLEESADIVITKLAERYI
FT                   GIIGDVQKPGLIDISLIGGEITLGKVLAYAGGVNNPSSAEIWLITDGESEKILLTPEKL
FT                   SEVSGRVLEAGTIIYVPLSYLRVYVFGEVERPGVIEYTPDMNVLEAILSAGGPKNTAEL
FT                   SRVLLFKNGISENPEVQYVDLDKYAVDSKKSNEVPKIPEVPKVEPGDVIYVPSSYMVDI
FT                   KEVMGVISSLLTIIYTGKLIAAP"
FT   sig_peptide     13900..13968
FT                   /locus_tag="Kole_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.952 at
FT                   residue 23"
FT   gene            17509..18198
FT                   /locus_tag="Kole_0013"
FT   CDS_pept        17509..18198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0013"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /note="KEGG: sun:SUN_1558 capsular polysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78742"
FT                   /db_xref="GOA:C5CHA3"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHA3"
FT                   /inference="similar to AA sequence:KEGG:SUN_1558"
FT                   /protein_id="ACR78742.1"
FT                   /translation="MVNVEMHCHLLPGVDDGARDVEEALELINEMKDLGVERIYLTPHL
FT                   YSPKVPTDISKIKKAFSQFKEIVSNEVEILPGSEIYLVPGVSNRELIPLGDTNFLLIEL
FT                   PTDIPPLYLWEEIDRLQRKGYVLILAHVERYGYFYKCSGLLSQLFRCKQPKKEFFDRLR
FT                   QQGVLFQVNWDILSPKTGKTPKHIRNLLEITFVDFTGSDKHRRNDSRQLIDFSTQLYKD
FT                   LRNGELL"
FT   gene            18232..20457
FT                   /locus_tag="Kole_0014"
FT   CDS_pept        18232..20457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0014"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="KEGG: pca:Pcar_1464 uncharacterized
FT                   exopolysaccharide biosynthesis protein; TIGRFAM: capsular
FT                   exopolysaccharide family; PFAM: lipopolysaccharide
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78743"
FT                   /db_xref="GOA:C5CHA4"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHA4"
FT                   /inference="protein motif:TFAM:TIGR01007"
FT                   /protein_id="ACR78743.1"
FT                   /translation="MNELDNEYRELTLEDILRMFKKRFWFFMAIVIGVVVATGIYLVLA
FT                   TPIYEASVNIKVEPTSKSSVSDIFMNQVTGSYSSKDISTEVELIKSRTNFEEVIRRLGL
FT                   VDKMYEPEVKERLLSEGYTEDDLVQSLTYTLSEMITVSPVKDTRIVKVAVQHPDPVLAK
FT                   DIANTLAEVYNEKLAELSKRDITMKKQFIESQIPVLEEDLKKSTNELKAFKEKTGIYVL
FT                   EEQARWLLQMITTYDQQYNNLQISMEEKIAQKKSYEELLKQFDSSEDKTFRDKWLKTSE
FT                   TLSRNPIIQQLKSKLVELQVELAALRQQYPETDPRVRAKLTQIAETENLIKKETEEFIR
FT                   TGETQTLNPAYETALTGVISAESTIQILEARLKAVDRLRKEYEKELSKLPTIEQQLLEL
FT                   QRQIAVKENLYTLLLERLEEARISEAAVVGNAAIIDPARVPRYPVKPNKKLSLAIGGVL
FT                   GIFLGMLAVFLVEYADKTLKTEEEIERYSGVQILGRIPQIQDLKDELHVKASPISPESE
FT                   AIKMAASNISFILGDKKSFAITSVSPSEGKSFIAANLAYSMASNDTKVILVDLDMRRPR
FT                   VEKILKLNGRKTKGIVDVVLGKITLNEAILNYEGVFDVLPVGSIPPNPTVILSSKKLTE
FT                   IFEELKKRYDTIVIDMPPAMVTSDVSMVGNKFDGVLLVVKPGTTPRDGLRIAVQNLRTV
FT                   NINVLGLLVNGVDEKTSSYYYYYYHYYYTQDGTKKKIRRKKSRRTGE"
FT   gene            20454..21197
FT                   /locus_tag="Kole_0015"
FT   CDS_pept        20454..21197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0015"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: mca:MCA2417 ZIP zinc
FT                   transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78744"
FT                   /db_xref="GOA:C5CHA5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHA5"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ACR78744.1"
FT                   /translation="MTPAIKGIVYSLIAGMATSIGAIPFLFWKKGVDRRSLDMLLGLAA
FT                   GIMLAATAFSLVVPSIQIGGPFRFVVGFILGAIFVDLMDKFSPHEHFIKGYEGPMTKSK
FT                   LSKIWLFVIAITLHNFPEGMAVGVGGFTKDAFAIAMAIGIQNIPEGAAVAGSLIGAGYS
FT                   VRRSFWVTFLTGAVEIIGGALGAFLITISQPLLPYAMAFAGGAMLYVIGDEIIPETHSG
FT                   GYQRISTYSLLIGFIIMTLLDNLLG"
FT   gene            21224..24001
FT                   /locus_tag="Kole_0016"
FT   CDS_pept        21224..24001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0016"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: dat:HRM2_25580
FT                   O-antigen polymerase involved in exopolysaccharide
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78745"
FT                   /db_xref="GOA:C5CHA6"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHA6"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ACR78745.1"
FT                   /translation="MENKAYNSTFKAQLFIYYMMSVVIPLFVVKNFTHEPSTGKHLLYV
FT                   IGFTIIILSALFSNKKITIKYSYVHLAALGFGITAILSLISVSAENPQYFRYSLDVALF
FT                   ALFVVLTSFYISKEFDTRLKIEFAMFFFIIGAFVVAIDALLNYYAGFDLFLGKVGAPFQ
FT                   RASARSTIGNPNFVSDYMGLTIPMIIYFLVNPYPLKKVVKSRMGIILLKSSMLLFLAPM
FT                   IAAVFVAETRTVMTGILLGNLLFIIVYLLLSRKFQHEEDPALVKLSRIFIVAALVLAIV
FT                   LSILYLTPSPLTGKGKLNITRRLEYVLTSSKSWKERFSAWFNSIYQWIDPSHPSRIIFG
FT                   TGIGTFQLYHLLYSPYVIQEHPDYTVVWNNFKRTHNDYVQALSETGILGFSMVVLFLIF
FT                   MVSRYFRTMLRLKNKTDILMYGAFGAAIFSLAMHTMFEFPLHMQPNLMAGVFIMSITMG
FT                   TYFNDDLKELQISRTALAIPFVILSGTIIFLKTTAYLGEGFFRKGQVAQQYYYAYAREA
FT                   IKRNPVVIKNKLKDLENYRGEFAYLKNVGNYYAAREKELRSKFGGLSQVEFLKAIESER
FT                   KKEFDAIRANLMRELQTAEALQSKTRAYYNRAVDYFERSYRIYPVFGKPLWYLAAFGIK
FT                   PERVYSLSSDKEKVIQTLMGEDPYAALIVDEFKGDLRVIPLPERNIRTIPFKEFVKAHK
FT                   EKLAELSDKLYLSFLAQIQAVLDSIDYYESSMIFFSERQTPKIVGGLYKKVYEELKRYG
FT                   SFLLVREKLYSDTIDLADLLMQIERFKNYAKTQMYYWYDLAVTLLPGTWNRYSDWEGIY
FT                   GEYMTAVVSVGGDTTAVSNRILEIAKKHAFACEGMWEGGYYGIPDDTLGIALKYAGNLK
FT                   EKHQKEYERFMRELSEIYHGVYVKTKEGLSKFRSEELKKRAEKFIELYEKISTN"
FT   gene            24079..25998
FT                   /locus_tag="Kole_0017"
FT   CDS_pept        24079..25998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0017"
FT                   /product="methionyl-tRNA synthetase"
FT                   /note="TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase class I
FT                   (M); t-RNA-binding domain protein; Cysteinyl-tRNA
FT                   synthetase class Ia; KEGG: bsu:BSU00380 methionyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78746"
FT                   /db_xref="GOA:C5CHA7"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHA7"
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /protein_id="ACR78746.1"
FT                   /translation="MKPKFYVTTPIYYINSEPHIGSAYTTIVADIVARYKRLSGYDVFF
FT                   LTGTDEHGQKVLQAAKEENLDPQTYSDQLAEKFKVLWKELQITNDYFVRTTDERHMKTV
FT                   QLFVKKMLENGDVYKGKYEGWYCVPCETFWTEEDIGKERVCPSCGREVKWVSEENYFFR
FT                   LSKYNDALLKHFQEHPEFVQPDFRRNEMLRILENGLRDLSITRTSFKWGVPMPNDPEHV
FT                   IYVWVDALINYISAIGYIDDPETFHRYWPADVHIIGKEINRFHSLIWPAMLMSVGLPLP
FT                   KQIYAHGWLTVNGQKISKSLGNAIDPREFVKAYGNDAVRYYLLRDIQFGRDGDFSEENL
FT                   VHRINADLANDLGNLLHRTVAMIEKFNNGIVPKKGVVEDVDNQLYGLAEEVIAEYIDHM
FT                   DNLRFTPSLDAIWRFARFGNKYIDLTEPWKLGKDPEKAERLNTVLYNLVDTLRIVSLMI
FT                   EPVMPNTAKAIRERIGQAVELDFTHLKLGLTKNGVGVKHGEPLFPRIDVKKHRWVSKML
FT                   EEKKAEASVEGKEDNLIEISDFAKVELRVGEILEAEKVEKSRKLIKLKINLGELGERQI
FT                   VAGIARHYNPEELIGLKIVVVTNLKPAKLMGIESQGMLLAAKIEDSLTVLTVHRDIKPG
FT                   AKVS"
FT   gene            26015..28453
FT                   /locus_tag="Kole_0018"
FT   CDS_pept        26015..28453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0018"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: nam:NAMH_0664 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78747"
FT                   /db_xref="GOA:C5CHA8"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CHA8"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACR78747.1"
FT                   /translation="MPEEIISRSINDEMITSYMLYSMSVIVGRAIPDVRDGLKPVQRKI
FT                   LFGMLELGLRHNQSYKKSARIVGEVMGKFHPHGDMAIYDALVRMAQPFSMRYPLIQGQG
FT                   NFGSIDRDPPAAMRYTEARMQRLAEELLADIDKNTVKMIPNFDGSLIEPEVLPAKAPNL
FT                   LMNGASGIAVGMMTNIPPHNLSELVEALTALIDNPDATIEELMEYVKGPDFPTGGIIMG
FT                   RDGIKKMYETGRGRMVVRGVAEIEEAKGGTRIVISEIPYGVSKADLIQQIANVAQNVRD
FT                   IQVRNVRDESDKRGLRVVIELKRGADPNVVLNLLYKHTQLQTTFGAHMLVIDEKKRPKL
FT                   MNLKEIFQAFIKHRYEVVKRRTEYELEQASKKAHILEGLTKASRAIDTVVDIIRNSKNI
FT                   QEASVNLQETLEITPEQSQAILEMRLGKLTALEIDKLVTEYAELVEKIKEYREILSDDK
FT                   NIYQIIKKELQELEAQYGDARRTKISIDGNTDFNVEDVIPDDEVVVTVTKKGYIKATPL
FT                   EDYRKQGRGGKGIRGVKTTDADFVTNVVSTTRLSKTVVITSKGKAYFINNYELECTSRS
FT                   SRGKLLANYVKIEPDETVQAVLSVKREEVANKHLIITTRKGKIKRTPFEAFINSRTSGI
FT                   KAITLNEGDSVVDAGISTSEEETIIISTRKGMVIRFPISQIRPMGRTAAGVKAMALRGD
FT                   DEVVSATIVLPVDERYLFTATERGVGKRTPLSEYRPQHRAGMGVKNIYGLERTGYVVGS
FT                   LVVTNEDEIIVITKNGMSIRIPAADIRPTGRVTKGVKVVELRDDDTVASLAVVVDQAEV
FT                   "
FT   gene            28473..29099
FT                   /locus_tag="Kole_0019"
FT   CDS_pept        28473..29099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0019"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="KEGG: glo:Glov_1232 transcriptional repressor, LexA
FT                   family; TIGRFAM: LexA repressor; PFAM: LexA DNA-binding
FT                   domain protein; peptidase S24 and S26 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78748"
FT                   /db_xref="GOA:C5CHA9"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHA9"
FT                   /inference="protein motif:TFAM:TIGR00498"
FT                   /protein_id="ACR78748.1"
FT                   /translation="MNLTERQREILEYIEKFIKLNGYPPSIRDICRDFNISSPRGAAKH
FT                   LEALEKKGYIERTGVSRGIRVIRDASGGSVTLENDVVMLPVVGVIAAGEAIRAIENRDE
FT                   SIPVPMWMVRRGFEYYVLKVTGNSMIESHILNGDYVVIRKQEWANNGDIVVALIDGENA
FT                   TLKRFEHEGPKVRLVPSNPEMLPIVLEADRVKIQGKLVGLLRWYK"
FT   gene            29123..29578
FT                   /locus_tag="Kole_0020"
FT   CDS_pept        29123..29578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0020"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /note="KEGG: afw:Anae109_2734 ribose 5-phosphate isomerase
FT                   B; TIGRFAM: ribose 5-phosphate isomerase B; sugar-phosphate
FT                   isomerase, RpiB/LacA/LacB family; PFAM: Ribose/galactose
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78749"
FT                   /db_xref="GOA:C5CHB0"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHB0"
FT                   /inference="protein motif:TFAM:TIGR01120"
FT                   /protein_id="ACR78749.1"
FT                   /translation="MKVAIASDHAGFAMKKELIDFLSSAGYEITDYGTYSEESVDYPDY
FT                   AAKVAEAVTEGTAERGILICGTGLGMSIAANRYKGVRAALCLYPEMARMTRKHNDANVL
FT                   VLSGRLIGVELARRIVEVFFETGFEGGRHERRIRKIDDLPDLRRRSD"
FT   gene            29575..30540
FT                   /locus_tag="Kole_0021"
FT   CDS_pept        29575..30540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0021"
FT                   /product="Histone deacetylase"
FT                   /note="PFAM: histone deacetylase superfamily; KEGG:
FT                   dat:HRM2_13220 histone deacetylase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78750"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHB1"
FT                   /inference="protein motif:PRIAM:3.5.1.98"
FT                   /protein_id="ACR78750.1"
FT                   /translation="MKIFYDRRHLLHIPKKEMDNGKWVENADKPDRIEAIRESLERHFG
FT                   FSFNEPRDYYSSYLYLVHDHDYVHWLKKRSEGVEPGEEYFPEVFGYDKVFDTGTPITRN
FT                   SFFAALNAVSASLNAVDEILTGETIVYALCRPPGHHASSSQAGGYCYFNNAAIAARYFQ
FT                   KYTHGYVAILDLDFHHGNGTQEIFYADSTVLYVSLHGDPEKFYPWISGYDWEIGEEDGV
FT                   GYNFNFPLPGETTGTDYLRTLEKALAEIENFDPDLLIVSLGFDTHKEDPVGHFSLEDKD
FT                   YYLIGKALKDLDFSIVLIQEGGYNPDANMRASRNFFAGLL"
FT   gene            complement(30600..33110)
FT                   /locus_tag="Kole_0022"
FT   CDS_pept        complement(30600..33110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0022"
FT                   /product="surface antigen variable number repeat protein"
FT                   /note="PFAM: surface antigen variable number repeat
FT                   protein; surface antigen (D15); KEGG: tcx:Tcr_1278 surface
FT                   antigen (D15)"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78751"
FT                   /db_xref="GOA:C5CHB2"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHB2"
FT                   /inference="protein motif:PFAM:PF07244"
FT                   /protein_id="ACR78751.1"
FT                   /translation="MRKVSVLLLSFLIFSVIVMSGIVVKKIEITGNTILKDSEIRELLG
FT                   IKLRTEIDRETLEASLGSLTDSGYFKNVDFSFDEASGLLSITVEEFPGADVEITFVGPK
FT                   IADKDTLLASGVTIEDGKPLNPTRIIYEIPRSVEGLTETLKSLGYPEAFFDIEWDTEPD
FT                   KKDIMRGNVEDHIKIIFKIKPYYLWDVEIEAPLSERALEELKNTAKLKTFKSYYEAPGI
FT                   IRLFMKESSYVPKASDIASAVRSIFSTYYVNPEGSWGLEKVYRALAFAYSNALKTAREV
FT                   ELPEGVEGQAKIITLSFKPASYIARPMEVKTIFFTGNEHVSSLTLLNAVGIREGEVIDS
FT                   EKIAKALQAIQEVYSKEGYPFTKQQVRIDENLGSLTFEITELKVGNINVEYVGEHKTRD
FT                   YLIQDKIVLKKGEVLSLKDYQNTYAFLNSTGYFDSVVINPIPSDGETLDVKIVLDEKDK
FT                   NGKIMGGGGWQDGLMLNLDVGFLNPFGYGQDISLKANVNFPVGGSKTTISTDETTGATI
FT                   TETSSPTYDLSFSYIVPKIFASNWDVGLSMKLRSTGKSTEEATETAPDTIEATITEERE
FT                   YRIDLALAPTYNLSAAEKIRTSAGFEYINIYTETATELRTATSTEVATSQTANTFYGLY
FT                   TSLSYSYSTRDDLLRPKNGTEFSARLYARGIFGNEPFAGVMFEFKKFIDLGPLPIAKGL
FT                   GNPVLGFRARTDQLFPFNEYNKVFETYLLSPGTYLRVKNGGLVVGNDVYGVTAASLQLR
FT                   VPLVEIRGSMPLDFVLFGDLVYYREGANIADLIGNKTIWDAGVSLEISLPMIGLFRVGW
FT                   GWNSVYGESTDYSGTFFFGIGPVF"
FT   sig_peptide     complement(33048..33110)
FT                   /locus_tag="Kole_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.942 at
FT                   residue 21"
FT   gene            complement(33115..33657)
FT                   /locus_tag="Kole_0023"
FT   CDS_pept        complement(33115..33657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0023"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   dat:HRM2_16530 sensory signal transduction histidine kinase
FT                   (ATPase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78752"
FT                   /db_xref="GOA:C5CHB3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHB3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACR78752.1"
FT                   /translation="MRTIADHILDICQNAVDAGASQIKLSIEEIPGERFSFVVEDNGKG
FT                   IPEEKLKEILDPFYTEKKKKVKFGLGLPMLKFASESTGGSFSIQSKPGVGTKVSATFNL
FT                   SNIDCQPVGDLASAIFSAITMEAGVNWQIVRVKGQNGYSLTTEELKKILGDDFYSNPMK
FT                   MKKIMELLNMMENSLGG"
FT   gene            complement(33654..34397)
FT                   /locus_tag="Kole_0024"
FT   CDS_pept        complement(33654..34397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0024"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; SMART: phosphoesterase PHP
FT                   domain protein; KEGG: dat:HRM2_16540 metal-dependent
FT                   phosphoesterase (PHP family protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78753"
FT                   /db_xref="GOA:C5CHB4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHB4"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ACR78753.1"
FT                   /translation="MIGLGLKKFSCDFHVHTCLSPCADITMTPRAVAKVLTEKGIDWIA
FT                   VTDHNSAGNVRTFMKALTLQGIKVIPGIEVHTAEDVHLLAYFPDAETAEDYSSWLYDKI
FT                   PDISIDPEKFGYQLFVNENDEFIGMEEKWLGQPANVKIHEAIQEILKRKGIFAFAHAER
FT                   RMGILYQLGFIPPVANPVLVEVAFKKTLHEFPSNVAINCLHSSDAHSLNMLKPSMVVEC
FT                   ERRTFEAFKKSLLIDYEARVRINWV"
FT   gene            complement(34394..34726)
FT                   /locus_tag="Kole_0025"
FT   CDS_pept        complement(34394..34726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0025"
FT                   /product="iron-sulfur binding hydrogenase"
FT                   /note="KEGG: dat:HRM2_16550 iron-sulfur binding
FT                   hydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78754"
FT                   /db_xref="GOA:C5CHB5"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHB5"
FT                   /inference="similar to AA sequence:KEGG:HRM2_16550"
FT                   /protein_id="ACR78754.1"
FT                   /translation="MLLREIIDKCNLKVIEAENLDVEISNGYVGDLLSDVMGNAPGDSI
FT                   WLTVQSHMNIVAVASIVGVKAIVLCNGLTYEDETIEKAKENAIALLSSSENSFKTCMKL
FT                   FEAGLR"
FT   gene            complement(34766..35722)
FT                   /locus_tag="Kole_0026"
FT   CDS_pept        complement(34766..35722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0026"
FT                   /product="putative signal transduction protein with CBS
FT                   domains"
FT                   /note="PFAM: CBS domain containing protein; ATP-binding
FT                   region ATPase domain protein; SMART: CBS domain containing
FT                   protein; KEGG: dat:HRM2_16560 RsbW2"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78755"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHB6"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACR78755.1"
FT                   /translation="MSDEGVDKLIEKLRKFFSHIKAGEIMTKNIITMTPERTLWQAKEL
FT                   MKLRKISGIPIVNRDNKLLGIVSIEDIIVALEKDHIRDKIGEHMTKDVIVLKPDEELES
FT                   ILQKFDRYRYGRFPVVDESGKLVGLVTKKDIISAILERFRIIYVHDERRSRVLENTNKW
FT                   FERSLITGDYVEKKKADFFFAINYTDVDLAGMGAARLKRFLMGKIKDENLVRKVSIATY
FT                   EAEVNVVIHSGSDGFIYCWIDDDAIRVRVEDHGKGIENIEMAMKEGYSTATDHVRELGF
FT                   GAGMGLPNMKRYSDKMVVMSEVGKGVVVEMIFYMNKK"
FT   gene            complement(35719..36084)
FT                   /locus_tag="Kole_0027"
FT   CDS_pept        complement(35719..36084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dat:HRM2_16570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78756"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHB7"
FT                   /inference="similar to AA sequence:KEGG:HRM2_16570"
FT                   /protein_id="ACR78756.1"
FT                   /translation="MTLEEICKFLGCEILNDTGDLDKRQIEYIGAADLMSDVLAFGTPN
FT                   MLLVTGLNSPQCVRTASVVGAAGVLIVRKREVPESTVNLAKDLEIPLLHARISMYKACG
FT                   KLYDLNLKDALEEVNGF"
FT   gene            complement(36081..36773)
FT                   /locus_tag="Kole_0028"
FT   CDS_pept        complement(36081..36773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0028"
FT                   /product="thymidylate synthase, flavin-dependent"
FT                   /EC_number="2.1.1.148"
FT                   /note="KEGG: ott:OTT_1076 Thy1 protein; TIGRFAM:
FT                   thymidylate synthase, flavin-dependent; PFAM: thymidylate
FT                   synthase complementing protein ThyX"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78757"
FT                   /db_xref="GOA:C5CHB8"
FT                   /db_xref="InterPro:IPR003669"
FT                   /db_xref="InterPro:IPR036098"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CHB8"
FT                   /inference="protein motif:TFAM:TIGR02170"
FT                   /protein_id="ACR78757.1"
FT                   /translation="MEIKVLEKGFIRLVEVMGDDFSAVQAARVSYGKGLTTPERDKKLI
FT                   FYLMEHGHHSPFEHIIFKFHIKLPIFVMRQLVRHRIASINERSGRYTEFSDEWYIPERI
FT                   RTPDKVNRQGSVFVDDDDLNSEGIRLIEETIEKTYQAYKRLLEMGVARELARIVLPTSM
FT                   YTECYWTINARSMMNFLNLRADSHAQYEMQQYALAVAKIFKSKCPVTYEAFLNFAYTGD
FT                   LLKTEGCL"
FT   gene            complement(36785..37957)
FT                   /locus_tag="Kole_0029"
FT   CDS_pept        complement(36785..37957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78758"
FT                   /db_xref="GOA:C5CHB9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78758.1"
FT                   /translation="MKYKIELILVLLMSFVYIFAMDVNEGIILLLSKDYAQKIFFAQDD
FT                   SEISKVFSCIAYGVRYMENLAWIDKDRFYDSLEELKREELPEEIIIGLDVLETAISTST
FT                   VGALALLEESAESSVAAAIALRLYKIDWTETRDPNSGKAMLRIAETLQKKYPEAYLPYE
FT                   AIFLFHSSSVFGDKSEFLRYRDVVLGMIDESDEFSAILQALIKGEYYLGLYEELLEDYR
FT                   KLTDPGDETKFYAAMAEFETGSQGTAEILLKDTNLSSLPSKMASKGFEVLGKIAENEGN
FT                   TDSAIYYFKRAIKFNGKNRDALVHLGFLYMNSDLEEHDTLARYYFEMSGMEDYDPEVAE
FT                   ALNVLRKRLVLRIIFYQVLPLIAAVVLGLILVEYIYIKRRKKQEEEALRK"
FT   sig_peptide     complement(37895..37957)
FT                   /locus_tag="Kole_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.892) with cleavage site probability 0.878 at
FT                   residue 21"
FT   gene            complement(37947..38768)
FT                   /locus_tag="Kole_0030"
FT   CDS_pept        complement(37947..38768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0030"
FT                   /product="Phosphomannose isomerase-like protein"
FT                   /note="KEGG: aba:Acid345_0569 mannose-6-phosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78759"
FT                   /db_xref="GOA:C5CHC0"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHC0"
FT                   /inference="protein motif:COG:COG1482"
FT                   /protein_id="ACR78759.1"
FT                   /translation="MIYLSEPLFSERPWGDPELNKLYGVNSELPIGEVWLLCDFLDKRT
FT                   PLKDSCKTVFPMDLVSDFCDKPLPRFPLLIKLISAKDWLSVQVHPDDVLARKLEKEPWG
FT                   KTEAWYFVSDGTIAAGFSDPGVVNKKDISEIKAEDLNILDVHKGELIKLPAGMVHALGP
FT                   NTRLLEIQQASDLTYRIYDWDRPRELHLEKARLAIKPSLTPEIEALKDFETRDMGIFKL
FT                   TLTNKASGKGIFVTLEEKPRAYVVVDDSLETKKIGLWIEPGEYWKGVSYEV"
FT   gene            complement(38770..40083)
FT                   /locus_tag="Kole_0031"
FT   CDS_pept        complement(38770..40083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0031"
FT                   /product="gid protein"
FT                   /EC_number="2.1.1.74"
FT                   /note="KEGG: gsu:GSU2547 tRNA (uracil-5-)-methyltransferase
FT                   Gid; TIGRFAM: gid protein; PFAM: glucose-inhibited division
FT                   protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78760"
FT                   /db_xref="GOA:C5CHC1"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHC1"
FT                   /inference="protein motif:TFAM:TIGR00137"
FT                   /protein_id="ACR78760.1"
FT                   /translation="MKVKINIVGGGLAGSEAALSLAEKGIEVTLYEMRPKVKTDVHQTG
FT                   YFAELVCSNSLKSVELTNASGLLKEEARMLGSILLEIAERHRVPAGKAFAVDRKTFSKE
FT                   VTERIESSPYIHVVREEVKEIDLNDEGTLWIIATGPLSSPAFEKWLSGLFGEDLFFFDA
FT                   LSPIVAADSIDYRRCFVGDRYGKGSGDYLNCPLDKETYERFWNELVNAQVAPIENFSDK
FT                   LLFDRCQPVEEIARTGIDALRYGPMKPVGLIDPKTGSEPYAVVQLRKENKEGTLYNLVG
FT                   FQTRLKWGEQKRVFRIIPALEHAEFVRYGVMHRNTYLNSPKILNRDLRSKGYPNLFFCG
FT                   QITGLEGYVEAITSGRFVALNVMELVKTGSTFYLPEKTMLGALINHITVSGRVPLSPVY
FT                   ANYGLLPPVKAKGKRERNLKKAERAIEELKKFLKERGF"
FT   sig_peptide     complement(40015..40083)
FT                   /locus_tag="Kole_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.664) with cleavage site probability 0.567 at
FT                   residue 23"
FT   gene            complement(40080..40973)
FT                   /locus_tag="Kole_0032"
FT   CDS_pept        complement(40080..40973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0032"
FT                   /product="8-oxoguanine DNA glycosylase domain protein"
FT                   /note="PFAM: 8-oxoguanine DNA glycosylase domain protein;
FT                   SMART: HhH-GPD family protein; KEGG: OGG1; 8-oxoguanine DNA
FT                   glycosylase ; K03660 N-glycosylase/DNA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78761"
FT                   /db_xref="GOA:C5CHC2"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHC2"
FT                   /inference="protein motif:PFAM:PF07934"
FT                   /protein_id="ACR78761.1"
FT                   /translation="MIKFSLKLDTAFDLDTTLDCGQTFRWEKTDGWWKGVVRDTVLFLK
FT                   QSGKKLDVIASRDTLLGMDIDEGLRKYLGFEDDLEEVHSTLEMIIRSLPERTKELSLNA
FT                   VKQARGLRILRQDALEMTVEYIISTRNSIPTIRKISDLLSAKFPENRVEMDDEVFYTFP
FT                   SLEQLKHLKLEDLLEIKLGFRADWLYELFQNLEDEMFFEELYDKPLMEKLEELMKIKGI
FT                   GYKVGSCITLFAYAELNSFPVDVWIKRVMKDLFGVNGSTKKVMEFGMETFAPYAGYYQE
FT                   AVFRYYRTHKLGRDKQ"
FT   gene            complement(40970..41284)
FT                   /locus_tag="Kole_0033"
FT   CDS_pept        complement(40970..41284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78762"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78762.1"
FT                   /translation="MGSVPVELIERIEELGNEIGLQLRLVDSQGNSLGKPLPVEIPPLV
FT                   LALSLQTGSRSSTTSGLETITAMPVNIGGNALVLVVIGEFREDNAFRLLKVVTERMLTK
FT                   "
FT   gene            complement(41277..42092)
FT                   /locus_tag="Kole_0034"
FT   CDS_pept        complement(41277..42092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0034"
FT                   /product="protein of unknown function DUF208"
FT                   /note="PFAM: protein of unknown function DUF208; KEGG:
FT                   nis:NIS_0539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78763"
FT                   /db_xref="GOA:C5CHC4"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHC4"
FT                   /inference="protein motif:PFAM:PF02677"
FT                   /protein_id="ACR78763.1"
FT                   /translation="MKLLLHVCCGPDLAVTMEHLKSDFNGKITAFFYNPNIFPYEEYVK
FT                   RLRAFEQVAERYGLETMEGKYDEERFYALARNLEDESEGGERCRRCIALRLGVTASLAQ
FT                   KMDFDLFSTTLMASPRKSIVMLENEGKRAEKATGKRFLFSNFRKGIDGKKKRELFSGIY
FT                   VQDYCGCVFGLREQEMKRQEIEKKDFEKLKQDFPEKIHLWKYRRKPLNSDNFEINDINE
FT                   LKELLEIIKPSKLVVTEGFAKAFSLTSKWLKCGSYNCRLERSERGETYG"
FT   gene            complement(42089..42883)
FT                   /locus_tag="Kole_0035"
FT   CDS_pept        complement(42089..42883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0035"
FT                   /product="competence protein ComEA helix-hairpin-helix
FT                   repeat protein"
FT                   /note="KEGG: EEPD1; endonuclease/exonuclease/phosphatase
FT                   family domain containing 1; TIGRFAM: competence protein
FT                   ComEA helix-hairpin-helix repeat protein; PFAM:
FT                   helix-hairpin-helix motif; SMART: Helix-hairpin-helix
FT                   DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78764"
FT                   /db_xref="GOA:C5CHC5"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004509"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHC5"
FT                   /inference="protein motif:TFAM:TIGR00426"
FT                   /protein_id="ACR78764.1"
FT                   /translation="MKRLSSKEAQLLGSVIFIVVIGFIALLNMGETNDVTKNSEALFDV
FT                   KERFPIDLNTATVEILQLLPGIGETRAKAIVTFRESNGGFSSTEELLQVKGIGNSTYEK
FT                   LKDLVTITNAAKSKAENTRDTRLDLNTASKVDLTSLPGIGEVKAAEIVKYREEHGGFKA
FT                   IDELINVKGIGRATLDKIRNLVRVGSVSTNVPDKSENSGKINVNTATLQELVALPGIGP
FT                   VLAERIIDYREHNGKFHKPEDLLKVSGIGIKTLSKFREMIDF"
FT   gene            complement(42880..43641)
FT                   /locus_tag="Kole_0036"
FT   CDS_pept        complement(42880..43641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78765"
FT                   /db_xref="GOA:C5CHC6"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78765.1"
FT                   /translation="MSDKAFGAAVRMLSVFVIALSIAVFIVGGYAYLLKQENDNYRLIV
FT                   EEIRNSVNPTIAATEPQEPSLEPLKKEIEKLEEASPDKEMAVEEPERHFFLESFDYERL
FT                   IIESFDYFVQGTAFSYVVVDENTAFKLCIEKGKDNYFITKIDPGNYGIMFLGENPLEGL
FT                   FASKVAYGVQLVSHTIVDGIAPQIINLRANGYPAFAYKFYTADGRTFYAAILGAFPDLE
FT                   TARDYSEALNVFKVEEITGWDISGRYLRRIK"
FT   gene            complement(43638..44627)
FT                   /locus_tag="Kole_0037"
FT   CDS_pept        complement(43638..44627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0037"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="PFAM: 3-dehydroquinate synthase; KEGG:
FT                   dat:HRM2_06080 AroB1"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78766"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHC7"
FT                   /inference="protein motif:PFAM:PF01761"
FT                   /protein_id="ACR78766.1"
FT                   /translation="MKKFLFTRVQESECVVKFVEDCRKNIPESLLIVDSGVPKFKGKSF
FT                   PNIYALKGGEHVKSLDRVLEMYQLFKVSKKDSVTAVGGGALLDLVGYSTSTYTELKHLR
FT                   LVPSTPLSQVMLPICGSFFINLEFRKDVLRTFGVPEEVIIEPQLSYEVFSRQGVYELFP
FT                   MLITAYSYDWRLFNYLSNLISEGMEIDLKLWEDLLWSSLKAYIDGISNDYEPVGISMTR
FT                   ILQSAFRLKLDYMVALAFGAIIESWVGLLHGLLDEEHTRKFFLTLKKIWCNNWPYRLDM
FT                   SSVTEYIDKLKEIVIWLPGGAQQRRVVVSSTELSRMVRKNMRGLESFT"
FT   gene            complement(44624..45634)
FT                   /locus_tag="Kole_0038"
FT   CDS_pept        complement(44624..45634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0038"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; peptidase M18
FT                   aminopeptidase I; peptidase M20; KEGG: bsu:BSU28820
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78767"
FT                   /db_xref="GOA:C5CHC8"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHC8"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ACR78767.1"
FT                   /translation="MKELIKKVTEVCSPSGREDKIREMIIEEIKDFVDGYKVDRLGNLV
FT                   AWKKGSSGKKLLLDAHMDEIGVVVSNIDDKGFLKIEMIGGVSPYILLGTRIRFETGVIG
FT                   VVGVEGESGKELQENMKGLSFDNIFVDIGATSREEAGKLAPVGTFGTYDATFYDAGKRL
FT                   ISKAMDDRIACAILIQVAKELKNPKDDIYLAFTVQEEVGLVGASVAGFDIMPDMAIAVD
FT                   ITGGPDTPKSYKRMGFELGKGPAIKIKDRASVSSSWVVKKLAEVAEKYKIPYQYEVLIF
FT                   GGTNARGYQVTRSGIAAGTLSIPTRYAHTPHEMVDYDDVLNAVKLLKALCEEGIG"
FT   gene            complement(45631..46665)
FT                   /locus_tag="Kole_0039"
FT   CDS_pept        complement(45631..46665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0039"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; KEGG: bha:BH3132
FT                   endo-1,4-beta-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78768"
FT                   /db_xref="GOA:C5CHC9"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHC9"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ACR78768.1"
FT                   /translation="MKLERLKELSELPGISGFEEKVADYIEEKIKDKVDKYWRDNVGNL
FT                   IALKKGKGNGKKLMLLAHMDEVGLMVKRVNEDGTLAIRAVGGLAPRVLIGKKVLVGPDL
FT                   IPGVIGFDAIHIQEPATVLKSPSYDSLSVYLGVSSKDEVKNVRIGDPVFFSTKYEEVGN
FT                   YAIGKAFDDRSGCEVLLSVLDDILENPVDYDIYFAWVVQEEVGLRGSGVAAAQIKPDAA
FT                   LVFENTTAGDNPEMPESRWSTRLGEGPALTFAHSGLVLDRKIFETIVDTAKRYDIPFQY
FT                   KSRTVGGTDAARLARTLRGIPSGVISTPSRYIHSPVSVIDINDFLKVVKLAKILVREGK
FT                   VLSE"
FT   gene            complement(46655..47677)
FT                   /locus_tag="Kole_0040"
FT   CDS_pept        complement(46655..47677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0040"
FT                   /product="peptidase M42 family protein"
FT                   /note="PFAM: peptidase M42 family protein; peptidase M18
FT                   aminopeptidase I; peptidase M20; KEGG: bha:BH3132
FT                   endo-1,4-beta-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78769"
FT                   /db_xref="GOA:C5CHD0"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHD0"
FT                   /inference="protein motif:PFAM:PF05343"
FT                   /protein_id="ACR78769.1"
FT                   /translation="MKTPELLIKLSNAFGPVGYEDEVRKIIQEEIEPYVDEVKVDNLGN
FT                   LIAFKRGTGKKKVAFFAHIDEVSLVVSAKDERGFLRFDTMGGIDPKVLIAQRVKVVSKD
FT                   GKVRRGVIGVLAPHLQKAADRKNIPPMDEMFIDVSMNPDYEKIEIGDLVVIDTEAFESN
FT                   GKVIGKALDDRACAVISILVAKQLSKFSRFPDVYFVFTSREEVGGMGARVAAEAIQPDV
FT                   GIAMDVTHAHKRTGIELGKGPAITVGGPNIHKGYFKMLDDVAKREGVKVQYEIAAGRTG
FT                   TDADNVQIAGTGIPALLVSLPNKFMHTPVEVVQVSDVEESARLLVNFLFELEEGEENEA
FT                   "
FT   gene            complement(47674..48330)
FT                   /locus_tag="Kole_0041"
FT   CDS_pept        complement(47674..48330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0041"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; KEGG: sfu:Sfum_1280 septum
FT                   site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78770"
FT                   /db_xref="GOA:C5CHD1"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CHD1"
FT                   /inference="protein motif:TFAM:TIGR01222"
FT                   /protein_id="ACR78770.1"
FT                   /translation="MPIDFRMTKKGLILLIESYSSIESLKQEIMAKFNEARDFFSEGDE
FT                   ISLMLTQETSKPDDIVNIVSLLGNLGVRVKDILVGSLEKKNVKIGQKYDLVREKVTEVR
FT                   GAQVIKRNLRSGQIVVHNYDIIVFGNVHPGAEIIAGGSIVIFGTARGILRAGYSVGDEA
FT                   VIAALDLKPSLIQISGLISQDYNVYETPAVAHIRTGRIVVEKIESAKFEVKGGKI"
FT   gene            48490..48565
FT                   /locus_tag="Kole_R0001"
FT                   /note="tRNA-Glu1"
FT   tRNA            48490..48565
FT                   /locus_tag="Kole_R0001"
FT                   /product="tRNA-Glu"
FT   gene            48571..48645
FT                   /locus_tag="Kole_R0002"
FT                   /note="tRNA-Val1"
FT   tRNA            48571..48645
FT                   /locus_tag="Kole_R0002"
FT                   /product="tRNA-Val"
FT   gene            48654..48729
FT                   /locus_tag="Kole_R0003"
FT                   /note="tRNA-Phe1"
FT   tRNA            48654..48729
FT                   /locus_tag="Kole_R0003"
FT                   /product="tRNA-Phe"
FT   gene            48858..49364
FT                   /locus_tag="Kole_0042"
FT   CDS_pept        48858..49364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0042"
FT                   /product="3H domain protein"
FT                   /note="PFAM: 3H domain protein; Helix-turn-helix type 11
FT                   domain protein; KEGG: bha:BH1216 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78771"
FT                   /db_xref="GOA:C5CHD2"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHD2"
FT                   /inference="protein motif:PFAM:PF02829"
FT                   /protein_id="ACR78771.1"
FT                   /translation="MRKERLEGILEILSSAKQPISGLELAEKLNVSRQMIVRDIATLRN
FT                   AGHEILSTAHGYLLKKQKTVKKLVAVAHGSENIMDELLTIVRNGGSVVDVIVEHPVYGE
FT                   LKGNIGVSTEEDVIRFISLLKGSSASPLLAVSKDGIHLHTIEAPNQKIMDTIIKNLDEK
FT                   GYLLK"
FT   gene            49390..50667
FT                   /locus_tag="Kole_0043"
FT   CDS_pept        49390..50667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0043"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: abm:ABSDF0216 MFS family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78772"
FT                   /db_xref="GOA:C5CHD3"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHD3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACR78772.1"
FT                   /translation="MIIDKVVEKYVSRARQLRILLVTSLEWMLVAAGVMVLSLTLPSIL
FT                   KELPGAAELKGTIASSVFMGMLVGALSSGFISDIFGRKVGNIMFLVLAGLFSGLTGASS
FT                   DGTNFIINRFLAGVGYGGLLPVVNAYLTEFTAIKIRGLYLTLLEASWAIGSILLGVYTI
FT                   LTLGVFGWRASYYLLTLVSLPLLAVVSLLPESPKFAYMRGGRRALEKALGTKIDEKVEM
FT                   HKIKKVPFLEILSKRFAPRTLMVWFSWFTVSFIYYGLFIWAPKIFRSKGIAPGNALMYT
FT                   FFMLMMQLPGYLLAAYLIERIGRKKSIMFFFSGTAVSALLLAAVNSQGMLLFSSVVMSV
FT                   FCLGAWGMVYAYTPELYPTEMRGLGNGSAGVMARIAGIIAPYYTAFMMDKTGSITWVMI
FT                   PMSLLAITTVILNATFGIETRGKPVE"
FT   gene            50822..51394
FT                   /locus_tag="Kole_0044"
FT   CDS_pept        50822..51394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0044"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: sat:SYN_00663 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78773"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHD4"
FT                   /inference="similar to AA sequence:KEGG:SYN_00663"
FT                   /protein_id="ACR78773.1"
FT                   /translation="MLYFSEPGEHNTDAVLDLVFETAVKEGIRHVVLPSTRGKVATKAL
FT                   EMVPEDIDLVIVTHSVGFRKSGVDEFDPEVRKLYENTRHKILTTTHLFRGLEGYFYKKF
FT                   GGVYPPQFFAAALRLFGEGTKVAVEIALMAADAGLIPIDQWVISAGGTGKGLDTAYILK
FT                   ACNTRDLSEFRFGRLLAIPSEFYSRRS"
FT   gene            51399..52568
FT                   /locus_tag="Kole_0045"
FT   CDS_pept        51399..52568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0045"
FT                   /product="phosphopentomutase"
FT                   /EC_number="5.4.2.7"
FT                   /note="KEGG: baa:BA_4767 metalloenzyme superfamily;
FT                   TIGRFAM: phosphopentomutase; PFAM: Phosphopentomutase
FT                   domain protein; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78774"
FT                   /db_xref="GOA:C5CHD5"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024052"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CHD5"
FT                   /inference="protein motif:TFAM:TIGR01696"
FT                   /protein_id="ACR78774.1"
FT                   /translation="MRAIIIVLDSAGIGEMPDAEKYGDKGSNTFGNTAKAVGGLHMPNS
FT                   QRLGLGNLTDILGVPPTDHALGAYGRMLEKSPGKDTTTGHWEFMGIILEKPFDMFPNGF
FT                   PPEIIEPFEKETGRKVIGNKPASGTEIIKELGREHEKTGALIVYTSADSVFQIAAHEEI
FT                   VPVPELYKYCEIARKILNESGYKVARVIARPFIGEWPNYTRTPRRHDYSLPPEGKIALE
FT                   YLVENGVPVYAVGKINDIYDGHGITEYVKTKDNMDGVDKTLDYIRKVDKGLIFTNLVDF
FT                   DMKYGHRNNPEGYAKALEEFDARLPEIIGTMRPDDVLFITADHGCDPTTPSTDHSREKV
FT                   PLLVYGRHVKENVFLGERETFADLGQTILDLFGVEPMENGTSFKKEILD"
FT   gene            52605..52680
FT                   /locus_tag="Kole_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            52605..52680
FT                   /locus_tag="Kole_R0004"
FT                   /product="tRNA-Ala"
FT   gene            complement(52745..55573)
FT                   /locus_tag="Kole_0046"
FT   CDS_pept        complement(52745..55573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0046"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: glo:Glov_0704 excinuclease ABC,
FT                   A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78775"
FT                   /db_xref="GOA:C5CHD6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHD6"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ACR78775.1"
FT                   /translation="MNDFIYVKGARVHNLKNIDVKIPKNSLTVITGLSGSGKSSLALDT
FT                   IYAEGQRRYLESLSNYARQFLGELKKPDVESIEGLSPAIAIEQKTVSHNPRSTVGTVTE
FT                   IHDYLRILYARIGQPHCPKCGRPVEKQSLDEILEHVSRDFPEGTRIAVYAPIAKEKKGE
FT                   FKKELDLLKKKGYVRIEIDGIIYDLEDELSLDKNKRHTINLVVDRLKVREENKSRLADS
FT                   IEMALHEGNGFVEIVNLDNLQKKIFSEHFACPVCGISLPEINPKIFSFNNPYGACPECH
FT                   GLGFTREFSEELVIDRELSIRDGAIRAFSNSFDSFTMRMIMRVLEWLGESPDKPFKDLS
FT                   EEAQRVILYGTREELSFSFQSERLSYKIRKPFEGVMNNLKRRYRETQSGDIREWMESKF
FT                   MVTQECPRCHGQRLRAEALAVKIDGKNISELSDLTIREIYDFLGELKLTEHQEKIVGEL
FT                   LREIKRRLKFLIDVGLDYITLSRSATTLSGGEAQRIRLATQIGSGLTGVTYVLDEPTIG
FT                   LHSRDNARLIKTLKNLRDLGNTVIVVEHDEEVIRNSDYIVDVGPKAGIHGGEVVFQGPT
FT                   KKLLDNPPENSLTGKYLRGELKIPRFDSRNVKAKKKLILKGARQNNLKSIDVEFPLGKF
FT                   ICVTGVSGSGKSSLVMDTLYPALSNRLNRSRLPEGKYDDIIGVEELDNVIVIDQSPIGR
FT                   TPRSNPATYTGLFDHVRDLFAKTPEARARGYKKGRFSFNVKGGRCEACQGHGLLKIEMQ
FT                   FLPDVYVECDVCKGKRYNKETLEIEYKGKNIADVLNMTVEEALEFFERIPPLQRILSLL
FT                   NDVGLGYIALGQPATTLSGGEAQRIKLAAELKKRSTGRTFYILDEPTTGLHFDDVSKLV
FT                   KVLGRLVEKGNTVVVVEHNMDVVKNADYIIDLGPEGGDGGGQIVVAGTPEEVAACKKSY
FT                   TGYYLRKHLNLK"
FT   gene            complement(55566..56879)
FT                   /locus_tag="Kole_0047"
FT   CDS_pept        complement(55566..56879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0047"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="KEGG: bsu:BSU01770 hypothetical protein; TIGRFAM:
FT                   phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain III;
FT                   phosphoglucomutase/phosphomannomutase ;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain II"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78776"
FT                   /db_xref="GOA:C5CHD7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHD7"
FT                   /inference="protein motif:TFAM:TIGR01455"
FT                   /protein_id="ACR78776.1"
FT                   /translation="MKKLFGTDGIRGIVNEELTVELALKLGNAIGRYFAGKYDVLIIAK
FT                   DTRSSADLLESALAAGASSAGINVEYAGVMPTPALAYITRKYDTIGVMISASHNPAVYN
FT                   GIKVLERGMKIPDEVEVELENLMAMPMNYTVYSEVGKICSKDSYREEYIEHVVSMFSGK
FT                   AFRNNSLIVDGANGAITTVLKEVYSRLGIVADYTFFEPNGININDGCGSLHPKTLGKKL
FT                   DDDHIGVLFDGDADRCLFVLPGGTLIDGDMLMALNADKLHREGRLKNNTVVATVMSNLG
FT                   FEKFLESRGMKLLRTRVGDKYVLEKMIETGSTLGGEQSGHIIFFDRSTTGDGLITSLET
FT                   LNSLAVLGTDLREFYENFPKFPQLLKNVPVVDKKAVMECEDLHKLLEELKEDRTLRIVV
FT                   RPSGTEPYIRVMVEGMDEGKVSEIVERIVEVLEDCSNE"
FT   gene            56969..57059
FT                   /locus_tag="Kole_R0005"
FT                   /note="tRNA-Ser1"
FT   tRNA            56969..57059
FT                   /locus_tag="Kole_R0005"
FT                   /product="tRNA-Ser"
FT   gene            57103..57921
FT                   /locus_tag="Kole_0048"
FT   CDS_pept        57103..57921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0048"
FT                   /product="dimethyladenosine transferase"
FT                   /note="KEGG: bsu:BSU00420 dimethyladenosine transferase;
FT                   TIGRFAM: dimethyladenosine transferase; PFAM: ribosomal RNA
FT                   adenine methylase transferase; SMART: ribosomal RNA adenine
FT                   methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78777"
FT                   /db_xref="GOA:C5CHD8"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHD8"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ACR78777.1"
FT                   /translation="MNITDILRKYGIHLKDSLGQNFIKDERILSRIVKDSGITDEATVI
FT                   EIGIGLGTLTLKLAKKAKKVIGFEIDKRFEQIHKELLSDKNIQIIYEDFLKADLKDYDS
FT                   RPLFYVANIPYYITSPILEKILFEGPAFEAAILMVQKEYAERLLAKPSSKSYGALTVTI
FT                   GAFTMVRRLFNVSRKAFIPAPAVDSSVVKLIMREQTLVPLNEKRRFRNFVKLAFSHRRK
FT                   KLKNNLKPIIDNPEEFLRSLGFSVNVRAEELTIESFVKLYEASKRWNKNE"
FT   gene            57914..59626
FT                   /locus_tag="Kole_0049"
FT   CDS_pept        57914..59626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0049"
FT                   /product="PAS modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="KEGG: bsu:BSU24100 transcriptional regulator
FT                   (sigma-L-dependent); TIGRFAM: PAS sensor protein; PFAM:
FT                   sigma-54 factor interaction domain-containing protein;
FT                   helix-turn-helix Fis-type; PAS fold-4 domain protein; PAS
FT                   fold domain protein; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase; PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78778"
FT                   /db_xref="GOA:C5CHD9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHD9"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACR78778.1"
FT                   /translation="MSEKLLETIVNALIEAVIVIDDSEKIILINNEACNILNLKKDEAL
FT                   GKPVVGTIPNTRLHIVLKTGKPEYNRIQKLGDKTIVTSRIPLKDEEGNVYAVMAVFRDI
FT                   TSIKRLAEEVTNLREIEALLSAVIDSTHDAISVADEEGKIVLVNRAYTRITGMSAKYVI
FT                   GKLATVDIAEGSSLHLEVARRKEPILNARLKVGPAKKDVAVNVTPLFVNNEFKGSVAVI
FT                   HDLSEIEKLARELEQTRRLLRYVKAKYTFDDIAGNSQKMRVAIEQAKRVAKTPMTVLLR
FT                   GPSGTGKELFAHAIHNASDRADKNFISVNCAALPESILESELFGYADGAFTGAKKGGKR
FT                   GLLEEANRGTLFLDEIGKMSISVQSKFLRFLQDKEIIPVGGTKPQKLDVRIIAATNLNL
FT                   EQLVAEGKFLADLYYRLNVVPIVIPPLKDHIEDLPEIARVILIRLNQEYGRLVEDIDDE
FT                   ALELLMNYPWPGNVRELENVLGRSMINMEPDERVIRKDHLPKLELENHHREATQIGKLS
FT                   NLLADYEKKIIEDTLKATEGNKTAAAKVLGISIRSLYYKLERYGIDTAKNFEP"
FT   gene            59652..60003
FT                   /gene="ssrA"
FT                   /locus_tag="Kole_R0006"
FT   tmRNA           59652..60003
FT                   /gene="ssrA"
FT                   /locus_tag="Kole_R0006"
FT                   /note="tmRNA as predicted by Rfam (RF00023), score 187.00"
FT   gene            complement(60061..60807)
FT                   /locus_tag="Kole_0050"
FT   CDS_pept        complement(60061..60807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0050"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; KR domain
FT                   protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   shl:Shal_2747 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78779"
FT                   /db_xref="GOA:C5CHE0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHE0"
FT                   /inference="protein motif:TFAM:TIGR01830"
FT                   /protein_id="ACR78779.1"
FT                   /translation="MRLKEKVVIITGAASGIGKAAAKLFCKEGATVVACDLNEELLQAL
FT                   KDETKDFGGEIYPKKLNVTDREAIKELVEEIKEKFGKIDGLVNNAGITRDALLQRMTEE
FT                   NWDIVINVNLKGVFNMTQFVAPVMLKQGYGSIVNTSSIVGIYGNIGQTNYAATKGGVIA
FT                   MTKTWAKEFTRKGANIRVNAVAPGFIKTPMTEKIPEKIVKMVEERIPLKRMGTPEEIAN
FT                   VYLFLISDESSYITGQVIGVDGGLVI"
FT   sig_peptide     complement(60739..60807)
FT                   /locus_tag="Kole_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.775) with cleavage site probability 0.676 at
FT                   residue 23"
FT   gene            61213..61548
FT                   /locus_tag="Kole_0051"
FT   CDS_pept        61213..61548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78780"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHE1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78780.1"
FT                   /translation="MVPQELTKSDIVKIIEQLDKLLPSNFVNKQGRGRRKAYSDKSILK
FT                   LSILLKLCDVSYRGAKNFLEKNPKYMGTLGLEKHTTIPDYIQESKRIASSQDKQRCCKP
FT                   LFGYRRT"
FT   gene            61578..62180
FT                   /locus_tag="Kole_0052"
FT   CDS_pept        61578..62180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0052"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   dol:Dole_3091 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78781"
FT                   /db_xref="GOA:C5CHE2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHE2"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACR78781.1"
FT                   /translation="MTKTCKAHTAQRRRRTGKYKDPQSSWTKTTKGWEYGRKVHMSLVA
FT                   QNLLIQDWMTTPAAVHDSTVAKAQIDSGQGYKYFLADSAYDSQQIYRYIFDCSSMIPVI
FT                   DTNKRKGVSLEKQCQARWLGIQLRQIYAEKYKNRWEIERTINILQEYFNLEYIWYVRNR
FT                   NYDAVLGLAILAYNLCVMFNILNSRPHRKVADIIGCY"
FT   gene            62582..66382
FT                   /locus_tag="Kole_0053"
FT   CDS_pept        62582..66382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0053"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eck:EC55989_2911 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78782"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHE5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78782.1"
FT                   /translation="MSLFSLEIKDLTNLGPDRAVSFFRKLLWAEALQVGISRNMIDVPE
FT                   NINVPDGGIDAIIRDANPTSDEVIPQGLTGFQIKSSDLCPSRCKQELHINGDIHNDLKP
FT                   EIKQILESDGTYVLVLFADITTQQKRKREEAIKQELEEFGYRNPKIRIYTASQIIEFAN
FT                   RFPAVICYLKPHITSCMPYELWHKNFDVSNPYTFVVDPEREKIINDIRELIRSAKSTTI
FT                   IRIEGLSGIGKTRLIFEALSPNDLKNKVIYFKSSEDFKNSTLFNQFKIDENLDAIIVVD
FT                   ECSSSDHDIFKNSFVNVGKRITLITLSHEISNYNSSFPTHYWKLEPLSQEKIKELLSEE
FT                   FRGLPREAIDRISVFSGGCPRIAVLIANNYATVPTSYQGDFLFISDESLVNRLIAGRMD
FT                   TNSERFKITKRVLMGLSLFEKIGYRDKVVEESKWLAEYLRIDWIEFQEIIAEQKKRGIV
FT                   QGEHYIYITPFVLAVHLLKEWWEIYGNDFNLENFVGSFPDKFSKDMFERFISRFPYISS
FT                   TSQGKKTIEKLLSSNGIFSDGSLFKTEIGGKLFLKLTEADPKAALERLKRTIGRWNKKE
FT                   LLEFITGRRYVIHALEKIVVWRDFFQDAARLLLALGEAENDSYANNASGVFASLFSPAP
FT                   APVAPTEASLTERLPVLEEAINSSSKERKRLALKAFEKALQSTNFLRMVEAEYQGGKPL
FT                   PKLWKPKDLNEIIKYYKQVWKNLEEHLEVLEEDLREEGVEILLSSIRGLSVIHPELDEM
FT                   ARATINKMSSIPWIEKEKLIEVVSQILHYERSKMDEDTYVKWNKLKDNLIGSDFSSLLK
FT                   RFVSMNLLEDYLMDSDRYNTKWVEINIDKLVKKCLENPDLLESEYEWLLTEKAKRGYLF
FT                   GYRMGIKDINLIFLEKLIEKYKKINAINANVSMQVFGGYLNAMYEKDSALWEEKIEELS
FT                   NDQLFRKFIPELTALSGMTTKIALNILNLAKNGYIEIEAFRVFQYRSVIESMSQKIFNE
FT                   WIKFLLSDKTHKGALIALELFYSYYHDKKEVPYKLTLSILLHPVFWNNPKNVLHYQMID
FT                   YYWKEIALKLVDQYPDTVEKIAEQVTKYLGNAKSITVKTHFVVQEVLYELSIREPKSIW
FT                   RIISKYLGPPIDERAFYLNEWLRGKKWDGTKGKGALDLFDPEDIWNWVNEDVEMRSRYL
FT                   ATFIPPFLFHSEKKVCLAREMLARYGDRKEVRRNFSANFASEAWSSSSSLHYKKVKEEL
FT                   LEFGKKETNKNVLIWIEEYVDWLDESIEYTKIEEERRGWNE"
FT   gene            66591..67436
FT                   /locus_tag="Kole_0054"
FT   CDS_pept        66591..67436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Rap/Ran GTPase-activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78783"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHE3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78783.1"
FT                   /translation="MKMGIFVSGILLALLILSNCSITAFADANIGSISKIKKDYEVIND
FT                   LYRQGLNGPVRAVKLIKKRQWVEKIGSEEVYGSDTNMYVYFYNPNGYLVKELINPSTAD
FT                   WTLIIFVNEYDSKGRLSKRLELETYCDFNVDSLLSEEYEKIDEIVNMGTISALRNTKYT
FT                   YDSSGRLVLEVKNFFYEKKSRYSKQWILGNKEKIEYITDPSGTAIVKTVYDSHGEKIDY
FT                   RVTKYENYKQAITRGRVNLSYWTTVKYDDYGNWIELELRDTSDEIDETTIWKREIYYFE
FT                   "
FT   sig_peptide     66591..66671
FT                   /locus_tag="Kole_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 27"
FT   gene            67539..69281
FT                   /locus_tag="Kole_0055"
FT   CDS_pept        67539..69281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0055"
FT                   /product="protein of unknown function DUF262"
FT                   /note="PFAM: protein of unknown function DUF262; KEGG:
FT                   see:SNSL254_A4878 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78784"
FT                   /db_xref="InterPro:IPR004919"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHE4"
FT                   /inference="protein motif:PFAM:PF03235"
FT                   /protein_id="ACR78784.1"
FT                   /translation="MELEWSKKKLLGLVRRAYRGEVMLPDFQRNFVWSRSDIEELICSL
FT                   LEKMFIGTFLIQRVNPTDVPFKVIPIEGANKVNGGFSSRPEIIVLDGQQRLTSLFYALY
FT                   SPDIPLKNTTNPYAFFIDLQELCKDNIESAVFSWSKQWREYKALLDGNGKYILSELKKE
FT                   KILPLTFLADDDEFGDLWHESFKSLFSREDARKVKGYLDHLRHYEIHVLSIPLTEKPED
FT                   IAILFERINRTGIKLSIFDLLTARLYKFINLRTEWETAFDKKYWLKQIASNDIKNTKIP
FT                   YYIIQGLALGKGMSIKARDIIKIDSTILNKESWENAIDILENKILSRLFDVSEYGIADY
FT                   RWLSYPSMISIWLGLFIKAENGEINIDVEKINKWYWSVIFTERYSGSTETKQTKDFKDL
FT                   IKWLNDSSEIPETVLDIRNKLGVMKIDTRYPGSSIYKGVFNLLFRKGAWDFYEKDKIKF
FT                   SAKDLEDHHIVPKKFLENKGVDVDKDIVLNRTLILSLTNKKISKKAPATYIADMIKIHG
FT                   SEERVMEVLEKHFINKEMFELLKSIKEDSPPNEIKEKFECFISMREELIKNEITQLVGD
FT                   RIKD"
FT   gene            69397..70290
FT                   /locus_tag="Kole_0056"
FT   CDS_pept        69397..70290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_4010 restriction endonuclease-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78785"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78785.1"
FT                   /translation="MDIIALTDVSWFKFLRKKNREKDFKLINFWTPTGWEPKKINPGDM
FT                   FYLFLKSPYRKVGGYARYVYSFQLTVRDAWNKFGQANGAPNINIMLEQLSAIRGTRIDE
FT                   NTIIGCIMLQDPVFLQDDEFFDSREIGVEIKQAMQKFKYIKGAEIIRPEYTIDKIGNYV
FT                   LNEKVTVEYTLSAHKKRIGQSTFRERLLELYRKCAVTREDYPLVLEAAHIDPYLGENSN
FT                   HLQNGLILRSDVHKLFDANLLTIDTNYRVRLSNILTGTSYERFENKPIELPKNKNYYPS
FT                   EDALKRRMEKLIVLNY"
FT   gene            complement(70413..71135)
FT                   /locus_tag="Kole_0057"
FT   CDS_pept        complement(70413..71135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0057"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: atc:AGR_L_50 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78786"
FT                   /db_xref="GOA:C5CHT0"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHT0"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACR78786.1"
FT                   /translation="MRLCKRLKTPGIFNSYERITRQAQQEGMSYIEFLLEILESEVQSR
FT                   ESRNIVKKIKRAGFPTPKRFEELNEAALPEDARKHLKELKSLKFLSENRNLILLGNSGT
FT                   GKTHLATAIGIKACEEGYNVLFKTAAGLINELKEAKDEKQLVRYAKQFKKLDLVIIDEL
FT                   GYISFDIEGAELLFQYLAMRYETKSTLITTNLVFSEWIKIFHDKALTMALLDRITHNAV
FT                   ILNMSGRSYRRRDILEDT"
FT   gene            complement(71143..72612)
FT                   /locus_tag="Kole_0058"
FT   CDS_pept        complement(71143..72612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0058"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   gur:Gura_2875 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78787"
FT                   /db_xref="GOA:C5CHH0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHH0"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACR78787.1"
FT                   /translation="MKNVYEVKEIQRLYQEYGSIREVTRLTGISRNTVRKYLRRIEAVK
FT                   LGSAKEVIVRKPVPFKRRTIEPRTVARIEELLDSNKDKPKNLQFTAKKIWQMVVKEGHK
FT                   ISYTSVKRIVRKWKEEHGQRDVYIIQKPDGKRAEFDWGEVELVIAGEKGKYPAAFMVLN
FT                   RSLYRFSRVFERETAQEVIQAHIDFFEEIGGVPQEIFYDNMKVVKDRKNLNKNFVKFAT
FT                   FFGFTPRLCNPYSPQEKGTDEESVGFVRNWVFSERNEFDSLEEANEYLKEKLAELNASP
FT                   VYGRELVPVKALNEEKLNALPTASYNNYRLEERIISRYSLIMLDGNYYSVPEDCPGKRV
FT                   QLKIYPDRIEILKEGKVVAVHKRLRGKGKYAIQIAHYLNTLRKKPGALAGSRAFQALND
FT                   TLKVVFGKYYTTKPREFVQLLELLNDYDEKTFCEKIEELFENGIIPTADIMRNLLQQKP
FT                   IQYETFDYPLKIQIDHGDPSEFDRLVGVHRG"
FT   gene            72722..73309
FT                   /locus_tag="Kole_0059"
FT   CDS_pept        72722..73309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78788"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78788.1"
FT                   /translation="MTTYNKLRALCTSETLCEFVLVRENKMKDIVILRLLGPYKLFGND
FT                   GNSLFNTDISRKNGIYFWTVKYKNGYLIDYIGETGKTFCQRMKEHLIETLGGNYRICDP
FT                   DKLLQGKEKIVWNGLWRKGTRDKIGEFIRKKIGKKNRDRHLFRCLSRVSRKASEKKGLA
FT                   VFQLPSYQGLCYLSAWKCFRDVISYFVAVVYS"
FT   gene            73366..73581
FT                   /locus_tag="Kole_0060"
FT   CDS_pept        73366..73581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0060"
FT                   /product="transposase"
FT                   /note="KEGG: rfe:RF_1071 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78789"
FT                   /db_xref="GOA:C5CHT3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHT3"
FT                   /inference="similar to AA sequence:KEGG:RF_1071"
FT                   /protein_id="ACR78789.1"
FT                   /translation="MIYTTNPIESLNSQLRKVTKNRGVFPNDMALMKLAYLAINNITRK
FT                   WTVRINEWDKILATLMIEFDWVKSYV"
FT   gene            complement(73638..76265)
FT                   /locus_tag="Kole_0061"
FT   CDS_pept        complement(73638..76265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0061"
FT                   /product="Type III site-specific deoxyribonuclease"
FT                   /EC_number="3.1.21.5"
FT                   /note="KEGG: eta:ETA_pET090040 DNA restriction subunit type
FT                   III restriction and modification system; PFAM: type III
FT                   restriction protein res subunit; SMART: DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78790"
FT                   /db_xref="GOA:C5CHT4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHT4"
FT                   /inference="protein motif:PRIAM:3.1.21.5"
FT                   /protein_id="ACR78790.1"
FT                   /translation="MPDNQRLNQEYDILSKMGYLKKDIPKYIEDNLNPRFKLRPYQIEA
FT                   IARFIHYLEENPNRKRPTQLLFNMATGSGKTLLMAANILYLYNKGYRNFLFFVNSTNII
FT                   EKTRDNFLNLLSPKYLFNQRIKFEDKEVVIREVSNFDEANEEDINIIFTTIQGLHSQLN
FT                   LFRENSITFEDLKDKKIVLISDEAHHINAWTRNRLSKTEEMKKTSWEYTVMQILNSNPE
FT                   NILLEYTATIDLENPSIYSKYKDKIIFEYDLKQFRIDGYSKEVKVLQADLENWERMLQA
FT                   VILSQYRRKIAERNGIRLKPVILFKSRSIKESKENYELFRERMDNMSEADIEAIKSNST
FT                   GTVLERVFNYFENEGINVDNLITELKEDFSEEKCILLDSENIDKEKQIRLNTLEDENNE
FT                   IRAIFAVKMLDEGWDVLNLFDIVRLYDTRDGRWTRDGRYIPGNTTIAERQLIGRGARYY
FT                   PFKINEEDDLFKRKFDNQPENPLKILEELYYHSKYNPRYIQELTTALKEYGIMPYEEKE
FT                   IQLRVKPDIKNTEFWKKGFLFVNKKVEADRRGIKTIDDIEIERTYKYILPTGFLREDIV
FT                   LQEETTRRNSFETTTRTFRLGDFGDVVIRKAMAKLDFYRFSNLKRYFPDLNSSKEFIES
FT                   LKKINVDITSSREKLDDLTPDDKLKACLNVLLQLENEILNEYVEYKGTEVFVPIEIKEV
FT                   VKDKQLKINVGDYGDQEYGIPMSNAKHPYLQLNLANKDWYIYDENYGTYEEKSFVKFID
FT                   GVINELRQKYSEVYLLRNANLFKIYRFSDGKAMEPDFVLFLRREDSKEIEQYQLFIETK
FT                   GEHLIKTDQWKEDFLKEIEEKYSINLKATIFGENEKYRLIGLPFYNEGRKNEFINEFKK
FT                   KLGL"
FT   gene            complement(76258..78309)
FT                   /locus_tag="Kole_0062"
FT   CDS_pept        complement(76258..78309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0062"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   hip:CGSHiEE_06790 putative type III
FT                   restriction/modification system modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78791"
FT                   /db_xref="GOA:C5CHT5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002295"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR022221"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHT5"
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /protein_id="ACR78791.1"
FT                   /translation="MTLMEELKELLKEDTRFVDTEGKLLKNKIVEHALKLDKGLIKLLL
FT                   KNKRIKEHFFKDVDGVLVFDKEKFMKFIDNKEFLPDSYTAFKNKIGLANKEGKYLAKSK
FT                   EIVLVWPYKDCVLEGGQEKSDEKRKEIFHNVILAPDEIDRLLEPKVFTNFKRIDKDGEH
FT                   QLDGFRRDDEINRKRGLPEDTITDNLIIKGNNLLVLYSLLKEFRGKVKLIYIDPPYNTG
FT                   SDEFQYNDNFRHSTWLTFMKNRLEVAKELLKDDGAIFVQLDHHEIGYLNVLMDETFGRG
FT                   NKVQIIAIKTASPAGFKVVNPGPIDVTEYILFYARDKKKFNFKLQYVEVEYHENYDRVI
FT                   LNFEDKPENWKLESIKKVVLEENGIPVTGSLRKAYKEAQRRWGKYWKIIFNQLIAEFAL
FT                   RNKERIVSIRDPHKPSESLKQLLIKSKKERDRIFVYGREGADPIFVINGGALAFYKNKV
FT                   KNIGGREVPTELLTDFWGDISWAGIANEGGVRLKEGKKPEALLKRIIELSTEENDIVLD
FT                   FFMGTGTTCAVAHKMGRQYIGVEQLDYGENSAVVRLKNVINGDQTGISKAVGWQGGGDF
FT                   IYMGLMKNNEIYIEKIENAKTTEELLNIWKDINHNGFLSYRVDSKLFDENIEEFKALSL
FT                   DEQKKLLLEMLEYNDLYVNYSEIDDVIYNVSEEDKKLNKDFYEERKDA"
FT   gene            complement(78311..78526)
FT                   /locus_tag="Kole_0063"
FT   CDS_pept        complement(78311..78526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0063"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: vvy:VV2209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78792"
FT                   /db_xref="GOA:C5CHT6"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHT6"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACR78792.1"
FT                   /translation="MPDNQRLNQEYDILSKKEVAAYLRLDEHTAYRMARKGEIPAYKVA
FT                   GQWRFKKMMIEEWLEQNLKYEKQGGQ"
FT   gene            complement(78519..78959)
FT                   /locus_tag="Kole_0064"
FT   CDS_pept        complement(78519..78959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0064"
FT                   /product="DNA recognition and methylase subunit Mod"
FT                   /note="KEGG: eta:ETA_pET090030 DNA recognition and
FT                   methylase subunit Mod"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78793"
FT                   /db_xref="GOA:C5CHT7"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHT7"
FT                   /inference="similar to AA sequence:KEGG:ETA_pET090030"
FT                   /protein_id="ACR78793.1"
FT                   /translation="MVEQLDEHMEMQVGRLKNVINGEQTGISKDVGWQGGGDFIYMELM
FT                   KLNEGFIQKIEDANTMEELLNIWDEMKQHSFLSYRVDPKLFDENIEEFKALSLDEQKKL
FT                   LLEMLEYNDLYVNYSEIDDVIYNVSEEDKKLNKDFYEERKDA"
FT   gene            complement(79272..79994)
FT                   /locus_tag="Kole_0065"
FT   CDS_pept        complement(79272..79994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0065"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: bha:BH3999 transposase (26)"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78794"
FT                   /db_xref="GOA:C5CHT8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHT8"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACR78794.1"
FT                   /translation="MKELIAQYCKELRLGKSIVENYQKIQTETNEEFLVKLLKLEIENR
FT                   RVSRKNRYLKQANFEVMKTFEDYSFENVQIPKSITLEELQEGRFLGKKENLILYGPVGT
FT                   GKTHMATAIGIAACNREKKVRFYRTATLVNELVEAKSNGTLKRFLKTLRKTDLLICDEW
FT                   GYIPLDREGAQLLFQVIAERYERNSVIITTNLEFSKWNGIFYDEKLTSAIIDRLIHHCH
FT                   LLVFTGKSYRLEHSSIKA"
FT   gene            complement(80025..81101)
FT                   /locus_tag="Kole_0066"
FT   CDS_pept        complement(80025..81101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0066"
FT                   /product="transposase (25)"
FT                   /note="KEGG: bha:BH3998 transposase (25)"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78795"
FT                   /db_xref="GOA:C5CHT9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHT9"
FT                   /inference="similar to AA sequence:KEGG:BH3998"
FT                   /protein_id="ACR78795.1"
FT                   /translation="MIQVHHIKYLREFEGKSLRSIANETGHDFRTVKKYDEMDDLNEHV
FT                   QRRKKTSKLDPYKPKIDEWLEEDKKVKAKQRHTARRIYKRLCEEYPNFPLSERTVRAYV
FT                   RKKKKELYSNEGYLPLDHPGGEAQADFGQAEFIEKGKGTTLHYLNLSFPYSNGGYFQLF
FT                   RGENLECLLEGLKNIFEHIGKVPRRIWFDNLSPVVKKILDGGEREVTEKFYRFCLHYGF
FT                   EPVFCNPGCGNEKGNVENKVGYNRRNFFVPIPRIENLEDYNKELLILSEKDMERPHYRK
FT                   EKSIKELFLEEKKKMLLLNEKPLDISRVQKAKTDKYGMLRFENNRYSVSPKHAETEVWL
FT                   KIGARERSTEITSVRNRF"
FT   gene            81157..81582
FT                   /locus_tag="Kole_0067"
FT   CDS_pept        81157..81582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cje:Cj1602 conserved hypothetical protein
FT                   Cj1602"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78796"
FT                   /db_xref="GOA:C5CHU0"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHU0"
FT                   /inference="protein motif:COG:COG2958"
FT                   /protein_id="ACR78796.1"
FT                   /translation="MDFPGAGNDLFLFLTAGFLSCHLLYFYFAIHTKKILEEEKRPLTV
FT                   EEIWENAVEKGYDKLCGSQGKTPWRTIGAQIYVDIRDNPDSPFVKIDSKPRKFFLRTVV
FT                   SDAELKEIEERERGKVEAPRKLKYSERELHPFLAYFA"
FT   gene            complement(81975..82241)
FT                   /locus_tag="Kole_0068"
FT   CDS_pept        complement(81975..82241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78797"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78797.1"
FT                   /translation="MPENCMCFFSLGFLIYTIGPQKKSLSPIFSILHPESTSRPIGHIT
FT                   LGTKQTGKPYAGKPHVRFDVAGDGNLGTAILVRHSRRKRGETG"
FT   gene            82512..83846
FT                   /locus_tag="Kole_0069"
FT   CDS_pept        82512..83846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0069"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: sat:SYN_01506 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78798"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHU2"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACR78798.1"
FT                   /translation="MMNDEEFFEVLLRWNLWGNQQLNIIPRRVLSQIKPFMDYHGAIVI
FT                   QGPRRAGKSTLLYLIIQNLMKEIAPERCLYINFEDYALSSLELTPSTIQRLLEVYGEKV
FT                   YSGEDFFLFLDEVQNVKDWHRWVRTFLDTHHNNTVFISGSSSRLLSSELAGLLTGRHVV
FT                   FETLPFSFSELVINQGYSTDSIYIRKNKNAIKGLLAEYMRFGGFPEVVLRRPINESRAR
FT                   RILTQYAEDILFKDISTHYNVLNMKILKFVSLFLAQNSGCKLSIRGLQKVIEAEFGEKS
FT                   STTTIANYIQYLEEAYMSFEVRHFDYSIMRAIRRPSKYYMVDTGLRNAMCGSLTPDRGK
FT                   LLEYVVYLYLRTIYDDVFYWSGKREIDFVCREGKEIDLYNITYVSDVNEISVRELEGFL
FT                   EFPSGKAVRKRYLITWDLQRTITHKNITIEAIPAYVLLLQKSENW"
FT   gene            complement(84166..85065)
FT                   /pseudo
FT                   /locus_tag="Kole_0070"
FT   gene            complement(85101..85502)
FT                   /locus_tag="Kole_0071"
FT   CDS_pept        complement(85101..85502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0071"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   pst:PSPTO_5508 ISPsy8, transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78799"
FT                   /db_xref="GOA:C5CHU3"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHU3"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACR78799.1"
FT                   /translation="MKGKTPRRYSSEFKIKLVKEYLGTNKSYRELGVEYDVDASLIMSW
FT                   VKRYERYKENAFQPPKRKPSFIADESKIPAFLKEELGLDKIKEHSDDPEEINAELERLK
FT                   LELAERDLRIRILKEKLKKTNMEENQGKK"
FT   gene            85578..85769
FT                   /locus_tag="Kole_0072"
FT   CDS_pept        85578..85769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78800"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHU4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78800.1"
FT                   /translation="MLKKVYAQPTTYNEKLRSENREKETVKARTRELLCSWHTLSVVKT
FT                   RKSSDVGLRWKRHNGNKR"
FT   gene            complement(85901..87112)
FT                   /locus_tag="Kole_0073"
FT   CDS_pept        complement(85901..87112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_1480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78801"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHU5"
FT                   /inference="similar to AA sequence:KEGG:Abu_1480"
FT                   /protein_id="ACR78801.1"
FT                   /translation="MISLDVYFEIQDRLLKAVPTEFRRYLYTTINWDARMIGLTGFRGI
FT                   GKTTLLLQWLANESKGSSEYLYISADNPLVLKDGLYNIGDTFFKYGGKLLVVDEAHRYP
FT                   GWSSELKALYDAFPNKKIIFTGSSTMEILRGKADLSRRAVIYNLNILSFREYLQIRTGD
FT                   RIESVKLDELLINHRKISASLLHYEPLKFFSEYLQQGAYPYFVEGDYYNKVLNTLDKVI
FT                   YDDIMGVSGIKPEGAATIKRLIAFLTTSTVPKISAEKLCNALGITKPTLYNYLDLMEHV
FT                   RLITRVPPEKIGHKFLRSGAKVFLSNPNIYYALSRPIWSLEANTGTIREAFFASQFFSY
FT                   SIAVPDVGDFSIRFNGKRIVFEIGGPGKTLQQIKNEKNAFVLKDGIESGYSQVIPLYLI
FT                   GMMY"
FT   gene            88310..89644
FT                   /locus_tag="Kole_0074"
FT   CDS_pept        88310..89644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0074"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: sat:SYN_01506 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78802"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHU6"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACR78802.1"
FT                   /translation="MMNDEEFFEVLLRWNLWGNQQLNIIPRRVLSQIKPFMDYHGAIVI
FT                   QGPRRAGKSTLLYLIIQNLMKEIAPERCLYINFEDYTLSSLELTPSTIQRLLEVYGEKV
FT                   YSGEDFFLFLDEVQNVKDWHRWVRTFLDTHHNNTVFISGSSSKLLSSELAGLLTGRHVV
FT                   FETLPFSFSELVINQGYSTDSIYIRKNKNAIKGLLAEYMRFGGFPEVVLRRPINESRAR
FT                   RILTQYAEDILFKDISTHYNVLNMKLLKFVSLFLAQNSGCKLSIRGLQKVIEAEFGEKS
FT                   STTTIANYIQYLGEAYMSFEVRHFDYSIKRAIRRPSKYYMVDTGLRNAMCGSLTPDRGK
FT                   LLENVVYLYLRTIYDDVFYWSGKREIDFVCREGKEIDLYNITYVSDVNEISVRELEGFL
FT                   EFPSGKAVRKRYLITWDLQRTITHKNITIEAIPAYVLLLQKSENW"
FT   gene            90329..90442
FT                   /locus_tag="Kole_0075"
FT   CDS_pept        90329..90442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78803"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHU7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78803.1"
FT                   /translation="MSDGGNRNRKGLLLAKGGRIEEMAQRKASITGARNGG"
FT   gene            90600..90776
FT                   /locus_tag="Kole_0076"
FT   CDS_pept        90600..90776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78804"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78804.1"
FT                   /translation="MVFYHRRRIRYSIHEPCTLARTHGSVRGRGGSPLLLDPDFVRGVH
FT                   SFGVGKNCHSENL"
FT   gene            91104..91520
FT                   /locus_tag="Kole_0077"
FT   CDS_pept        91104..91520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78805"
FT                   /db_xref="GOA:C5CHU9"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHU9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78805.1"
FT                   /translation="MKLEKKGPSRLLLIARIWSVVVIAIGVFIFAGYIANFFTTGVTDP
FT                   YAAENYPFIENIPPFFSFICIIGLALAWKWKLIGGWIAIIFSAANYVIFFIHWPLTENI
FT                   NFLYAPYGINTLLLVPGILFVLYWRKAHKLQNNL"
FT   gene            complement(91571..92653)
FT                   /locus_tag="Kole_0078"
FT   CDS_pept        complement(91571..92653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: AGAP004514-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78806"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78806.1"
FT                   /translation="MVDYMRMAELFVDHIKREYPDDISIVAYYGSYAQGTQNHNSDFDL
FT                   FFIPATERGFELSDCIILDGIGIDFFSISWDRAERIANFNENIVSVIADCKLLYVRSEE
FT                   DKERLESLQDIIRSYQTPKKRKAMLDKAERVFNDTYRILHYLRNSKDISEQRTEVFHAL
FT                   THILQSVALINQTYLKSGWGKNFKQVFSLPLQPEDLEKLVYQAINAKSKKEMLEALEKL
FT                   CDRTAGLLKKEKEKFRSKNSFESVFKDFYEELRSTFLKIETACDNNQPEIAFCASAMLQ
FT                   DEVKYCLNKIGDRNIIERFSKLEPLRAFDPLNLKPLKSAAVRYEKELVELLGENNVPIT
FT                   RMDNLEEYRNYLKQRKYLVE"
FT   gene            complement(92897..94258)
FT                   /locus_tag="Kole_0079"
FT   CDS_pept        complement(92897..94258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0079"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: cbd:CBUD_1375 hypothetical
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78807"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHV1"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACR78807.1"
FT                   /translation="MDLSLLSIYNPWWDLSKNASEIKNKILKNYVQASFKRNYSGFFDF
FT                   ESNGLYILRGPRQIGKSTLLKIAISKLIEKGERRSILYIPLDTVKDFKVLRDILLDFLK
FT                   FSKSEKKRYIFLDEISMVEDWQKAIKELRDNTDFADDFFVLTGSSAWDIKRTSERLPGR
FT                   KGNVKSDVLLLPMMFSEFFENIERKKSPKYDVNEIISLGKDDEYELRLISKDTEILFEQ
FT                   YLNSGGIPAVIEAALSGGGDLENHYDTLWDILLGDIERQGLSRSKLLDVLGFTSSRLSQ
FT                   RFSWKSAASEVEIDTKTFQKYINALAYNFMCAVLKFLDKDTLSPRERKQKKVYFYDVFL
FT                   LYTLRQKLGITNDKASLIENIVGTHLLYRYGKNLENGLTDFLGVGYWYSKEGKEIDFLV
FT                   NGIPIELKYQNKINADDLRTIKRVFGKGILLSKKTLDLSGEIKIIPVSLFLYMI"
FT   gene            94791..95756
FT                   /locus_tag="Kole_0080"
FT   CDS_pept        94791..95756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0080"
FT                   /product="protein of unknown function DUF534"
FT                   /note="PFAM: protein of unknown function DUF534; KEGG:
FT                   hch:HCH_04501 ABC-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78808"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHV3"
FT                   /inference="protein motif:PFAM:PF04392"
FT                   /protein_id="ACR78808.1"
FT                   /translation="MKRFITVVVILLSIVGFGVVKIGVTQIVDHPALDAVVKGMISFLE
FT                   ESGFEVGKDIVLDRQSAQGSVQNAVAIAKKFASEDIDIVVAVTTPSAQACAQAITDRPV
FT                   VFSAVTDPVGAGLIKQFGKNEGNIVGISDMVPVATHLKLIRMVFPEAKKVGVIYNPGEA
FT                   NSVTLTEIAKSAAPSLGFTIVDIPGTTPNEMITALNSIGPSVDVIYVGTDNTVASSIQA
FT                   IGSAAIKLKKPIVAADISIARGGGIIGFGFNYFQVGIETGRIVLALLKGAKPSEIESRI
FT                   LGPDSLELFVNLDLAKALGVEIPKELVERADIVVENGVER"
FT   gene            95762..96721
FT                   /locus_tag="Kole_0081"
FT   CDS_pept        95762..96721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0081"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   atc:AGR_C_4842 probable ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78809"
FT                   /db_xref="GOA:C5CHV4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHV4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACR78809.1"
FT                   /translation="MISIFEQGLLLSIAAMGVYISFRIVDLPDLTPDGSYVLGGAVAVA
FT                   LLRSGHWWVHSLILAVIASALAGVVTAFITTRFRVNSLLASIMVMTGLYSVNIRVMKAP
FT                   NLPIPRIDTGAVMNYEQMAGKTPLDDLLGSTVASYQGSGAKAISIPFNGISDGRDLFII
FT                   TLFAVGALLLMWVFLKTEFGIMFRGYGRNRFAVKTLGMNPNLFAYVGLALGNAFAGLSG
FT                   GLFSMYSGFADVNMGLGIVVICLASVILGEILLGKFGWMYGMLCPLFGALAYQLLLTVA
FT                   MKYGYKVGFKPTDMKLLTAVFVVVVIALRRFKKSEVTT"
FT   gene            96718..97467
FT                   /locus_tag="Kole_0082"
FT   CDS_pept        96718..97467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0082"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMC domain protein;
FT                   SMART: AAA ATPase; KEGG: bxe:Bxe_C1111 ABC transporter,
FT                   ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78810"
FT                   /db_xref="GOA:C5CHV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHV5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACR78810.1"
FT                   /translation="MISVKNVEVVYNRGTLDEKTALKGVSMKILPGEFVIIVGSNGAGK
FT                   STLLKVITGEIKPLRGSCEIMGSPVRANQIFRKASIVCQDPNTGVFPNLTIEENLILAR
FT                   RKGSRGLTFGRIDKKSIELLKSTKLGLESDLKRKASKLSGGQKQALALVMAVSSDPELL
FT                   LLDEHTAALDPRSTETIMELTERINKELGTTVVMITHDMAIAENYGERVIVMEDGKVSA
FT                   IIDKTTRKVAASELKAMIGTAALLAAD"
FT   gene            99173..99412
FT                   /locus_tag="Kole_0083"
FT   CDS_pept        99173..99412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0083"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: atc:AGR_C_418
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78811"
FT                   /db_xref="GOA:C5CHV6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHV6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACR78811.1"
FT                   /translation="MMKLKEIRIKRGMTQEELAEKAKISRATLSKIENGKVKLTDFFLA
FT                   DTIAAILGVPVEVLVPEFLEKRHSPLFRKEDAKL"
FT   gene            99409..99702
FT                   /locus_tag="Kole_0084"
FT   CDS_pept        99409..99702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0084"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78812"
FT                   /db_xref="GOA:C5CHV7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHV7"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACR78812.1"
FT                   /translation="MNLLVYSRLQFSLTQKELGRLIGKDSKYISAVERERIKPPFYVSD
FT                   NIAYVLKMPVEVLFPNYVRRSRLPNWKELMYLRSLGYNIEVYRELVSTLTQG"
FT   gene            complement(99880..100740)
FT                   /locus_tag="Kole_0085"
FT   CDS_pept        complement(99880..100740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0085"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: tgr:Tgr7_2706
FT                   D-amino-acid transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78813"
FT                   /db_xref="GOA:C5CHV8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHV8"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACR78813.1"
FT                   /translation="MKAFLNGKFVEKNEKLITLENRGLTFGDGLFEVLRVKDGHIFFFE
FT                   DHLLRMKSSASFFGIPFPYSLDEIKNRAHELISLNRINDGELYIELTRGVDTNREHRYP
FT                   PRSTQTTFFMLAIPLREINPENWKRGAAVFSFPDLRHKLCEHKTINLLPNVMAKNFAYE
FT                   RGGYEALMYRENSKGKYITEGGSSNYFLVKNCTVITPEIDNILPGITRSKVIKLLKESG
FT                   IEVVERRVYLEEFLSADEVFLVSTVSMVMPVRRIDDREFKAPGEITLKAMELYRDFMDK
FT                   EKERY"
FT   gene            complement(100737..101081)
FT                   /locus_tag="Kole_0086"
FT   CDS_pept        complement(100737..101081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0086"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppr:PBPRB1691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78814"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHV9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78814.1"
FT                   /translation="MPFKSLFLSGAPDANPEKDKALVKTELAELEVVLVKHSEFSKILD
FT                   ICKDFADRGGNAIILCPGFTHEQVAKISETVGESVSVNVARGDGKSAVAARRAMERAGW
FT                   FNQKGSGQNQ"
FT   gene            complement(101153..101956)
FT                   /locus_tag="Kole_0087"
FT   CDS_pept        complement(101153..101956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0087"
FT                   /product="phosphodiesterase, MJ0936 family"
FT                   /note="TIGRFAM: phosphodiesterase, MJ0936 family; PFAM:
FT                   metallophosphoesterase; KEGG: afw:Anae109_3653
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78815"
FT                   /db_xref="GOA:C5CHW0"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHW0"
FT                   /inference="protein motif:TFAM:TIGR00040"
FT                   /protein_id="ACR78815.1"
FT                   /translation="MKLAFISDIHGNLEALEAVLEDIKRREVDRIYCLGDLVGYGPDPE
FT                   KVVQKIKVLGISTVMGNYDDAIAHEKKSCGCAYNPGRETEVGNITLNWSIANTSQESKE
FT                   FLKSLPHKLNFEAEEVRFLLVHGSPLDNLLEYIKPDTPVERLKEITEGISADVIVNGHT
FT                   HLPMVRWINGKLIFNAGSVGRPKDGDPRACYLIVNVNKGSLKHEFVRISYPVKITVEKL
FT                   AKYKLPMELATVLALGTTFNMGKSDKTEKRSKIDTDITLDPGIRE"
FT   gene            102411..103001
FT                   /locus_tag="Kole_0088"
FT   CDS_pept        102411..103001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0088"
FT                   /product="plasmid pRiA4b ORF-3 family protein"
FT                   /note="PFAM: plasmid pRiA4b ORF-3 family protein; KEGG:
FT                   afw:Anae109_1544 plasmid pRiA4b ORF-3 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78816"
FT                   /db_xref="InterPro:IPR012912"
FT                   /db_xref="InterPro:IPR024047"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHW1"
FT                   /inference="protein motif:PFAM:PF07929"
FT                   /protein_id="ACR78816.1"
FT                   /translation="MKKKFNRVYQFKITLKGIKPPIWRRIQVPETYTFWDLHVAIQDAM
FT                   GWLDYHLHEFEIINPSTGLKVNIGIPDEDFGRDVLPGWKQKIADYFSMENPKANYTYDF
FT                   GDNWEHKIELEKILPREKGVTYPVCIKGKRACPPEDCGGVWGYEELLEAIKDPAHERHE
FT                   ELLEWLGEDFDPEHFDVNEVSFDDPNKRLKNIF"
FT   gene            103140..104168
FT                   /locus_tag="Kole_0089"
FT   CDS_pept        103140..104168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78817"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHW2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78817.1"
FT                   /translation="MVRKLTFLLIFVIFSSISICQIPSLSNIPQLFKGKYPIPSWIKPG
FT                   LVTVYEMEGGTRTLPTGQESSAFYGKGYAVFIVTQVENNLIYGLTLFAYDYPGIMVTPP
FT                   NPMILYGSIYVDPRDIQEILSQREEYERQGIIVKGGQYGEGIRWVNITYKSTSYTIFIS
FT                   EDGKAQKFLFSEKQENGSSVINMQLMGLFYTNCPEIEDFPEAARENHSYEIYSYDPFYT
FT                   GLTTPAGRETIEFQNIQKPIASYRLSYYTADMMVPISQTINGLPLLGPHYIHPELLNKD
FT                   TILEIPEINLSWVNEGEDGEIDSIIYFNGQESLRINCDQRGLVTRMQYPFSGFIIITQL
FT                   ER"
FT   sig_peptide     103140..103220
FT                   /locus_tag="Kole_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.761) with cleavage site probability 0.681 at
FT                   residue 27"
FT   gene            104385..105008
FT                   /locus_tag="Kole_0090"
FT   CDS_pept        104385..105008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0090"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: baa:BA_0933
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78818"
FT                   /db_xref="GOA:C5CHW3"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHW3"
FT                   /inference="protein motif:PFAM:PF04199"
FT                   /protein_id="ACR78818.1"
FT                   /translation="MPKFIDLTRIIEDGMAVYPGDDETILRQSRQLDKDGYNNHRLEIS
FT                   MHSGTHIDGPMHMTNCEKLILDFPLETLIGEGVVLDVRDQEVIELKEEYKSAIKEGSIL
FT                   LLYTGRDKIFGTKEYFLNNPVVSKEFAEFLVERRIKILGLDSSSPDRYPFEIHKILFAG
FT                   GVLIAENLTNLDKLLCVDTFEVIALPLRIKADSSIARVIARVMG"
FT   gene            105188..105706
FT                   /locus_tag="Kole_0091"
FT   CDS_pept        105188..105706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0091"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: sat:SYN_02123 ferric-chelate reductase / rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78819"
FT                   /db_xref="GOA:C5CHW4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHW4"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACR78819.1"
FT                   /translation="MDYEALFKVTYGMYVITSKTNEKKNGQIANVVFQVVAEPPTIAIC
FT                   INKQNLTHDFIQESRVFGVSVLSQDTPLKLIGHFGFRSGRELDKFKEINHKIGVTGVPL
FT                   LEDYCIANLEAKVVNVVDVGTHVLYIGEIVNAEVVDEKEPMTYAYYHEIKGGRSPKTAP
FT                   TYADGGSQR"
FT   gene            106424..107710
FT                   /locus_tag="Kole_0092"
FT   CDS_pept        106424..107710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0092"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: argininosuccinate synthase ; K01940
FT                   argininosuccinate synthase; TIGRFAM: argininosuccinate
FT                   synthase; PFAM: argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78820"
FT                   /db_xref="GOA:C5CHW5"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHW5"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ACR78820.1"
FT                   /translation="MKKEKVILAYSGGLDTSVILKWLSEKGFEVIAFVANVGQRDDFDA
FT                   IKEKALKTGAKKVYVEDLRKEFVTDFIFPALMGNAIYEGRYLLGTSLARPLIAKKQVEI
FT                   AEKEGAQYVAHGATGKGNDQVRFELNYAALNPHLKIISPWKDPEFLEKFKGRTDLINYA
FT                   KEMGIPITVSEEKPYSEDENLMHISHEAGKLEDPMYIPEEHIFNWTVSPKDAPDEETLL
FT                   EILFKNGIPTKVVNLDDGTEKTDPLELFEYLNEVGAKNGVGRVDMIENRFIGIKSRGVY
FT                   ETPGATILWIAHRDLEGIAMDKEVLHLRDMLTPKFSELIYNGFWFSPEIDFLLSAFKKA
FT                   QEAVDGKVVVSIYKGNVTPVSRYSPTSLYDQALSSMDVEGGFNAIDSKGFINIHALRLK
FT                   AHNLVLKGKDPFAWRKEIGNVYKTLGKGI"
FT   gene            107679..108875
FT                   /locus_tag="Kole_0093"
FT   CDS_pept        107679..108875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0093"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: fph:Fphi_0553 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78821"
FT                   /db_xref="GOA:C5CHW6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHW6"
FT                   /inference="protein motif:TFAM:TIGR00838"
FT                   /protein_id="ACR78821.1"
FT                   /translation="MSIKLWEKGYEVDPIIEAFTIGNDYKTDMRLIKYDIKASMAHAEM
FT                   LCKMGYLSRKELKEIKKALEELLALVNNGKFVIKPEDEDCHTAIENFLTQKIGEAGKKI
FT                   HTARSRNDQVLTALRLFYKDELENIVQLIKLLQKAIEDFSTKYGHVQFAGFTHTRKAMP
FT                   TDFKTWSEALYDSLEDDLKLLKTAYEIIDQSPLGTGAGYGIPIEIDREYTANELAFSRI
FT                   QKNPIYSQNSRGKFDYLILHVLSQISYDLNRVSSDIIFFSLPEVGYMDLPKELCTGSSI
FT                   MPQKLNPDPLELVRGYHNRIVSRMMESVITSSNLISGYHRDFQLLKESVIECFDVAKTL
FT                   LKVMKIVFERLSVNKENCEKSITEEVLATQKVYEMVKKGTPFRDAYRKIAQSYGGEKK"
FT   gene            108872..109891
FT                   /locus_tag="Kole_0094"
FT   CDS_pept        108872..109891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0094"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: gme:Gmet_0608
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; TIGRFAM:
FT                   N-acetyl-gamma-glutamyl-phosphate reductase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78822"
FT                   /db_xref="GOA:C5CHW7"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CHW7"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ACR78822.1"
FT                   /translation="MIRVGIIGATGYTGLELVRILTNHPDVKITFLSSRSFAGKKLNDV
FT                   YPFSLKNETLEEIDPEKISKNCDVVFTALPAGVSYEIARKLKDVRIIDLGADFRFDDPA
FT                   VYEEWYSKKLPDYDPTERVYGLTELYREKIKNARFVGNPGCYPTSVLLATAPLLKNGSL
FT                   DEETIIVDSKSGVSGAGKKESIDYSFSELSGSLKAYNVSKHRHVPEMEQEMSKLCGKRL
FT                   KLVFTPHLVPMVRGILSTIYVKTDLSLDEVYELYREYYGKEKFIHVLQPGVYPSTKWTY
FT                   GSNHAFISMAKDDRTDTLILISVIDNLVKGASGQAVQNMNVMFSLAEDAGLSFNPIYP"
FT   gene            109907..111100
FT                   /locus_tag="Kole_0095"
FT   CDS_pept        109907..111100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0095"
FT                   /product="arginine biosynthesis bifunctional protein ArgJ"
FT                   /EC_number="2.3.1.1"
FT                   /note="KEGG: bsu:BSU11200 bifunctional ornithine
FT                   acetyltransferase/N-acetylglutamate synthase protein;
FT                   TIGRFAM: arginine biosynthesis bifunctional protein ArgJ;
FT                   PFAM: arginine biosynthesis protein ArgJ"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78823"
FT                   /db_xref="GOA:C5CHW8"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHW8"
FT                   /inference="protein motif:TFAM:TIGR00120"
FT                   /protein_id="ACR78823.1"
FT                   /translation="MNIPKGFKFVGLHCGIKRKRKDLGIIYSEKPCIAAGVFTTNVVKA
FT                   APVVYNMEVLEKSFKNIRAIVVNSGVANACTGEQGMKNTIKMAEKTAKELGIPVDSVLV
FT                   SSTGLIGVQLPMEKIESGIEEAAKNLAEDPLPFAEAIMTTDTVTKTSSVRVEINGKEVN
FT                   VLGVAKGSGMIHPNMATMLSFILTDAQITPEALKKLLKASVDKTYNMIDVDGDTSTNDM
FT                   VLILANGLSDALEIHEGTEEFQKFSEAIDIVNTELAKKIVEDGEGATKLMEVKVINAPN
FT                   VNVAKKVALSVVSSNLVKTAIYGEDANWGRVFAAAGYSGAMFDHSRLDLYIESEKNRIM
FT                   VAKDGCEYPFDEIEAKEILSSKYVRLILDMKQGNGEATAWGSDLTEKYVEINGRYRT"
FT   gene            111097..111945
FT                   /locus_tag="Kole_0096"
FT   CDS_pept        111097..111945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0096"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: net:Neut_2384 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78824"
FT                   /db_xref="GOA:C5CHW9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CHW9"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACR78824.1"
FT                   /translation="MKRETVQVLLEALPYIKEFHGKTFVIKFGGSAMKNENAKEAFIKD
FT                   LVLLKYTGINPVIVHGGGSEISSLMNQLGIEPVFKNGYRITDEKTMEIVEMVLVGKVNK
FT                   DIVMNINLHGGKAIGVCGKDGELLLAEKETKYGDIGYVGKVKKVDTTLIKGLLVEGYIP
FT                   VIAPIGFGEDGTSYNINADIVAAEIAKSLEVEKLVLLTDVDGVFKDGKLLPILSSKEAE
FT                   DLIEKNIVKGGMIPKLQCAISAVNSGVKSVHIINGGVEHALLLEIFSKEGIGTMIKNLE
FT                   V"
FT   gene            111948..113147
FT                   /locus_tag="Kole_0097"
FT   CDS_pept        111948..113147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0097"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="KEGG: sat:SYN_02155 acetylornithine
FT                   aminotransferase; TIGRFAM: acetylornithine and
FT                   succinylornithine aminotransferase; PFAM: aminotransferase
FT                   class-III; aminotransferase class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78825"
FT                   /db_xref="GOA:C5CHX0"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHX0"
FT                   /inference="protein motif:TFAM:TIGR00707"
FT                   /protein_id="ACR78825.1"
FT                   /translation="MNGMNYLMNTYNRFPVVFDHGEGARIWDKNGKSYLDFTSGIAVNV
FT                   LGHSHPKLVETIKTQAEKLIHCSNLYWTEPQIELAKLLGENTLKGKVFFVNSGTEANET
FT                   AIKIARKYGKKKDKNKYKILSAHDSFHGRTLGSLTATGQPKYQEDFKPLVDGFDYFEFN
FT                   NIDSLKQKISNEVCAVILEPVQGESGIIPATKDFLEAVRKLCNEYETLLIFDEVQCGMG
FT                   RTGKLFAYQRYGVDPDILTVAKGLGGGVPIGAVVVNKKADILEPGDHGSTFGGNPLACS
FT                   AGVTVMREILENNLLEQVEKLGIYLKKKLENLKEKFPEHVKETRGIGLMLGMELKEISA
FT                   KDFAKKCFEKGLLLVPAGNNTVRFLPPFVITEDDIDQALEIVKECFSEFENRESRSETR
FT                   "
FT   gene            113672..115282
FT                   /locus_tag="Kole_0098"
FT   CDS_pept        113672..115282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0098"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: sse:Ssed_3778 response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78826"
FT                   /db_xref="GOA:C5CHX1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHX1"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACR78826.1"
FT                   /translation="MRKFIKHNGAFLLIVIILTTLFWIVVHRGENQIYEKEAKWQYEST
FT                   ISQLLTAEEIIRVQFHDFERVLFLLKSIPNTRSYVNTNFESVSYKNKVKEIFFELAKVF
FT                   KHFYKIRIIDSSGQEIIKVARGSDGTAIIAPGSQLQNKRNRYYFQEAMKMDENQIYVSP
FT                   IDLNIENGKIEMPYTPVIRLATPLFDSKGEKRGILVLSVEFSKVLELLPKNVFIQTEDG
FT                   YLISSNSDKSVNFRKSDYNFPDDSGHIELSDIETIHYSTVDFLPGNRLIVASYHKHPTS
FT                   KAALQNLTLISMLIFILFLVLMFAGVYLDFSKSRDLLGAQKAIMSSLATLAERRDTETG
FT                   RHLKRTREYAVILTKQLRKNKKYRKIITNEFIENLYDTAPLHDMGKVGIRDSILLKEGK
FT                   LTKEEYEEIKKHTIIGKQIIQDVIGRYRLKGSYIIMARNICAYHHEKHNGEGYPEGLKG
FT                   EKIPLEARIFALCDAYDAIRSKRPYKDELPHEEAIRRIKADRGKHFDPDIVDAFLECEK
FT                   EFERVYETYKYDQGIGFVI"
FT   gene            115908..116315
FT                   /locus_tag="Kole_0099"
FT   CDS_pept        115908..116315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0099"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: sat:SYN_02123 ferric-chelate reductase / rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78827"
FT                   /db_xref="GOA:C5CHX2"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHX2"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACR78827.1"
FT                   /translation="MDYEAMFKITYGMYVVTSETNGKKNGQIANVVFQVVAEPPTIAIC
FT                   INKQNLTHDFIQKSKVFGVSVLSQDTPLKLIGHFGFKSGRELDKFNDINHKIGVTGVPL
FT                   LEDHCVANLEAKVVNAVDVGTHVVGYVKKVL"
FT   gene            complement(116341..117465)
FT                   /locus_tag="Kole_0100"
FT   CDS_pept        complement(116341..117465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0100"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: sun:SUN_2453
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78828"
FT                   /db_xref="GOA:C5CHX3"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHX3"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ACR78828.1"
FT                   /translation="MEIKDIILQFLTENEEGMRNLLTWFLNTVMEYEARIQAGADYYER
FT                   TKNRRAHRNGYRKRSLNTRLGKLELKKPQFREFPFETRVFDKYSRVEKALKNAIVESYL
FT                   QGVSTRRIKEIISTLGAEELSPGTVSNIARELDEKVYEFLNREIEEEIPYLFVDASYFK
FT                   VRDGVRYVNKALYVVAGVRKDGHREILGAKIADVEDELFWEDFFQELKNRGLRGVELVI
FT                   SDGHKGIISAVKKAFIGASWQMCHVHFVRDVLKKVPRKRWKEIAERLNESLESAKKLQA
FT                   FIEELEEEGFKKAAETCERFIFGLFNYQKYPRDHWKRIKTTNMLERINKELKRRTRVVG
FT                   AFPNDAALLRLAVAILLDINEEWLLGRRYLNMGS"
FT   gene            117562..117873
FT                   /locus_tag="Kole_0101"
FT   CDS_pept        117562..117873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0101"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   sat:SYN_02123 ferric-chelate reductase / rubredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78829"
FT                   /db_xref="GOA:C5CHX4"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHX4"
FT                   /inference="protein motif:PFAM:PF00301"
FT                   /protein_id="ACR78829.1"
FT                   /translation="MVYIGEIVHAEVVDEKEPMTYAYYHEIRGGKSPKTAPTYVEERKE
FT                   NKDSGKKKYRCKVCGYIYDPKNGDPDSGVAPGTPFEELPDNWVCPVCGVGKDKFEEVR"
FT   gene            complement(117934..119034)
FT                   /locus_tag="Kole_0102"
FT   CDS_pept        complement(117934..119034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0102"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: hdu:HD0892
FT                   acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78830"
FT                   /db_xref="GOA:C5CHX5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHX5"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACR78830.1"
FT                   /translation="MLCKVYTPYEFKVEKARGIEIFTDKGVFLDTYSGIGVLALGHSNP
FT                   EVLTAMKKKLERYTHLSNYFLDEDAEEVAARLVGLSGQVGEVFFTNSGTEATEAALKAI
FT                   KKLRKGKIVSFVGNFHGRTIGALSLTYGKAIREPFEPLLTERVFLKPDPEKFTSFAREN
FT                   QIAGVFIECIQGNSGVLPLSEELLETISQYQREQGFILVADEIQSGLGRTGKAFAYQHF
FT                   GLKPDIITVGKALGGGLPLGAALFSGFSPFKFGEHGSTFAPNPVALAAGKIVLSKLDEN
FT                   FLMQVQEKGKYFREKLAELPWVQSVNGYGLMIGVTTENASKVKAEAYNRGVLLNIAGGR
FT                   IRFLPALNITIDEIDEIISRLSFEGF"
FT   gene            complement(119046..120245)
FT                   /locus_tag="Kole_0103"
FT   CDS_pept        complement(119046..120245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0103"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: psa:PST_1370 aspartate kinase; TIGRFAM:
FT                   aspartate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78831"
FT                   /db_xref="GOA:C5CHX6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHX6"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACR78831.1"
FT                   /translation="MLVQKYGGSSVATLERIANVANRIKARVDTGEKIIVVVSAMGETT
FT                   NKLISVAKKISDDPDPRELDMLLATGEQKSAALLSMMLLKMGVKAVSYNAFQLNILTTD
FT                   NHTDARIMDMNLEKVKKELLDKDVIVVTGFQGITPEGNLTTLGRGGSDTSAVAIAAKLG
FT                   TRCEIYSDVAGIYTTDPKFYSKAKKLEYITYDEMLELAAQGSRVLHSRAVEIAKKYNVE
FT                   VVCLSSFSDEGGTTIVNTLPEWLEQPVVTGVAMDSNQIKITINNIPNNVDLISGIFNAV
FT                   AEARINIDMISIVNDNSHTHITFTAVAGNPDRVEEVIKTVLKDEKGWKITADTNVTKVS
FT                   AIGVGMRSNSGVASRFFSALQREGIRIIATTTSEIKISVLVPKEESGRALKALIDEFEL
FT                   "
FT   gene            complement(120265..120963)
FT                   /locus_tag="Kole_0104"
FT   CDS_pept        complement(120265..120963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0104"
FT                   /product="Tetrahydrodipicolinate succinyltransferase domain
FT                   protein"
FT                   /note="PFAM: Tetrahydrodipicolinate succinyltransferase
FT                   domain protein; transferase hexapeptide repeat containing
FT                   protein; KEGG: bha:BH2669 tetrahydrodipicolinate
FT                   succinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78832"
FT                   /db_xref="GOA:C5CHX7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR013710"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR019873"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CHX7"
FT                   /inference="protein motif:PFAM:PF08503"
FT                   /protein_id="ACR78832.1"
FT                   /translation="MNAETIIKMIKDSKKKTPAVCYVSGNLEGLETGTLNFVGGKDFGV
FT                   IIGDFKEIQDLIARERERITGYHIDIQARNSALPLADLTKYEARIEPGAIIRDLVEIGK
FT                   GAVIMMGAVINIGAVIGKGTMIDMNAVIGGRAIIGDNCHIGAGAVVAGVIEPPSATPVI
FT                   IEDNVLVGANAVILEGVRVGANSVVAAGAVVTKDVPSGTVVAGIPAKVIKAFDATTADK
FT                   TKIVQDLREL"
FT   gene            complement(120960..121595)
FT                   /locus_tag="Kole_0105"
FT   CDS_pept        complement(120960..121595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0105"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="KEGG: zmo:ZMO0707 dihydrodipicolinate reductase;
FT                   TIGRFAM: dihydrodipicolinate reductase; PFAM:
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78833"
FT                   /db_xref="GOA:C5CHX8"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHX8"
FT                   /inference="protein motif:TFAM:TIGR00036"
FT                   /protein_id="ACR78833.1"
FT                   /translation="MNYGLIGHTGQMGKAIQEVMTDSRLVYTRDENGRNLIKRPEVIID
FT                   FSNRSALSETIKDCREFKCGLVIGTTALTEADFELLHKLAEEVPVVQSYNFSPGINLLK
FT                   LILRQFSPYMKNWDVEIVEKHHNRKKDAPSGTAIMLQKELGREAKIHSLREGGIPGDHS
FT                   IIFANDGEVLELSHRAISRKVFAIGAKEAANFVLKKEKGFFSYEEVIL"
FT   gene            complement(121592..122476)
FT                   /locus_tag="Kole_0106"
FT   CDS_pept        complement(121592..122476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0106"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: sat:SYN_02161
FT                   dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78834"
FT                   /db_xref="GOA:C5CHX9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CHX9"
FT                   /inference="protein motif:TFAM:TIGR00674"
FT                   /protein_id="ACR78834.1"
FT                   /translation="MFRGAASAVITPFKGNEIDYDSFDKFLKFQLDSGINGLIVLGTTG
FT                   EAPTVTSEERREIISFAVKKVGGRVPVIIGTGSNSTAHSIELSQEAFELGADGVLVVTP
FT                   YYNKPTQEGLYRHYEAIAKSVPGHVIIYNVPGRTGIDIIPETVLRCAQIENIVGIKEAS
FT                   GNQAQVDELLRLKAKVRPEFKIWSGNDDQAFHLVCSGGDGVISVLSNVAPSQTVEMIAA
FT                   ALEGDLEKAREIHLKLFPLMKALFIETNPIPVKFATHLLGFGSETLRLPLTEASKRTRE
FT                   VVKKAMQDCGVLR"
FT   gene            complement(122446..123159)
FT                   /locus_tag="Kole_0107"
FT   CDS_pept        complement(122446..123159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0107"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="KEGG: dps:DP0433 diaminopimelate epimerase; TIGRFAM:
FT                   diaminopimelate epimerase; PFAM: diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78835"
FT                   /db_xref="GOA:C5CHY0"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHY0"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ACR78835.1"
FT                   /translation="MTGAYYSATGNTFFVVDSRNTKLTDSIKEAVVLKYVADKDGVIFV
FT                   EDHFMDYFNRDGKRAEFCGNGARTYVAFIHEITGETKITFESYAGRIEGFVDGLYNVKM
FT                   PPVNYHGSREFQGIKGEFLTVGVPHFVIEGDTEKLEWETLIPIRWELNTNINVYKEIEP
FT                   GKLRIRTFERGVEGETGACGTGATATAWCYARGRKLLQVTLQANGGELVVSFKEGNIYL
FT                   GGGVERCSEVLQVQL"
FT   gene            complement(123156..124124)
FT                   /locus_tag="Kole_0108"
FT   CDS_pept        complement(123156..124124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0108"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: sfu:Sfum_3032 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase NAD -
FT                   binding; Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78836"
FT                   /db_xref="GOA:C5CHY1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHY1"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ACR78836.1"
FT                   /translation="MRIAVVGATGEVGNAMIRVLNERGLVNDDLVLLASKKSVGKKLKV
FT                   DSREFTVKELTSEILRTGFDYVLFSAGASVSREFAPVAAAAGAVVIDNSSAFRMDPAIP
FT                   LVVPEINGALLKDYSGIVANPNCSTIQMVLSLYRVHRRFGIKTIVVSTYQAVSGAGRKG
FT                   LNELFAQERGSEGTRIFADRIHRNVVPQIGDFLESGFTTEELKMINETRKILNDPEISI
FT                   WPTTVRVPVLYGHSESIFVETKRPFTIDSLKDELGRCEDVVLTNQLITPRQVAGDDLTY
FT                   VSRVRSLDNTHFLIWNVADNIRVGAATNAVRILQKHRELNS"
FT   gene            complement(124769..124969)
FT                   /locus_tag="Kole_0109"
FT   CDS_pept        complement(124769..124969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0109"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: amc:MADE_03487 putative cold
FT                   shock-like protein CspG"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78837"
FT                   /db_xref="GOA:C5CHY2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHY2"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACR78837.1"
FT                   /translation="MKGTVKWFNAQKGYGFITRDEGEDVFIHFSGIVSDGFKTLEEGQR
FT                   VEFDIENGQKGAQAVNVKTVE"
FT   gene            125629..127308
FT                   /locus_tag="Kole_0110"
FT   CDS_pept        125629..127308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0110"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: ppd:Ppro_2725 PAS/PAC sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78838"
FT                   /db_xref="GOA:C5CHY3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHY3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACR78838.1"
FT                   /translation="MNKLMNVFRMSLFVSLLIIFLAVTFGIYLPMKNELTKELNEKFSN
FT                   NAKLSKKAIDNFLKRCIQGAESLSSRTMIRKMIVEYLSGNITFKELQKYTAPKYLDGAN
FT                   VLQNLKRATRIVSGNIIASVGSLDNLDIGKAISCEDVSETTLDIEFENQFIVVNVCSPI
FT                   RENTTHNFVFMTSSRGRNGENATVIGHDLVSFDMTKLLDEINTGNIVYEIYIATNSKYI
FT                   SLKGKIFDVLKDDTLSSDGKTTRYTMKLRDTDAFLVASVPNNIIYTRIKKISLTIFIVI
FT                   AAAFLIVVLLIHFTILTNARKMIKTIEQDNIKIKELERLKSEFLATMSHELRTPLNSIT
FT                   GFVSMILQGISGEINEEQRKQLSMVHSSSIHLLNLINDILDISKIEAGRMSFSKERFNI
FT                   KDVISEVVQNVSLLISKKEVKLITEIPDEIPEIYSDKRRVFQILLNLVSNAIKFTEKGE
FT                   VRIKCEVDGNKLKISVSDTGKGIKEEDMETLFEAFRQISGSARRRYQGAGLGLYLSKKL
FT                   VTLLGGEIWVESEYGKGSTFTFTLPLKSVEENNHEEKSTGDR"
FT   sig_peptide     125629..125703
FT                   /locus_tag="Kole_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.839) with cleavage site probability 0.443 at
FT                   residue 25"
FT   gene            127358..128551
FT                   /locus_tag="Kole_0111"
FT   CDS_pept        127358..128551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0111"
FT                   /product="response regulator receiver modulated metal
FT                   dependent phosphohydrolase"
FT                   /note="KEGG: dal:Dalk_4664 response regulator receiver
FT                   modulated metal dependent phosphohydrolase; TIGRFAM: metal
FT                   dependent phophohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; response regulator
FT                   receiver; Metal-dependent hydrolase HDOD; SMART: response
FT                   regulator receiver; metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78839"
FT                   /db_xref="GOA:C5CHY4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHY4"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACR78839.1"
FT                   /translation="MKKRRLPSAVLGTSRNLFPENFIPEIGKVINMKILAVDDNKENIY
FT                   MLETLFKSYGYEVESSQNGVEALEKLAEQDFDVVISDILMPEMDGFQLCRRVKMDDRLK
FT                   EIPFILYTAAYTDPEDRKFALSLGVDRFIIKPLEPDAFVKIVREVIQNHKVKPLNNNKV
FT                   VNKEEIVYLKNYNERLIKKLEDGMLQLEEKNKELEQSYKKVQRTLDSVVETIGLVIEMR
FT                   DAYTSGHQRRVSQLACAIAREMNLSEEQIEAVRIAGLLHDIGKISIPTDILNKPDKLNK
FT                   FELGIVRNHPQTAFEILKDVEFSQPIAEIVLQHHERIDGSGYPNGLKGNQILTEAKILA
FT                   VSDVVEAMAFHRPYRPALGIAKALEEITTNSGNLYDPETVKACIAVFSRGFDFEKER"
FT   gene            129526..129795
FT                   /locus_tag="Kole_0112"
FT   CDS_pept        129526..129795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0112"
FT                   /product="DNA methylase N-4/N-6"
FT                   /note="KEGG: rru:Rru_A3210 DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78840"
FT                   /db_xref="GOA:C5CHY5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHY5"
FT                   /inference="similar to AA sequence:KEGG:Rru_A3210"
FT                   /protein_id="ACR78840.1"
FT                   /translation="MKTGHIYKGDCIKVMREHIKDENIDLIYADPPYNLSGKSLNLINN
FT                   KTGGPFYKMNEDWDTWDYNEYVEFTENWFVMLPEKLDKKSSNFV"
FT   gene            complement(129778..130597)
FT                   /pseudo
FT                   /locus_tag="Kole_0113"
FT   gene            complement(130606..130896)
FT                   /locus_tag="Kole_0114"
FT   CDS_pept        complement(130606..130896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0114"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   nha:Nham_4140 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78841"
FT                   /db_xref="GOA:C5CG55"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:C5CG55"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACR78841.1"
FT                   /translation="MAKKLSTEEKMAIILEGLRREKSVSQICREHGISQAQYYKWRDRF
FT                   LEGAKEGLENGKKSRVKQLEEKVEELEKVIGKQTIVIETLKKTVVHPGNGK"
FT   gene            130965..131546
FT                   /pseudo
FT                   /locus_tag="Kole_0115"
FT   gene            131539..132291
FT                   /locus_tag="Kole_0116"
FT   CDS_pept        131539..132291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0116"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   pub:SAR11_0109 site-specific DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78842"
FT                   /db_xref="GOA:C5CHY7"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHY7"
FT                   /inference="protein motif:PFAM:PF01555"
FT                   /protein_id="ACR78842.1"
FT                   /translation="MLNIKLILGDCIEELKKLEAESVDLIFADPPYNLSGENHLTVHAG
FT                   KPVKLDKGEWDKIDNIHEFNLNWIKECIRVLKPHGTIWISGTLHNHPSIGMALKQLGLW
FT                   IINDVVWYKPNATPLLSKNRFVPSTEIIWVAGKSKKYYFNYELAKEMNKGKQMRNLWTI
FT                   KAKRHITPHPAEKPEELLERIILIGSNEADTILDPFMGSGTTGVVAKRYNRNFIGIEIN
FT                   QEYFEWAKERIEKTIVKPSLFGSIKKSV"
FT   gene            133355..133792
FT                   /locus_tag="Kole_0117"
FT   CDS_pept        133355..133792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0117"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: neu:NE1602 general secretion pathway protein
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78843"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHY8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78843.1"
FT                   /translation="MRKRGFSLVELLIVLAVIAALIATITPVALNAIKKAQATKVAQNL
FT                   KTLASSFENKAYVDGTAPSSISDLGRDIDTAKYGVAYTESAGDYTVVVFTTEDVDFNTV
FT                   QGILKDAVSSDPGTSGYTFLSGGLSSTTGGTVFYEFSFVVY"
FT   sig_peptide     133355..133450
FT                   /locus_tag="Kole_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.590 at
FT                   residue 32"
FT   gene            133939..134946
FT                   /locus_tag="Kole_0118"
FT   CDS_pept        133939..134946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0118"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cja:CJA_2729 pilin"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78844"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78844.1"
FT                   /translation="MQRIKKGFSLIELLIVLAVIAAVASVMTTIAINAVRAARATKVAY
FT                   NFRILSQSVTNKIYIDNEIPSTINELGENIDTENYGVAWRGSDGFYEFVVFTSEDVDIT
FT                   TLHEKLLNVSGTVPSGDFTFIAGGKSDFDGMTACYIFLLDEQGNPASMSYGSYTFDEDF
FT                   DISTLVSVYGRDWVATEQGLMPSKWGEARAILPGDETWTDYTVNVVATYSEGNGYAIYI
FT                   RATGEADNITAYAFQVDPGYGSGAFLVRPVYDGRERSPIAITWFRNIDDGWTLPIRPEK
FT                   HYITITAEGNHFTMTFNGIEVLNFTDDRFPSGRVGIRKWHKTDVAFESIEIQQN"
FT   sig_peptide     133939..134052
FT                   /locus_tag="Kole_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.608 at
FT                   residue 38"
FT   gene            complement(134983..135324)
FT                   /locus_tag="Kole_0119"
FT   CDS_pept        complement(134983..135324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0119"
FT                   /product="protein of unknown function DUF202"
FT                   /note="PFAM: protein of unknown function DUF202"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78845"
FT                   /db_xref="GOA:C5CHZ0"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHZ0"
FT                   /inference="protein motif:PFAM:PF02656"
FT                   /protein_id="ACR78845.1"
FT                   /translation="MKISKKEIEKCKEFDTNKLILRDYLAISRSKLANERTLLAYVRTG
FT                   FMFFVSGLSLIKLFPTETIWVFFGYSLIPMSVFTIILGIIRFRQTERDIAKSYKMKKVY
FT                   EEDRKNFGN"
FT   gene            complement(135387..136679)
FT                   /locus_tag="Kole_0120"
FT   CDS_pept        complement(135387..136679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0120"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; Spore
FT                   germination protein; KEGG: nis:NIS_0790 amino acid
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78846"
FT                   /db_xref="GOA:C5CHV2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHV2"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACR78846.1"
FT                   /translation="MGEKKSIGLWSAVSIGVGGMVGAGIFSILGTACQIGGNAVYLSFV
FT                   IAGIVALFSTYSYAKLGAKYPSAGGPVEFLVRSFGSGILSGGFNILLWIGYILALSLYA
FT                   RAFAAYALTFFPDAPSMLLNIFATGIILLFVFVNFIGSKAVGRSELFIVTIKVGILVLF
FT                   AIAGFFFIKPELLSPSRFPPVNNILFAAAIVFLAYEGFGLITNAAEDMKDPAKTLPRAL
FT                   YLSVFIVIMIYVGVSLAVIGNLPLPEIVRAKDYALAEAAKPFLGSIGFTIIAIAALFST
FT                   ASAINATLYGGANVSYIIAKEGELPKYFEKKVWGRGIEGLFITAGLVILFANLFDLSKI
FT                   AMVGSASFLLVYAAVNIGHLRLRKETHGNLILIWLAIIGNLVSFSILVRYLLSHSLLTL
FT                   VFLMIILFFSFTGEWLYRKCTKREIKVRKNV"
FT   gene            complement(136825..136900)
FT                   /locus_tag="Kole_R0007"
FT                   /note="tRNA-Pro3"
FT   tRNA            complement(136825..136900)
FT                   /locus_tag="Kole_R0007"
FT                   /product="tRNA-Pro"
FT   gene            complement(136936..138015)
FT                   /locus_tag="Kole_0121"
FT   CDS_pept        complement(136936..138015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0121"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /note="TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   PFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   KEGG: gbm:Gbem_1976 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78847"
FT                   /db_xref="GOA:C5CIB3"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIB3"
FT                   /inference="protein motif:TFAM:TIGR00420"
FT                   /protein_id="ACR78847.1"
FT                   /translation="MLVKIGVALSGGVDSAVAAAILKAEGHDVVGYHMKNLPDTLFELV
FT                   PEKKKVCCSPSDTIDTHKIAAKLGIELRIVKLNDIFRKEIIDYFIREYQAGKTPNPCVR
FT                   CNDLMKFGALMEKAFGDGMEKFASGHYARIVEHPKYGLSLARGVAKYKDQAYFLSRIKR
FT                   RKLPYIIFPNGNMTKEEIRDIARELGLPVHSKKESQELCFIPDNDYRRFLLEEGIEIKP
FT                   GEIVDLEGNVLGRHKGLAFYTVGQRRGLGIVSDKKLYVVALDADKNRVVVGPKEAVMRK
FT                   KFRAIEPNWLADLDEKELRCQCQIRSNMKAQGATIRIFSNIVEVEFDKPALAITPGQLA
FT                   VFYDGNIVLGSAFIENVVS"
FT   gene            138405..139097
FT                   /locus_tag="Kole_0122"
FT   CDS_pept        138405..139097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0122"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78848"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78848.1"
FT                   /translation="MKRILVFVLLSLSIISFGSYKLGILSFESPYSIHFSGLTEDLVFA
FT                   DDQGRSYQFSNVIEPELSLKANKSSALEFGIDSYDLQISVWFDTLGILGAGRNEFRIGW
FT                   RKGFFEAGIGIRTLFINITKQLAWRLADYSYYMTIDGTLFDPTQTEVLLIHRINDYCPG
FT                   IYFTAYFGNFWFSIAGYPLEFSSIFEERYLKISDDDNEEKIYYPGGGSFSFSNDEFSFA
FT                   IGWSFKLF"
FT   sig_peptide     138405..138470
FT                   /locus_tag="Kole_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.706 at
FT                   residue 22"
FT   gene            139136..139858
FT                   /locus_tag="Kole_0123"
FT   CDS_pept        139136..139858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0123"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   ionotropic glutamate receptor; KEGG: dde:Dde_0186
FT                   extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78849"
FT                   /db_xref="GOA:C5CIB5"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIB5"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACR78849.1"
FT                   /translation="MRKLSLVILLVALAAFAFGKTYVVGTSADFPPFEYVENGEFKGFD
FT                   MDLIRAIADEMGFNIKIVDMSFDSLIAALVSGNLDIVIAGMTITAEREAVVDFSKPYWT
FT                   ADQSIIVKEDSDYTVTVLFGKHDIGVQTGTTGDLWVEENLVKTKILTGKFKRYDTFVLA
FT                   LTDLINGNVDAIVLDSPVAERFAETRPVKIVGIIVTGEEYGIAVREGNKELLNLINEGI
FT                   QRLKENGKLGEIVEKYFK"
FT   sig_peptide     139136..139195
FT                   /locus_tag="Kole_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.855 at
FT                   residue 20"
FT   gene            139938..140558
FT                   /locus_tag="Kole_0124"
FT   CDS_pept        139938..140558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0124"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dat:HRM2_20380
FT                   GlnP5"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78850"
FT                   /db_xref="GOA:C5CIB6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIB6"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACR78850.1"
FT                   /translation="MTLKLTFWSLGLGLILALPFSFGQVYGGRIAKGIIVVYERLFRSI
FT                   PLLVILFLIFYGFPKINVRFSPFTACILGLGLRSAAYQSQIFRGAIQSVSETQMRAARS
FT                   LGMSRLQGFRHVVLPQALRIALPGWTNEFTIVLKDSSLAYALGVTELLRQGGYIISTKY
FT                   EPMLIYLSVAVIYLVITLGINRGLGTVEKKLAIPGFAVKEQIR"
FT   sig_peptide     139938..140009
FT                   /locus_tag="Kole_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.729 at
FT                   residue 24"
FT   gene            140555..141325
FT                   /locus_tag="Kole_0125"
FT   CDS_pept        140555..141325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0125"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sfu:Sfum_3901 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78851"
FT                   /db_xref="GOA:C5CIB7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIB7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACR78851.1"
FT                   /translation="MSGKTTNKPLLRIENLKKSFGDNEVLKDITFSVNEGETKVIIGPS
FT                   GTGKSTLLACINMLVTPDSGKIWLKDVEITGAKDLNKIRQRIGFVFQDFGLFNHLTALQ
FT                   NVMIGLTKVKKIPKDKARERALEELQRVGLEKSANFYPAQLSGGQKQRVGIARALAMDP
FT                   DIILFDEPTSALDPELIGEVLAVMKDLASSGMTMLVVTHEMGFARTVSDEIIFMENGVI
FT                   VEQGPPEELFSNPKHERTRQFLFKLTELYGDGGG"
FT   gene            141322..141996
FT                   /locus_tag="Kole_0126"
FT   CDS_pept        141322..141996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0126"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: dat:HRM2_14040
FT                   GlnP2"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78852"
FT                   /db_xref="GOA:C5CIB8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIB8"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACR78852.1"
FT                   /translation="MIERIIDIIIKFWPEFLRGLGVTLEMTLISVVAGFLIGILLALAR
FT                   VYGNALLKGIATVIIEVIRGTPLLVQLFILYYGLPPYGVSLTPLTAALIGFSINSGAYQ
FT                   AEYLRSAINSIQHTQMLAARSLGMTKWQAIFNIILPQALRRVIPAWANEFIYLLKYTSL
FT                   AYIVGAPELMAKAKFIASRNFQFFEVYLVVALIYLIVVLAFTKILTTVEKKVRIPGLEW
FT                   SR"
FT   gene            142019..143515
FT                   /locus_tag="Kole_0127"
FT   CDS_pept        142019..143515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0127"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: aba:Acid345_1410 histidine ammonia-lyase;
FT                   TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78853"
FT                   /db_xref="GOA:C5CIB9"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIB9"
FT                   /inference="protein motif:TFAM:TIGR01225"
FT                   /protein_id="ACR78853.1"
FT                   /translation="MVIINGNDLTVEQVYSVAFHGEEVRIAESTLDELKKKRLFLEEMH
FT                   NKDVIYGINTGFGILADKRISDDDLEKLQVNIVRSHAAGVGEPLKTELVRAIMLVRANS
FT                   LCKGYSAVRPEVVQQLVNFLNKGIVPIVPEQGSVGASGDLAPLAHIALALIGDGEVFHN
FT                   GRKEKALEAIQAEGLKPLTLKTKEGLSLLNGTAFMAGIGACSVHIAEKMFDKAILVAAM
FT                   SVDALMGSTSPFDPRIQEARPHPGQKYVAKKLREYLEGSEIRRSHLHCDKVQDAYTLRT
FT                   IPQVYGAVYDTLQYVKSVITREINSATDNPLIFDNGDVISGGNFHGEPIALVLDFLSIA
FT                   LTDMANMMERRVDRLVNPKLNNFPAFLTRGKEGLNSGYMIWQYTAAALASENKTLAHPA
FT                   SADTIPTSGFQEDHVSMGAWGARKLWKILKNWSNILAIETVLAYRALSFRKPKKSGKAI
FT                   EGFFKELSNILEEHVEDRYFGKEFADARDFLLKSQGLKGF"
FT   gene            complement(143563..143650)
FT                   /locus_tag="Kole_R0008"
FT                   /note="tRNA-Leu5"
FT   tRNA            complement(143563..143650)
FT                   /locus_tag="Kole_R0008"
FT                   /product="tRNA-Leu"
FT   gene            complement(143686..144267)
FT                   /locus_tag="Kole_0128"
FT   CDS_pept        complement(143686..144267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0128"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bar:GBAA2479
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78854"
FT                   /db_xref="GOA:C5CIC0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIC0"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACR78854.1"
FT                   /translation="MQIKKEDKKDRILKSAEKLFAEKGYANVSISEIAKDAKVGKGTIY
FT                   VYFSSKEEILDAVALRIFEEFVDGARYALEMSKNLKEFLELLAEKLSKDVENRSKILAM
FT                   FHRERLKDRSKYREITSEYRKVFMAAYERYRDEFKIPFDEMFAFMRGIFMSAYTMADNI
FT                   TEESIKIFLKKILLCFFDVQKDMDCGSGAS"
FT   gene            complement(144268..144717)
FT                   /locus_tag="Kole_0129"
FT   CDS_pept        complement(144268..144717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78855"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78855.1"
FT                   /translation="MRKMLVLFILVMSVLAFSLDYSPVLAGLSAVGSSAGAYIGENLAV
FT                   PALIIMNKMGFVSDDIFSPFSTTMADAIETGAVVGTVIGGVIAKHVYLAFNGDFRVENL
FT                   IVDSVISSVVAYVAHKVVKSFCDDSLISDIFVVPGINGLVLGGVW"
FT   sig_peptide     complement(144661..144717)
FT                   /locus_tag="Kole_0129"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.481 at
FT                   residue 19"
FT   gene            complement(144727..145368)
FT                   /locus_tag="Kole_0130"
FT   CDS_pept        complement(144727..145368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78856"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIC2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78856.1"
FT                   /translation="MRKFKMVTGLFLVMVIVASAVLSVSLNDILVTSENMKTIKCVVNA
FT                   TKFSKRSKSQVEFLFYFNRDGQKLRIEYTAPRNMKGSIVAIDGEYFYNYISSLKRTMKK
FT                   ELSGDFDKNKAPGRDMGIFFDFVYGDLDRVFSNMQHEYIGEETLKINKKEVNTYHYVFQ
FT                   KADEKQEVWFDSETLAPVKIVIYQDGKKVYEIFVFDIQINITLEDSLFRL"
FT   sig_peptide     complement(145297..145368)
FT                   /locus_tag="Kole_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.839 at
FT                   residue 24"
FT   gene            complement(145355..146737)
FT                   /locus_tag="Kole_0131"
FT   CDS_pept        complement(145355..146737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0131"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bar:GBAA4216 EmrB/QacA family drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78857"
FT                   /db_xref="GOA:C5CIC3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIC3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACR78857.1"
FT                   /translation="MSMFTILFVNFISAVGITIVAPILGIAGQIFEVDQGYAMWLMTGF
FT                   MMAYASFMPMIGRMSDNFGRKKGFIASASIFSFGLLLSFLSNDFNIVILGRMIQGFGAG
FT                   GILPVANAMAVELYQDSKGKALALVNATYGLGVVVGVNLGGIIYDHLGWKWMFIVPFIL
FT                   TLIVIPIAVSFLKETLKFKKHEAIDYIGSILFAVAIISFMFMMKYLAVAPFFSPEVLIP
FT                   MIGMVISFILFVIRELKVENPVIDIKDFKNPSFLIYSLIAFFFGFSMFLFVTFLPSFTQ
FT                   TLLGYGVSESVYAIDPFAIAMIFFVMLGGILIKRFGARKSMVIGALLFSIFSYLFVKMV
FT                   DDGPSFYIYSILLASGLGISMTPMNYVIMEEGGKEKQGVSAGIASVMRSLGGIVGPTIA
FT                   GIIIANVDFSSIFVMDNLIEAYMKIFSISFYSTLIQVALSILGLFAFRKILIKGGIRNE
FT                   KI"
FT   gene            complement(146904..147950)
FT                   /locus_tag="Kole_0132"
FT   CDS_pept        complement(146904..147950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0132"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; Ion transport 2 domain
FT                   protein ; TrkA-C domain protein; KEGG: dal:Dalk_2078 TrkA-N
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78858"
FT                   /db_xref="GOA:C5CIC4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIC4"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACR78858.1"
FT                   /translation="MEEISTKHRVILRSIFMIIGVILFGTFGYGVIEDWSFLDSFFMTV
FT                   ITISTVGYGTPGDLSEAGKIFTSFLILSSVTVVVYGFSNITAFVVEGRVNEFLRRRRIL
FT                   KAIEKLTGHCIVIGAGTVGLTVAKELARKGKKVVIVDRDEQLISHLLDEEKKNLYYVLG
FT                   DAKNEEVLIQAGVTRAGGLVTTLDSDAESVFVILTAKSLNPNLNVIARSNEHESIKKLQ
FT                   YAGANNVVPITEIGAHRIVNMLMNPVIVGFLDSITRSGDLELRFEQIVVPEEGFPVDGL
FT                   TLGEMEIPKKVGLIVIAINNGEKNIFNPSAGTRIYPGYTLMVLGEEEKIEKFNKLLSEG
FT                   AFTNQNKR"
FT   gene            148036..149994
FT                   /locus_tag="Kole_0133"
FT   CDS_pept        148036..149994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0133"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: sat:SYN_02537
FT                   UvrD/rep helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78859"
FT                   /db_xref="GOA:C5CIC5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIC5"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACR78859.1"
FT                   /translation="MKRYNLKPHGIPNFIQESLDNEQLNAVLNSKGRTLIVAGPGSGKT
FT                   RVITFKIAYLVSSGVNPQNILLVTFTRAASREMIERARRVSGSDLRGMLAGTFHHVCNH
FT                   FLRKYATHLGISSDFTILDREDSKDLIKHCKAQLMEQRGNDGSLKLPSPGVIQSIFSYS
FT                   VNCMVSLDESIAKHNRKFFAVRDELEEIWKSYTQLKLEHNTLDYDDLLIKAVELFENNP
FT                   EILIRESSRFQWILVDEFQDTNLVQYKLVEMLAGVHGNLIVVGDDAQSIYSFRGARFEN
FT                   VYDFLNRDQTSVFKIQTNYRSTPEIVRLVNHLVPKSSLEKQLKAVRPSGPVPVIVETWD
FT                   NLDEASFVAQKINEHIEDGIQPNRIAVLYRSHFHSLELQLELDRRRVPYIVFSGPKFVE
FT                   TAHVKDILAFLKILQNPYDQLSWGRVLRLFPGVGIRRATQIINAIRESLGNDNEVISAL
FT                   RPFATPRVRIERLISLLEELNSEQSPEEVISTIYKGFYGEYMDEHFSDAKERRMDIERL
FT                   IEVADRYDSIGEFLEDLAVSEKVDIEREIVDREEKIVLSTVHQAKGLEWDVVFILAMNP
FT                   GDFPHALAIMEGNLDEEERIFYVAVTRARDYLYLIRQRTGRSRPMIGNSYVFRSGHDFL
FT                   TKIPEDVAERWDVGWNI"
FT   gene            150034..152205
FT                   /locus_tag="Kole_0134"
FT   CDS_pept        150034..152205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0134"
FT                   /product="V-type H(+)-translocating pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="KEGG: sat:SYN_02772 membrane-bound
FT                   proton-translocating pyrophosphatase; TIGRFAM: V-type
FT                   H(+)-translocating pyrophosphatase; PFAM: Inorganic H
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78860"
FT                   /db_xref="GOA:C5CIC6"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIC6"
FT                   /inference="protein motif:TFAM:TIGR01104"
FT                   /protein_id="ACR78860.1"
FT                   /translation="MNALYLPLTAGVLSTIFAFIMLARTLKFSPGNKTMQKLSGYVQEG
FT                   ASAFLSEEARKIFLVAVLIAAALGIIFQSFKYPIALLFGALVSELAGVMGMYAATRANA
FT                   RVTQGATKGLSEAFKVAFSGGSVMGLSVAGFSLTGLSIIMLVFKDSFLYNNITEISQAF
FT                   GKISFLDPVMIVSSYSLGASLIALFDRVGGGMYTKAADMSADLVGKVEAGIPEDDPRNP
FT                   ATIADNVGDNVGDVAGLGADILESYVASVVSAIVLAIFMKLADKQMINGQVQYGMSPEQ
FT                   YYGLILLPILIAGVGVLSSLVGVLVVANMKAKDARKALGFGNVFTGILVLASTAIVIGI
FT                   AAPDYAFKDTFILNPEFVSRWRLFLAIASGLIAGLIISKLSEYYTSYDYKPTQDLAEKT
FT                   KSGVAINITSGLALGMGSTFWPVIVLAIAILGAYWSAGVYGIAIAALGMLSFVGYIVSV
FT                   DSYGPVADNAGGIAQMAELDPKVREITDRLDSVGNTTAAIGKGFAIGSAAFAALALIVS
FT                   YIWSAAHSAEEIVNNPVINLVSPYTIIGSIIGAMLPFFFTSLLIRGVADTADLMITEIR
FT                   RQFREHKGILTGEETPDYKRCIEITTKGAVSRMLLPGIIAIATPFVVGFLFGKAAVAGL
FT                   LLGGLGSAIMIALFTANSGGAWDNAKKYIESGHFGGKGTDVHSAAVVGDTVGDPLKDTV
FT                   GPSMDILIKLMSVVSLVFGSLFPDKPFFM"
FT   gene            152314..153843
FT                   /locus_tag="Kole_0135"
FT   CDS_pept        152314..153843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0135"
FT                   /product="nucleic acid binding OB-fold tRNA/helicase-type"
FT                   /note="PFAM: nucleic acid binding OB-fold
FT                   tRNA/helicase-type; KEGG: sus:Acid_0157 PAS/PAC sensor
FT                   hybrid histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78861"
FT                   /db_xref="GOA:C5CIC7"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIC7"
FT                   /inference="protein motif:PFAM:PF01336"
FT                   /protein_id="ACR78861.1"
FT                   /translation="MRKALILALVMVMVVSTVSLSRVTLDTLTFYTIDLETGNSSIFPI
FT                   AYFTFEPIKGIGIRLEDYLALSHDTLNLGPISLMKPRLYYGYYYGNDLSIKIGNFRSKY
FT                   YNTRKINFLRVGGFYDYNYGAEVKYDYGNFTFLGRYNYDSYNSEHQYGGMISYKTKSSA
FT                   LAFYGMVKGTTYDLSVDGSLKVKLGPVSSEIFGAVAVYGSSPFSAPPTYLIGALADWNK
FT                   ISAGIQYANQGSWSIKYDYSDPNKYSEWVLNTFVDYYFTSDISVGFFLDVNPTGYNYGT
FT                   KFKLNDLELLVSNGDVDGGMDGIQRLELSYSNYFSIDLEKSFKALIRSTKKLPKIAEIK
FT                   KTAKVGDTVTIRGIVAVDTGVMGNNVTYVVDETGGYMVWGRNAAGLKAGDEVIITGYIK
FT                   EYYGILEIVTNSVEKIASGKKIPIIPVRALDVFSGKYESALVKITGTVMEVQKYSIMVK
FT                   DDSGVIKVYAKKGTNVSFEDISFGQKITVIGIVSLFKGEWEIIPRSQADIQ"
FT   sig_peptide     152314..152379
FT                   /locus_tag="Kole_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.861 at
FT                   residue 22"
FT   gene            153869..154708
FT                   /locus_tag="Kole_0136"
FT   CDS_pept        153869..154708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0136"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein); SMART:
FT                   nuclease (SNase domain protein); KEGG: bsu:BSU21610
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78862"
FT                   /db_xref="GOA:C5CIC8"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIC8"
FT                   /inference="protein motif:PFAM:PF00565"
FT                   /protein_id="ACR78862.1"
FT                   /translation="MSSHRSVIKQSWLYVSLVILVSISALFLTSCPGWFTSSYYVTEII
FT                   DGDTIKVLYNGEEVKVRYIGIDTPETHSDYQDSKPNGEFGIEAMEFNRDLISQSGWRVS
FT                   IIARGYDKYDRLLAYVYTKDDKMINEEIIRNGLARPLTYTSTSEHSQDFKEAYEEAFKE
FT                   RRGIFSKYDPDSDNPAPTVDASVVKDNLDDYLGKIIWLKFTPTDTGYDSKFDEYLLFSD
FT                   DAVIAIRKDEAYLFFGGDPKFKNYVGEEIKVYGEIWEEDGKPEILLRAPFEIKPIGE"
FT   sig_peptide     153869..153961
FT                   /locus_tag="Kole_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.683) with cleavage site probability 0.525 at
FT                   residue 31"
FT   gene            154792..155457
FT                   /locus_tag="Kole_0137"
FT   CDS_pept        154792..155457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78863"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIC9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78863.1"
FT                   /translation="MKKVLLVLSIAVLILALTGCPGWFNFGDVQKMTIPEIIEWIDTNE
FT                   ATDVSEFLVETEGIVTYAYSYYAYIVDAENNGIMLRSDSSVIDFRDFNPGDKISVVGSP
FT                   YFSKYGEYRLDTDTPGGTATLIEKNVALPDPYVLPAGEGLTVGLFGKLVQLTARYDGTD
FT                   SYGHHTFNNGGVTVTVFKYSDMPSDLATNTTYTIMGVVGQSYGYKLFVWDKSYVLPAE"
FT   sig_peptide     154792..154851
FT                   /locus_tag="Kole_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.769 at
FT                   residue 20"
FT   gene            complement(155652..156944)
FT                   /locus_tag="Kole_0138"
FT   CDS_pept        complement(155652..156944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0138"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: bxe:Bxe_B2763
FT                   putative transposase IS110"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78864"
FT                   /db_xref="GOA:C5CID0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C5CID0"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACR78864.1"
FT                   /translation="MDIVGIDWSWNFHTCYSIEQDKVFKIKDGIAGYEKLLKTVSKDAV
FT                   FVIEESFNRLGDFLLSRGKEVYLLPPKRSKEARGYHSNGVKTDSTDARCIALTYKEHPE
FT                   YCIKATHDELGMLFRELLRHYRYYTDMSSRLKNKLQNELHNYFPEYARVMGNSWTDCDG
FT                   RIFLLTICPDVTELRKTSDKEINRHFKANHLRYTSSLKRKVKELREKAIDWGMSKYTRD
FT                   MIANVATQLLEAKREKKKITKEMEKELRKSKYNIILTLPGVGVATGMALVTAFLTHEFK
FT                   NYRDFQKYCGTMPIVSQSGNFRMCRMRKNCDKKLRGILHMMAINAKKCGAWMKGYYDKK
FT                   TNKEGKKPSLALRALANILVKIAFAMLRNLKAYDEELFLSSRGNKSPRLNYTTRNSIPG
FT                   TKKMKKEKLSLPVSVAQTNCHLGTVSGSLSP"
FT   gene            complement(157229..157525)
FT                   /locus_tag="Kole_0139"
FT   CDS_pept        complement(157229..157525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0139"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein;
FT                   SMART: Excinuclease ABC C subunit domain protein; KEGG:
FT                   fph:Fphi_0656 endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78865"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:C5CID1"
FT                   /inference="protein motif:PFAM:PF01541"
FT                   /protein_id="ACR78865.1"
FT                   /translation="MNPGFVYIMSNPGRTTFYIGVTNNLLRRVKEHKSKKIEGFASKYN
FT                   CVDIVYYESFEQISSAIEREKQLKTWKRQWKIALIEKVNPEMRDLYEDILCGS"
FT   gene            complement(157796..159067)
FT                   /locus_tag="Kole_0140"
FT   CDS_pept        complement(157796..159067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0140"
FT                   /product="RNA-directed DNA polymerase (Reverse
FT                   transcriptase)"
FT                   /note="PFAM: RNA-directed DNA polymerase (Reverse
FT                   transcriptase); Group II intron maturase-specific domain
FT                   protein; KEGG: ppr:PBPRB0807 maturase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78866"
FT                   /db_xref="GOA:C5CID2"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="InterPro:IPR013597"
FT                   /db_xref="InterPro:IPR030931"
FT                   /db_xref="UniProtKB/TrEMBL:C5CID2"
FT                   /inference="protein motif:PFAM:PF00078"
FT                   /protein_id="ACR78866.1"
FT                   /translation="MRKYYSLIDKVYLESNLAKAYHKVRRNNGAPGIDGVTVQEYGENL
FT                   LERIKKLSEKLRKGEYRPSPVKRVEIPKGNGKTRMLGIPTVEDRIVQQSLKEIMEPIFE
FT                   EGFHPSSYGYRKGRNPHQAVEKAYAFACKYKMKYVVQLDLSQCFDTLDHEKMIDAVAER
FT                   ISDGKILRLIRSFLKSGVITDQYQPSEMGSPQGGVISPLLANIYLNKFDQKMMARGIRI
FT                   VRYADDILIFAKSYKSAEKYLKIAIRILEKELKLKVNKEKTRITTIDDGIEFLGFTIQK
FT                   GKIRIQEKKIKRFKAKVKTLTRRNQCTPIGEIIKRLNQLLRGFSNYYKIIDWVGVFKGL
FT                   MGWIRRRLRAIILRQWKTTKKLCRVMRQKGYRGEISGIRMNKWRSSQSRLVSRLLPNKY
FT                   FQKIGLYDMKLSHVPLSENPILNP"
FT   gene            complement(159222..159335)
FT                   /locus_tag="Kole_0141"
FT   CDS_pept        complement(159222..159335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78867"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78867.1"
FT                   /translation="MSDGGNRNRKGLLLAKGGRIEEMAQREASITGVRNGG"
FT   gene            complement(159947..160144)
FT                   /locus_tag="Kole_0142"
FT   CDS_pept        complement(159947..160144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78868"
FT                   /db_xref="UniProtKB/TrEMBL:C5CID4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78868.1"
FT                   /translation="MRLVSTLRVGKLCYAGGKPDYVRGVHSFGVGKNRHSGNVLSRILF
FT                   FKNEILNQVQDDGLWGRTTG"
FT   gene            complement(160409..162199)
FT                   /locus_tag="Kole_0143"
FT   CDS_pept        complement(160409..162199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0143"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: swi:Swit_4521 membrane-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78869"
FT                   /db_xref="GOA:C5CID5"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:C5CID5"
FT                   /inference="protein motif:COG:COG4907"
FT                   /protein_id="ACR78869.1"
FT                   /translation="MSQSLKRALVGGIIGGIIWVFLFLILTYGSSIGSIYKLEGATIEQ
FT                   KIQEDGSIVVHEKIDYLLVKPYRGVYREIPYDFRTHYSNLKVWADGLPIQHIENNSTEN
FT                   SIDVKVWFVPYQSEPVKPPEGGQRVTLHLSYTVRGAIQVGKDTAQLFRKIWGDGWDVPV
FT                   KSLIGIFEFPEYFPIMEYYTHPFLRVEKIGTQYIFKAEKLPPRTFAEVRFVFPKENLRG
FT                   LSLSAITPGDFMYSDIEKIEKEYSSKVKFLKFQFPFLMGIGAFVILSLLFFYFGREPEI
FT                   SYNAEYEREPPFKDNPEEVNAIVKNLCTGADNDGIGAMLLNLYRKGFITFETDPKNEKI
FT                   RGIRILKLGGELTDSEKFFLSFLKGYSHDNVFDFDAVKSDLRKSQTKARTFTKQFQAWK
FT                   KLIKNKVKERRYMVTTGNTYAKLFAVILLGINLLILVVSVKYPEILFMNSWTKYVYGGF
FT                   WVLGFSVLFLPIDVFGRWTRQGREYYLKWKKFQRFLEDYSLLSEHPPESITLWEEYLVY
FT                   AAALGIADKVRKNMERIIPYEVWQERGGRSCMYHPAMFNISRQFGSVASTAQASSSSSS
FT                   SGGGAGGVGGGSGGGGGGAF"
FT   gene            complement(162232..162723)
FT                   /locus_tag="Kole_0144"
FT   CDS_pept        complement(162232..162723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0144"
FT                   /product="Ferroxidase"
FT                   /EC_number="1.16.3.1"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   gbm:Gbem_2519 ferritin Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78870"
FT                   /db_xref="GOA:C5CID6"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:C5CID6"
FT                   /inference="protein motif:PRIAM:1.16.3.1"
FT                   /protein_id="ACR78870.1"
FT                   /translation="MISEKMVRMINDQIKAEFESEFLYLSMALWCSRKGYKGALMWLLK
FT                   QAAEEHEHAMKFIRYLDQVHADVEVPGIDKPNVEFNSLLDVFEKGLEHEKYISSRIFKL
FT                   METAEEEKDYFTADFLQWYVTEQLEEETSFSSIVKKLKMVGDSKQGLMMIDAQLGQRQE
FT                   "
FT   gene            162846..163979
FT                   /locus_tag="Kole_0145"
FT   CDS_pept        162846..163979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0145"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; monooxygenase
FT                   FAD-binding; KEGG: noc:Noc_0982 geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78871"
FT                   /db_xref="GOA:C5CID7"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5CID7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACR78871.1"
FT                   /translation="MEKKAEVIIIGAGPAGSTAATVLARRNFDILLIDKCQFPRDKVCG
FT                   GVLTAKSMKLLEKIHPGVVFSLNLKPITKVSFGYPGTERKNESITYIYKKPLFYVATRK
FT                   ELDNALMENALRNGAKYENDAIIRIERLDDGFICHGRSGNTYSAPYVVIAAGVFGHNLL
FT                   ENTSKISYSIAYKAQTASVPITTATINFHDFGYTWILPGKGFFNVGIGSYDNSLTYADA
FT                   ENIVKKLFNFPIGKLNAAPLPMFDKTISVDLNNMVPGCLFVGDSGGFVDPWTGEGISFA
FT                   METGFCSAKAIIEKGGDRLKVNDDFLGRIRRIGIHLQIAGILREKLTTTLPERFDLLSD
FT                   IRMAKLLYVYLNGYLKGIDRLMIKGFFFQGVKGIETR"
FT   gene            complement(163976..165160)
FT                   /locus_tag="Kole_0146"
FT   CDS_pept        complement(163976..165160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0146"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ypg:YpAngola_A2760 aminotransferase, classes I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78872"
FT                   /db_xref="GOA:C5CID8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:C5CID8"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACR78872.1"
FT                   /translation="MEKYDFDKFIDRRETNSYKWDYLDEAFGTRDLIPMWVADMDFEAP
FT                   KPVIEAIKNRAQHGCYGYTARPDSYYESIMNWLEKRHSWKVEKEWLLHSPGVVPGIVIA
FT                   ILAFTNPGDKVIIQTPVYHPFYSTVRENGRQLVKNPLKLENGKYFMNFEDLESKIDERA
FT                   RMLILCNPHNPGGRVWTEGELLKLGELCIKHDLIILSDEIHSDIIMPGYKHIPIASISQ
FT                   ELADRTITYIAPSKTFNLAGLTTSTVIISNQRLRRIYNNMLSSLELNLGNVFGIVATEA
FT                   AYRYGEEWLEQLLKYLKGNLEFLKKFISERLPEIKVVEPEGTYLVWLDFRGLGMDQEEL
FT                   RKFIIEKAKLGLNDGVTFGEEGKGFQRMNIACPRSILKKALEQLETAVKNLKGT"
FT   gene            complement(165169..165987)
FT                   /locus_tag="Kole_0147"
FT   CDS_pept        complement(165169..165987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0147"
FT                   /product="ABC-3 protein"
FT                   /note="PFAM: ABC-3 protein; transport system permease
FT                   protein; KEGG: bha:BH1390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78873"
FT                   /db_xref="GOA:C5CID9"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C5CID9"
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /protein_id="ACR78873.1"
FT                   /translation="MSIIQDILTYEFLRNAFIAGILVSVLTSLFSTVVVLRKIEFIGDG
FT                   AAHAAFGGLALGFLIGAGSEIMAMVTAIIFALTISYFSRREKISENSMIGMLLPLSMAV
FT                   GVILLSFVRGYTPDVMGYLFGNILLVGKNDIWLLLGFTVAAVLFFCFFRREILYYSYDE
FT                   TMARHCGVNVNFIHYAILIGLSLSIVASVKIAGIILVTAFIVTPAATAKLIVKTYRSMI
FT                   LFSLLLSVFAMIFGLGISYLFDLPPGPVVVLILFLEFLLTYVFAMKTKNE"
FT   gene            complement(165984..166733)
FT                   /locus_tag="Kole_0148"
FT   CDS_pept        complement(165984..166733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0148"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: baa:BA_4953 putative cation ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78874"
FT                   /db_xref="GOA:C5CIE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIE0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACR78874.1"
FT                   /translation="MVQDRIILKVENLSFKTGDHYILRNISFEMEQGSFVGIIGPNGAG
FT                   KSTLVKAIVGDLEGYTGEITVNGRIGYLPQQEKIDREFPITVKEVAAMGLYPKRGLFKK
FT                   YTREDWEQVKKTLKAVGIVHLENRKIGVLSGGEHQRLMLARALLMEPDLLILDEPEAGV
FT                   DEMGKASFYELLEEFRNKQGISILMVSHDIGMVFDSCDKVMCLNKTLHCYRESADISPD
FT                   EIRRIFSMDFDILIRGKRHYHKEHDKK"
FT   gene            complement(166720..167598)
FT                   /locus_tag="Kole_0149"
FT   CDS_pept        complement(166720..167598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0149"
FT                   /product="periplasmic solute binding protein"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   pap:PSPA7_2852 putative adhesion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78875"
FT                   /db_xref="GOA:C5CIE1"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIE1"
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /protein_id="ACR78875.1"
FT                   /translation="MKKLSVFIAWIIIMASLGFSLNVVTTINPYYLIVKEIVGDKGNVE
FT                   LLIPAGQNPHIYSPKMSDVKKLFKADIVVANGLGLENFLLDTLKDLEKRGKPVVYAGEF
FT                   VPMGMLISINTEHDTADHTSVNPHVWLDPVLLSEYIVPGIVKALSKISPANKEFFAERA
FT                   NLLIDDLMEFHRKVADLLAPFSGKAVIVAHPSFEYFFNRYGIEERTIFSGHGDEPSISE
FT                   LKVLINFARKNTVFGIFGEYQQNKKPVEIIAKSTGLPLSELDPLGFDKGSIIELLSWNL
FT                   NQIERVIHGAR"
FT   sig_peptide     complement(167521..167598)
FT                   /locus_tag="Kole_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.606 at
FT                   residue 26"
FT   gene            complement(167595..168053)
FT                   /locus_tag="Kole_0150"
FT   CDS_pept        complement(167595..168053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0150"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG:
FT                   cjd:JJD26997_1557 ferric uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78876"
FT                   /db_xref="GOA:C5CIE2"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIE2"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACR78876.1"
FT                   /translation="MLYKYMCKSFAQIICEVIVLKRLTELRKEILRIIETSEVPLNAEE
FT                   IYQKLETKPNLSSVYRGLSFLEDNGMIKSISFDSHVRFFYPVEKNHPLHFIYCKNCRKI
FT                   EVFNECFADRIQAQIEKKHDCTITDHVFYFIGLCSECRHNYPGRGRET"
FT   gene            complement(168141..169817)
FT                   /locus_tag="Kole_0151"
FT   CDS_pept        complement(168141..169817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0151"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: baa:BA_3885 putative ABC-2 type transport
FT                   system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78877"
FT                   /db_xref="GOA:C5CIE3"
FT                   /db_xref="InterPro:IPR031599"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIE3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78877.1"
FT                   /translation="MKWKRLISLISTLINSHYGISYKKFIYFKKKERLWEPILITFAIF
FT                   SMIVGMVPLYSIIMKTSFEQMTAMGLQNLFLMQAFTATTFIGFFFGLFIVVNYLFFSRE
FT                   MKVLLPLPLKPSEVMTAKFSVIILDQMLISLVLLLPPLIYFGVKTSQGLLYWFFAAVIF
FT                   LLSQILPVMLATVIILPLYRVIKFDRYRDFFIFILASLLLVASLFFVAITNRMSFSGGF
FT                   SPEALARILSDPESLINKVGRIYPPAILVVKSLTAGGFEGLIAFLGFVVLHVFVFLLLL
FT                   YMGKKFYYSTYIELQEAHAKRTKVGKDELERLFGKSRSRFAALMAREWKYFLRVPSFSF
FT                   NGFINVVIFPILLLIFASVNGEQMEEIKRFIPLIKPYAVPLGVLVAVLAGGINSLSPTL
FT                   LSREGRLFIELKALPVSPTTIFVVKFTHIMTITIIAPIFVSIALHMFLELSLIQSLSIF
FT                   FISTVNLLFLNLLQTMIDSKKPVLDWDNPSKAMKQNINVALTIPIIFGFVGGFGYLGFV
FT                   LKGTLSPVVMSSILLLVGVAGSALCAPIATRMFGSALSRDV"
FT   gene            complement(169774..170532)
FT                   /locus_tag="Kole_0152"
FT   CDS_pept        complement(169774..170532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0152"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bar:GBAA3387 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78878"
FT                   /db_xref="GOA:C5CIE4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIE4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACR78878.1"
FT                   /translation="MIELKNVTKVYSGGVKAVDNLSLSVEKGEIFGFLGPNGAGKTTTI
FT                   KMIVGLLKPTSGQIKVFGKELSKEPEAIKQRIGYVADEPLVMEKLRGYEYLNFIADVFG
FT                   VPSDVRRERLERLLADFKLKDAIKDPVSSYSHGMKQKLTLIAALLHAPDLWILDEPIVG
FT                   LDPESAYILKKMMRKHADSGKTVFFSTHVMEVAEKVCDRIGIIGKGKLLFVGTVEELKK
FT                   ARGEESLEKLFLEVTESEMEATDFSYLDAD"
FT   gene            complement(170546..171406)
FT                   /locus_tag="Kole_0153"
FT   CDS_pept        complement(170546..171406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0153"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sus:Acid_3750 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78879"
FT                   /db_xref="GOA:C5CIE5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIE5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACR78879.1"
FT                   /translation="MEREEMKVITVRNLKKTYRNGVEAVKGIDLDIEPHEVCALLGPNG
FT                   AGKTTTLKSILGFINYEGEIKVFGKPIDEVRDRISFVPAERSFYGYMTLSKAMKFCERF
FT                   LPNFDSKKSLEMIKHFRLPMDKKIAGFSSGMKTGVYLSFTLAQEADLYILDEPTWGLDP
FT                   IMRDDVLEMIREKVIQGKSVLYTSHIISEVEKISDRIYIIDKGKIRYSGALDGLKEQFR
FT                   IFYLPIEAMKKLDNRDFSSLRKVPNRIVVLSKDPEEWEELENLSEMEGTAPNLEEFFQF
FT                   LIRGE"
FT   gene            complement(171388..171762)
FT                   /locus_tag="Kole_0154"
FT   CDS_pept        complement(171388..171762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0154"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: bsu:BSU30460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78880"
FT                   /db_xref="GOA:C5CIE6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIE6"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACR78880.1"
FT                   /translation="MWFNVDLRSRTPIYEQIKRGIREAILRGKLNEGDTLPSIRDMASS
FT                   IRVNPNTVARAYRELEMEGIVMAHQGVGYIVIKDKEGIKEFMLEDLKKDFREIVSKSRR
FT                   AGFSLDEIVEVISKIWNEKK"
FT   gene            complement(171779..172549)
FT                   /locus_tag="Kole_0155"
FT   CDS_pept        complement(171779..172549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78881"
FT                   /db_xref="GOA:C5CIE7"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78881.1"
FT                   /translation="MFYKEWNEHKTRAIVIFILSLIVLTTTVALRPYASSMMEQMVNEL
FT                   EEMPEFLQKMIGDPSIAQKLTNDEYYINSQWHGKNLGQFLPIFVLIIAFPVFAREVDKK
FT                   TIYFLLSRRKREEVFWKKFFVGYFVITAIIVIFSLAGPIAMKIAGYQIGFRNTGLILVH
FT                   EIVGVSFFYSLFILFSVLSNDQVKPVVGGLVVIIALPFLSLIESIAFLNPYPYILGLDI
FT                   INGSGIDWWYTLSLAVLTLVIAFQSYRIFKTKEF"
FT   gene            complement(172769..173530)
FT                   /locus_tag="Kole_0156"
FT   CDS_pept        complement(172769..173530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0156"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78882"
FT                   /db_xref="GOA:C5CIE8"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIE8"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ACR78882.1"
FT                   /translation="MKNWEIALQKFLKKWENKKEVIGAIVCGSYITGNPSKHSDIDLHI
FT                   LLDSDTSWRERGNEIIDGILIEYFVNPIRKHYEYLEDDYKQRSRVNAHMLCTGKVLFDK
FT                   TGELKKLIQDAREYLVKKYPEQNKIQIELAKYGIWDLCDNLEEVFEANGEEFFFVFYVH
FT                   LKELFEIYANFLQFDSIPVHKIKRFLTDEKDKKKYHVSNFPDQEFVKMYVNAINIKDKS
FT                   EMMKEYKMLTNHVLEKMGGFNIDGWKIKSPA"
FT   gene            complement(173631..173705)
FT                   /locus_tag="Kole_R0009"
FT                   /note="tRNA-Asn1"
FT   tRNA            complement(173631..173705)
FT                   /locus_tag="Kole_R0009"
FT                   /product="tRNA-Asn"
FT   gene            complement(173773..174138)
FT                   /locus_tag="Kole_0157"
FT   CDS_pept        complement(173773..174138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0157"
FT                   /product="protein of unknown function DUF1667"
FT                   /note="PFAM: protein of unknown function DUF1667; KEGG:
FT                   sat:SYN_02448 zinc finger protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78883"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="InterPro:IPR036593"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIE9"
FT                   /inference="protein motif:PFAM:PF07892"
FT                   /protein_id="ACR78883.1"
FT                   /translation="MKGHITCVLCPLGCRISISEKNGEYKIEGNRCPRGKQYAIDELVS
FT                   PKRVLTTNVKVVDGELELVSVKTSRPINKDIIINKMKEIKRVAVKAPVKVGDVIVEDLD
FT                   GKGTALIATRNVRKRSE"
FT   gene            complement(174135..175373)
FT                   /locus_tag="Kole_0158"
FT   CDS_pept        complement(174135..175373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0158"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: sat:SYN_02447 pyridine
FT                   nucleotide-disulphide oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78884"
FT                   /db_xref="GOA:C5CIF0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIF0"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACR78884.1"
FT                   /translation="MKKLKTDVLVIGGGAAGMAAAIGAAREGSKVILIEREDRTGGVLN
FT                   QCIHNGFGLKFYEEELTGPEFAARLEEEMSQKSIDIISQAYLREVDLDNKIAYILSPED
FT                   AFIVKSKAIVISTGARERPFGSLMVPGDRPAGIFTAGTAQRFVNLENRLPGKRALVLGS
FT                   GDIGLIMARRLFLEGMEVVGVVERLPYPGGLTRNVVQCLEDFGIPLYLSATVTYVKGFP
FT                   RLEAVEVMEVDKNLNPIPGTEKWYNVDTLVLSAGLLPQVEDFSDRLLVDRINRGFLVSN
FT                   TCETSKPGIFAAGNNVAVFDLVDYVAAEGWIAGRHAALTAQEKRQNHKQFPVVRGKNVG
FT                   VLVPGKISLEENLRIYLRLKKPMESGTVVLKELGIESSFKYGVPSEMLQIVVNKNKLAA
FT                   IKNHEKLTVEVIE"
FT   sig_peptide     complement(175302..175373)
FT                   /locus_tag="Kole_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.517 at
FT                   residue 24"
FT   gene            complement(175370..176815)
FT                   /locus_tag="Kole_0159"
FT   CDS_pept        complement(175370..176815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0159"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; BFD domain
FT                   protein [2Fe-2S]-binding domain protein; KEGG:
FT                   NAD(FAD)-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78885"
FT                   /db_xref="GOA:C5CIF1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIF1"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACR78885.1"
FT                   /translation="MRFAIIGGGVIGSLIAWKLSKYDVDVVLIEKKSDFGQGVTKANSA
FT                   ILHGGYDDPPGSLRARFCVLGNQMYRTLSHELGFEIKWTGSIVLARDTNEEIEKLKELM
FT                   KKGEENGVKGLQIIDRNEIEKIQPGIAEDYKYALYCPTAGVTEPWEIAINAADGAALNG
FT                   ATLIRGDGVVGGEIINGSIKTLKLSSGKTIRVDVVINAAGLYYEHVANLFGARTPKVFL
FT                   RKGQYILLDKIVGTRVEKIIFPLPNEKGKGKLVVPTVDGGVLLGPTSEDLPGFSPEDVS
FT                   TTLDGIKEVMEAGEQLMPGLAKREWVIKSFAGLRPETKEKDFFIQRSEELRNFITVGAI
FT                   RSPGLTAAPAIAKYVVEEIIHEEMGLALTGKTVIKYPEKKTRVKEKDFNELAEEISREP
FT                   LLGKIICHCNQVSEKEIVEAIRDGATTIDGIKFRTRAGFGRCQGGFCGWKIARILAREL
FT                   NIDISEVLQNEDESWLVREKVRP"
FT   gene            177136..177906
FT                   /locus_tag="Kole_0160"
FT   CDS_pept        177136..177906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0160"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; SMART: regulatory protein DeoR; KEGG:
FT                   set:SEN1438 putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78886"
FT                   /db_xref="GOA:C5CIF2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIF2"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACR78886.1"
FT                   /translation="MNKSESLKIISEIIRKEGNVSIKMVSEKLGVSESTARRYINELIK
FT                   ISSLPLKRVHGGVILDTGKGSLELMFDTKLSMNAEEKKRIAQKAVNFVEDGDSIIIDSG
FT                   STAFYMAKYLSKKRGIKVISVDIRVTEELAKNPDIETYIIGGIVRPGYYSIGGELAVET
FT                   IKNFSVEKVFLTVDAIDLENGITNSSMFEVYVKRALINAGKTVILLADSSKIGKKAFVK
FT                   VAPIESVDIIITTPGIDADTLKQLEDKGVRIVIV"
FT   gene            177918..178700
FT                   /locus_tag="Kole_0161"
FT   CDS_pept        177918..178700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0161"
FT                   /product="photosystem I assembly BtpA"
FT                   /note="PFAM: photosystem I assembly BtpA; KEGG:
FT                   jan:Jann_2112 photosystem I assembly BtpA"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78887"
FT                   /db_xref="GOA:C5CIF3"
FT                   /db_xref="InterPro:IPR005137"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIF3"
FT                   /inference="protein motif:PFAM:PF03437"
FT                   /protein_id="ACR78887.1"
FT                   /translation="MATVKEIFGKEKVIIGMVHFPPLPGSPLYDDKKGVEFIVERIKSD
FT                   LKSLQNGGIDAVMFCNENDRPYKLKVDSATVATMSRAIGEVMDEIRVPFGVDVLWDPFA
FT                   AIAIAKAVGAKFIREIITGTYVSDMGLWKTEVGEFYRYRKLLDANDIAVFFNISAEFAY
FT                   NLDRRPLEEIAKSVAFSSLADVILVSGPMTGESPSLDHIKKVKDKVGEKPVFANTGVTK
FT                   ENVREILNIADGAIIGTSLKKDGITRRFWNGSYFNSHR"
FT   gene            178672..179937
FT                   /locus_tag="Kole_0162"
FT   CDS_pept        178672..179937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0162"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: rru:Rru_A1267
FT                   carbohydrate kinase, FGGY"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78888"
FT                   /db_xref="GOA:C5CIF4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIF4"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ACR78888.1"
FT                   /translation="MVPTLILIDENGKPLYNSIQQNDSRAIEEIEYFKKMIDKEVYFSV
FT                   TGNTVNQQVIFPKFLWLRKHVPDKVKHTRWIMGSYNFINFKLTGIPNLEKNWALESGLW
FT                   KIEDGWYKDILDASEIPESILPEVYEPWDIVGGTTRELEEETGIPEGIPVTAGSADHIA
FT                   SALAVGMSRNGDLLLKFGGAGDILFVTEQLKLSKKLFIDYHDIPNCYVLNGCMASSGSI
FT                   VKWFKNEFAPNVNFDELTEMARTAGVGSGGIVMLPYFIGEKTPIFDAKARGTMVGLSLF
FT                   HNKGHMFRSILEAVAFGFRHHVEVIEEMGFAIERVFMSNGGAKNELWRQIVADVVGYDA
FT                   VYITNHPGSSLGAAFIAGKATGMFEDWDEINKFLKTKEKISYDQDNHEVYSKYYEIYRD
FT                   TYTSLKSVFEKLYEVYHEKSES"
FT   gene            179961..180752
FT                   /locus_tag="Kole_0163"
FT   CDS_pept        179961..180752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0163"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR;
FT                   NAD-dependent epimerase/dehydratase; KEGG: ara:Arad_9891
FT                   short chain dehydrogenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78889"
FT                   /db_xref="GOA:C5CIF5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIF5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACR78889.1"
FT                   /translation="MSNCKRFEGMTVFITGAGKGIGKAISKAFAKEGAKLALADINKEV
FT                   LNETLGEIKQYSPDSRAYVLDVTNETLVKNVVEIVLEDFGTIDILINNAGVSTMNWFWE
FT                   LTEEEWDYNMNVNAKGVWLVSKHVAPHMIKKRKGKIVNTASMASKIGAPLLAHYSASKF
FT                   AVIGFTQAISKELAPYNINVNAVCPGFVKTSMQDREIVWEAKLRGIDEPEKVREEYIKQ
FT                   TPLGRLCYPEDVAKVVLFLASEDADFLTGQAINVTGGACTH"
FT   gene            180794..181615
FT                   /locus_tag="Kole_0164"
FT   CDS_pept        180794..181615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0164"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rru:Rru_A1263
FT                   binding-protein dependent transport system inner membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78890"
FT                   /db_xref="GOA:C5CIF6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIF6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACR78890.1"
FT                   /translation="MTRSEKRWNIIAHAVLIVFSILILFPIIWTIRTSFASDVIAYEIP
FT                   PKLIFKPTIKNYMDIFVENNFLLYFRNSFIVSIVSTLISIPIASLAAYAFARYNVGGSK
FT                   FRMLIIQTQMLPPVVLIIPLFVIFMKLGLTNTLTGLIISYLAFNLPFLIWTLIGFFESI
FT                   PRSIEEAALIDGANRFVAFVRVVFPIAAPGIMAAAVFSFILCWNEFLFSLVLSGPGTAT
FT                   IPVRLAALQTSRGVLIGKLSAGVVIAILPIVILSQFIQKYLVRGLSFGAIK"
FT   sig_peptide     180794..180904
FT                   /locus_tag="Kole_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.945 at
FT                   residue 37"
FT   gene            181655..182917
FT                   /locus_tag="Kole_0165"
FT   CDS_pept        181655..182917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0165"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rru:Rru_A1262 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78891"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIF7"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACR78891.1"
FT                   /translation="MRKFWFALLLLVISTSLMATTLNVLMEDVPETHIIKKLLPEFEAS
FT                   TGIKVNFEIVQYGDMHAKLVPQLLSPNCQYDLLQVDNYWAGEFSAAGWLEPLEKYVERD
FT                   GFDISVYLPSMLNMVGYYNGTLYMIPMYNYAMGLIYRKDVLEDPEIQNMYRRKYGKEIA
FT                   IPRSLDEYVELCKFIQENTNLYGSAMQAQRGDPIVMEWSNYLFSSGGDYYDEKWHSIIN
FT                   NEKGIKATQLYIDLLKHGAPKGALSFNLDDAYRIMSQGKAFSMISYNWMVAQLNDPEKS
FT                   RIAGKVALEPMPGGVGLNGGWGWAIPRNAPDKEASWKFIKWVESFKVAKQRALLGGAPT
FT                   RFDIFTDEDVVKAFPYYPKIMWLVMTAKPVPEFQYSSQMIEITGRELSLAATGEKSISK
FT                   ALDTIAKELDKLSKLAKLWKK"
FT   sig_peptide     181655..181714
FT                   /locus_tag="Kole_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 20"
FT   gene            182935..183828
FT                   /locus_tag="Kole_0166"
FT   CDS_pept        182935..183828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0166"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rru:Rru_A1261
FT                   binding-protein dependent transport system inner membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78892"
FT                   /db_xref="GOA:C5CIF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIF8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACR78892.1"
FT                   /translation="MISKYMKNEKLTGWIFATPSLIVLGAVIAVPLIYSFIVSFSDYTF
FT                   VSPFFNFVGFQNYLAAFQDSYFWNSLKVTLKFVVLVVSMEFAIGFVIALMLNREIRLKK
FT                   LYYTILTLPMVMSPVAVGLIWKMLLHPDLGVINYFITSLGLKPVNWLANSTNAFWTLIM
FT                   VDIWQQVSFMILLLLAGLVSLPKEPYEAATIDGANETQKFLYITLPLMKPVIAAAITIR
FT                   IILAFRTYDLVYVLTKGGPGVKTEVLSYFIYRKTFMGLNLSEASATSYILLLVVMVIVI
FT                   LAFRFILKSQNIGEQQ"
FT   sig_peptide     182935..183024
FT                   /locus_tag="Kole_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.819) with cleavage site probability 0.588 at
FT                   residue 30"
FT   gene            183865..184638
FT                   /locus_tag="Kole_0167"
FT   CDS_pept        183865..184638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0167"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: mgm:Mmc1_0078
FT                   inositol-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78893"
FT                   /db_xref="GOA:C5CIF9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIF9"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ACR78893.1"
FT                   /translation="MNIKTMIKAAEAAGKLALKYFRSDFLKYETKSSSADLVTEIDIAS
FT                   QNEILDVLSKNCPGIPIITEEKNPQTYPEKYFLVDPLDGTLNYFHGIPLFCVSIALIDK
FT                   GYPVLGVVHVPTFSETFTAEKSKGAYLNSKRIQVSNKLRLEDALCVTGWPYNKKLHNWT
FT                   QNAVRKMLEVTQEVRILGSAALELCYIAAGNLDIYFEIGLSPWDIAAGYLIASEAGATV
FT                   SSISVDGFELNLGEILATSPAIYADTLKILRKSSE"
FT   gene            184831..185370
FT                   /locus_tag="Kole_0168"
FT   CDS_pept        184831..185370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0168"
FT                   /product="glycerol-3-phosphate responsive antiterminator,
FT                   GlpP"
FT                   /note="PFAM: glycerol-3-phosphate responsive
FT                   antiterminator; KEGG: baa:BA_1143 dihydroorotate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78894"
FT                   /db_xref="GOA:C5CIG0"
FT                   /db_xref="InterPro:IPR006699"
FT                   /db_xref="InterPro:IPR035928"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIG0"
FT                   /inference="protein motif:PFAM:PF04309"
FT                   /protein_id="ACR78894.1"
FT                   /translation="MLKGIIAALWERTIPPERVPNDTIFFLNGGLLELPERVKRFKESG
FT                   KRIYVDIDFISGLNSDHDSVQYLKEIGVDGVITAKVRTYKIALSLGIPGLLRFFALDSR
FT                   AVDRGLEQILHNDVRAVEILPGLAACKVSKKLRGLLPNVNIVAAGLIDNVEELKMIKPY
FT                   VDAISTSNKELWYQSW"
FT   gene            complement(185419..189942)
FT                   /locus_tag="Kole_0169"
FT   CDS_pept        complement(185419..189942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0169"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Fibronectin type III domain protein; SMART:
FT                   Fibronectin type III domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78895"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIG1"
FT                   /inference="protein motif:PFAM:PF00041"
FT                   /protein_id="ACR78895.1"
FT                   /translation="MSRKSKSLSSPTLSFVLLAILVIGMIFTLSSCTEPPKILVNAVSP
FT                   VPRNNDDTVKYSKTIELSWDVMYKKTSETLTAEIWMGESKDALRKIAEGVKGVPSREAK
FT                   DIVKFSYEANVKPHKQYWWKVKVFNEKGKYDESEIWTFKLKNSDPDKPELVAPANNSAN
FT                   VTARGLTLKWISGGDPDGDNLTFTVMFDTDIRFTNPEKVNVGSATSYTIEELEFGKKYY
FT                   WKVIAKDGYGGERISGTYAFTTEVAPRLKGITLISPADTSVVGEQPVELTWKVEYNRYY
FT                   WPVKFQIHIVSDEGEKVFGPVVKNPEELSSPIKFVLDEKLKGHTSYKWYVVAEGAYDGK
FT                   AIKSDEWAFEMSNTEPEVAFVYPAEEMQEVSRDATFSWIGTDADGDSLVYDVYIAKVGE
FT                   LYTTLATNLEDDFIAVTGLDSASTYSLKVVARDTYGGQGSVERKFVVGNRAPVVEILSP
FT                   EDGTFIDPRSVVLEWHCFDPDGDDVIYHVFIRQAEGEEEMYETPDSTFKLEKVQARSQY
FT                   FWRVEAIDSKKASTVTEEHMFFTENTEPNRPIAESPTPGATDLDNFDRLIFAWSCDDPD
FT                   GDALTYTIEIATDTTFETLIASATLEEKTITVEGIFSPRSTYYWRVTATDGAATVTSDV
FT                   WEFSTFDEPPVVELKEPFDGAPVSTIKSKFSWSVFDQDDPVFTAKLFLLPDGEEEPVVV
FT                   DLGANVEEVELDFPLTPDTTYTWWVVASDPIGKKGISEKRSFVTGNEKPVIEITGPGDL
FT                   WKYGAVAPLEFTWEATDPEGEDVFVEVYFDTSKVPETLVATGINLSSFVAENLAPDSIY
FT                   YLNIVATDAHGAKNWLEQPERIETADSNLEYLSPEDGSVIDPATATFSWEYTSDDGTVN
FT                   YIFVLYDSEEKMIDREFVGSKTSLTLPEIFSKEVVDSLLGNRTYYWKIKIEDEEPRYGK
FT                   VSSFIVEDNPVEFSNPTPMDGSEDVETTDVVLMWNAYDPDNAKLVFDVYLDGQAEPLYT
FT                   GLITPVATITTPLESHKKYTWHVVARDEFGNSTESPKWTFTTKNNPPAVELIAPENDAT
FT                   DLTGEIVLSWEGTDTDGDTLFYTLYIGTDVDNMQQIDLATETTYGFTEYSGNKVYYWKV
FT                   EASDGIDSAVSDVWSFVTGNAAPRVQLSVPENGSEMVSLSPEFEWKSEDPDGDEIVNTI
FT                   YLGEDPDVLTFVATTSEDSYKLTEILNAGSTYYWRVKATDSRGGSSNSEVYTFTTAPER
FT                   DKVVYIENGVLVEKIFAEGIDEVYERRLTDLDLNSEVAPIINGDLVYVINNNGDLIALK
FT                   LGYSTTQPAFKQELGLGLKDPIDMVYADNALWILDIDPAVGAKVYKVSLDDQGLPGQSE
FT                   VIYNGLFISDIDVSEDASKIVLADFLSGVVKLTRDEDGNYKYAGEEGGNAQAVVLKDDV
FT                   AFVGETGAKGGLKYVDLNIMKETVVDSFYAVTRLLLKGNALYAIADGDLVVLNVEDPYN
FT                   PEIVKAIKDVAKVKQLVAGEKMLAVVTEEGVILFDITDPMNPVKLD"
FT   sig_peptide     complement(189841..189942)
FT                   /locus_tag="Kole_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.672 at
FT                   residue 34"
FT   gene            complement(189955..191253)
FT                   /locus_tag="Kole_0170"
FT   CDS_pept        complement(189955..191253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0170"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afw:Anae109_1868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78896"
FT                   /db_xref="GOA:C5CIG2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78896.1"
FT                   /translation="MVKSQRMVTKVYLGDLHIGDGTFETDFEYDNELADLIESLVISGC
FT                   SELVIVGDGLELVNSNEVKSLGLLPYPILSRSLTSRLISDIESRHTRVFDAFRRFSEYG
FT                   KIVYVVGNHDHYLLENPELRNSLIEALGGQKNVRILPFYYDAEMQLFTLHGNQFDIVGR
FT                   FSKDDNGNLLAPFGNFMARYMVLNFEEKLKRLNAPVPFINDYRFVHPTLDVFQWFEHIR
FT                   QRYDVDTDLLELWTKTFIEMLKTPEAQSWLKTNYPRLRYLTTIFVNRFGGMKFGEWIIR
FT                   VIMSFRRFMQTDYLYRCARRILGCSFEKGFKKVMRKTNFVGYCNGVPEVLPTDIKGVIM
FT                   GHNHRHTLRGIPVDGELKFYANTGTWQPVVEMVDRKSSNSFVKRAQLSYLIVQKIGKDL
FT                   NIESRHVMKLNGIGSDQRYGSDKFTANEINIRV"
FT   gene            191354..192274
FT                   /locus_tag="Kole_0171"
FT   CDS_pept        191354..192274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0171"
FT                   /product="sugar transferase"
FT                   /note="PFAM: sugar transferase; KEGG: azo:azo3193
FT                   glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78897"
FT                   /db_xref="GOA:C5CIG3"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIG3"
FT                   /inference="protein motif:PFAM:PF02397"
FT                   /protein_id="ACR78897.1"
FT                   /translation="MFFYVIDFLFSIPLITNSVEDFLLAFLISGFVSLSMRGYESQIIL
FT                   DPKERKISFFGSLVMVTILFFVFTGSDIIILLPALLSALFRYTILFRFKRFFKLRPMTV
FT                   DPGTVEEDFQELVHVKTYDGFKRFLDFVFGVVFLILLTPIFLIIAVLILITSGRPVFIT
FT                   QDRMGRNEKVFKMLKFRTFTNGEHHKRITRVGKILRPLRLDELPQIINIILGEMSLVGP
FT                   RPELKAFHEMGKKHVPNYKLRLLVRPGLTGWAQINYKYTTTPEEYMIKTSYDLYYVLNR
FT                   SLRLDILCLLKTPYAVIKSLVSKDF"
FT   gene            complement(192345..194099)
FT                   /locus_tag="Kole_0172"
FT   CDS_pept        complement(192345..194099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0172"
FT                   /product="hydrogenase, Fe-only"
FT                   /note="TIGRFAM: hydrogenase, Fe-only; PFAM: hydrogenase
FT                   large subunit domain protein; iron hydrogenase small
FT                   subunit; ferredoxin; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; KEGG: sfu:Sfum_0844 hydrogenases, Fe-only"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78898"
FT                   /db_xref="GOA:C5CIG4"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR003149"
FT                   /db_xref="InterPro:IPR004108"
FT                   /db_xref="InterPro:IPR009016"
FT                   /db_xref="InterPro:IPR013352"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036991"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIG4"
FT                   /inference="protein motif:TFAM:TIGR02512"
FT                   /protein_id="ACR78898.1"
FT                   /translation="MPVTVTINGKQYQVEENRTVLEVCREIGIEIPTLCYHPALSIVGA
FT                   CRVCMVEIEGARNLSPACATYVTDGMVIRTNTERVNRSVRFNLALLLSSHPNDCMTCDA
FT                   NGRCEFQDLIYRYDIKDMFPKDLRNIPYDTSSPSLFRDMNKCILCGRCGRACKELQGLS
FT                   ILSVAGRGYHSIPVPALGAPIAATDCINCGQCATVCPVGAITERMDFRRVAEELYKHEK
FT                   VLVVQTAPAVRVALGEEFGEEPGTISTGKMVAALRKLGFDYVFDTDFAADLTIMEEGSE
FT                   LLQRIKEGGKFPMFTSCCPGWVNLMEKLYPEFRENLSTAKSPHEMLGALIKTYFAKKIG
FT                   KDPKDIFVVSVMPCTAKKDEAERETLLVRGHVAVDAVITTRELGKLIKMKKIPYESLPE
FT                   EEYDTPLGISTGAAVIFGATGGVMEAALRTAYELYTGKELPKLDFEFVRGFEGVKEAEV
FT                   DLDGKILKVAVAHGGANVVKLMDKIKSGEVYYDFVEIMACPGGCIGGGGQPKSTRPDYL
FT                   ERRMQAIYEIDENMPIRKSHENPAIKKIYEEYLEHPLSHISHELLHTHYLDRKKSVVER
FT                   KKELEEVN"
FT   gene            complement(194262..196637)
FT                   /locus_tag="Kole_0173"
FT   CDS_pept        complement(194262..196637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0173"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: bsu:BSU30320
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78899"
FT                   /db_xref="GOA:C5CIG5"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIG5"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ACR78899.1"
FT                   /translation="MYDFKSIEKKWQKYYEEEEPFKVDLKNAKKPFYNLMMFPYPSASG
FT                   LHIGNMYSFIGSDVYGRYKKLQGYDVFEPIGFDAFGIHSENYALKVGEHPAKLTPKSIK
FT                   YFRDEQLKKIGNIYDWSSEVNTSSPEYYKWTQWIFLQLYKAGLAEKKNSEVNWCPSCKT
FT                   VLADEQVIDGKCERCSTEITKREMSQWFFKITKYADRLLENLEKLDWTETTKNIQRSWI
FT                   GRSEGAKIRFPVENSDIEIEVFTTRPDTIYGVTYLTLAPEHKLVKKLIKEDKFSQFEEF
FT                   LESVKKMDVATRTSKTRPKTGMFTGSYAIHPLTGERIPIWVGDYVLVEYGTGAVMAVPA
FT                   HDERDYAFAKKYGLEIKQVIECDPEDLPYTEKGIMINSGPYTGWKSEDFIANIDSVHEK
FT                   IESAVTYHLHDWCVSRQRYWGPPIPIIYCDKCGIVPVPEEDLPVLLPETDDYIPDGSGK
FT                   SPLARNEEFVNTTCPKCGGPAKRETDVSDNFLDSAWYFLRYISPHDQDRPFDPELAKKW
FT                   LPVDMYIGGNEHANLHLMYARFITMALHDLGILHFEEPFKSFRGHGLIIKDGEKMSKSK
FT                   GNIVNPNDYFDTHGVDALRTYLMFMGSFLEGGDFRDSGMDAIKRFLNRVWEVANKPEGE
FT                   SSLQLKIKMAETIKKVEYSIENIKYNTAIAAIMEFINEAVKEERIERQLVVDLAKLLAP
FT                   FAPFICEEIHEMKGGKGTILNAGWPTGYDKYLSMADVEIPVQINGKMRGKVKIHQKASE
FT                   DEVIEKIKGDERLAHYLNKGEIRKVIYVQDKIINIIVK"
FT   gene            complement(196763..197890)
FT                   /locus_tag="Kole_0174"
FT   CDS_pept        complement(196763..197890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0174"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA4111 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78900"
FT                   /db_xref="GOA:C5CIG6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIG6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACR78900.1"
FT                   /translation="MASSINTVAASWQLPYFSIGLLNFLGSIVYVLSTLTFGRLGDKIG
FT                   FKLLLIVSMVLFGLFLPVGFLWSQVWHLFLFVVVMNLFFGIFFPCIEGLISSREKSEGV
FT                   SPVATTMRFTLSWSIGNIFGMAFGPFLIERLSFLVFLYGMVLSFLAAFLIYSHFRKYGD
FT                   HLPGPYSPKLLNTRAKIDFPRIRLYRKTYRLTFVIAGIIYSAVLALFPKILSFYNLPLE
FT                   KVGFFIVGANIGVFLSFVLLTLFRFWVGNPGFSFLLMAVFPVTAASFFLSPSPAVFFLI
FT                   AFLAGVTYAVPYTFAIFYGLSSQENDHGKQGGIHEAMVGIIFGFGPLIGGLFLELWPDL
FT                   KSLGVMTALLCLVSYAIQLRFLKRLHEEDEASQRL"
FT   gene            complement(198050..199315)
FT                   /locus_tag="Kole_0175"
FT   CDS_pept        complement(198050..199315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0175"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: kpe:KPK_4987 ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78901"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIG7"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACR78901.1"
FT                   /translation="MKKLLLVITMVLALSIFAMAEKIEVEFWHAMGGGHGKALEEIVNL
FT                   FNETHPDIEVKAIYVGNYGALSQKLLASAESGNLPVLSQAYGNWTAKLIPRGVVQELDS
FT                   FIKNPDYGLTEEQWDAIWAPFKKMITWGDTVYALPFNKSTYVLYYNTDAFEAYGLRPPE
FT                   TVEDLFFDAMMLTEDKDGDGEIDQFGFGFRTTIDHFVVFLRANKGKIIEVKDDGSIEIT
FT                   INSPEAKEALQFMYDMVHTYKIAYTQGGYLDGVFGDGKIMMFIETIASKPYVERASTGK
FT                   HGWAWAPVPLWKTQAPPFAGTDLIMFSTASEEQKKAAWEFMKFLISPEIQAYWSVKTGY
FT                   MPAVKTALETAQWKEYVKQHPEAMVPINQIPKGTTDPNIAEWYEVRSVIGQMVGDVMNN
FT                   KRTIDEGLAWAEAELHRLIFGE"
FT   sig_peptide     complement(199253..199315)
FT                   /locus_tag="Kole_0175"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 21"
FT   gene            complement(199356..199937)
FT                   /locus_tag="Kole_0176"
FT   CDS_pept        complement(199356..199937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0176"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="KEGG: sat:SYN_02876 dephospho-CoA kinase; TIGRFAM:
FT                   dephospho-CoA kinase; PFAM: Dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78902"
FT                   /db_xref="GOA:C5CIG8"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIG8"
FT                   /inference="protein motif:TFAM:TIGR00152"
FT                   /protein_id="ACR78902.1"
FT                   /translation="MKIIGVTGKAGCGKSLLVSLLSGPETKVIDLDRLGHEVLKELKSQ
FT                   LVLTYGSGILDNSRKKIDRKKLGEIVFKDSRKLKLLNSIVHPLIKEKVKKIISKTRKKY
FT                   VLIDGALIHQIGLGKLCDLIIWVDCPDEVAIKRLASRGIPRERAISILNSQKELENYKV
FT                   YSDIAIDNTGSPQELLIKVREILRGKEIML"
FT   gene            complement(199937..200203)
FT                   /locus_tag="Kole_0177"
FT   CDS_pept        complement(199937..200203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0177"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78903"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78903.1"
FT                   /translation="MNDMVNYLVECLKEYKLEEFYHLEGDEVPFYVIVSQEPEKVIEVL
FT                   QSLDDLEADVVVLSPEEKEAIGSTNSEIAAAVSKAIEKGQKVL"
FT   gene            complement(200200..201561)
FT                   /locus_tag="Kole_0178"
FT   CDS_pept        complement(200200..201561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0178"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   afw:Anae109_2086 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78904"
FT                   /db_xref="GOA:C5CIH0"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIH0"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ACR78904.1"
FT                   /translation="MLKFDFSFAFKENLGTGLSKDEVFNNREFAKRSLLDVIESEPGFL
FT                   RILKTDEYLDEVEALKDWVKNFDTLVVVGIGGSALGNLALHASLKPMNWNLLSEEEREG
FT                   NLRVFVVDNVDPHFVGSVIEQIDLDRTLFNVISKSGTTAEAMANYLVVRGILEKRGLDI
FT                   SEHLIFTTDPEKGVLRQIAKEEGIRTLTIPQDVGGRFSVLTPVGLFSAMAEGIDIRKLY
FT                   EGARNGVKRYSESSADTNPVLVNALLHYSYLKDGKSISVMMPYSNQLYLLADWYRQLWA
FT                   ESLGKKYDLDGNVVNTGQTPVKALGAVDQHSQIQLYNEGPKDKIVTFLKLEKFPGDLQI
FT                   PELHSEIEALSYLGGKSLSELLNSEQEGTAMALTENGVPNLTLRFDELSESSVGEFIIY
FT                   YELLTAVMGAMLNINPYDQPGVELGKKITYSLMGRKGYEAFAGKFSEKKWRFEL"
FT   gene            complement(201575..202087)
FT                   /locus_tag="Kole_0179"
FT   CDS_pept        complement(201575..202087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0179"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="KEGG: sus:Acid_7098 adenine
FT                   phosphoribosyltransferase; TIGRFAM: adenine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78905"
FT                   /db_xref="GOA:C5CIH1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CIH1"
FT                   /inference="protein motif:TFAM:TIGR01090"
FT                   /protein_id="ACR78905.1"
FT                   /translation="MNLKDFIRDIPDFPKPGIIFKDVTPMLKDPGAFKVCISSLKELVK
FT                   DFEFNLIVAPEARGFIFAAPLALELEKGFVPIRKPGKLPYKTVSVEYSLEYGTATLEMH
FT                   TDAIKEGDKVLIVDDVLATGGTMKAIAEMVEKVGGTISGIVSLVELSFLEPRKKLSGYE
FT                   VRSIITY"
FT   gene            202244..202738
FT                   /locus_tag="Kole_0180"
FT   CDS_pept        202244..202738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0180"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 24 kDa
FT                   subunit; KEGG: pca:Pcar_1846 NADP-reducing hydrogenase
FT                   chain A"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78906"
FT                   /db_xref="GOA:C5CIR5"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR028431"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIR5"
FT                   /inference="protein motif:PFAM:PF01257"
FT                   /protein_id="ACR78906.1"
FT                   /translation="MSHVGCEDHEKLYTQLNEYIDQVKEEPGVLINVLHKAQELFGYLS
FT                   EELQQHVADKLGVPLSQVHGVVTFYNFFTTKPKGKHQVKICLGTACYVRGADRILERFK
FT                   EELGVDLDEPTSDGLFSLHGVRCLGACSMAPVVLVGERDFYGKVTPDEVSAIIKKYRGE
FT                   K"
FT   gene            202738..203115
FT                   /locus_tag="Kole_0181"
FT   CDS_pept        202738..203115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0181"
FT                   /product="NADP-reducing hydrogenase, subunit B"
FT                   /note="KEGG: dat:HRM2_16520 NADP-reducing hydrogenase,
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78907"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIR6"
FT                   /inference="similar to AA sequence:KEGG:HRM2_16520"
FT                   /protein_id="ACR78907.1"
FT                   /translation="MAKIKSLEELMKIKENALKELKMRDSEKRGKIIVAMGTCGIAAGA
FT                   KETLKAIVETLNEKGIDDIAVVQSGCFGLCDVEPTIEVHMENSEPIIYGHVTPAQAKRI
FT                   IEQHVIEGKVVGDLIVKRGEL"
FT   gene            203131..204930
FT                   /locus_tag="Kole_0182"
FT   CDS_pept        203131..204930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0182"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dat:HRM2_16600 NuoF"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78908"
FT                   /db_xref="GOA:C5CIR7"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIR7"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACR78908.1"
FT                   /translation="MPTVENTILICAGGACISAGEKSVKDALQDLLKEYALDSVVKIIE
FT                   TGCMGACDLGPIIIVYPEGIFYQKLTPENVRRVVEEHLLKGRIVEDMLYKGEFGEVKAK
FT                   PQEELPFFTKQVKIATRNLGVIDPLSIDEYIARDGYFALHKAIKEMTPEEVISEVKKSE
FT                   LRGRGGAGFPTGLKWEFVRKAKGDIKYVICNADEGDPGAFMDRAILEGDPHSVVEAMTI
FT                   AAYAVGAQKGFIYVRAEYPLAIERFSKALETAREYGFLGKNILGTGFSFDIEIRIGAGA
FT                   FVCGEETALINSIEGKRGVPRVKPPYPATYGLWGKPTLINNVETYANIAPIILHGGDWF
FT                   AQYGVEGSRGTKVFALAGKIKNTGLVEVPMGITLRELIYEIGGGVPDGKKLKAVQTGGP
FT                   SGGCIPEEHLDTPITYDNLKKLGTIIGSGGMIVMDEDDCMVDVAKFFLEFTVEESCGQC
FT                   TPCRDGTKKMLEILEKITAGEGTEEDLEVLKELGEHIMKTSLCGLGQTAPQPVVSTMRY
FT                   FWDEYIAHVKEKRCPAKRCKELTRVVIDEEKCVGCTACARVCPVNGIIGDIRKPHRIDP
FT                   EICTRCGSCIEVCRFDAIKKVSP"
FT   gene            205002..205505
FT                   /locus_tag="Kole_0183"
FT   CDS_pept        205002..205505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0183"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 24 kDa
FT                   subunit; KEGG: pca:Pcar_0833 NADH:ubiquinone oxidoreductase
FT                   24 kD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78909"
FT                   /db_xref="GOA:C5CIR8"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIR8"
FT                   /inference="protein motif:PFAM:PF01257"
FT                   /protein_id="ACR78909.1"
FT                   /translation="MAVEEVKETVASIYEKVMSESLEKGDILINTLHAIQDYYGNYIPL
FT                   EATEALRDIMGIPLSKIYEVLTFYTMFSTEKRGKYIIRVCKSLPCHVTGGEKVVEALKD
FT                   TLGIDFGNTTEDGLFTLEESSCLGLCGVSPVMMINDEAYGNLTPDKVEKIINEIREKER
FT                   SDAR"
FT   gene            205502..207121
FT                   /locus_tag="Kole_0184"
FT   CDS_pept        205502..207121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0184"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /EC_number="1.6.99.5"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit; KEGG: dat:HRM2_16600 NuoF"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78910"
FT                   /db_xref="GOA:C5CIR9"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIR9"
FT                   /inference="protein motif:PRIAM:1.6.99.5"
FT                   /protein_id="ACR78910.1"
FT                   /translation="MKPITVLVSVDSNSVLLGARHFKNHLVGLVKKYNLDGIVEVLETG
FT                   SFGRYDEGALFLLLPDNIFYKINSEADVERFVEEQLLKGRRVEDLIVEELEGSETIEAR
FT                   TITKEERIVLKRAGEINPKNIDEYIAFDGYQGLAKALQMSPEDVIKEVKESGLRGRGGA
FT                   GFPAGLKWEFTYKVDAKEKYVICNADEGEPGTFKDRLIMEGDPHSVIEGMAITAYAVGA
FT                   NKGYIYIRGEYFESVNNLRIAISQAYDYGLLGENILGTNFSFDLSVRLGAGAYVCGEET
FT                   ALIESIEGHAGRPRLKPPYPPVKGLYQKPTVVNNVETFANVPWIVLNGAEWFRSIGTES
FT                   SPGTKVYSLCGNLVRRGITEVPMGTTVAELIYKHGGGIANGRNLKMVQTGGAAGTFIKP
FT                   DEINTPLDFNSFRDYGVALGSGVILAVDDTHCAVDVALNLMEFFAHESCGKCSPCREGT
FT                   KLIVNILKEISKGRGTKEMIGQLYDIAETMQNSAFCGLGQSVPVPLRSLLDRFRDEIEA
FT                   HIGAESCPVGVCKFEKKKKKRK"
FT   gene            207193..208014
FT                   /locus_tag="Kole_0185"
FT   CDS_pept        207193..208014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0185"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bap:BUAP5A_259 membrane-bound lytic murein
FT                   transglycosylase E"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78911"
FT                   /db_xref="GOA:C5CIS0"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIS0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78911.1"
FT                   /translation="MSGEKKYDLPVFLLILSIIVGLAAIIWYMPTNPRILTGKQTEKIR
FT                   RLSVLYNAGLNSDCGAILSNESYDYDDSVLEAYRYFFGINRKPIVMLAGIKTVDNKGKK
FT                   IFSSNPVIESYVNKNMRKVMPELRKRIERAVLSLNSFSKSDTTFKKRIAQEIYHAIMDF
FT                   SSAKVALTINNETIDLDLSKVDPYLVASIMLVESMMNPYAVAEERSIKQDFSDTIYSRG
FT                   LMQIYETTFWQLKSWINNSELDMTVDDLWSIRNNIFLGMVYLAYAQTLIER"
FT   gene            208020..209510
FT                   /locus_tag="Kole_0186"
FT   CDS_pept        208020..209510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0186"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: vpa:VP2077 maltodextrin
FT                   glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78912"
FT                   /db_xref="GOA:C5CIS1"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIS1"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACR78912.1"
FT                   /translation="MFDWHTSKVVYQIFPDRFNIGDGKTAKQKENEGLYPLPGQRTVDW
FT                   KEKPKRTGDRTQQLLFWGGDLKGITEKIDYIKSLGAEIIYLTPIFYAHTNHKYDTIDFF
FT                   RIDPAFGTLQDFKELCETAHQKDLKIILDGVFNHVGFASKWFNGLNLFPEKGAYQSPNS
FT                   PYRDYFYFSGDKYRSWVNSGSLPELNLDNPELQEILFTGKNSVVKYWLKQGADGWRIDC
FT                   AHDIGNLNHIIVEAAKSVKPDALIIGEVWNYPKGWNEFARLDGIMNYHFRSLVIDLLKA
FT                   DMPVETVAKIMKDTVEDCGIDYLSKCWNMLSSHDVPRLSNLFDNERDIRLAIALQFSFP
FT                   GVPMIYYGEELEMTGGEDPENRDAMRWENLSNSPERLNFYKKLTEIRKKKIALQIGSFG
FT                   ILYTSQPDRTIVFKRSTERIDDLLLIAFNLSFEKVQFKTYINESTLMTGTLFRDLFTGE
FT                   TFRTDVSNITLQVEPRSFRILEPIIERVPDRYTPYKRV"
FT   gene            209515..210432
FT                   /locus_tag="Kole_0187"
FT   CDS_pept        209515..210432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0187"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bsu:BSU02210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78913"
FT                   /db_xref="GOA:C5CIS2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIS2"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACR78913.1"
FT                   /translation="MNKRVTATLLLATTAIIWGESYLFTKVAVESMPPMTLALFRFIVA
FT                   VAVFIPVQIKKGVCPKRTTKQRFNIAMAGFFGVTLYFLFENYGLRLTSASDASLLVSSA
FT                   PILTMILYDILHRKFDGLEYLGSTIAFIGISIVIYGGQFSEGSSVLGNSLSFLAALSWA
FT                   GYTYFFDKVKDSSIATIVQLMVWGIVFITPFSIIEVFFLKDPVIFSVEAVSGVLYLGIL
FT                   ASALGYLMWGKGIHLWGGKAATLWVYTIPVFTILGDIIFLKHRPSLFFYVGALLVGMGM
FT                   SIAIWRQRKHLQVQEENASTQGLH"
FT   sig_peptide     209515..209574
FT                   /locus_tag="Kole_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.862 at
FT                   residue 20"
FT   gene            complement(210365..210823)
FT                   /locus_tag="Kole_0188"
FT   CDS_pept        complement(210365..210823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0188"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: glo:Glov_2047 methylated-DNA/protein-cysteine
FT                   methyltransferase; TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78914"
FT                   /db_xref="GOA:C5CIS3"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIS3"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACR78914.1"
FT                   /translation="MATELGVVTTEIGAILLHADYGMLSRIELVFDSKLAPKSLPPFTT
FT                   QIQEYLEGCRKTFDFPLYLPYAGFKKKVLLYVKEIPFGRVVTYGEVAKAAGSPGAARAV
FT                   GQIMKRNPLPIVIPCHRVVSARGIGGFSAGLEWKRFLLELEGVSFDAI"
FT   gene            complement(210837..214358)
FT                   /locus_tag="Kole_0189"
FT   CDS_pept        complement(210837..214358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0189"
FT                   /product="chromosome segregation protein SMC"
FT                   /note="TIGRFAM: chromosome segregation protein SMC; PFAM:
FT                   SMC domain protein; SMCs flexible hinge domain protein;
FT                   KEGG: bha:BH2487 chromosome segregation SMC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78915"
FT                   /db_xref="GOA:C5CIS4"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIS4"
FT                   /inference="protein motif:TFAM:TIGR02168"
FT                   /protein_id="ACR78915.1"
FT                   /translation="MRLVSIFIKGFKSFAYPTKIDISKGITAIVGPNGSGKSNIVDAIR
FT                   WVFGEQSMKTIRADNREDVIFAGSEKNPPANSAVVKLTFEDERGLITIGREITRDGLSQ
FT                   YSINDKPSRLRDIKEIFQGTGVGMDIYSIVGQGQVDKVVTASPYELRALIEEAAGTAIY
FT                   KEKKKQSLAKLSETEANLNRIEDILFELGKQRKSLYLKAKRAEKYLEYTERLKEVRTLY
FT                   YGNAVRVEREILNTHMEGHEKVSDELKELQRKLIEHESKWSTLRQEFSEMDKEIEGFTR
FT                   LLEEYKKRQNDLLELKEMYSKKLSDKESKLIEVSTKLDTLKAEVEDLEKRKDELKLISD
FT                   GMKQQIEDEEKELKELESIKDSMVHKYSEKEKDWLKLQEELDSVVKRMSKIENELERLS
FT                   NVREDTQKRLNLIGSQLQSKGERLEDLKKEIEELAAQGKESTEKQKELEENIALSKERR
FT                   DTLENQLEELKEKIAQSMEELRRSQIERNTLERQQLEYQGFSRAVREIFSRSDDFDGLI
FT                   DVVANLVEIPKTFETAVSVLLGSRMQDVVVESSITAKRIVAFLKQHKIGRLTLLPLDML
FT                   KGNFKRFKAVENHPGFLGYAAKVVDVAEEFKIVPEYLFGSAIVVKSLDDAIDIRKNLGF
FT                   QGRIVSLDGQLLSAGGAITGGYIGNDVRLDLVTRKRRIQELEQKEKDLQKAMERMQRES
FT                   VKIKDEIQELRGYIRVLNEELNGIISKGAAINRMIHELLKTANELESEISELDKLKEEY
FT                   TKKLNDSLNKREELEEEFKTLNQQKKEFEKELQTFSQELKEEKKKLEEIQNQIVDRKLK
FT                   LSGLYEKQEQYTKELSAISQKKRENSEAIIVLEREIEELENEAEKLRKQVADQDRELQS
FT                   VKRETEALFSSIRDQRQGKEERLNALQELESEIEALKSEREQKREKLHQFDLLIQESKM
FT                   RLEQLEKELGEVEGEIPVLSDEELEKTRMELEELENKLKFLGSVDLDAIEEYKLVDAEY
FT                   QELMVQKEDLEEARQKLIKLIEKIDEEARNRFKSTYEKVNENFGKYISEIFDGGEGEIR
FT                   IIPGEDLLESGLEISVRRPGRKFQKLQLFSGGEKALVGIALVFALLSIKPSPFYVLDEV
FT                   DAPLDDFNAERFKNMLRRHGEDTQFLVITHNKIVMEVAYVLHGITMTDGISRVIPVKLG
FT                   TIESVIG"
FT   gene            complement(214370..215419)
FT                   /locus_tag="Kole_0190"
FT   CDS_pept        complement(214370..215419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0190"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: dal:Dalk_4810 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78916"
FT                   /db_xref="GOA:C5CIS5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIS5"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACR78916.1"
FT                   /translation="MNIIPIFLPHAGCKRRCVFCNEYSATGLGRIPTKDEIFNEVDRYL
FT                   AFFADRENVELAFYGGTFTGLPEWLMHDYLDLAMEIIKSGKAKAIRFSTSPEEITQRKV
FT                   EILSDYPISLVEIGAQSFDEEVLRLANRPHGVKEIYTACELLKEAKIPFGIHLMTGLPG
FT                   DSEEKNIRSAVEVVKLKASTCRIHPTVVLKNSTLESMYHEGKYKPQDLGEALNILWKMY
FT                   VIISLGGVKINRIGICLYGDEVNNVVAGPYHPAMGELVKNWVALEILRVLKKRRGDKII
FT                   LKVDEGTKQFFTGHKKCVLNRAKEEGMEVIFERASAPELNLRELMKIVLVESLDELFRS
FT                   EVSGILLAN"
FT   gene            complement(216068..216271)
FT                   /locus_tag="Kole_0191"
FT   CDS_pept        complement(216068..216271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78917"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78917.1"
FT                   /translation="MSDKHITSAIEKVINLESGAFQTLWDNLTTNQRQVLKKLVHGISP
FT                   YELPINAGSVKRALETCKLWIL"
FT   gene            complement(216631..218505)
FT                   /locus_tag="Kole_0192"
FT   CDS_pept        complement(216631..218505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0192"
FT                   /product="LVIVD repeat protein"
FT                   /note="PFAM: LVIVD repeat protein; KEGG: dal:Dalk_1645
FT                   LVIVD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78918"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIS9"
FT                   /inference="protein motif:PFAM:PF08309"
FT                   /protein_id="ACR78918.1"
FT                   /translation="MSCVVRKGFKSWKLVMVVTLVLFLLTACPGFNNPDGNDEAEKQYV
FT                   YAAGGVEGLLIFEVSDPENPILVSYYDTDGCAYGVTVSGGYAYVADDYNGLVVIDISEP
FT                   SNPAEVGHYDTADAAYGVTVVGNYAYVADNDNGLVVIDISEPSNPAEVGHYDTAGAAYG
FT                   VTVVGNYAYVADNDNGLVIIDISDPTNLLQIGHYDTVGYACGVTVVGDYAYVADWENGL
FT                   VVIDISDPSSPILVGRYDTDGSAYGVTVSGDYAYVADDDNGLVVIDISESSSPVEVGCY
FT                   DTADEAYGVTVVGNYAYVADGGNGLVVIDISDPTNPVQIGHYDTGRWASEVVVSGNYAY
FT                   VADGDNGLVVIDVSDSVKVGHYDTAGDACGVTVEGDYAYVADWENGLVVIDISDPSNPI
FT                   LVGRYDTAGYACGVTVVGDYAYVADDYNGLVVIGISEPTNPVQIGHYDTDGWANGVTVA
FT                   GDYAYVADMSSLVVMDISDPSNPIPVCHYDTDGYACGVTVEGDFAYVADWGNGLVVMDI
FT                   SDPSNPILVGHYDTNGWACGVEVSGDYAYIADGDNGLVMIDISDQSNPVEIGSFDLNGF
FT                   VYRVTVAEDYAYVANWDNGLVILDISDPSNPKLVNDMPWITLYGICGN"
FT   sig_peptide     complement(218407..218505)
FT                   /locus_tag="Kole_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.767) with cleavage site probability 0.723 at
FT                   residue 33"
FT   gene            complement(219146..219259)
FT                   /locus_tag="Kole_0193"
FT   CDS_pept        complement(219146..219259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78919"
FT                   /db_xref="UniProtKB/TrEMBL:C5CHU7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78919.1"
FT                   /translation="MSDGGNRNRKGLLLAKGGRIEEMAQRKASITGARNGG"
FT   gene            219806..220968
FT                   /pseudo
FT                   /locus_tag="Kole_0194"
FT   gene            complement(221059..221157)
FT                   /locus_tag="Kole_0195"
FT   CDS_pept        complement(221059..221157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78920"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78920.1"
FT                   /translation="MTLADAVRCRAADANSFGVVPNHYVVVSVITP"
FT   gene            221282..222016
FT                   /locus_tag="Kole_0196"
FT   CDS_pept        221282..222016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0196"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: dol:Dole_0130 cytochrome c biogenesis protein
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78921"
FT                   /db_xref="GOA:C5CIT2"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIT2"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ACR78921.1"
FT                   /translation="MNEFTLAATASNLLQSPGGISPLISVSVSYSSAILGGLLSFFSPC
FT                   VLPLIPIFFGVLMAGAESAKVRFFRGLSFTIGMSLFFFLLGTGAGGLGQFIRRNETLMN
FT                   ILSGSLFIAFAFMYLFEVGFKGVRVNAWKFSGSVFSGFLLGSVLGLIWVPCAGPILGSI
FT                   LVLAANQGTAAKGGMLLLTYSLGLSIPFLTLSGVVAKITSRLSFGGESKARRIVRIIVF
FT                   ILLFGAGILTLFGKLNLLQFTA"
FT   gene            222029..222706
FT                   /locus_tag="Kole_0197"
FT   CDS_pept        222029..222706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0197"
FT                   /product="Thioredoxin-related protein-like protein"
FT                   /note="KEGG: dat:HRM2_42220 putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78922"
FT                   /db_xref="GOA:C5CIT3"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIT3"
FT                   /inference="protein motif:COG:COG2143"
FT                   /protein_id="ACR78922.1"
FT                   /translation="MKKIMVLFSVLVIATLSLAYIGKLDDFNVGMKLAKLEKKQLIVMF
FT                   SDPSCFYCTKFQKETLVNDKVQELLKAGYIFVEIYPGEEEATIEVNGKTYNFSYSELYA
FT                   AFEVRGTPTFWFFDENGTPITNLPGYAPADIFVKVLQYMGEKAYMKGITFDAYTKQNID
FT                   YIGESKLIKLTKKEADFVLENDPLARTYTGEFDRYTIWVTENEALASELISKGAFRVIL
FT                   VIE"
FT   sig_peptide     222029..222088
FT                   /locus_tag="Kole_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.978 at
FT                   residue 20"
FT   gene            222927..223742
FT                   /locus_tag="Kole_0198"
FT   CDS_pept        222927..223742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0198"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF125
FT                   transmembrane; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78923"
FT                   /db_xref="GOA:C5CIT4"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIT4"
FT                   /inference="protein motif:PFAM:PF01988"
FT                   /protein_id="ACR78923.1"
FT                   /translation="MSFKKTRIQLAREAFKRRDLSLHQMAHDPKKIGQEPWHKTEAGRY
FT                   IGSAVYGASDGIVTTFAVVAGVAGAQLDPKIVLIMGFANLFADGFSMAVGDYLSEKSEQ
FT                   DYIKSEREREAWEVDVNPEGEREEIREIYKRKGLKGEKLEQMVELITSDKELWIDTMMK
FT                   EELGIMEDEGSSPLKSAIVTFLSFVIAGFMPLVAYVFASLVPFFSQNMFLSASLITAAT
FT                   LFVVGSLRQMVTGVNWLIGGLEMLLVGGLSATVAYGIGYLLRTVFNVVI"
FT   gene            complement(223726..224289)
FT                   /locus_tag="Kole_0199"
FT   CDS_pept        complement(223726..224289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0199"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein; KEGG: Appr-1-p
FT                   processing enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78924"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIT5"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ACR78924.1"
FT                   /translation="MVKSIVLEDGKIIQIVQGDITKEEVDAIVNAANGYLRHGGGVAGA
FT                   ILRAGGKIIQEESDRIIRKNGPLEVSEVAVTGAGSLHPKYIIHVHGPRYGQENVEELLY
FT                   ESFLNAFKTAGKLGVKTLSVPAVSSGIFGVPKDLCARCFFRAVEYYFENYKDTPLSLIR
FT                   VCNIDRATTEVFEKVSEEFFKLQR"
FT   gene            complement(224663..225904)
FT                   /locus_tag="Kole_0200"
FT   CDS_pept        complement(224663..225904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0200"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: sfu:Sfum_0727 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78925"
FT                   /db_xref="GOA:C5CIT6"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIT6"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ACR78925.1"
FT                   /translation="MKKLTEEVKKVFDTGNTGFMLVATSLVMLMTPGLAFFYGGLVSRK
FT                   NVLTIMMQSFVSMGWTTILWVTVGFTMCFGGDIGGIIGDGKYLFLHGISLSTAFGSNMG
FT                   IPMLVFVAYQMMFAIITPALITGAFADRVRFKAYMIFLTVWLLFVYFPLVHMVWGGGLF
FT                   QQWGVLDFAGGIVVHASAGFAALASVFFVGKRKVKNTRPHSIPLVALGTALLWFGWYGF
FT                   NAGSELRVDSVTVSAFLNTDVAASFAAITWLILAVIFEKKPKVLGMLTGAVAGLATITP
FT                   AAGYVNVQSSMLIGIIASLIGYAAIAYKNKKGWDDALDVWGVHGMGGYVGILLLGLFAS
FT                   TNINPNGANGLFFGDASFFLKEFVAVTVTAVYAFVFTYVALWLINKITTVRVSEETETN
FT                   GLDLFEFGEEAYVE"
FT   gene            complement(226509..227792)
FT                   /locus_tag="Kole_0201"
FT   CDS_pept        complement(226509..227792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0201"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase; KEGG: gme:Gmet_0939 recombination factor
FT                   protein RarA"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78926"
FT                   /db_xref="GOA:C5CIT7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIT7"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACR78926.1"
FT                   /translation="MPLSERLRPRNFDDLVGQEHLTGKNGIIRRAVESGYVFSMILFGP
FT                   PGSGKTTIARLIKESLADDKYEFVAFSASLQGTADLKKIFERARQLRKYGKHLVLFVDE
FT                   IHRLNKTQQDVFLPVVEDGTVTLIGATTENPSFEVNPALLSRCRLLVLRQLSPEDTVQL
FT                   LHRALEKDERLSSLDIAISEELIRILAENAGGDARVALNFLETLYENAAAMGYKELNVD
FT                   ILDELPIISHKRYRKAGEEHYDLISAFIKSMRGSDPDAAVYYMMRMIEAGEDPKFIARR
FT                   MVILASEDIGLADPMALLVAVAAFQAVERVGLPECTLNLSEAAIYLSVASKSNSVYLAQ
FT                   KAAQEVIKKHPNLEVPLKLRNPVTDMMKKMGYGKDYNYPHDFGGFSRELYLPDKIKNMV
FT                   FYKPTENGREKSVKARLEQLWKGLKKFE"
FT   gene            complement(227779..228720)
FT                   /locus_tag="Kole_0202"
FT   CDS_pept        complement(227779..228720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0202"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; polysaccharide biosynthesis protein CapD;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: mxa:MXAN_3507
FT                   UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78927"
FT                   /db_xref="GOA:C5CIT8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIT8"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACR78927.1"
FT                   /translation="MENIVVTGGAGFIGSHVVNELIEKNMGPIVIDNLSSGKIENLDPR
FT                   ALFYQQDITDLEMMERVFMLHKPRYVFHLAAQISVSQSVKDPIEDARINILGTLNLLNL
FT                   SVKYGVEKFIFSSTGGAIYGDDVSEIPTSEKEFPKPFSPYGIAKFSVENYLRFYSEQYG
FT                   LKYVALRYANVYGERQDPHGEAGVVAIFSKRMLANDEVIIFGDGENVRDYVYAGDVAHA
FT                   NVLAMEKVENEVINIGTGIGTSVNELFALLKEITGYQKEPVYADPRPGDLRKSILKWDK
FT                   AKELMGWEPTVKLEDGLVKTVEFFRTEMGASE"
FT   gene            complement(228731..229354)
FT                   /locus_tag="Kole_0203"
FT   CDS_pept        complement(228731..229354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0203"
FT                   /product="phage SPO1 DNA polymerase-related protein"
FT                   /note="TIGRFAM: phage SPO1 DNA polymerase-related protein;
FT                   PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   sat:SYN_02178 uracil DNA glycosylase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78928"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIT9"
FT                   /inference="protein motif:TFAM:TIGR00758"
FT                   /protein_id="ACR78928.1"
FT                   /translation="MTEYVKKKELMMGIIRKIEECNLCPLHLTRTNVVPGEGSLDSPVV
FT                   FVGEGPGADEDATGRPFVGRAGKLLTKILESVGLSREDVYITNIVKCRPPNNRTPTLQE
FT                   MKACEPYLLSQLAVIKPKLIVCLGATALAAFLESEKVQITKYRGKLFDWHGGIKVFGMF
FT                   HPSYLLRNPSTAPGSPKRLTWEDIQKVRKMYDQVINGREISLED"
FT   gene            complement(229374..233774)
FT                   /locus_tag="Kole_0204"
FT   CDS_pept        complement(229374..233774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0204"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   dvl:Dvul_1425 permease YjgP/YjgQ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78929"
FT                   /db_xref="GOA:C5CIU0"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIU0"
FT                   /inference="protein motif:PFAM:PF03739"
FT                   /protein_id="ACR78929.1"
FT                   /translation="MRILIKYIFKQSMGAFFIGLGGFLIFVSLELLYQLSDLIVRYKVG
FT                   IDKLFLLIYYNLPYFIVLGIPVGVLLAIFWTLSRMQSDNELIALQTHGITLKTVVLPFV
FT                   IFAVLLSGITYLFNDYIVPYANRKAYEAQARFIYRRPEVTLKENAFMEDGKGRYLYIKK
FT                   IDPETGELKKILLYDLSGGKTRVTSAKSATKEGDKWIMHDGRVFELDSKGFLTFDMSFE
FT                   SLELDFGSDIQEYIRQSKSPREMTSAELKKKIASFSRLGVRTSSLMVALQEKYSLSLAP
FT                   LVIVMIGVPLSLIFNLRSKSWSVILTFILIVIYQGSGAWLSAMGKEDLLNPAYAPWIPN
FT                   IIFAITGIITYLLIDTRASYRLGEFLSRFFRFGVLLLFIFSFTVAFSAKVSITAGDVSG
FT                   SGREIYLTNGVEFTYTSEGFNATVSASNASILLKDETPLSISFWGNVVMHSDEKIIEAQ
FT                   RLVIDLTKETIEVMKVRTRTEFKISDKSEEKIPFFVYGELAESTMEPTPTLMLKEGYLT
FT                   TCDLKDHPHYRFAVSSAEIEPGKYVIVKNLLMKILDVPVFYLPWYYFSLDDPERRPFQI
FT                   DLSSIQEWKTITTLRYLDIDWLLLALSWERNWQTTEDIFTLSAKVEPAPELGTLRLLGQ
FT                   YGDGSPASWGGYALYEPGFLPNYRLNLLAVSGTPSELLKEPFKRISFANKKVGSKSVAA
FT                   DAFTLMSDFGMDELYLFNLTGSNRSKNLEYSLGFSGALFEREDAELYLWNAALSKLSVP
FT                   ANFSMKVGSGSFTMKTLSGSLNAKSSIEYEETQTSDIPTPTYTVTGTLSLTGLKLDTDV
FT                   FTTKLQSFNFKLESTSSDWGEILAPENIEDFILEAKRYEMKLGRFTTTGDIESTFDASD
FT                   MTANIKMPYTTKSIGKNRFSYASKDSKLKISGNYALDYSTDNSYQQEHPKLFWIEPFKI
FT                   SYKGWLDFNSSIIYTLYQDNSWALTADNALSKTLKLLDYEFKGVEFSSFIVPKFSWKLT
FT                   KDASDSFDLSSISDYFSEDRMELSLKNSFNLTPLKGFSAGIEYNPTAVASPSDLFSGIF
FT                   NDMELIHPGRLTAKLKTGIVDVNYNMNVDYSGLFPTRDASFFGTGTLEISGKIAKDPVS
FT                   LSYKTDSELQGLSATETSLEFSLAAGSFSHKMKTVYDWSTGSFGNIEGNEKIEYKEGSY
FT                   GFTFDLGWTADIDQDGEDENKISLNTTLRIGDDFKTSLKFSYPYVYRKKNYFDRIRLEL
FT                   GEFSTPAFSINKAVIDFTTGYARFSKYDNYKAFPAKYFSTFEVLYTTTPKYVKFFYTDI
FT                   ASLKFSNVKLEDFYLASASASSTGEPTGEYEYAIGVQKVVFDGKTLVSGKGKSFENYGI
FT                   SVSFGKEETLKNYFILSMNDLRLGKSLLRHIKLQLKEGESYLQIGLSPGSYLDWSELYR
FT                   KEKPLYIDLHCMALEGILELNLSATSLADVLNFLGLKYYIKAMPDRYLVFGLSQGYKPF
FT                   FKFKF"
FT   gene            complement(233799..234491)
FT                   /locus_tag="Kole_0205"
FT   CDS_pept        complement(233799..234491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0205"
FT                   /product="phosphate uptake regulator, PhoU"
FT                   /note="PFAM: PhoU family protein; KEGG: glo:Glov_0622
FT                   phosphate uptake regulator, PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78930"
FT                   /db_xref="GOA:C5CIU1"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIU1"
FT                   /inference="protein motif:PFAM:PF01895"
FT                   /protein_id="ACR78930.1"
FT                   /translation="MISKKGLRKIEETKHEIINMARYVQNLFSKCSLAILSRNEHHARD
FT                   VLYSISILDQHAFSVENKVVGLVGTLTPMGRELRFLVMAANITRTLRMIGEKCITLANK
FT                   SLLLTKHPPIGFYETLKKMIDTVDKMLADAVDNLINPSLSDAQMICEQDDRVDKMLDKV
FT                   EKELKIVMEESPKLVSRAIELLTIFRLLEEIGDLCTEIIESSMYVAKGKYYHCANDTLE
FT                   EVSENGSV"
FT   gene            complement(234481..235305)
FT                   /locus_tag="Kole_0206"
FT   CDS_pept        complement(234481..235305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0206"
FT                   /product="ATP-NAD/AcoX kinase"
FT                   /note="PFAM: ATP-NAD/AcoX kinase; KEGG: tdn:Suden_1085
FT                   NAD(+) kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78931"
FT                   /db_xref="GOA:C5CIU2"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIU2"
FT                   /inference="protein motif:PFAM:PF01513"
FT                   /protein_id="ACR78931.1"
FT                   /translation="MKAIVFFNHKRLDEEMIQKIISFLGSFNIDVFIGDTFSGKQNHDY
FT                   EPEVIMTFGGDGTVLRAVPFAVERDLPILSFKVGSVGFLAAFELGELETAIGKFVDNRL
FT                   HMEERYLLEVSFKEKRYKVLNDCAVERGDPSRTTSLEVEIEGFSAYRIVGDGVILSTGT
FT                   GSTAYNLSIGGALVDPMAKVYQVTPVAPHNPFVGSIIVDSTRKTKVTVIDGKNAPMKLY
FT                   LDGILTAVLRDGDEIVAGISDKKVKLLRDAGFDFVRVLKRKLAFGGRLKDDL"
FT   gene            complement(235315..235632)
FT                   /locus_tag="Kole_0207"
FT   CDS_pept        complement(235315..235632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0207"
FT                   /product="protein of unknown function YGGT"
FT                   /note="PFAM: protein of unknown function YGGT; KEGG:
FT                   gur:Gura_1165 protein of unknown function YGGT"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78932"
FT                   /db_xref="GOA:C5CIU3"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIU3"
FT                   /inference="protein motif:PFAM:PF02325"
FT                   /protein_id="ACR78932.1"
FT                   /translation="MFVLANLVYAVALVLRILVEFEIFAVIASALFSWLNPNYYGNFRM
FT                   FFQAMSDLVERPLRKVFPFLRSGIVDYTPLVAILVLVFIDQFLVGSLFDLSYVIRAASG
FT                   L"
FT   gene            complement(235645..236673)
FT                   /locus_tag="Kole_0208"
FT   CDS_pept        complement(235645..236673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0208"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: sfu:Sfum_0993 Holliday junction DNA helicase
FT                   B; TIGRFAM: Holliday junction DNA helicase RuvB; PFAM: AAA
FT                   ATPase central domain protein; Holliday junction DNA
FT                   helicase RuvB domain; Chromosomal replication initiator
FT                   DnaA; ATPase associated with various cellular activities
FT                   AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78933"
FT                   /db_xref="GOA:C5CIU4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CIU4"
FT                   /inference="protein motif:TFAM:TIGR00635"
FT                   /protein_id="ACR78933.1"
FT                   /translation="MEERFLTPKDIGEEQLTRTLRPQRLDEYIGQRNVKQRLKISIEAA
FT                   KVRNEALDHVLLAGPPGLGKTTLAHIIANEMGTNIYVTSGPVIEKQGDLAAILTSLEEG
FT                   DVLFIDEIHRLGRAIEEILYSAMEDFKLDIMIGKGPSARSIRLDLAPFTLVGATTRSGL
FT                   IGAPLRNRFGMVLELEFYTPDELKQIIKRSARLLEVKIDDEAAELLASRSRGTPRIANR
FT                   LLRRVRDLATVDGTGKILSKTVEDAMKIMGIDAEGLDDMDRKILRVLIENYEGGPAGLK
FT                   AIAASVGIEADTISEVYEPYLLQSGFIVRTNRGRMATKKAYRHLGIARFNGIGPLWDST
FT                   GD"
FT   gene            complement(236683..237981)
FT                   /locus_tag="Kole_0209"
FT   CDS_pept        complement(236683..237981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0209"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /note="TIGRFAM: asparaginyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: bsu:BSU22360
FT                   asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78934"
FT                   /db_xref="GOA:C5CIU5"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIU5"
FT                   /inference="protein motif:TFAM:TIGR00457"
FT                   /protein_id="ACR78934.1"
FT                   /translation="MNWVYIRDLKDHIGERVEIRGWLRRKRSSGKIHFLALRDGSGFVQ
FT                   GIVERSSVSEELFKLAKKLKMESSIIARGIVREDPRAPEGVELLIDEIEVVHQPEKDFP
FT                   INKPDHGIDYLMDHRHLWLRSKRQFHILHIRHEIIRAVRDFYNERGFVLIDTPIFTGSI
FT                   GESAGNCFEIDYFDYGKAYLAQTGQLYLEAACMALGKVYNLGPTFRAEKSKTRRHLIEF
FT                   WMNEAEVAYYQHEDNMKLQEELVSYVVQKTIERAANHLHAIGRDISKLEKIEAPFPRIT
FT                   YTDAIKLLQKKGFNVNWGDDIGGDEETAIAEEFDKPVIVERYPRKMKAFYMQPDPENPD
FT                   VVLCDDMLAPEGYGEIIGASERIWDKELLIERIKEFGLDVESYSWYLDLREYGSVPHSG
FT                   FGMGIERVVAWIAGLEHVREAIPFARTLYRIHP"
FT   gene            complement(238088..239485)
FT                   /locus_tag="Kole_0210"
FT   CDS_pept        complement(238088..239485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0210"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78935"
FT                   /db_xref="GOA:C5CIU6"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIU6"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACR78935.1"
FT                   /translation="MKLKILAPLMIFVLLAGFAFAAVYTDVSPSHWAYDSIVRLTDLGI
FT                   LSGISEGGLYYFKGDDPLTRYQAAVLLDKFLTYLEEKGVSGASEAVSGEAIEKIREQLG
FT                   IFETILKDQKGEYIDLADILGRLEKLEKEVADLQSKGIIPALGEGTDLKKFFDKLQSFG
FT                   ESVAELKRDLEGKFSELSENVNVLEKTLNATLSEIEVNLKTLNESVLGHSNEISGLSKR
FT                   ITAAGNRVATLENKVESLWNLTGSFVKTEEFKALEDRMTGVEAKLSEFVTWKDLGSKLE
FT                   DYATVKDLEEMNTSISGLQMEVLGLKKRLDKVEESSVSKDSLAPLISELENLKTSTTDL
FT                   EKEVEKKVESIDKALMFSGNKVDTLEGLKSDVETLKSIVAKLNKNTPEIENALKFLVDD
FT                   VDTLNSTVTELSSQLVELRKDVPENINLEEIKKRTETAFWVGFGGIVFGIAGIVIGIIA
FT                   FWYPPSP"
FT   sig_peptide     complement(239420..239485)
FT                   /locus_tag="Kole_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            239587..241362
FT                   /locus_tag="Kole_0211"
FT   CDS_pept        239587..241362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0211"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); tRNA synthetase class II
FT                   (G H P and S); GAD domain protein; nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: bar:GBAA4632
FT                   aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78936"
FT                   /db_xref="GOA:C5CIU7"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIU7"
FT                   /inference="protein motif:TFAM:TIGR00459"
FT                   /protein_id="ACR78936.1"
FT                   /translation="MKKRTHTCGELRSEHAGKTVVLNGWVDRIRDLGGIKFILLRDRYG
FT                   FTQVVFDPSNEDVYKTALQLGIEYTISVTGIVRERPKDAVNPKMPTGKIEVLATEVEIL
FT                   SESDTPPIYVNIDDDSSEELKLKYRYLNLRKPKMQRNIIFRHKVVQAVRNYLNKNNFLE
FT                   IETPVLTKSTPEGARDFLVPSRLRPGKFYALPQSPQLFKQLLMVAGFDRYYQIAKCYRD
FT                   EDFRADRQPEFTQIDLEMSFADSEDVFAIVEGMLSHTFKETLNVGLTTPFPRLTYEEAM
FT                   EMYGSDRPDRRYGMELHDVSEAFVGTGFRVISEALGRGEIVKGFLAKGLSSKFSRKRLD
FT                   EYTAFVKENGLGGLIWIKVEDELRSSILKHCPDEIKKVVERFNAKIGDIIFLAIGKRET
FT                   VSKALGKLREKLISEEKPEVTGFDILWVTDFPMFSYNEEEGRIEAEHHPFTMPNLGDLD
FT                   KFGKTEPLKVRSHAYDLVINGYELASGSVRIHRRDIQNRIFEMIGLTHEEAQEKFGFLL
FT                   EAFKYGPPPHAGIAFGLDRLVAIMVGTSSIRDVIAFPKAASGNDPMTGAPSEVSERQLE
FT                   ELRIKIIDEKDGKKR"
FT   gene            241359..242009
FT                   /locus_tag="Kole_0212"
FT   CDS_pept        241359..242009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0212"
FT                   /product="cytidylate kinase"
FT                   /note="TIGRFAM: cytidylate kinase; PFAM: cytidylate kinase
FT                   region; KEGG: geo:Geob_2362 cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78937"
FT                   /db_xref="GOA:C5CIU8"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIU8"
FT                   /inference="protein motif:TFAM:TIGR00017"
FT                   /protein_id="ACR78937.1"
FT                   /translation="MKIAIDGPAGSGKSTVAKMLAERLGFTYVDTGAMYRAVAWKLKQH
FT                   DIDPDNTDALRELLENTQFSISDSVLCMDGRKIGDEIRTPEISRLSSDVAKIAEVRHFL
FT                   TAEQRRIAEKGNVIMEGRDIGTVVIPDADLKFFITASPEERARRRYEQLKRLGIEANYD
FT                   RILNELIQRDRNDSSREIAPLKPAKDAIIIDTTNMTIDEVLDLLVRKVRDKGT"
FT   gene            242006..242902
FT                   /locus_tag="Kole_0213"
FT   CDS_pept        242006..242902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0213"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="KEGG: gsu:GSU2604 penicillin tolerance protein LytB;
FT                   TIGRFAM: hydroxymethylbutenyl pyrophosphate reductase;
FT                   PFAM: LytB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78938"
FT                   /db_xref="GOA:C5CIU9"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CIU9"
FT                   /inference="protein motif:TFAM:TIGR00216"
FT                   /protein_id="ACR78938.1"
FT                   /translation="MKIVLAESLGFCYGVNRAVEATKRLLKEKRDARVIGDIVHNEIVM
FT                   KKLKDMGLKVYPDLSSIDFSDTAENSVAIIRAHGASPDVEDFLKRRFGYVVDLTCPIVY
FT                   NVFSLAKDLEKKGYFIVIFGKKDHAEVKALCGRLNDYLIVEPGYDFETIKAFLREKKPK
FT                   KVALISQTTMNSESFEKLAEKLLKLEGIEVSVNNTICNVTINREKMAIHLAQTCDAVVV
FT                   VGGKRSSNTGKLAKIVESHGKRAFHVQNPEQLPDLSIYRKVGIISGTSTPKEQILKILD
FT                   YIKFTYEGEVIRNGGEV"
FT   gene            242886..244604
FT                   /locus_tag="Kole_0214"
FT   CDS_pept        242886..244604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0214"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART: RNA
FT                   binding S1 domain protein; KEGG: mxa:MXAN_3793 30S
FT                   ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78939"
FT                   /db_xref="GOA:C5CIV0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIV0"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACR78939.1"
FT                   /translation="MEEKYNGQNEENLSMEDILKQMDEVDERRGRSKTAEVHSIQPDGL
FT                   LVILEGKLDGFAPESELVKPLKEYNIGDKIEVQIMKVDEDEGRSVVSEKRIYFRTALKK
FT                   VENAYKSGEPVTGTILGETKGGYNVKLLNVVPAFLPGSQSGIRRGRPIPEGEQEFKVIN
FT                   FRKKKRGTNIVVSLTAFKEEKVKAYFEALETGSTVEGTIESIKDFGAFVRLTNEVVGLI
FT                   PASEVSWDPSQKVHDVLNVGDKVTVKVIDVDPEKKKISLSLKQLQEDPWNTVEEKYPVG
FT                   SVVEGVVKSIVPFGFFVMIEPGVEGLVHISEVFWGNVRRDLKELIREGDRVKVKIKDID
FT                   KEKRTLSLSYREALGDPWDNIEEKYKVGEIVDGKVVKVLPTGAIVELEEYVSGFVPVSE
FT                   MSWNFVDRVEDVVKESSEVKTKILSIDKENRRMRLSLKQATEDPWQKVHTELKVGDYVE
FT                   GKITRLIKSGAVVMVDGYGVEAFLPASQVAMKRVENLEDAIKIGEHRRFKIIRLVYDPE
FT                   KDVRNMVVSIKQLLLDKEKEETQKALEELSGEESSTLSLGEKLKEHLEKNSEGEK"
FT   gene            244604..245932
FT                   /locus_tag="Kole_0215"
FT   CDS_pept        244604..245932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0215"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; Miro domain protein;
FT                   KEGG: bha:BH1638 GTP-binding protein EngA"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78940"
FT                   /db_xref="GOA:C5CIV1"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CIV1"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ACR78940.1"
FT                   /translation="MATVLIVGRPNVGKSTLFNRLVGGRRAIIDDQPGVTRDFVFGRVF
FT                   WQHKSFEVVDTCGLFDSPKDIIEEKMKEVTLALLSEGDLLLFVVDGRKGLTSADMDIAE
FT                   TLRKSKKRVILVANKVENVDKFTLEVLPELYSLGFGEPIPISAEHGLNIDVLLEKIIKT
FT                   LEEAGHLLDYEPEKEEDNLKVAIIGKPNAGKSSLFNSIVGSDRSLVTEIPGTTRDMVDE
FT                   TIEIDGMPVTFIDTAGMRRKSKVGVKNVEYYSVMRAVDAIERSDICILVIDATLGISNQ
FT                   DQRIAGLVEKRGKGIITVFNKSDLLNEKHKESLLSSFERELYFIDYSPVVFTSATEGFG
FT                   IDELLDKLFLVAEKIDLRIPTGLLNNLISRYTLSTPPVGRKNKKAKIYYAAQIDTRPPL
FT                   IMLKVNDPALFTEPYLRGIRSTIRMNIDPFEGTPIFIKLRRKK"
FT   gene            245929..246552
FT                   /locus_tag="Kole_0216"
FT   CDS_pept        245929..246552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0216"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   rlt:Rleg2_1297 protein of unknown function DUF205"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78941"
FT                   /db_xref="GOA:C5CIV2"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CIV2"
FT                   /inference="protein motif:PFAM:PF02660"
FT                   /protein_id="ACR78941.1"
FT                   /translation="MRFIWLAIIGYLFGSIPWGYIIPKLRGIDIRKVGSGNVGGTNVLR
FT                   NLGGFWGAITMVLDGFKPFIPIMIAKHTFGVSVSDAMMIGFFAGVGHCYPIWLKFKGGK
FT                   SVAVSVGTISGTKASLVPVFFAVWLPIVLITQYVSLGSILSLAVITILYFLTDSWQTGI
FT                   WMLALFLLTTYRHRGNIVRLIRGEERKTDLIAAFTKRNKNKKEG"
FT   gene            complement(246570..246986)
FT                   /locus_tag="Kole_0217"
FT   CDS_pept        complement(246570..246986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0217"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: bha:BH3753 ATP synthase epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78942"
FT                   /db_xref="GOA:C5CIV3"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIV3"
FT                   /inference="protein motif:TFAM:TIGR01216"
FT                   /protein_id="ACR78942.1"
FT                   /translation="MSLNVSIVTPYAKVWEGEAEYLSFRTPFGEMGFLPQRAPIVAQLA
FT                   VDVIEIKSKGERLLFAVHGGYILNTREKTLIVADAAERPEDIDIHRAEERVKRAEEILK
FT                   VERDARKRARANAKMQRHLLRIRVYKEHTQTEHK"
FT   gene            complement(246992..248443)
FT                   /locus_tag="Kole_0218"
FT   CDS_pept        complement(246992..248443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0218"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: geo:Geob_0447 ATP synthase F1, beta subunit;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78943"
FT                   /db_xref="GOA:C5CIV4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIV4"
FT                   /inference="protein motif:TFAM:TIGR01039"
FT                   /protein_id="ACR78943.1"
FT                   /translation="MAKKTEEKKNKKEQKSINKGKIVAIIGPVIDVSFEGAELPDILNA
FT                   LEVYNKFLGKKIILEVAQVIGDNVVRTIALDSTDGLVRGQEVIDTGRQIAVPVGDKILG
FT                   RMFNLLGEPIDERGPVEAEEFWDIHREPPGVTEQKTDVEILETGIKVIDLLAPFNKGGK
FT                   IGFFGGAGVGKTVLVMELIRNIAIEHKGLSIFAGVGERTREGNDLWLEMQEAGVIGNTA
FT                   LVFGQMNEPPGARFRVALSAITMAEYFRDVQKKDVLVFIDNIFRFVQAGSEVSALLGRM
FT                   PSAVGYQPTLATEMGQLQERITSTKNGSITSVQAIYVPADDFTDPAPATTFSHLDATVN
FT                   LSRSIAEQGLYPAVDPLDSSSKNLAPEIVGMEHYVVARRVQEVLQRYKDLQDIIAILGM
FT                   EELSEEDKLIVRRARRIQRFLTQPFFVAERFSNIPGRYVPIKETVRGFKEILDGKHDDL
FT                   PEQAFMMVGTIDEAVEKARKLGYGG"
FT   gene            complement(248459..249298)
FT                   /locus_tag="Kole_0219"
FT   CDS_pept        complement(248459..249298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0219"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /note="TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit; KEGG:
FT                   sfu:Sfum_2583 ATP synthase F1, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78944"
FT                   /db_xref="GOA:C5CIV5"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIV5"
FT                   /inference="protein motif:TFAM:TIGR01146"
FT                   /protein_id="ACR78944.1"
FT                   /translation="MSKGKLRAIKKRIDATESTMQITRAMEMVARAKLKKVEKGLAYTR
FT                   NYADSMKEILKRVIRNLDTFPKFPGEGDVLLVVSTDMGLCGAFSSEILRHADIEISKGN
FT                   IKAIVTVGLKAELHYKKHKLFKKAFTRFYDVPDVDEAAIIVDEVLAIKEELNASGFKVV
FT                   YSEFKNPIVQLPKTLRLLPLEPIAEEEKDEDMYDFEPEVSVIFPEMLNSWIISEILRAT
FT                   YETKVGELFSRQNAMKSATENAQKLIERLTLERNKVRQATITQEIIEIVNSAEALKG"
FT   gene            complement(249309..250817)
FT                   /locus_tag="Kole_0220"
FT   CDS_pept        complement(249309..250817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0220"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: sfu:Sfum_2584 ATP synthase F1, alpha subunit;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78945"
FT                   /db_xref="GOA:C5CIV6"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CIV6"
FT                   /inference="protein motif:TFAM:TIGR00962"
FT                   /protein_id="ACR78945.1"
FT                   /translation="MKISPSEITKIIEEQLKRSDREIDYFEAGRIIQVGDGIARAYGLK
FT                   GVMSNELVQFENGEYGLALNLEEDNVGIVVLGDYREIKEGDLVKRTGRIIEVPAGEALL
FT                   GRVVNPLGIPLDGKGPIEASEHRPVEIKAPGVVMRKPVDTPLQTGIKAIDAMIPIGRGQ
FT                   RELIIGDRQTGKTAIAIDTIINQKDQGVYCIYVAIGQKTAVLARIIDKLEETGAMEYTT
FT                   IVAATANDPATLAYLAPYAGAAMGEYFMYSGKDALVIYDDLSKHAAAYRELSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARLNEEHGGGSLTALPIIETLANDVSAYIPTNVISITDG
FT                   QIYLDPNLFYAGNRPAINVGLSVSRVGGSAQIKAMKKIAGSLRLDLAQYRELLAFAQFS
FT                   TELDKATQAQLIRGEKLTELLKQEQYSPMPVEEQIAVLYAGTRGYLDDLPTDKIRQFEK
FT                   QLLQTMRQKYADVLKAIREKKDMTEEIEAGLKKAVEDVRQAFVS"
FT   gene            complement(250848..251375)
FT                   /locus_tag="Kole_0221"
FT   CDS_pept        complement(250848..251375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0221"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: abb:ABBFA_003368 ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78946"
FT                   /db_xref="GOA:C5CIV7"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIV7"
FT                   /inference="protein motif:TFAM:TIGR01145"
FT                   /protein_id="ACR78946.1"
FT                   /translation="MKRSLTVAYKYAKALFLMTDESERDGILELLKASSEMFSDKKARE
FT                   FLQDPTFPRSEAVKLILEFLEDVPEIFKNFVVILVEKKRLLYLPTITNAYEQILDESRS
FT                   KIKVLVETAVALSNEELKLLEEFIERESGMRPLFQIQIKPELIAGMVVHFQDRVLDLSA
FT                   SGRLKRLEYGLK"
FT   gene            complement(251372..251857)
FT                   /locus_tag="Kole_0222"
FT   CDS_pept        complement(251372..251857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0222"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   bha:BH3758 F0F1 ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78947"
FT                   /db_xref="GOA:C5CIV8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIV8"
FT                   /inference="protein motif:TFAM:TIGR01144"
FT                   /protein_id="ACR78947.1"
FT                   /translation="MIELNLTSLIQLLNFLVLLFVLKKLLFDKFFDIIEERQNMIKSEL
FT                   TEAEKLRKEAEAYREKYRIEMENARKKSQEIIANAERQAEEIIKTAKENAQREAVRIME
FT                   SAEAQIAQEKEKALKQLQATVITTAVEIAAKFLGKEMDEAMKRQYAQRILRSLGDEK"
FT   gene            complement(251891..252136)
FT                   /locus_tag="Kole_0223"
FT   CDS_pept        complement(251891..252136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0223"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   dol:Dole_0802 ATP synthase F0, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78948"
FT                   /db_xref="GOA:C5CIV9"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIV9"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ACR78948.1"
FT                   /translation="MELGNALVQLGKFIGAGLAMGIGAIGPGIGEGNIGAKAMEAMSRQ
FT                   PEMIGTLTTRMLLAMAVTESTGLYSLVIAFMILLVG"
FT   gene            complement(252172..253008)
FT                   /locus_tag="Kole_0224"
FT   CDS_pept        complement(252172..253008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0224"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   dol:Dole_0801 ATP synthase F0, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78949"
FT                   /db_xref="GOA:C5CIW0"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIW0"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ACR78949.1"
FT                   /translation="MRIQLTKGDKIFLTFIALGYIAVLIYMVATGYTFSLEGVGERWIY
FT                   QLPFGTGPLSRINPMTVIMTWVIMAGLIIFVSTVKVFKVIPGKKQTLLELALEFILDMT
FT                   KDAIPKKEFVRPTFNIAATLFLFILIANILSGIPGVQVVPTDSGIKITLFEDTWYTPTS
FT                   DLNTNATFAVLVLIISHAFAIKAKGFTTWLKSFFEPNPIMFPMNIVGELAKPVSHSLRL
FT                   FGNIMGGGLLVLIISYLVKYLILPTFLWGFFGMFVGSIQALVFTILAIAYIGALLE"
FT   gene            complement(253281..253568)
FT                   /locus_tag="Kole_0225"
FT   CDS_pept        complement(253281..253568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_3176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78950"
FT                   /db_xref="GOA:C5CIW1"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIW1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78950.1"
FT                   /translation="MKKKRIDFRQLNAINMVFQFGIVVISNILVGGLLGYLTDKYLFHN
FT                   KIWLVIFLFLGTISGIYQGIRYLMKEAEKYERLNKDSTKRNDSDKYSGDN"
FT   gene            complement(253586..256276)
FT                   /locus_tag="Kole_0226"
FT   CDS_pept        complement(253586..256276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0226"
FT                   /product="DNA polymerase I"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dol:Dole_2573 DNA polymerase I; TIGRFAM: DNA
FT                   polymerase I; PFAM: DNA-directed DNA polymerase; 5'-3'
FT                   exonuclease; 3'-5' exonuclease; SMART: 5'-3' exonuclease;
FT                   DNA-directed DNA polymerase; 3'-5' exonuclease;
FT                   Helix-hairpin-helix domain protein class 2"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78951"
FT                   /db_xref="GOA:C5CIW2"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIW2"
FT                   /inference="protein motif:TFAM:TIGR00593"
FT                   /protein_id="ACR78951.1"
FT                   /translation="MANRLFLFDGTAIVYRAYFAIDVSLTNSKGEPTNAVYGTARMLSR
FT                   FIKNYIAEGDYALFAFDRKEATHRHDLFEGYKATRAEMPDALVAQLKYIPDLVEGFGIK
FT                   FHSVATLEADDIIATAVTKYRDKFDEIVIVSGDKDILQLVDEKVKVLRFVSGLTDLEEY
FT                   DRRKVEEKFGLPPEKIYELLSLCGDTSDNIPGVPGIGIKTALKLLKEYGSIDEIYKNIR
FT                   KLSPGLRKKLMDGKKALEMSKKLVRLVTDADLHIELEELRYRGLDKEKLRELFLKLEFA
FT                   SLLREFDLTNLGSDNNEDNGYRPVSSQQELDELFETLKGSDVISIDLETSSLDPHEAKI
FT                   VGISVAIKDGEGFYIPVNHESSDWQADEKQVLLRLKELLEDSGTKIVGQNLKFDYEILE
FT                   KHGIEPVVPHFDTMIAAYLLNPDSRRFNLDDLALKFLGYRTTSFSELMNKNQLKDQFEK
FT                   VSVEEAAKYSVEDADIALRLYRVLSKKLYESDLDNIFHKIEMELIPVLAELELNGVYMN
FT                   VESLKNLSEEYEKRLGKIREELFELAGEPFNPNSPTQVSKILFEKLGLNPPKKTKHGAY
FT                   STSAAVLEELVNEHPIIQKLLDYRKYQKLKSTYLDTLPTLVNPVTGRIHASYHQTGTGT
FT                   GRLSSSNPNMQNLPIKGEEGKEIRKCVVPQKSDWKIISADYSQIELRVLAHFSEDERLI
FT                   SAFKNGEDVHALTASRLYGVSVKDVTPEMRQVGKMVNFSIIYGISPYGLARRLKIKTHI
FT                   AENMISNYFNAYPGVRKFINEVIHEAKEKGYVRTLFGRKREIPHFRTRNKMKIQEGERI
FT                   AINTPIQGTAADIMKLAMIKIHKMVKEEGLEAFPILQVHDELVFEAPATEVDRVCDILT
FT                   RGMSGVVELKVPLEVDVAVNSYWGK"
FT   gene            complement(256279..256623)
FT                   /locus_tag="Kole_0227"
FT   CDS_pept        complement(256279..256623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0227"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   smt:Smal_0827 alkylhydroperoxidase like protein, AhpD
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78952"
FT                   /db_xref="GOA:C5CIW3"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIW3"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACR78952.1"
FT                   /translation="MGEIEKFRKFRKKMNKRILETGDINTKRFFSLDSAVYREGALDSK
FT                   TKELLGLVASMVLRCDDCITYHILQCKSLGVTRDEFMEAFNVALVVGGSIVIPHFRRAV
FT                   ALLDELEGED"
FT   gene            complement(256637..257458)
FT                   /locus_tag="Kole_0228"
FT   CDS_pept        complement(256637..257458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0228"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: gme:Gmet_2464 TatD-related
FT                   deoxyribonuclease:radical SAM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78953"
FT                   /db_xref="GOA:C5CIW4"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIW4"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ACR78953.1"
FT                   /translation="MRSYMTETSYTSGQTRELKICDTHAHLNFPHFNRDRKRILEEIDS
FT                   GKIVFTIEVGTNMDDSKAAVELAKANRHIFASVGVHPHDSDEVPSDYIDILKELAAEKK
FT                   VVALGEIGLDFYRDLSPKDVQRKVFREQLLLAQELDMPVIVHVRDAYYDAYEILREFEG
FT                   KLTGVIHAFSGTQEDALRFKELGFKLGIGGPLTYPKNKGLREIVKVLPIETFVPETDCP
FT                   YLPPQPHRGKRNEPYYVRFVVEKISELKGLSVETCADILCANAVALFRLNL"
FT   gene            complement(257409..258488)
FT                   /locus_tag="Kole_0229"
FT   CDS_pept        complement(257409..258488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0229"
FT                   /product="Protein of unknown function DUF933"
FT                   /note="PFAM: Protein of unknown function DUF933; KEGG:
FT                   bha:BH4051 translation-associated GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78954"
FT                   /db_xref="GOA:C5CIW5"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIW5"
FT                   /inference="protein motif:PFAM:PF06071"
FT                   /protein_id="ACR78954.1"
FT                   /translation="MEIGIFGLPLSGKTTIFSLLTGVDTSGSHRTESHTGVAKIYDERV
FT                   AKLSEIFKPKKTTYATLSFIDIPSFDPSANRKEKNRIFQFIQNADALLAVVRTFRDPTV
FT                   PWPVGAETPKQQLDAIITELLLRDMEVVENKIERLNESLKKKKLTKEEEKELEVLGEIK
FT                   NALEEEKFVSQLGLEADILKLLGSLSLFTAKPLIIVANTDDEQFTEGNYDGKEDIKATC
FT                   EENGFAYMELSGKIEMEINELEDEEKEAFMEELGIKESGIQRLSRVVYEHIGLMSFLTV
FT                   GEDEVRAWTIKKGSTAREAAGKIHTDLAKNFIRAEVIPYQTFIEIGDMHEAKNKGLVKL
FT                   VGRDEIIHDGDIVHIRANA"
FT   gene            258828..259004
FT                   /locus_tag="Kole_0230"
FT   CDS_pept        258828..259004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78955"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIW6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78955.1"
FT                   /translation="MADTNPFGIDPNSFGVVPNHSVVVPNRKRLKKAVILEMFYPESRF
FT                   LKYEILNQVQDAR"
FT   gene            259202..260482
FT                   /locus_tag="Kole_0231"
FT   CDS_pept        259202..260482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lpn:lpg2913 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78956"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIW7"
FT                   /inference="similar to AA sequence:KEGG:lpg2913"
FT                   /protein_id="ACR78956.1"
FT                   /translation="MELFDILLSMNLWWRGTKIEVPEIKRDTYDEVQELYNTSKTMICI
FT                   QGLRRVGKSTLIFQFINELLTNGADPEDILYISLDDPRLISFDFPIIEAYELWLKRFGR
FT                   RKAYLFVDEAHFSRNFDLQLKRIYDNYGPKIVFTGSASLFLKKGISESLAGRVISVPMN
FT                   PLSFREFLRFKNLKVESFVSLEEAIDNAYKLPLEIYSLFHEYLLIGGFPETLTLKPEMA
FT                   KRYLRETYVERVLLKDIPTIFGNVDSLKLLSTFAILAESTGNKINFTEVSSSLRLKIDT
FT                   VIKYSDYIKASGLVHFIQRMSKSVRARRNIMPKVYLAHPSIAGAFSEIRLNEGVLVENA
FT                   VENHLKADKYYWEGKREVDFVVNGIPIEVKFSNKPETALKNLQELSRYLDFKRAIVVTR
FT                   DILKKENSNDKEIFFIPAAVFLLSEVR"
FT   gene            complement(261104..261451)
FT                   /locus_tag="Kole_0232"
FT   CDS_pept        complement(261104..261451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0232"
FT                   /product="protein of unknown function DUF86"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   gur:Gura_4166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78957"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIW8"
FT                   /inference="protein motif:PFAM:PF01934"
FT                   /protein_id="ACR78957.1"
FT                   /translation="MSERTPTELIEDIIEAINRIMNYIDNLTYNEFLNDLKTQDAVVRN
FT                   IEIIGEAAKKIPLHIRQKYSRIPWKEIAGTRDKLIHDYFGVNFDIVWAIIKNDLPELRK
FT                   QIESIKSDMRF"
FT   gene            complement(261444..261746)
FT                   /locus_tag="Kole_0233"
FT   CDS_pept        complement(261444..261746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0233"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: ccs:CCNA_03176 nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78958"
FT                   /db_xref="GOA:C5CIW9"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIW9"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ACR78958.1"
FT                   /translation="MKDLGAIINVLKELLPELRDRFGVSKIAVFGSFSKGSQTKDSDID
FT                   IYVEFDKVPGLKFMELAEFLENALGKKVDLITPIGLKTIRNRKVKEDIERTLTYV"
FT   gene            262494..263051
FT                   /locus_tag="Kole_0234"
FT   CDS_pept        262494..263051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0234"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: pde:Pden_5114 DNA polymerase III, epsilon
FT                   subunit; TIGRFAM: DNA polymerase III, epsilon subunit;
FT                   PFAM: Exonuclease RNase T and DNA polymerase III; SMART:
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78959"
FT                   /db_xref="GOA:C5CIX0"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIX0"
FT                   /inference="protein motif:TFAM:TIGR00573"
FT                   /protein_id="ACR78959.1"
FT                   /translation="MNKVYVVIDTETTGPSPLRGDRIIEIAAIPIYRGKMFVDLAFHSL
FT                   VNPQIRIPAYISGIHGLKNEDVTSEPTISDVFPRFKEYLGNAIIVGHSIEVDMKFFDIA
FT                   CKEIGTFPLSNQYIDTLKIAKDLFKEGSYSLAELAKRLKIKDAPTHRALDDARVTGKVF
FT                   LAMVKKLGGFSSIRKYVKRWRG"
FT   gene            263054..264343
FT                   /locus_tag="Kole_0235"
FT   CDS_pept        263054..264343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0235"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; SMART: Nucleotide binding
FT                   protein PINc; KEGG: geo:Geob_2932 PhoH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78960"
FT                   /db_xref="GOA:C5CIX1"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIX1"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ACR78960.1"
FT                   /translation="MVKNFILDTNVLVHDPYCIEKFEDNNVIIPFPVLEEIDKLKSKPG
FT                   TLGQSARKVNRILDSYREKGSLTGGITLPSGGKLKVLVFNEFHVELPPFLEHNYKDNAI
FT                   LLYTLELKKRNKVPVVLVSKDINLRVKADVVGIPAQDYLADKVSLDEGLSGILKINDDI
FT                   LRKRFLETGELPAKELADDEIYPNLFIDFGEDVFGRVAPDGKKIVKLKVNMETSCWGIQ
FT                   PRNVEQMLVMELLLDDRIKLVTIPGMAGTGKTLLSLAAGLRKVLDEKVYDRLLVARPLI
FT                   PMGKDIGYLPGSREDKVRPWMQPIYDNLFLLFTNRHQDLDTFLKRGEKLEIEILSYIRG
FT                   RSIPNQLMIIDEAQNLTPHEVKTIITRVGEDTKIILTGDPYQIDNIYLDTSSCGLVYAA
FT                   SRFKKHPLAGCVTLTKGERSVLASAAAELL"
FT   gene            264363..264605
FT                   /locus_tag="Kole_0236"
FT   CDS_pept        264363..264605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78961"
FT                   /db_xref="InterPro:IPR032587"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78961.1"
FT                   /translation="MTNTQEYDLYLKIAKPDIHVLCYIVEAEDNLMNIRHVTEDGFLKI
FT                   IVPGDLLKDALNFLESIGNYIDLEVVEIRENPGHT"
FT   gene            264583..265635
FT                   /locus_tag="Kole_0237"
FT   CDS_pept        264583..265635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0237"
FT                   /product="HAD superfamily (subfamily IIIA) phosphatase,
FT                   TIGR01668"
FT                   /note="TIGRFAM: HAD superfamily (subfamily IIIA)
FT                   phosphatase, TIGR01668; hydrolase, HAD-superfamily,
FT                   subfamily IIIA; KEGG: baa:BA_5007 haloacid
FT                   dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78962"
FT                   /db_xref="GOA:C5CIX3"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010021"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR027706"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIX3"
FT                   /inference="protein motif:TFAM:TIGR01668"
FT                   /protein_id="ACR78962.1"
FT                   /translation="MKILDILRLPLPKERAKSVRDIDYDKLINKGYNTFLFDYDNTIAV
FT                   WRSTFDMRNESLFNSLLNKGVKVAVVTNAPANRVQHITKIFGHKVKIYHSMKKPGTKEM
FT                   QRVLKELRSAPEKTVIIGDLFLTDVIAGNRIGMYTILVRPAINKNAALYKKIAAFLTMA
FT                   SYVTFFYTVGWFVRTIDLLTPHVFHKRVEDINFEQLKDAGYELVVFDFDNTLQPWNSNS
FT                   LSHERELFIKRIQLLGFKVVIVSNGSKRRLKDISQSLSGVKILPEARKPYPGKVRRLLK
FT                   SLDILPHKTVVVGDQLFTDVLMGNLLGAFTIKVVPLSNKEFFWTRIMRKLEAVVLKIIE
FT                   SSAELKEIDK"
FT   gene            265632..266738
FT                   /locus_tag="Kole_0238"
FT   CDS_pept        265632..266738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0238"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   baa:BA_5006 MMR_HSR1, GTPase of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78963"
FT                   /db_xref="GOA:C5CIX4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIX4"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACR78963.1"
FT                   /translation="MKCKGCGVEIQTFNDDVPGYIPADVLERRQKEGKEILCQRCFHLK
FT                   HYGKFKKEKKGVKSLDSLKKYLHLAKNVIYVIDIFDFDGTYREEIVELLKEHNVYYVIN
FT                   KVDLVPKEVAPPEIKKWARDRLKVQSTRVKLLSAKVGRGVSGFVKFLKSKKDRRFLVVG
FT                   VTNVGKSSVLNALTGEGQLTASKYPGTTLELVQLKNEDTGLTLIDTPGIFTNDRVTDLL
FT                   DPWCQAKIMPQKKLTVTTINAKKDRTVFFSSFVSITVKGYKGRRSPIFHILTSENVVVH
FT                   ETNPEKAEERWSEWFGRFLVPPCGNSGFDNYKFENHQLRLEAGQEIHICGLGWVNVARG
FT                   PAEFTLKLPESVKWVVRDALIGPYKFKK"
FT   gene            266755..267348
FT                   /locus_tag="Kole_0239"
FT   CDS_pept        266755..267348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0239"
FT                   /product="Propanediol utilization protein"
FT                   /note="PFAM: Propanediol utilization protein; KEGG:
FT                   pmr:PMI2713 propanediol utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78964"
FT                   /db_xref="GOA:C5CIX5"
FT                   /db_xref="InterPro:IPR008300"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIX5"
FT                   /inference="protein motif:PFAM:PF06130"
FT                   /protein_id="ACR78964.1"
FT                   /translation="MKLKKLPIKAGVSNRHVHLSQEHLEILFGKGYELTPIKDLGQPGQ
FT                   YAAKEKVILVGPKGAIEGVRVLGPVRKATQVEISKTDAFKLGVNPPIKDSGDHEGSVGL
FT                   TLVGPKGTVILERGVILAKRHIHMTPEEAEAFGVKDKDIVMVYCEGTGGRKTIFDDVLV
FT                   RVSKSYALEFHVDTDEANAAMLSNNDPVYIIEEL"
FT   gene            267353..268150
FT                   /locus_tag="Kole_0240"
FT   CDS_pept        267353..268150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0240"
FT                   /product="protein of unknown function DUF72"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   par:Psyc_1936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78965"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIX6"
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /protein_id="ACR78965.1"
FT                   /translation="MLFLGTSGYSFKDWLGTVYPPDVKPSQMLKYYKHVWRFNTVELNF
FT                   TYYRQPTYKTIAGISRKIPGEFLFTAKAPSTVTHEYWKEGKKEAAKQDMVRFLSALQPL
FT                   KDEGRLGPILFQFPYAFKATKERLRYLEFIAEKLSGENIHYALEFRNDSWDDPKIYDYV
FT                   IELGFTPVTVDEPQLPGLFPYRPIMGKNLAYFRFHGRNPKWFRAEGSARYNYNYSDDEL
FT                   RRFALDVLEFLRTGADVFVFFNNCYMGQAVQNALRFRELVGGA"
FT   gene            268157..268483
FT                   /locus_tag="Kole_0241"
FT   CDS_pept        268157..268483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78966"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIX7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78966.1"
FT                   /translation="MTYSDILSIVLRMIAEGSEPHEIFEQLSKFGLSSSEIDEIYDAVL
FT                   EMVVNGYEKTEMIIDNSYDIRRRVFVDDELETLKMMPGLFKSFVKGDISPGDFEKSLSD
FT                   FSVF"
FT   gene            complement(268540..271104)
FT                   /locus_tag="Kole_0242"
FT   CDS_pept        complement(268540..271104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0242"
FT                   /product="alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: gur:Gura_4193 alpha-glucan phosphorylase;
FT                   TIGRFAM: alpha-glucan phosphorylase; PFAM: glycosyl
FT                   transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78967"
FT                   /db_xref="GOA:C5CIX8"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR024517"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIX8"
FT                   /inference="protein motif:TFAM:TIGR02094"
FT                   /protein_id="ACR78967.1"
FT                   /translation="MYFLEKITVVPKLPEKLKRLEELAYNLWWTWNPKVEALFRSMDSE
FT                   LWYEVKRSPVKLIRRINQQKLNELAKNEKFLKEYAEVVAEFDAYMNNSNTWMDKNHPDR
FT                   KNELVAYFCAEYGLHESFPIYSGGLGILAGDHLKTASDLGLNIVGVGLLYRHGYFVQTI
FT                   DKTGWQHSEFPSYDFSDFPVVSATNEKGEEIYVNIEFPGRKVWAKVWKAMVGRSVLLLL
FT                   DTDVPMNDPEDRKITAQLYGGNRETRIQQELVLGIGGVRALRMLGYNPKVWHMNEGHAA
FT                   FLALERIREYVQGKKLDFRTAIELTRATNIFTTHTPVPAGNDVFDLSLIDKYFSEFWPK
FT                   LNASRQEFIDLGLERGVGGHQQFSMTVLALRLSSLANGVSKLHGEVSRKLWSHVFPEYP
FT                   AVEVPITHVTNGVHMWTWLNRDLKKLFDKYFPKGWEEKITDSEIWEYVDKVPDEELWEV
FT                   HMKLKERMKVFLQGRIRRQRLRCGETIEELMEVDKLLPEKILTIGFARRFATYKRATLI
FT                   LKDIERLKMILTDNERPVQFVFAGKAHPADEPGKELIRQLYQLSRMPEFKNRIIILENY
FT                   DMNIARHMISGVDVWMNNPRRPHEASGTSGQKAAMNGVINFSVMDGWWVEGYNGENGWT
FT                   IGDNRDYDDNELQDRIDSVSIYSTLEKEIIPLYYKRDENGIPREWVKKMKNSIKSVALN
FT                   FNSHRMLIDYIENLYLKGVEYYEFMNADSFKKALEIARWHQRLLQNWGYIRIKPNLLRP
FT                   SSGDSLRVGSEISLTANVYLGELKPEEVRVEIYVAMLNEDGEIVKFKTYPMKLEKEDVH
FT                   GEYVYTGKFTVEEEGKMVYTIRVIPNPENLPNGHFLPMAKWI"
FT   gene            complement(271912..272277)
FT                   /locus_tag="Kole_0243"
FT   CDS_pept        complement(271912..272277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0243"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART: RNA
FT                   binding S1 domain protein; KEGG: bha:BH0077 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78968"
FT                   /db_xref="GOA:C5CIS6"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C5CIS6"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACR78968.1"
FT                   /translation="MSVKVGNIVQGKVTAVRKYGAFVTLEGGEEGFIHISKVSKGYVKN
FT                   IDDYLKVGQEITAKVLGTTKDGKWELSIKDAGGNQGEEQATSQDFERKLARFMRDSSQK
FT                   LSAYRRRLDKKRGVKKR"
FT   gene            complement(272337..272546)
FT                   /locus_tag="Kole_0244"
FT   CDS_pept        complement(272337..272546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0244"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: nam:NAMH_1326 ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78969"
FT                   /db_xref="GOA:C5CIS7"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CIS7"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACR78969.1"
FT                   /translation="MKKGIHPELKLITVKCTCGAEHKFWTMKEDIKIDLCSNCHPFYKG
FT                   DTGSLIVDTEGRVQKFRNKYGDNY"
FT   gene            272661..273650
FT                   /locus_tag="Kole_0245"
FT   CDS_pept        272661..273650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78970"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD26"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78970.1"
FT                   /translation="MKDIERVFESVKGKIYEEGFTTFYYERKEWVERLALLLRRNSESG
FT                   LRLLKRELDNSSPLLSFSDENLSFIIDILKDSERDVKERIVLASDLSGDTVGNTAHLLY
FT                   LIYPKHYPPVPKAIGNEMVTVEEYYSWKKRAEKFLGNIVDNYIMLESAFLFKPSPKISE
FT                   GIEEFFKGLSFINVKGIKKAREEYKKLKGKQKERVVRFLNDSYVKKVVTSKRVSPVVID
FT                   GSNIVFSQQPFPDIARLDKLFNFMGRAKEALFPYRIVFDANIRYIIRGYQQSQLEKWLV
FT                   LPNVELYSPADDRIIMLARSLKAKVISYDRFLEHNTSGIKILRPEDLL"
FT   gene            273647..274669
FT                   /locus_tag="Kole_0246"
FT   CDS_pept        273647..274669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0246"
FT                   /product="S-adenosylmethionine/tRNA-ribosyltransferase-isomerase"
FT                   /note="TIGRFAM:
FT                   S-adenosylmethionine/tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein; KEGG: bar:GBAA4648
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78971"
FT                   /db_xref="GOA:C5CD27"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD27"
FT                   /inference="protein motif:TFAM:TIGR00113"
FT                   /protein_id="ACR78971.1"
FT                   /translation="MNMKVSDFDYELPKELIAQEPVQPRDHSRLMVIRRDRENFEHTHF
FT                   YRIIDYLEPGDLLVMNDSKVIPARLLGKKSTGAKVEIVLIEKVGSKQWKAIVRPGSKIK
FT                   RGNVLLFEDLQCEVVEHCDDSTRILEFTGSNPWEKIRRIGKLPIPPYISKYPDDPNLYQ
FT                   TVYAKKDGSVAAPTAGLHFTDSLLKKLKEKGIKMAFVTLHVGLGTFRPVKVENVEDHVM
FT                   HSEYYTLPEETVELIKETKRNGNRVIAVGTTVVRTLEAVAQKHDGKLVAESGRTDIFIY
FT                   PPYEFKVIDGLITNFHLPKSTLLMLVAAFTGREKILKAYNEAIKLRYRFFSFGDACFIY
FT                   "
FT   gene            complement(274640..276706)
FT                   /locus_tag="Kole_0247"
FT   CDS_pept        complement(274640..276706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0247"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   bsu:BSU27420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78972"
FT                   /db_xref="GOA:C5CD28"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD28"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ACR78972.1"
FT                   /translation="MKRSNKGRLFVALLTFLYLFIAFMIFLLSPTTAIVVLATLVIVFI
FT                   VVTWAKFATTKLKIKRALALIIGLLSVFLTIIMIMFFIVPLVLKQVPNFYNLVLDFFPS
FT                   DDKTISTGYVGTTLWVLEVGNRDRVIESQYRIILDRMGASKEQMIKEIEDYLLAASSVK
FT                   RNPNYLELQLRSATEKLKEYFEEVPTSPDIKKVEIYGALVSSDERIFRTKLENKIKECI
FT                   SPETVAVAIAHDIAARLSEEISQQGNLRDSNIYVPFTIQSRNALLKIINKYSYEFNPDK
FT                   TFSEFISEIKQIVDEEINTRYLLMIPLPDGEPEKIREFIEKELVSVFPPGLFRVKIYSP
FT                   GANDVNSLKAYYMTEKERSELQRYTVNFPDLERAYIVIMEEPNLRDGIKRRVEEILETY
FT                   KPIGLSKEEEKYFQRFTRDFATNLASNFESYDGNWLAYTNELLDWFNVKRETKASILLT
FT                   TRTFLLELKVKLRDYTNSMLEKIPNIASETFTIVFFVVIGSIYTSFYFAFFKRLAPKLY
FT                   PRQYRRIAANFLRELHGNMKRYILSILFIALIVGITVGLLIKFLGLGYSLLIGFWAAIT
FT                   NLVPVVGVIFEIVPIILLIAAQPSLSGLIIFVIALIAIHSAAFIIFLKLMGDYNRVNPV
FT                   MVILLVLFMGQLLGILGAFLAAPVAILLKQLWKHFFEPWLESENSVNEASIAE"
FT   sig_peptide     complement(276605..276706)
FT                   /locus_tag="Kole_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.414 at
FT                   residue 34"
FT   gene            complement(276724..277704)
FT                   /locus_tag="Kole_0248"
FT   CDS_pept        complement(276724..277704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0248"
FT                   /product="Asparaginase/glutaminase"
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: bha:BH1624
FT                   L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78973"
FT                   /db_xref="GOA:C5CD29"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD29"
FT                   /inference="protein motif:PFAM:PF00710"
FT                   /protein_id="ACR78973.1"
FT                   /translation="MPEIAIITTGGTIAMVRDPSTGASVPASGMNVHVAEVDGLSAIAK
FT                   IRHYDFSNVPSPYMTPSMLWNLSSLVNDILKDENIAGVVITHGTDTLEESAYFLDLTVQ
FT                   SDKPVVCTAAMRNINELGTDGPRNVVSSVKVALSPASRGLGTLVCLNDEIHAAKEVTKT
FT                   YTSNVATFDSPGYGPLGIVDEDKVVYFRRLYYRENYRVRFIEENVALIKTFVGDDGRII
FT                   EKLPELGYKGLVIEAFGRGNVPPKVEDALKVLIKDLSFPVVITSRCFKGRVLGIYGYKG
FT                   GGRSLHDLGVIFAPGLSSQKARIKLMVVMGLTDDLTKIAEYFQHS"
FT   gene            complement(277686..279341)
FT                   /locus_tag="Kole_0249"
FT   CDS_pept        complement(277686..279341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0249"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: bcc:BCc_272 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78974"
FT                   /db_xref="GOA:C5CD30"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD30"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACR78974.1"
FT                   /translation="MKAVLVDGYIDEPAAFGVSPYISPKIRLLAGILFRAGYEVEYHTI
FT                   DDVRKKELWEAFRGHQILVVHGGITTPGRYVGGNPVTLNDIKKLLSGNKEPQKIICGPI
FT                   ALGYSLKGGTKAMNVELSEVDALLSHELQLADFLGLELKGSRYEILNELYPIGARIVPQ
FT                   HPRYPDVMIEFDISSGCERSDGYCSFCTESLLYGKFESRDLRGIERELRALKDVGVKAL
FT                   RFGRSANVVAYGYNRDVGKPDPEAVENLFRLATEILKPEVLHIDNGNPIFIAQYPEESR
FT                   KILETIARYDTPGDIISFGVESFDETVRRLNNLGGSAEDILKAIEIVNEIGAFRVDGVP
FT                   KLLPGINLLYGLPGHSKETFKIDRAYLKKIYDNDWLIRRLNIRQVMIFEGTPLSHQVLP
FT                   KFSKKAFIKHKETIRKEFDTPMLKKVFPVGAILRKVIPEYTQGDITFGRPLGTYPILVG
FT                   SPVKFESPTDMVVIGHGIRSITAIPVNADLNSLSLRELTFLPGIGKNRATMLVLNRPFK
FT                   NWEELVNLLEQETVNNLKKLRLQIGGKTDCLKSR"
FT   gene            279446..280657
FT                   /locus_tag="Kole_0250"
FT   CDS_pept        279446..280657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0250"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpX"
FT                   /note="KEGG: pca:Pcar_1688 ATP-dependent protease
FT                   ATP-binding subunit; TIGRFAM: ATP-dependent Clp protease,
FT                   ATP-binding subunit ClpX; PFAM: ATPase AAA-2 domain
FT                   protein; zinc finger C4 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78975"
FT                   /db_xref="GOA:C5CD31"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD31"
FT                   /inference="protein motif:TFAM:TIGR00382"
FT                   /protein_id="ACR78975.1"
FT                   /translation="MPFERKCSFCGRPASQVKKLISGAEGYICDECVELFHDILKEDTK
FT                   VRREPGKKLPKPAEIKAILDQYVIGQEKAKKTISVAVYNHYKRVFIGSDDIEVEKSNIM
FT                   LIGPTGSGKTLIARTLAKILDVPFAIADATPLTEAGYVGEDVENVILRLLQAANFDVER
FT                   AQYGIIYIDEIDKITRKTSNPSITRDVSGEGVQQALLKIVEGTIANVPPQGGRKHPYQE
FT                   FIKIDTTNILFIVGGAFDGLDEIIKERILTSTMGFGAEVKGKDSYRLGEILAQVGPDDL
FT                   IHYGMIPEFVGRFPVVATLDDLSVEDLKRIMLEPKNAVIKQYQKLLEIEGITLQFTEDA
FT                   LTAIAKEALKRGTGARAIKSVIESVMLDIMFEAPSMENVEKIIMTKDVIEGRAKPEIIT
FT                   RESA"
FT   gene            280657..281649
FT                   /locus_tag="Kole_0251"
FT   CDS_pept        280657..281649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0251"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: mxa:MXAN_2051 O-sialoglycoprotein
FT                   endopeptidase; TIGRFAM: metalloendopeptidase, glycoprotease
FT                   family; PFAM: peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78976"
FT                   /db_xref="GOA:C5CD32"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CD32"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ACR78976.1"
FT                   /translation="MRVLAIESSCDETAVAIVEDGKLLSSVLSSQVNIHRKYGGVVPEI
FT                   AARKHLENILFLLDEALDRASLKIDDIDVFAATQGPGLVGSLLVGLSLAKGLSISLNKP
FT                   FVAVNHLIGHIYANFLSFPDLEYPFLVLLVSGGHTEILLAEDWNNFKRIGKTRDDAAGE
FT                   AFDKVARLLGLGYPGGPEVELAARNGNPIYRFPRALNEKGNFDFSFSGLKTSVLYFLKN
FT                   NPEARIEDVAAAFQEAVIDSLLTKTFAAAKTYGINKIVFAGGVAANTRLRERANEIAKE
FT                   KDINIYFPPIEFCTDNAAMIAMVAYEKAKRGIFSPIDTNAIPYLSIVSL"
FT   gene            complement(281632..281871)
FT                   /locus_tag="Kole_0252"
FT   CDS_pept        complement(281632..281871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0252"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; KEGG:
FT                   dal:Dalk_4244 regulatory protein, FmdB family"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78977"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD33"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ACR78977.1"
FT                   /translation="MPIYKYRCESCGNVVEVFQKINDDPLETCETCGGELKKMIGNIGV
FT                   VFKGSGFYSTDSKKTSNDSSSSKETTNNTSKTND"
FT   gene            complement(281889..282248)
FT                   /locus_tag="Kole_0253"
FT   CDS_pept        complement(281889..282248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0253"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein;
FT                   protein of unknown function DUF861 cupin_3; KEGG:
FT                   sfu:Sfum_1397 cupin 2, conserved barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78978"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD34"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACR78978.1"
FT                   /translation="MSERIVTGKAHDLEAQVFDSDTVRGVEKRILIGEKHNAPNFVMRL
FT                   FTVKPGGYSPRHSHDWEHEVFIVKGEATVVTPEGEIKVSAGSYVYVPKNVEHQFKNETE
FT                   DILEFICVVPVYAEK"
FT   gene            complement(282214..282918)
FT                   /locus_tag="Kole_0254"
FT   CDS_pept        complement(282214..282918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0254"
FT                   /product="single-stranded nucleic acid binding R3H domain
FT                   protein"
FT                   /note="PFAM: single-stranded nucleic acid binding R3H
FT                   domain protein; SMART: single-stranded nucleic acid binding
FT                   R3H domain protein; KEGG: baa:BA_0592 R3H, putative
FT                   single-stranded nucleic acids-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78979"
FT                   /db_xref="GOA:C5CD35"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR032782"
FT                   /db_xref="InterPro:IPR034079"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="InterPro:IPR038008"
FT                   /db_xref="InterPro:IPR038247"
FT                   /db_xref="InterPro:IPR039247"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD35"
FT                   /inference="protein motif:PFAM:PF01424"
FT                   /protein_id="ACR78979.1"
FT                   /translation="MKTVVVSAPSVDEAVRLAQIKLDAYEDEIEVKVIEKGSKGFLGIF
FT                   GGKATKIEAKLLPKYFERKLSEYLKGILHHFGEDIYFDVTFNGKTFKVIIEGDNISRLI
FT                   GRHGKTVSALQHILNIYANRLSDIKVNVSVDVGNYKRERSELVVNMAHKIVRKVKKQKG
FT                   KVILEPMFAFERRIVHEIVSQYDGVRSYSIGLEPYRRVVVEYSGNGNGRNGARKKTGRF
FT                   KNVRAYSNRKSS"
FT   gene            complement(282953..284290)
FT                   /locus_tag="Kole_0255"
FT   CDS_pept        complement(282953..284290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0255"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; KEGG:
FT                   hps:HPSH_07420 putative inner membrane protein translocase
FT                   component YidC"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78980"
FT                   /db_xref="GOA:C5CD36"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD36"
FT                   /inference="protein motif:PFAM:PF02096"
FT                   /protein_id="ACR78980.1"
FT                   /translation="MRKITALFFILVVLFASVLLGSEMTTKEGTDTLTISSKTFTIVLN
FT                   TRLGVLDDIRINVDRKVVDIYTYYPEDPDGYNVYGSNGELIPISFSYEEDENGNILVYF
FT                   FYDSGTKTFVVKNDPYYDFDIILSFSEEITAVSVPYISEINQKVHPNFFITYAKPDKQK
FT                   TVCISYSEEGRFDVKRFYPNSGRATISAFAGPVKLIHISEAFPEIYEEIKKDLEEFGAI
FT                   GFTSYIFHGLVAFLYWLYKLTKSFGWAIILFTIVVRLVLYPLYHLQTKSMIQMRAVQPE
FT                   IEKIKKKYKDPQKQQQALTKLYREKNINPATGCLTLLIQLPVFFVLYAVIRYFGEMFAY
FT                   SPKFLIWSDLSTGGFVINLPFIIITILAGFYMSLFTSQDPRAARQGMIFNVMFPFLFYS
FT                   FPSGLFLYYTTNTVIQMLITIYVYRKFGIKKLTVREVLGLPPKPVK"
FT   sig_peptide     complement(284225..284290)
FT                   /locus_tag="Kole_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 22"
FT   gene            complement(284287..284529)
FT                   /locus_tag="Kole_0256"
FT   CDS_pept        complement(284287..284529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0256"
FT                   /product="protein of unknown function DUF37"
FT                   /note="PFAM: protein of unknown function DUF37; KEGG:
FT                   bar:GBAA5048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78981"
FT                   /db_xref="GOA:C5CD37"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CD37"
FT                   /inference="protein motif:PFAM:PF01809"
FT                   /protein_id="ACR78981.1"
FT                   /translation="MKKIVLTLINFYRKYISPSKPPTCRFTPTCSAYTFEAVQRFGVFK
FT                   GLLLGTWRILRCNPFNKGGYDPVPEEFKLLRRNTK"
FT   gene            complement(284501..284905)
FT                   /locus_tag="Kole_0257"
FT   CDS_pept        complement(284501..284905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0257"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; KEGG: sat:SYN_01012 ribonuclease P
FT                   protein component"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78982"
FT                   /db_xref="GOA:C5CD38"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD38"
FT                   /inference="protein motif:TFAM:TIGR00188"
FT                   /protein_id="ACR78982.1"
FT                   /translation="MRKIDQRLTRNERLRKKADFDRVFKQGNVVQDNFFVVLYVRNGLP
FT                   FSRIGVSVKKKFGKAHDRNRLRRIVKEIFRKNKSAFLPGYDILVIARKELSDSFKSGKA
FT                   DYHILSDHLLGLLSGIAEQEKNEKNSSDVN"
FT   gene            complement(284902..285036)
FT                   /locus_tag="Kole_0258"
FT   CDS_pept        complement(284902..285036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0258"
FT                   /product="ribosomal protein L34"
FT                   /note="TIGRFAM: ribosomal protein L34; PFAM: ribosomal
FT                   protein L34; KEGG: dar:Daro_4204 50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78983"
FT                   /db_xref="GOA:C5CD39"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CD39"
FT                   /inference="protein motif:TFAM:TIGR01030"
FT                   /protein_id="ACR78983.1"
FT                   /translation="MKRTYQPSRVKRKRTHGFLVRMRTKSGRRIIANRRRKGRKRLAV"
FT   gene            285191..286795
FT                   /locus_tag="Kole_0259"
FT   CDS_pept        285191..286795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0259"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: bsu:BSU24240 DNA
FT                   repair and genetic recombination"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78984"
FT                   /db_xref="GOA:C5CD40"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD40"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ACR78984.1"
FT                   /translation="MLFTLSGKNFFTFKEFYMEFSEKLNVITGESGAGKTLLLKALKAV
FT                   TGFSPQLTERKEDSYVEAIFLMNEALRKRAVEMGIEPSDEILIKVSFGPQRTIYRLNGK
FT                   ITPRQVIAELLSDQIEIHSQHSSVKLLDSSKHHLILDNMIRDRSLLKEYAEKYNEFVKV
FT                   KKELGTFEVDPGSIAREKDFLEFQLKEIVDAKLQPGEDIEIERKYKKYTDAQELKKTFT
FT                   LLMETLKDMDNSAYAILSNILHDLEALEKYGYKDFSEHARVAIEEIDYLYDMLVAELPN
FT                   FEFDDEEFSQVEARFSLIQNLKRKYGQTVEEIIETGEKIANRLKELTNLEAKKERLVER
FT                   EKELYQELIRLGKEIDKERLEVARIIKEKIQKHLDDLKMKGAIVDFQFIPNEHPTSSGI
FT                   SKVSLLIRTNPGGGLLEISKVASGGELSRILLAIESVLKDELTLSTVVFDEIDTGVGQR
FT                   LGKIVAEKVKEISDSVQSIVITHIPQIAAIADRHFTVNKEIIGNNTYSFVKTLSDQERQ
FT                   LELKAMTGIIGEERLYE"
FT   gene            286788..287426
FT                   /locus_tag="Kole_0260"
FT   CDS_pept        286788..287426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0260"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_2690 heat repeat-containing PBS
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78985"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR025977"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD41"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78985.1"
FT                   /translation="MNRDEVIRKIVDEKGEEAIPLLLDLLEKEDDEVANICLDALCDMG
FT                   SSGIDALFKKLKEIVSEGRQNDITALYIVDRLSDIGETRIVPLIYSMLKLYDSEEAQVI
FT                   LYEALAKLGEGDKVVDLLSMLLKEAVSTDFRDQIIMALSHTGSMKALKALVELYNDDKI
FT                   DKATKAFLLEALQMLLVNRPEFIEVVKNLKSGKEIIDKIYFWGENCESK"
FT   gene            287413..288312
FT                   /locus_tag="Kole_0261"
FT   CDS_pept        287413..288312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0261"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: baa:BA_0174
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase, FAD-binding
FT                   domain; TIGRFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase; PFAM: UDP-N-acetylenolpyruvoylglucosamine
FT                   reductase domain protein; FAD linked oxidase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78986"
FT                   /db_xref="GOA:C5CD42"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD42"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ACR78986.1"
FT                   /translation="MSLNNKLFRKLYLSGCEIKLDESLANYTTIRIGGRVDAVVFPMTI
FT                   QAFSKCLEVLKAHSVPFKILGGGSNVVPPKSFNGIAVHTRYLANVRISGNKITAECGVP
FT                   LRRVLDIAAEGGLSGLEFASGIPGTLGGALYMNAGAFGGEMSQVVESVSVLDDNLKPKK
FT                   LSVEEIGYGYRQSLFKKNGLTILSATLSLHEGKPEKIREKMQEILSKRLEKQPIHLPSA
FT                   GSVFLRPKPDFYVGSTIDKLGLKGLRVGGVEVSRKHAGFIVNVGGGTQRDLVELIEKIK
FT                   ARVYEKTGVILQTEIDIW"
FT   gene            288330..289295
FT                   /locus_tag="Kole_0262"
FT   CDS_pept        288330..289295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0262"
FT                   /product="HflK protein"
FT                   /note="KEGG: dde:Dde_2946 HflK protein; TIGRFAM: HflK
FT                   protein; PFAM: band 7 protein; SMART: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78987"
FT                   /db_xref="GOA:C5CD43"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD43"
FT                   /inference="protein motif:TFAM:TIGR01933"
FT                   /protein_id="ACR78987.1"
FT                   /translation="MTEIGELPERRPSFKFMSGFVIVFVIIAIVVVYFLSGFFFVGPAE
FT                   VGLVKRFGAHIKTVGPGLHYHLPYPIESVVKVNVSALRKQEIGFRTVSPGRYTSVKNES
FT                   LMLTGDGNIVSVEAVVQYYVKDPEQFAFNLINDEQVVRFVSEAILREEVAAASIDEVLT
FT                   FERDVIAAKTAERVQDVLDQLNVGIEVKNVYLQEVSPPEQVVAAFDDVNNAKQDKEKLR
FT                   NEAERYKNDLIPRAEGEAVQIVREAEAYAEELILKAKGEAERFTKVFGEYKKAPKITRT
FT                   RLYLEMLNRILKDSEKFVLLSKDGVLKFLDLSKMEEGGSR"
FT   gene            289292..290140
FT                   /locus_tag="Kole_0263"
FT   CDS_pept        289292..290140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0263"
FT                   /product="HflC protein"
FT                   /note="KEGG: dde:Dde_2947 HflC protein; TIGRFAM: HflC
FT                   protein; PFAM: band 7 protein; SMART: band 7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78988"
FT                   /db_xref="GOA:C5CD44"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD44"
FT                   /inference="protein motif:TFAM:TIGR01932"
FT                   /protein_id="ACR78988.1"
FT                   /translation="MKAIITIVILAIIALILVPEFFYIVDQTKQAVVLRFGEIKEVSTE
FT                   PGLHTKQPFVDKVVRFDKRLQIYDVPAERIFTKDKKTLLVDTIAVWKIVDPEKFVKTMK
FT                   SVDLALTRIDDVVYSIVRNTFGKLQFDEVISGRGAVLEKVTLAAAEEMKDYGILIVSVR
FT                   VKRAVLPDENKNAVFNRMKSERYQEAALIRAEGEKEANMIRAEADKLKVIALAEAQKKA
FT                   EIIKGTAEASALRIYAEAFSDDPEFYEFWKRLVVYEETLPDSKFILSPDMSFIEKLMKG
FT                   E"
FT   gene            290143..290769
FT                   /locus_tag="Kole_0264"
FT   CDS_pept        290143..290769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0264"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; KEGG:
FT                   dat:HRM2_43180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78989"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD45"
FT                   /inference="protein motif:PFAM:PF01205"
FT                   /protein_id="ACR78989.1"
FT                   /translation="MSCYLSLTGTVSFEVNIKRSVFIGNAAHCETEEEAKRFIRDVAAK
FT                   YRDASHNCWAYKVIGNGVEKFNFSDAGEPHGSAGRPIFSAIEELNMTNVAIVITRYFGG
FT                   TKLGVRGLIDAYRSTARSTLEQGEKGRYCPGKVFSVQVNYSIWNMFVGKFVEGKDFNIQ
FT                   DIDFGASVKAKISCRVENLDVLISFFKERQIEVEMNGNIVFVEKV"
FT   gene            290791..291630
FT                   /locus_tag="Kole_0265"
FT   CDS_pept        290791..291630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0265"
FT                   /product="peptidase M55 D-aminopeptidase"
FT                   /note="PFAM: peptidase M55 D-aminopeptidase; KEGG:
FT                   pol:Bpro_0135 D-aminopeptidase DppA. Metallo peptidase.
FT                   MEROPS family M55"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78990"
FT                   /db_xref="GOA:C5CD46"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD46"
FT                   /inference="protein motif:PFAM:PF04951"
FT                   /protein_id="ACR78990.1"
FT                   /translation="MKIFISTDMEGIAGVVSWNEMKSNNKIYTTMQNTELNWVIELIKE
FT                   SKLNEQVEEIVICDSHSRGENLPFGGISDHRVSWIRGYPRPFYMMQGLDNSFDLVMLLG
FT                   YHGKVGSFRAGMDHTYAGSCIYNIRLNGKEVGETEINAYYAGVFGVPVGLITGDDVLEK
FT                   QVKEFFGNDFPFVRTKEGIGRFSAKVYHPVKVKKAYEKAFEKLLEQLDSLEVKKLNGEI
FT                   TLEVDLVTTVVADAVAIIPGLTRTSGRTVRYTSTEYLEIFRMILAIAMLGGRFANYE"
FT   gene            complement(291668..293320)
FT                   /locus_tag="Kole_0266"
FT   CDS_pept        complement(291668..293320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0266"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: csa:Csal_1545 peptidoglycan
FT                   glycosyltransferase; TIGRFAM: penicillin-binding protein 2;
FT                   PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78991"
FT                   /db_xref="GOA:C5CD47"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD47"
FT                   /inference="protein motif:TFAM:TIGR03423"
FT                   /protein_id="ACR78991.1"
FT                   /translation="MNSKRIDLLFLFFLLGAGLFIFRLFQFQILEHKEFQAEVEKIITR
FT                   VSSIEAPRGRIFDRNGIPLAWNEPIYILKKKVPFLSEKIRSILYTALNRADDATSTIRK
FT                   LEAFGEVEAHLRADYIHLLEDSDEIDVEEHFVRRYSENPGIAHVVGYITSEEQPVRGIE
FT                   KFYNDLLTGKNGLKLLKVDNHGKVVSVLEKTEPIPGEDLVLTIDASLSSYAYSLLKSYN
FT                   RPGAVIVMKTDGQILAMASNPSYSPEQFSLGLSDREWTRLKYDPEGPLLNRAVSPYPPG
FT                   SIIKPFISMVALSEKVSPDATIFCSGIFQYKDSEGHTLAVFSDWYLYGHKEVDLRRALA
FT                   VSCNVYFYELGLKLGIDTLTHYAELTGIFGKTGIDLEEREGLMPSREWKFKTYGEPWYP
FT                   GDTILTYIGQGYALMTPLEVTRMTAIIATKGCEVVPYIYRRSATNEKDFHLSEDAWETI
FT                   IAGMKDVISRAGTGPADRGTAYHAFKGFPYDVAGKTGTAENTGNVPHSWFTGFSPVDDP
FT                   EIIVTVFVENGGYGSTTAAAIARKIFEAYYGIR"
FT   sig_peptide     complement(293240..293320)
FT                   /locus_tag="Kole_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.678) with cleavage site probability 0.666 at
FT                   residue 27"
FT   gene            complement(293301..293690)
FT                   /locus_tag="Kole_0267"
FT   CDS_pept        complement(293301..293690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78992"
FT                   /db_xref="GOA:C5CD48"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD48"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78992.1"
FT                   /translation="MSWKYLIPVFLTYIDLGYADLFPLFPLSIVLLFITLRGGWLSFVL
FT                   SLFIIWLISVSYSSLSFAVLAGIITSFGYLVFKTKLKTPFSAILTTFLLSLSTLVFNTF
FT                   FPGIFVAPLLILFILRRKILEFEKN"
FT   gene            complement(293693..294394)
FT                   /locus_tag="Kole_0268"
FT   CDS_pept        complement(293693..294394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78993"
FT                   /db_xref="GOA:C5CD49"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD49"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR78993.1"
FT                   /translation="MKLLEISITILLIYLVFVSTCFYLGLLDGFKVFLGKAIWPLTYMR
FT                   MRSSEIFSILLKEQGRVVLLSELNELLKKELSITGIEPPLRVAFYNHYRGNHLLLDAVS
FT                   TPLLGSPVVAFESKHIVGVVVGWGSGYIEVEPLKFLEFRIPAVARHRSVDIEGFVYSEH
FT                   GRVFFKTFDPVELEYGDEVTLSPSIEGFGYLHHAGLTVIGQITTPFRECGNYLLKTLEI
FT                   SGELFIYLGGE"
FT   gene            complement(294391..295410)
FT                   /locus_tag="Kole_0269"
FT   CDS_pept        complement(294391..295410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0269"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: pca:Pcar_1049 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78994"
FT                   /db_xref="GOA:C5CD50"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD50"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ACR78994.1"
FT                   /translation="MLFRQDMGIDLGTANTLVFVKGSGVVVNEPSVVAIDSESQKILQV
FT                   GLEAKKMVGKTPASIIAIRPLRDGVIADYDIALAMLKYFISRASNRFTLLKPRVVIGVP
FT                   SGATEVERRALTDAGLEAGAKKAFLIEEPMASAIGVGLNVEEPTGNMIVDIGGGTTEIA
FT                   VISLGSIVLSQSIRTAGDELDESIVQYVKDKYRLSIGEKTAERVKIEIGNVVDHEDFDE
FT                   AETEVIGLDLNTGLPKKLILKGYEVREAITEPVNRIVEAVKFTIENTPPELVSDIVLNG
FT                   INVAGGGALLKGIRELLERETRIKVNLADDPLTCVARGAGMVLERVSILERISKENQY"
FT   gene            295613..296008
FT                   /locus_tag="Kole_0270"
FT   CDS_pept        295613..296008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0270"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /note="TIGRFAM: S-adenosylmethionine decarboxylase
FT                   proenzyme; PFAM: S-adenosylmethionine decarboxylase
FT                   related; KEGG: nis:NIS_1526 S-adenosylmethionine
FT                   decarboxylase proenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78995"
FT                   /db_xref="GOA:C5CD51"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD51"
FT                   /inference="protein motif:TFAM:TIGR03330"
FT                   /protein_id="ACR78995.1"
FT                   /translation="MKKVKALGRHLVAEFFECSSEALDNLDFVVNSMRQAAEEAGATIV
FT                   DSSFHRFLPHGISGVVVIAESHLAIHTWPEYGYAAIDLFTCGDEVNPWKAFEFLRIKFD
FT                   AKKTSVVEHLRGIYSEIGIPETAPHKV"
FT   gene            296023..296889
FT                   /locus_tag="Kole_0271"
FT   CDS_pept        296023..296889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0271"
FT                   /product="spermidine synthase"
FT                   /note="TIGRFAM: spermidine synthase; PFAM: Spermine
FT                   synthase; Methyltransferase type 12; KEGG: bsu:BSU37500
FT                   spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78996"
FT                   /db_xref="GOA:C5CD52"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD52"
FT                   /inference="protein motif:TFAM:TIGR00417"
FT                   /protein_id="ACR78996.1"
FT                   /translation="MKKDLRTMDHLMYMEYYTGRNAGIFMKIKKMLHSYQSPYQRIDIF
FT                   EHPDFGKVFALDGITMMTEVDEFMYHEMLVHVPLFVHPEPRRVLIIGGGDGGSLREALK
FT                   HPSIEEAILCEIDPYVIEAAKKYLPTAVEMDNPKAKIVNENGAEFIKKYKDYFDAIIVD
FT                   STDPTAGEGGHLFTKEFYKNCFEALKEDGVFSAETEDPFYDKGWVAIAYNRISSAFPIS
FT                   KLYTGFMTTYPSGLWTYVFASKKYHPIDDFDPSRVQNFDHQLKYYNEDIHKACFVLPNF
FT                   IKELINE"
FT   gene            297239..299053
FT                   /locus_tag="Kole_0272"
FT   CDS_pept        297239..299053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0272"
FT                   /product="GTP-binding protein LepA"
FT                   /note="TIGRFAM: GTP-binding protein LepA; small GTP-binding
FT                   protein; PFAM: protein synthesis factor GTP-binding;
FT                   GTP-binding protein LepA domain protein; elongation factor
FT                   G domain protein; elongation factor Tu domain 2 protein;
FT                   KEGG: bha:BH1342 GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78997"
FT                   /db_xref="GOA:C5CD53"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD53"
FT                   /inference="protein motif:TFAM:TIGR01393"
FT                   /protein_id="ACR78997.1"
FT                   /translation="MYNKELIRNISIIAHIDHGKTTLVDRILEITSAIEQRKMHEQYLD
FT                   TMDIERERGITIKATPVKVMYTADDGKTYEINIIDTPGHVDFSYEVSRSLAACEGAILL
FT                   VDASQGVEAQTFANTYLALENDLEIIPVINKIDLPNANIQETISELEDLIGFTEEDCIK
FT                   ASGKTGEGVKEILKAIVDKIPAPSGDSGAPLKALIFDAEYDKYRGVIVHARIFEGTVRP
FT                   GDKIMMFSSGETFEVTEVGIFTPELIPADSLSAGEVGYIIAGIKEVSSARIGDTITSAD
FT                   NPISEPLPGFREVKPMVYAGMFPGLPEYYGELRKALEKLKLNDPALVFEPENSPALGFG
FT                   FRVGFLGLLHMDVVRERLEREFEIAVILTAPNVVYRVKMKNGEIVEITNPAKFPNDGEF
FT                   EEVEEPYVELSIITPSEYMGNIIGFVTSEKRGEFKEVENAGKNRVVLKFIAPLSEIMFD
FT                   FFDKLKAISRGFASMDYEIIGYRPSDLVKVTILVNKEVVDALSFIVHKDKEYAVAKKVV
FT                   EKLKDLIPQHQFQIPIQAKSRGRIIARTDIKALRKDVLAKCYGGDITRKMKLLEKQREG
FT                   KKRLREIGRVTIPQTAFLALLKIGEEDK"
FT   gene            299067..299933
FT                   /locus_tag="Kole_0273"
FT   CDS_pept        299067..299933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0273"
FT                   /product="apurinic endonuclease Apn1"
FT                   /EC_number="3.1.21.2"
FT                   /note="KEGG: gme:Gmet_2994 endonuclease IV; TIGRFAM:
FT                   apurinic endonuclease Apn1; PFAM: Xylose isomerase domain
FT                   protein TIM barrel; SMART: AP endonuclease family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78998"
FT                   /db_xref="GOA:C5CD54"
FT                   /db_xref="InterPro:IPR001719"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR018246"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD54"
FT                   /inference="protein motif:TFAM:TIGR00587"
FT                   /protein_id="ACR78998.1"
FT                   /translation="MIIGAHMSTSRGFDKVPQASLNIGGNTFQIFPHSPSMWRAKLPDD
FT                   TTARNFKYRLAESGIKPEDTLVHSGYLINLASPKPEVWEKSVELLDLEIKIVEVLGLKY
FT                   LNFHPGSHLGTGLDEGISRIAKGIDVVLSRNEDSKVILLLENVAPKGGNIGSTFNELRR
FT                   IIETCSYPERVMITYDTCHGFDAGYDIRSKAAVEKLLEEIDSEVGLNRFVMIHLNDSKY
FT                   PLGAAKDRHERIGEGYIGNEGFYHFLSNPEILKRPLILETPGKDPEHAEDIKRVKEILG
FT                   ENGDSDD"
FT   gene            299917..301521
FT                   /locus_tag="Kole_0274"
FT   CDS_pept        299917..301521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0274"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="KEGG: bsu:BSU37150 CTP synthetase; TIGRFAM: CTP
FT                   synthase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACR78999"
FT                   /db_xref="GOA:C5CD55"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD55"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ACR78999.1"
FT                   /translation="MIAMTKKYIVVTGGVLSGIGKGILSASLARVLKEGGVDVNVLKID
FT                   PYLNVDAGTMNPNQHGEVFVTEDGYEADLDLGHYERFLGVNMQRINNVTAGQIYKSVVD
FT                   KERAGKYLGATVQMVPHVTAEIKERIDRISGDLVLIEIGGTVGDIEGEIFLEAVREMSL
FT                   EKGPENFLFIHVTYVPFLKASNEFKTKPTQQSVQLLRKIGIHPDMIAVRSEIPLGNDEL
FT                   NKIALFGGVPKQMVFNLPDASNVYEIPHVLYSMGIQKLIAQKLGIELKDVFHWDYPRAF
FT                   KPYRIALVGKYLGTDDAYKSITESLLLCGVSKPETVDSQILEEMSEDEIAVTLSSYDGV
FT                   IIPGGFGKRGIEGKIKAIKYARLNNVPILGICLGMQLMVIEFARNVAGLEGANSREFDP
FT                   ETPYPVIDLMEDQKRVLQMGGTMRLGAQKTPLFKGSKLREIYGKDLVMERHRHRYEVNY
FT                   EEFKNLFTFPEDKEAFKNTRLIISSKLDFVEAIELPNHVFFVGIQYHPEFKSRVGDPHP
FT                   LFKAYVEAVEAKGGHTT"
FT   gene            301518..302348
FT                   /locus_tag="Kole_0275"
FT   CDS_pept        301518..302348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0275"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: pin:Ping_0812 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79000"
FT                   /db_xref="GOA:C5CD56"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD56"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ACR79000.1"
FT                   /translation="MKKLLARGRYLDLSETVVMGIINVTPDSFYTGSRYQGIEDAVKKA
FT                   VEMYEEGAKILDIGGESSRPGADPVEPQEEIRRVVPVIKELRKLIPDCFISIDTYHPET
FT                   AKAALDSGADIVNDITGLRNEKMMRLVYENNAGVILMHMKGTPKTMQNEPYYEDVVSEV
FT                   KELLKANAEKAVEMGIPSESIVIDPGIGFGKRFEDNLEILRKLDIFKKLGYSVLIGHSR
FT                   KSFIGYILDLPPEERLEGTLAVSAYCYLKNVEIIRVHDVREHIRLFKVLSALKN"
FT   gene            302397..303728
FT                   /locus_tag="Kole_0276"
FT   CDS_pept        302397..303728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0276"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH1865 sugar transport
FT                   system (permease) (binding protein dependent transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79001"
FT                   /db_xref="GOA:C5CD57"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD57"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACR79001.1"
FT                   /translation="MAYSKYSKKYWRETLHAYLFLLPSLVILSIFVFWPIGFSLVLSFF
FT                   KWDYTTTEKYFIGFDNYKELFRLSYPIDMNIFYAALNTAIYLITALILVRFCYFIAGLL
FT                   SKYSKPAKIYSVYYGVTISLGAIYYILRNIVANLSMLHIWLGLTFFVIALISIKKIKKS
FT                   DAHIQLMDSRPWTKIILVVAAYLFFSMIVVPKSYDLVEYFKLAKESSDFLKAIYNTVYY
FT                   VILAVPTQIALALIIALLLNRNIKLRSLFRTAYFIPFVTSVVAVSLVWQWMFNDQFGLI
FT                   NYALSWFNIDKIAWLKEEKWTIPTIAIVSVWQRVGYTAVIFLAGLQNIDRSYYEAAEVD
FT                   GANSLQKFKYITWPLLSPTTFFILIITMIGAFKVFAQIFILYQGLPGPVNKSGLTLVYY
FT                   VFEKFYNEQRMGVASAAAYVLFIIILILTMVQFKIGRSRVHYES"
FT   gene            303738..306152
FT                   /locus_tag="Kole_0277"
FT   CDS_pept        303738..306152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0277"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rlt:Rleg2_5335
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79002"
FT                   /db_xref="GOA:C5CD58"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD58"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACR79002.1"
FT                   /translation="MKYTTKTLIQTLVYLIIVAGALLMLIPFAWMLDTSFKASSEVSSW
FT                   PPKWTTKNAKSEVEFQTKLKYKTTGAGIDLSSLSLSEFRNFAALLGSAAGKDTLVVMLD
FT                   DDPILRGTVTLRLTDETGQAPAYAKNIDKATYAEVVSEFEEVKSNAPSAYEKELRNIFT
FT                   DNPSDFIDDFLYVAEFSDEGFARRVMFVANLSASLEGAIGNLKRAVETPFKPFPMDNDT
FT                   TKKLKEELTLKASELFEPFREEISKVATDLQSMKVGETRVITLEEVRSVITALDNLINE
FT                   ARNLKNLVVKELTPLIPATDMRLKLSLRQVSSLIDGGVIKKLENWKTLLAFYNKVKAFY
FT                   VSQQVLRLSGSEIVGRIRTDQEVHAILMKEIDNWGAPDELKTYLKNNITEKNVRNSLQI
FT                   MLSHVDFEYKELLSKYFDNPTQAFNGITEIINLSRAALVSLNDPHYQNAVESKIESGLN
FT                   YDAFKNIAKEIGAKSGQSLVINASLASLDRYANKVDPATFGRLVSRRWKETRLIGEFSK
FT                   TVSDTFSELEIVKKPDEVYKVYYRGRITSAGTKSFEIKFKDLYAVWFKDDNVQGKVKYT
FT                   ASEVFKNFWQNYVDAWNAAPFGRYYFNTVFVAVSTTFLEIIFAAMAAFAFAKLDFFGKN
FT                   FLFTLFLATMMVPGEVLLVPNFITLTAFGWIDTYYALIVPWVVSVFAIFLLRQHFMTIP
FT                   DELFDAAKIDGMSKWKFLWRIMVPLAKPAVITGALLKFVGSWNAFLWVLIVTKSPEYRT
FT                   LPVGLQNFSSATGTEYNLLMSAATFSIVPVIILFLVTQKYFIAGIARSGLK"
FT   sig_peptide     303738..303827
FT                   /locus_tag="Kole_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.761 at
FT                   residue 30"
FT   gene            306176..306379
FT                   /locus_tag="Kole_0278"
FT   CDS_pept        306176..306379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79003"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79003.1"
FT                   /translation="MIIFITLLLLLTVVANYRAYTKYKEAKQRLQEVEKRYQDLTKELE
FT                   IKEKELEALRNFIEQNTAREEE"
FT   sig_peptide     306176..306235
FT                   /locus_tag="Kole_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.723) with cleavage site probability 0.713 at
FT                   residue 20"
FT   gene            306376..307161
FT                   /locus_tag="Kole_0279"
FT   CDS_pept        306376..307161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0279"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: baa:BA_2669 protein-L-IsoD(D-D)
FT                   O-methyltransferase (PCMT)"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79004"
FT                   /db_xref="GOA:C5CD60"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD60"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79004.1"
FT                   /translation="MTFIVTTSHKPDAKIAARAKDLAAKLGVPYVSRRRLKDYLKLKPV
FT                   DFYYVLDRNGQLSISYDNQRFFFHPSMAKLRLKNFRDGQRDHLIESLELKGNELILDTT
FT                   FGLGSEAILMAHFLTQGKVIGLEASPHIYRVVKHGLEHYPFQYQWMYDAVSKIILINAD
FT                   LKKFIRKVADGVYDIVYCDPMFEVPQYSSSSLNPLRPFAVYNPINEEDVLEMLRIAKKR
FT                   VVLKTRNTDSLFDSFKTIKFDRISGGKSSGVLYGVIEKK"
FT   gene            307158..308084
FT                   /locus_tag="Kole_0280"
FT   CDS_pept        307158..308084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0280"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="KEGG: dat:HRM2_22110 MiaA; TIGRFAM: tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; PFAM: tRNA
FT                   isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79005"
FT                   /db_xref="GOA:C5CD61"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CD61"
FT                   /inference="protein motif:TFAM:TIGR00174"
FT                   /protein_id="ACR79005.1"
FT                   /translation="MKIPMILGATAVGKTQFLVKLASLIPIEVVSVDSRQIYRYMDIGT
FT                   AKPTREELSKLKHHVIDVVDPDEDFNVFEYRKIALKAMDEIVKKGRIPVFAGGSGLYAE
FT                   TLMKGIVENVPRNDKVREALKTLEVNAPGSLRKLLEKVDHEAYEKIHPNDLKRTIRYLE
FT                   VFFTTGKTLTSLQKIHKCSNQFTVIILERDRRELAERIENRVDKMVESGLIEEVVRLKE
FT                   MGYTRELNSQQTIGYAEIWSYLEGEVTLERATELIKRNTRRFARRQIIWFRRYKDAKRI
FT                   SLSETNENDILSLLKEDILNVWGGKYG"
FT   gene            308077..308316
FT                   /locus_tag="Kole_0281"
FT   CDS_pept        308077..308316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0281"
FT                   /product="RNA chaperone Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein core; KEGG: bha:BH2365 RNA-binding
FT                   protein Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79006"
FT                   /db_xref="GOA:C5CD62"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD62"
FT                   /inference="protein motif:TFAM:TIGR02383"
FT                   /protein_id="ACR79006.1"
FT                   /translation="MAEKFNLQDRFLNLLRINKIEVKIFLEGGFQTKGIVRSFDNFTVL
FT                   LETGQEQTLIYKHAIKMMIPQRYVKLAVQNKKEG"
FT   gene            308432..309571
FT                   /locus_tag="Kole_0282"
FT   CDS_pept        308432..309571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0282"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: GTP-binding proten HflX; PFAM: GTP-binding
FT                   protein HSR1-related; KEGG: aca:ACP_1034 putative
FT                   GTP-binding protein HflX"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79007"
FT                   /db_xref="GOA:C5CD63"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD63"
FT                   /inference="protein motif:TFAM:TIGR03156"
FT                   /protein_id="ACR79007.1"
FT                   /translation="MDKIIQNLDKPDNRRYFGKGKLEQVKKIVSFKNISVVITRHNLTP
FT                   SQKKNLESFLEVKVLDRTQVILEIFKKHAVTREGKLEVELARLKYELPSLKGKGTSLSN
FT                   TGAGIGTRGPGEKILERDRRLALKRITVLQKELIKQRKVREVIRKKRQRNSIPVVSFVG
FT                   YTNVGKSSLISALTGADLLVENQLFSTLDVKTCRLKLPSGRRVLISDTVGFIRELPQEL
FT                   IQSFKSTLEEAKFSDLLVVVLDASDRYLDEKLEIINSTLRDIGAENVPKLNVINKIDKC
FT                   TGERLKELGNSFPDAVFVSAVLKYNLDELKEKIDIVLSQSFRKYKLVVPPEKLGEFLKV
FT                   RDEIKVISQECYGDSLIVVYKAPERIHKKLVSFIGEGVK"
FT   gene            309568..310581
FT                   /locus_tag="Kole_0283"
FT   CDS_pept        309568..310581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79008"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79008.1"
FT                   /translation="MKLHKQVLILLLSFLFLSSFLIAGYLKFPLNRKIEVTGYFGEYRG
FT                   PSRDLQFAAHFHKGIDFSTGGVTGLDVMAPENGYIDYFELNHPLYGNILVLALPEVENP
FT                   YTSKKGVKVLFCHLESIGAEGTLAGRKLRMIYEKIQGTYGEAYVKVKFDPEEITFRRGD
FT                   VVAKSGDTGGVPPHLHVEVRDMDEVLIMNPGFFFDLEYERTEVKIMELKVGNKKYDLSE
FT                   HPLVEIGKFSPIVLHTIIKLRHPINPKSIKLYIDDKLIYGIDFEYLKLEHYDAVNEIYV
FT                   NSTPSDYWFNLKSNANLDIVVNYWDRIDLSDPKDALIVVEDHWGNKSEVTFKIVGR"
FT   sig_peptide     309568..309639
FT                   /locus_tag="Kole_0283"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.934 at
FT                   residue 24"
FT   gene            310588..310914
FT                   /locus_tag="Kole_0284"
FT   CDS_pept        310588..310914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79009"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79009.1"
FT                   /translation="MFFKRKKKGKDINKNPFYNNGDTLVIYFKCTKCGEVFRSHLRKFY
FT                   DIHVNYERSGGAYRLDKEFIGSKCQNRINIYADFTRTFKPISFDIIGGRFISKEEYERE
FT                   SQQT"
FT   gene            310941..312125
FT                   /locus_tag="Kole_0285"
FT   CDS_pept        310941..312125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0285"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="KEGG: bha:BH3300 S-adenosylmethionine synthetase;
FT                   TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79010"
FT                   /db_xref="GOA:C5CD66"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CD66"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ACR79010.1"
FT                   /translation="MKKWLFTSESVTEGHPDKIADQVSDAILDAMLEQDPESRVAVETL
FT                   VATGVAVVAGEVTTKAYVDIPRIVRDTILEIGYTRAKFGFDGETCAVLTSIDEQSPDIA
FT                   LGVNKSLEAKNDGKDKYDIIGAGDQGMMFGYATNETEEMMPLPIVLAHNLARRLATVRK
FT                   ERIVEGFRPDGKTQVTVLYEDGKPIGVKTIVVSTQHDPAMTQEEIEQLVKEHVIKAVVP
FT                   EEMMLDGIETFVNPTGRFVKGGPAADTGLTGRKIIVDTYGGWIPHGGGAFSGKDPTKVD
FT                   RSAHYMARYVAKNIVAAGLADRVTLQIAYAIGVAHPVSFMIDAHGTEKVALEKLEKVVK
FT                   EVFDFRPAAIIDKLNLRRPIYKQVAAYGHFGRIDVEVPWEKLDAVDELKRAFNM"
FT   gene            312174..312470
FT                   /locus_tag="Kole_0286"
FT   CDS_pept        312174..312470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0286"
FT                   /product="ribosomal protein S20"
FT                   /note="TIGRFAM: ribosomal protein S20; PFAM: ribosomal
FT                   protein S20; KEGG: afr:AFE_2188 ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79011"
FT                   /db_xref="GOA:C5CD67"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CD67"
FT                   /inference="protein motif:TFAM:TIGR00029"
FT                   /protein_id="ACR79011.1"
FT                   /translation="MPNIKSAAKRVRQNKVRRLRNKSVRTRFRNVTKQLLKAIEINEEP
FT                   EKVNELLRLSYSVLDKAAKKGVIHKRQASRRKSRLTAKVKAYLEARSAGSAQS"
FT   gene            complement(312555..313688)
FT                   /locus_tag="Kole_0287"
FT   CDS_pept        complement(312555..313688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0287"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: bha:BH1140 sugar ABC transportor ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79012"
FT                   /db_xref="GOA:C5CD68"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD68"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACR79012.1"
FT                   /translation="MANVNLKNVTKVYPNGFKAVKSISLDVLDQEFVVLLGPSGCGKTT
FT                   TLRMIAGLEEITEGTIEIGGKIVNDVEPKDRDIAMVFQNYALYPHMTVYENMAFGLKLR
FT                   KFPKPEIDKRVKEAARILGIESLLDRKPKQLSGGQRQRVAVGRAIVRNPKVFLFDEPLS
FT                   NLDAKLRVQMRAELKRLHKNLQATIIYVTHDQVEAMTMADKIVIMKDGIIQQIGDPYSV
FT                   YFDPQNKFVAGFIGTPAMNFINAKLISDKGKLWVTAETMKIIVPDKFAPKLEPYIDKDI
FT                   IFGIRPENIYDKMFAVNATEENTVTGMVDVVEPLGSETLIHATIDGNDIVAKVDPKTRA
FT                   QAGTKIDLVFDVAMMHIFDPETEKNVLVGEHTESVEV"
FT   gene            complement(313681..313959)
FT                   /locus_tag="Kole_0288"
FT   CDS_pept        complement(313681..313959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0288"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG:
FT                   rsq:Rsph17025_3797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79013"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD69"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACR79013.1"
FT                   /translation="MRLHELKFYSIADAKAHFSQVVDESHSADVIITKNGVPVAVVIDY
FT                   EKYVAVNKFIEQTRDLYLMDAGEEAVSLKFEDILVQLDKNSGGELDG"
FT   gene            314082..314612
FT                   /locus_tag="Kole_0289"
FT   CDS_pept        314082..314612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79014"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79014.1"
FT                   /translation="MKKRTKTELFTLVFVIIALLFMMVYSSKYRIAVYVPNDSVELDEF
FT                   YPGEGFEIVDTSELCPISGWDYSGFVVTDASHHRYLVFFWKLDNKEKARELWEELWKKR
FT                   FEVLAKNRGRIVKPSYAFGKVVRFGIKDMAWQKGCWVFFVETDEGVIPEGKESDFMKKF
FT                   IPEQFLNEQAAPR"
FT   sig_peptide     314082..314162
FT                   /locus_tag="Kole_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.611 at
FT                   residue 27"
FT   gene            complement(314642..315967)
FT                   /locus_tag="Kole_0290"
FT   CDS_pept        complement(314642..315967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0290"
FT                   /product="glutamine synthetase, type I"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: bsu:BSU17460 glutamine synthetase; TIGRFAM:
FT                   glutamine synthetase, type I; PFAM: glutamine synthetase
FT                   catalytic region; glutamine synthetase beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79015"
FT                   /db_xref="GOA:C5CD71"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD71"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ACR79015.1"
FT                   /translation="MDKKSVLELVKRENVRFVRLQITDINGFLKNVEIPVKLLEKSLDE
FT                   GVMFDGSSIDGFVRIEESDMYLIPDASTVALLPWKDDDEKTMRIICDVHLPNGEPFEGD
FT                   PRYRLKKVVQRAKEMGFIAHAGPEPEFFLFKRDENSDRPIVGFMDRGSYFDMLPVDKGE
FT                   ETRKEIVISLEKMGFDIEAAHHEVAPSQHEIDFRYADILKTADNIQTFKWVVKTIALMN
FT                   GLYATFMPKPFAQVNGSGMHIHLSLFENGKNAFYDPEKPYELSDVLLNFVGGIIKYAKE
FT                   LTIVTNPIINSYKRLVPGYEAPINISWALGNRSAMIRVPAARGQATRIEIRNPDPSCNP
FT                   YLALAVLLEAGLRGIEEGILPPKPVGENIFKLNQTERKKRKIQNLPGNLNEALEYFSRS
FT                   SLIKDVLGDHIYKKFLETKKKEWKEFMMHVTDWEKEKYLELY"
FT   gene            316091..317470
FT                   /locus_tag="Kole_0291"
FT   CDS_pept        316091..317470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0291"
FT                   /product="AICAR transformylase/IMP cyclohydrolase PurH
FT                   (only IMP cyclohydrolase domain in Aful)-like protein"
FT                   /note="KEGG: scl:sce3150 IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79016"
FT                   /db_xref="GOA:C5CD72"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD72"
FT                   /inference="protein motif:COG:COG0138"
FT                   /protein_id="ACR79016.1"
FT                   /translation="MNIHKVFVSARITDGLENLCSKLISKGAEIIADESTYAFLKLKKI
FT                   TVKNLREFFETEVADDFALQRRIVSCLSGANEEKATCGSNNKHIDLLVVNFEPFSTYVE
FT                   KTGNETELVEHIDSFKPSLVLSAAKNYRNVVVLCDPEDYEDVLEDLEYYGDVSLQRRRK
FT                   LALKALYLLSAYTSEIYSVFSEIFAEEKYNYLILEKIMPLMFGEMSLKKSTLYKVSGIC
FT                   GILDDVHIANPSVAMNHSHIRSVLQFMRLYYFFGDVSAFISDGKLIEVSLRGNMETIHH
FT                   GESVMYGSSFPISYPMIKRLYATGVKSFCGVFEKEAVRYAHDNDILLLTIPERNSLSVA
FT                   KFNFVGFENYIALEENKFPKMDRFSSTEKLAVITSYFNPKISLALVETDNEHSITINVD
FT                   SENRLRTAIFGFNSLNGYVLACNVDLSDETVELLRSKGVNKMYLPCVSKTYNSVDIIPI
FT                   I"
FT   gene            317623..317737
FT                   /gene="ffs"
FT                   /locus_tag="Kole_R0010"
FT   ncRNA           317623..317737
FT                   /gene="ffs"
FT                   /locus_tag="Kole_R0010"
FT                   /product="SRP RNA; RNA component of signal recognitionparti
FT                   cle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            complement(317810..318274)
FT                   /locus_tag="Kole_0292"
FT   CDS_pept        complement(317810..318274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0292"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79017"
FT                   /db_xref="GOA:C5CD73"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD73"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79017.1"
FT                   /translation="MRDKGTMSLVEARRYKRRHLYNGISAWLTGAVAIILIVTAYNRSS
FT                   VLLPINPGSIGAIFWFGILLNIFSLLFYLVATIYALRFARVKFLFLNTLFSLIQGGLLF
FT                   YFSRDILLRGDSGKYELVTPLGGRILSIIMIITGLLVLIIGLIEIGRHRQ"
FT   gene            318519..319964
FT                   /locus_tag="Kole_0293"
FT   CDS_pept        318519..319964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0293"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: gsu:GSU0244
FT                   radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79018"
FT                   /db_xref="GOA:C5CD74"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD74"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACR79018.1"
FT                   /translation="MSIVDSMKKTMLKQAGKFVGSVVRNASEETLYRLFATVSAVSKEP
FT                   AKGGLKKLANMAKEKHPMIQSWRRVFQNANPKCVEKVMTNLVINEFALGEKIRQEKMLE
FT                   HEVVLPKLLVISPTYACNLNCVGCYAGLYGRKYQLSKEEVWSLIRQANELGIYFFIITG
FT                   GEPFVWPHLMETLKEFNDSYFQIYTNGTLITKEVAQKLAELGNATPAISVEGFETDTDW
FT                   RRGRGVFAKISEAWKNLREAGVIFGASVTATRLNHDTIVKEEFWNFLKENDVAYSWIFQ
FT                   FMPVGMNPSMDLVPTPEQRYERFFVLDKLRLGGDFAFVADFWNHGFLTHGCLAAGSKYL
FT                   HINAKGYAEPCVFQQFAVDSIREKSLLEILKSPFFTAYKRMIPYSNNLFRPCPIIDNPK
FT                   VLRAMVKKFNAIPQHEGSEKVLTDLAPELDKLSEEWAKYADKLWYEYGYAEKYPSKRGI
FT                   YDFEVRMNRYANNEEKLAIDKKA"
FT   gene            319999..320559
FT                   /locus_tag="Kole_0294"
FT   CDS_pept        319999..320559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0294"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sfu:Sfum_3459
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79019"
FT                   /db_xref="GOA:C5CD75"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD75"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACR79019.1"
FT                   /translation="MPQKTSTREKIILAARKAFAKKGHDGVSMSEIAENAGVKKALIYY
FT                   YFPSKEDLFYEVWQYSLDELEDHIFAEIENENAYLKKIKKLLKAYIDFITSKKEIRQML
FT                   LQEKGNFTREDERTWQRIKDRYMSLRKRISSLIEQAKLSQEINASVDPEGAAELILNGL
FT                   SSTDNPKSIETVKEIIWRGLVKE"
FT   gene            complement(320597..321433)
FT                   /locus_tag="Kole_0295"
FT   CDS_pept        complement(320597..321433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0295"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: helix-turn-helix protein RpiR; sugar isomerase
FT                   (SIS); KEGG: vpa:VPA1741 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79020"
FT                   /db_xref="GOA:C5CD76"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD76"
FT                   /inference="protein motif:PFAM:PF01418"
FT                   /protein_id="ACR79020.1"
FT                   /translation="MKKSFLNQFNERVGALTSSEEKVARYIKENPLKVVNMSIQSLANE
FT                   CFVVPSTVIKTAKKLGFSGFSELKIALAAELDKAAITGLDSDILSNTFKRYAEFVQELI
FT                   EQASVRLSEELLNEAARIVLEANKIDIYSFGFDSIAGLDLYLKLVQIGKTTAHYENGYM
FT                   QMISATYLGTEDAVIAISSTGSSKDLFDAVKRAIESGAKVIVIAPSSSMLAGLETVYLD
FT                   TYFSTLVLPEGGIATRLVQLFLIDQLYLRILKMDEKSSERYEKFQNVLEYKRKAPK"
FT   gene            complement(321435..322436)
FT                   /locus_tag="Kole_0296"
FT   CDS_pept        complement(321435..322436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0296"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: cvi:CV_2467
FT                   membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79021"
FT                   /db_xref="GOA:C5CD77"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD77"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ACR79021.1"
FT                   /translation="MKIHRFQMLLLVIFLMTGIGIAKGFTVGIMIPGEIGGNPIYELVF
FT                   QGAERAREEGINVKLVEGGYNPGKWEPLLRAMAASGRYDLLITFTEGLPQSVKKLAVEF
FT                   QKQKFALIDGKLNESISNVYSVAFRDEEMTFLAGIFAGLITVSELPGVNPDPVVGLIAG
FT                   DTYPAMMNKMKPGFENGVRFVLPDAKIIFSVAGNWADPGKGRELASKQFDEGVDVILSI
FT                   AGGTGIGIIEEAARRGKYVIGVDSNIISMRPGTILACSLKHIDRVVYETIMAAADGTIT
FT                   YGVNETVGVFEGVIDFTFEDPHYLEIVPERIQEIMKASYILLKYGILRPLEE"
FT   sig_peptide     complement(322368..322436)
FT                   /locus_tag="Kole_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.796 at
FT                   residue 23"
FT   gene            complement(322616..323857)
FT                   /locus_tag="Kole_0297"
FT   CDS_pept        complement(322616..323857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0297"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   bpt:Bpet2493 glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79022"
FT                   /db_xref="GOA:C5CD78"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD78"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ACR79022.1"
FT                   /translation="MGLFEMAISNFNRAVAIMGIDEEYAEMLRRPKRCLIVDFPVLMDD
FT                   GSVKVFTGYRVQHNTARGPAKGGIRYHPETNLDEVKALAFWMTWKTSLMDLPFGGAKGG
FT                   VRVDPKSLSEKELRRLSRRYFSEIQIMIGPQHDIPAPDVNTNPDIMAVYMDTYSMNIGH
FT                   TELGVVTGKPVRLGGSKGREEATGRGVMVTVREACRELGIETSKATVAVQGFGNVGMYS
FT                   ALLCNHELGCKIIAVSDSKGGIFNPNGLNIQELIEHKKSTGKVDSFPGGERIGKDDVFE
FT                   MDVDILIPAALENAITEDNAHKIKAKIISEGVNGPITPEADKILNQRRVMVIPDILANA
FT                   GGVTVSYFEWVQDLQAFFWSLEQIRETLESMMTEAFKETLDTAKKYGVDLRTAAYIIAI
FT                   DRVMYAIKKRGIYP"
FT   gene            complement(323882..324073)
FT                   /locus_tag="Kole_0298"
FT   CDS_pept        complement(323882..324073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0298"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79023"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD79"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79023.1"
FT                   /translation="MEKTSISEIKELSLMIRRGWEIVRYEIQGEKVIFHLVKELGKFNW
FT                   SEDPELKRKYGGDCANDE"
FT   gene            324396..325628
FT                   /locus_tag="Kole_0299"
FT   CDS_pept        324396..325628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0299"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   mxa:MXAN_0781 glycosyl transferase, group 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79024"
FT                   /db_xref="GOA:C5CD80"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD80"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACR79024.1"
FT                   /translation="MKKVQTSKKSLSQFIDVVGEKKIDEIVSLASELKGLRVLHINATS
FT                   FGGGVAEILHTLVPLMNNVGLKVDWMVLDGSNDFFDFTKKMHNSLQGKEGTISEEEKKL
FT                   FLRINKANAQSLKEVDYNVIIIHDPQPIAVPKFVDFQDTKLIWRCHIDTSTPNEEFVEF
FT                   LNSFVEYYDASIFTLKRYAGKLRFRKIYEIPPSIDPLSPKNRELTPNELKASIDKLKVD
FT                   TNRPLITQVSRFDPWKDPTGVVDVYRELKKELKDLQLLMIGSMASDDPEGWTMYEELLR
FT                   YIGRDYDVKVLTNFHGIESIEVNAAQRISDVVLQKSIREGFALTVSEALWKETPVVGGN
FT                   VGGIPTQISHGVNGYLVNNIEEAVEYTKILLTDETLRKEMGKKGKDIVKEKFLITRHLL
FT                   DYLKLFRDLVK"
FT   gene            complement(326386..327540)
FT                   /locus_tag="Kole_0300"
FT   CDS_pept        complement(326386..327540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0300"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: aca:ACP_1127 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79025"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD81"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACR79025.1"
FT                   /translation="MKIEEIRWDNLTKLLDFLYAGKRVLRKELTEKMKIRNSTLSYLLN
FT                   ELTKLEMIRIEKIAGGRGRPNHVVSLNPEHGTVFGVKLGRESLRAIVFDFSLKKIDSIE
FT                   YPLHEIGKSIPDVISELKRFVEHYKPVGAGFAVSGTVDLKSKRIIKSPILNLRNFDFEP
FT                   VISKLALSEFVMCNDVDALHIGQIVESGIINKSSLTVSFGVGIGASYYDGQDIFVGSDG
FT                   KTAFEFGHHGVDPDGEKCYCGRIGCLETVASEYVLVKERAGSIGNFVANFDLFRPIINQ
FT                   FREKAKKEERLQEYERIIKSLSYYLSNLVLSLRPAILWIGGEGIVSEWIFNDIVKSIHL
FT                   NIEDGWEIKPEIMRITDPESWEKGAAFLLLRKYISSRIKVGNKG"
FT   gene            complement(327567..328403)
FT                   /locus_tag="Kole_0301"
FT   CDS_pept        complement(327567..328403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0301"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mmw:Mmwyl1_2010
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79026"
FT                   /db_xref="GOA:C5CD82"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD82"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACR79026.1"
FT                   /translation="MRKKIQFREISLNITAWIIGLIWILPIVGILMTAIRPFDEVINGW
FT                   WRFDTFTPTFSNFFDALNHPTAPLINGMKNSLIVAIPATFLPLIIATMTGYGLSRYHFP
FT                   MRKAFIITVVLTLALPQQMIAVPIFQIMSTLGLVDSYLGLILVHTAWGIPWITFFMRNY
FT                   FKTLPFSIEEAARIDGASDFQIFYKIVFPNALPAIASASALQFTWVWSDFFLALILIYS
FT                   PNKLLATQRIPLMRGVYHVDWGLLSAASILVMIIPILIYLLLQRYYVKGMVGWTIK"
FT   gene            complement(328400..329284)
FT                   /locus_tag="Kole_0302"
FT   CDS_pept        complement(328400..329284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0302"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mca:MCA1942 sugar ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79027"
FT                   /db_xref="GOA:C5CD83"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD83"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACR79027.1"
FT                   /translation="MVLRKARLYHFTIFILPALLLIAIFVLYPTFRTIFLSFIDETGKL
FT                   SLNNYREVFSSRDIVNPRGFKQGFPFGALIHNLMWIGIHLPLTTFLGLILAVLLRKVKG
FT                   GAIIKSVIFLGMVMPMIVGGIMIRFMFEENVGVVNMVLGFFGIQGKTWTAYPETALLSL
FT                   IFGSVWLWTGFSMILYAAGLETIPRSYYEAAQLDGATPSKMFFNITIPLLKPITVVVVT
FT                   MTLLWELKVFDIVYVATMGGPGGASNVLALQMYMYGFREWDFGKAAVVAVLITLSTLVA
FT                   AIPMISSAGDDAL"
FT   gene            complement(329352..330515)
FT                   /locus_tag="Kole_0303"
FT   CDS_pept        complement(329352..330515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0303"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ara:Arad_8312 sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79028"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD84"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACR79028.1"
FT                   /translation="MRKLLVMFLLVLTVIAFGKSLTVIGPWAGPEMEKFLPVLKAFEEK
FT                   TGIKVNYQIYRAEDLANVLPAQFAARKAPGDIIFMWPTFIRENTKHVVEVTDIIRPESY
FT                   LPGALDNVMFNGKVYGIAYTAKVKPGFWYRKSFFEKYGLVPPKTWNEFVTLLRLLKNLP
FT                   GIKAPIASGDGVGWPLSDITEHFLITFGGPELQKDLIEGNVKWESFTVKKAMEKLTFLL
FT                   KEGFFSEPVEWTTILRQWWNGDYALYFMGSWITGMVDDPEDLGVFTLPGCQGMVFGIDY
FT                   AFIPKYSKNVEEAKELLKFLAGPEGQTIQIAQGGHIATALGVNENAYPPVDREVANLLE
FT                   GIASLNDLDDSIGGIWQPTFWDQLKLLWVKPDRLNQVLEILDEKMPE"
FT   sig_peptide     complement(330459..330515)
FT                   /locus_tag="Kole_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.888 at
FT                   residue 19"
FT   gene            330733..331347
FT                   /locus_tag="Kole_0304"
FT   CDS_pept        330733..331347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0304"
FT                   /product="deoxynucleoside kinase"
FT                   /note="PFAM: deoxynucleoside kinase; KEGG: baa:BA_0609 dNK,
FT                   deoxynucleoside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79029"
FT                   /db_xref="GOA:C5CD85"
FT                   /db_xref="InterPro:IPR002624"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031314"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD85"
FT                   /inference="protein motif:PFAM:PF01712"
FT                   /protein_id="ACR79029.1"
FT                   /translation="MGKMIVFAGNVGSGKTTIARALADALGFEIHFESVSDNPFLEDFY
FT                   HNQRKWAYHLQTFFLIHRFTALKEAMEKGSNIVFDRSIYEDAEIFARNLYETGKMEKRE
FT                   FETYLDMFYSMIKYIPHPDLLVFIDADIDTILARIRKRGRNMELEVPIAYWQQLANLYD
FT                   SWISRYDYSPVYRIDAKFVDIERYPDHLDKIVSDVKRILKI"
FT   gene            331344..332351
FT                   /locus_tag="Kole_0305"
FT   CDS_pept        331344..332351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0305"
FT                   /product="peptidase U61 LD-carboxypeptidase A"
FT                   /note="PFAM: peptidase U61 LD-carboxypeptidase A; KEGG:
FT                   dol:Dole_0590 peptidase U61 LD-carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79030"
FT                   /db_xref="GOA:C5CD86"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD86"
FT                   /inference="protein motif:PFAM:PF02016"
FT                   /protein_id="ACR79030.1"
FT                   /translation="MICADGEVVMKRILLLLLIFSIILSFMQLSANVSKRISVWNFIHK
FT                   NKVNTVFVTSPARFPDQTLLDAGIRTLQSAGLTVIVGDSCRRYLSDEEKAREINEAFAD
FT                   PNIDMIITSRGGHGSFRVLDYLDWKTISKNPKPIVGYSDITALLLGIYFKTGIITYHGP
FT                   MVTVELDNDGKSLEKMLKLLNGDKLITFDYNSKPIVPGKMVGRLIVGNLSLFKTLQGTK
FT                   YFGSLKDSILVLEDVGESRESIERMVWNIAHLKDYQTLRGIVFAGFTQINNDDFDGVFK
FT                   ILERFFEDAPFPVWVGLPVFHGNFTKLTLPVGAWVEMDLENHYIKILNGPEPER"
FT   gene            complement(332400..333365)
FT                   /locus_tag="Kole_0306"
FT   CDS_pept        complement(332400..333365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0306"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; HI0933 family protein; KEGG: dal:Dalk_2405
FT                   thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79031"
FT                   /db_xref="GOA:C5CD87"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD87"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACR79031.1"
FT                   /translation="MAFFDLGSAKQKSEVKDYYDILIIGGGPGGITAGIYAVQAGLDPL
FT                   IIERALEGGQINNTEKVENWTGFPSISGMDLAEKMAEHARAFDVSFLNAEVVELEVEGE
FT                   KKTVILDNGKKIQSRVLIIATGSNPRKLNVPGEAEFAGKGVSYCATCDGHFFAGKHIAV
FT                   IGGGNSALDEALFLSKIVDKITIVQNLPKLTADKLLQERIKATGKVDFIFNTVVDRIEG
FT                   SDKVERLILKNVETGELSTLEVEGVFVFIGLVPNTGFLKGKVKTNDWGYIMTDEHMETN
FT                   VPGVYAIGDVREKEVRQIVTAAADGAIAVSHASRTYFDEE"
FT   gene            complement(333381..334028)
FT                   /locus_tag="Kole_0307"
FT   CDS_pept        complement(333381..334028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0307"
FT                   /product="glutaredoxin-like domain protein"
FT                   /note="TIGRFAM: glutaredoxin-like domain protein; PFAM:
FT                   glutaredoxin; KEGG: ank:AnaeK_2804 glutaredoxin-like domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79032"
FT                   /db_xref="GOA:C5CD88"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011903"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD88"
FT                   /inference="protein motif:TFAM:TIGR02187"
FT                   /protein_id="ACR79032.1"
FT                   /translation="MSEKLLNDEIRTQVKDILSEMEGKVKLLFFENKDNCDYCSTIEQL
FT                   LSELTEVTDMVVFEKYDADSEKAKEYSIEISPAIVLLTPDGVDKGVRFYGIPSGHEFGT
FT                   LLQDIISFSKGAKPNLSPESIERLKTIEKPIDIKVFVTPTCPYCPRAVITAHNIAMANE
FT                   NVVASMIEANEFPDLSMKFGVSSVPQIVINDEVIFVGAYPEKQFIDEVFKAV"
FT   gene            complement(334092..334643)
FT                   /locus_tag="Kole_0308"
FT   CDS_pept        complement(334092..334643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79033"
FT                   /db_xref="GOA:C5CD89"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD89"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79033.1"
FT                   /translation="MLAIELLLEIFRHILVSAVAMVFAIATVFAFFRFSHKPGFLFRFM
FT                   NVPAMTFFIALGYILFINDMKLLYAWLFFTGYFFNLRAISEQVLRYDDTFRIFFLSLGY
FT                   TRQEYLRDLIIYGGRLKILDCVLTFSIIGTAIIMISDKMRILMPDQWLFFLLIFEGIIF
FT                   VLASVRWLAEDFVNKESKSE"
FT   gene            complement(334649..335575)
FT                   /locus_tag="Kole_0309"
FT   CDS_pept        complement(334649..335575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0309"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; SMART: band 7 protein; KEGG:
FT                   mca:MCA3112 SPFH domain-containing protein/band 7 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79034"
FT                   /db_xref="GOA:C5CD90"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD90"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACR79034.1"
FT                   /translation="MILWIILAVIALIIAVSGIKIIRPFEKGLVERLGKFRRQAQPGLN
FT                   FIIPFIERIVKIDMREMVIDVPPQEVITKDNVIVTVDAVIYYEITDAFRVVYNVRDFKI
FT                   AAIKLAQTNLRNVIGEMELDQTLTSRERINAKLRDVLDEATDKWGVKVTRVEIKKIDPP
FT                   QDIMDAMSKQMKAERTKRAVILEAEGYKQSEITKAEGDKRSAILKAEGQAEAIKRVAEA
FT                   NKYKLIAEAEGQAMAIVNVFKAIHEGQPTNDLIAIRYLEALKAIANGPANKVFLPFEAS
FT                   SLLSSIGVISELFKEEKKDSPQKKNKK"
FT   gene            complement(335588..336037)
FT                   /locus_tag="Kole_0310"
FT   CDS_pept        complement(335588..336037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0310"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   sfu:Sfum_2309 protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79035"
FT                   /db_xref="GOA:C5CD91"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD91"
FT                   /inference="protein motif:PFAM:PF01957"
FT                   /protein_id="ACR79035.1"
FT                   /translation="MEYIGWMILGVALLVVEIITPIFFFLWFAIGSFIAGIASFFGLSF
FT                   SWQLSLFSAVSVVLVILTRPIAKKLTGESPRKIYIDEIKGSIGNVVEEINNKKRTGVVR
FT                   AAGENWKAVSIDDDIIGVGEKVIVERLEGTIVYVRKFKNENAQDE"
FT   gene            complement(336049..336900)
FT                   /locus_tag="Kole_0311"
FT   CDS_pept        complement(336049..336900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79036"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD92"
FT                   /inference="similar to AA sequence:KEGG:NEMVE_v1g223552"
FT                   /protein_id="ACR79036.1"
FT                   /translation="MEFKIFSKALYSTWILYRPERVLFDAGEGISTILGNSVYAIKEVF
FT                   ITHGHVDHIAGLWGLINTRNNAMGDREKALKINYPKKNRAIEDFLRFITEMNPKLRYEM
FT                   ILNPIEPGEEVYLRTAGNFRRSVIPFPVQHTSGEISYGYHVLEERRKLKPEFSHLSPQE
FT                   ISDLVKEKGRDFVTQTYKKKILTVSGDCNALPVSVIKGSETLIHECTFINGGDRRGQNH
FT                   AVLSEILDNVREASDIKRLILYHISSRYSSKISVLRKKLQEEFAEKGIKIYLVHPERLF
FT                   VL"
FT   gene            complement(336904..337359)
FT                   /locus_tag="Kole_0312"
FT   CDS_pept        complement(336904..337359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0312"
FT                   /product="ribosomal protein L9"
FT                   /note="TIGRFAM: ribosomal protein L9; PFAM: ribosomal
FT                   protein L9; KEGG: nam:NAMH_1270 ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79037"
FT                   /db_xref="GOA:C5CD93"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CD93"
FT                   /inference="protein motif:TFAM:TIGR00158"
FT                   /protein_id="ACR79037.1"
FT                   /translation="MKVILLKDVAKLGKKGEIKEVSDGYGRNYLIPRGLAVEATKSELS
FT                   KLKNIEDQKKKKEERTKANSEELLRKIKQRHFRMKVKAGASGKLFGAVTSADIAELIAK
FT                   ELGTEFSKRYVDLKENIKNTGEYKVNLKLPGNVKGSIIIAIEKSEED"
FT   gene            complement(337413..337640)
FT                   /locus_tag="Kole_0313"
FT   CDS_pept        complement(337413..337640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0313"
FT                   /product="ribosomal protein S18"
FT                   /note="TIGRFAM: ribosomal protein S18; PFAM: ribosomal
FT                   protein S18; KEGG: nis:NIS_1166 30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79038"
FT                   /db_xref="GOA:C5CD94"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD94"
FT                   /inference="protein motif:TFAM:TIGR00165"
FT                   /protein_id="ACR79038.1"
FT                   /translation="MREKRRRRTKKKCKLCAMKVTYVDYKNTALLKEFMTEKGKIVPKR
FT                   ITGNCAKHQRMVKTAIKRARHMALLPFTKE"
FT   gene            complement(337655..338107)
FT                   /locus_tag="Kole_0314"
FT   CDS_pept        complement(337655..338107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0314"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; nucleic acid binding OB-fold tRNA/helicase-type;
FT                   KEGG: sat:SYN_00925 single-strand DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79039"
FT                   /db_xref="GOA:C5CD95"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD95"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACR79039.1"
FT                   /translation="MSISYNRVVLVGRLTRDPEIRFSANGTQVSVFTLAVDRPMRTDIN
FT                   DSNNTDFIRIVSFGKLAEFVSNYLVKGRLVLVEGSLRIRKWKTQDGDPRTTTEVVANNI
FT                   RFMETKSQANVDTEGPLIDENVKPVDDDITFFGSESENTDSDDIPF"
FT   gene            complement(338110..338565)
FT                   /locus_tag="Kole_0315"
FT   CDS_pept        complement(338110..338565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0315"
FT                   /product="ribosomal protein S6"
FT                   /note="TIGRFAM: ribosomal protein S6; PFAM: ribosomal
FT                   protein S6; KEGG: dal:Dalk_0919 ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79040"
FT                   /db_xref="GOA:C5CD96"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:C5CD96"
FT                   /inference="protein motif:TFAM:TIGR00166"
FT                   /protein_id="ACR79040.1"
FT                   /translation="MSEKRIYETMFIVSPELPDEAREAIAEKVKRYIEERVEGTIEQFD
FT                   RWGMRKLAYRVRKGFTEGDYTVVLFRADPEKVNSLERLYNITPEIFRWQTFRREDLEKE
FT                   EKKARKKAAEAVVTEVIETPQAEEQNEKSGVSSEISQKTTTEPSVEE"
FT   gene            complement(338770..339237)
FT                   /locus_tag="Kole_0316"
FT   CDS_pept        complement(338770..339237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0316"
FT                   /product="protein of unknown function DUF523"
FT                   /note="PFAM: protein of unknown function DUF523; KEGG:
FT                   saz:Sama_3292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79041"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDF7"
FT                   /inference="protein motif:PFAM:PF04463"
FT                   /protein_id="ACR79041.1"
FT                   /translation="MKKILVSACLLGINCTYCGKNSLSLNVLQLTKDFFLIPICPEQLG
FT                   GLPTPRPRAEIVSSKGWHEGARVIDEYGKDVTGYFIKGARESLKIAKLMGAQIAILKSK
FT                   SPSCGTHYVYDGTFKSVLVPGTGCTAWYLRTHGVEVFSEEELDFLTYSQIL"
FT   gene            complement(339239..340099)
FT                   /locus_tag="Kole_0317"
FT   CDS_pept        complement(339239..340099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0317"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; Peptidoglycan-binding LysM;
FT                   SMART: Peptidoglycan-binding LysM; KEGG: afw:Anae109_0789
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79042"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDF8"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACR79042.1"
FT                   /translation="MKLKHIMLLVFIIAVAHLYAYMLLTYEVQPGDTLYEIARRFDVHI
FT                   STILDFNDIENPRLLRVGEQLIIPQPDGLLYEVKKGDTLTYIAKLFFTPLEPLLKANNL
FT                   TRDSWVFPGQKIFIPASIINVFAYEPIEKPLRWPVYGYISSYYGMRIHPITGQRKFHTG
FT                   LDIAAPEGAPIFAAGRGTVVFAGFDKGYGYMVEIMHDDGETVTRYAHMSHISVYVGQHV
FT                   YAGDLLGRVGSTGLATGPHVHFEVRRLAADGKSYPRDPIAFLPTRDLIYYVREYKHDGT
FT                   QSGGK"
FT   sig_peptide     complement(340037..340099)
FT                   /locus_tag="Kole_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.780 at
FT                   residue 21"
FT   gene            complement(340096..340527)
FT                   /locus_tag="Kole_0318"
FT   CDS_pept        complement(340096..340527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0318"
FT                   /product="diacylglycerol kinase"
FT                   /note="PFAM: diacylglycerol kinase; KEGG: cha:CHAB381_0614
FT                   diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79043"
FT                   /db_xref="GOA:C5CDF9"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDF9"
FT                   /inference="protein motif:PFAM:PF01219"
FT                   /protein_id="ACR79043.1"
FT                   /translation="MSRFIKSLTHAFDGFTHLFKTQRNFRIQLIIGFIVLFFAILYQLD
FT                   DSDLLWIIFSVFIVWILEGVNTLIEELSDLLEPRFNTKVKVIKDVAASVVLFGASMTIF
FT                   IGLNVFGRAIFGFSSIYTFPFGIIIVVLVFLISRGGVER"
FT   gene            complement(340524..341129)
FT                   /locus_tag="Kole_0319"
FT   CDS_pept        complement(340524..341129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0319"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: sat:SYN_02500 pyruvate:ferredoxin oxidoreductase and
FT                   related 2-oxoacid:ferredoxin oxidoreductases, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79044"
FT                   /db_xref="GOA:C5CDG0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDG0"
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /protein_id="ACR79044.1"
FT                   /translation="MAVSYPHSIRISGIGGQGNVLMGIILADALVSKRYWVVQTQSHGA
FT                   QVRGGLSYCDVLFCKEPIDYPEASSFDVIYSMHQFALNMHAILLKTNGILIVDNSYIDR
FT                   IPKEAFRATKKIIIQPVTKIVEEKLGSSLPANMAGLGMIAKAANLLQSDELKKAMKKYI
FT                   KPKYHELNEKAIDLGFSLIERSYVLKEERHDFVGRGFE"
FT   gene            complement(341136..341963)
FT                   /locus_tag="Kole_0320"
FT   CDS_pept        complement(341136..341963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0320"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: pca:Pcar_1029 2-oxoglutarate ferredoxin
FT                   oxidoreductase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79045"
FT                   /db_xref="GOA:C5CDG1"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDG1"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACR79045.1"
FT                   /translation="MAITRLTKYLRQDRMPHVWCPGCGNGVIMKAFIDAVDKEQLDPDR
FT                   IAVVSGIGCSSRVTGYLNFNTLHTLHGRAIAFATGVKLARPEFNVVVMGGDGDLLAIGG
FT                   NHFIHACRRNMDITIIVFNNQIYGMTGGQYSPTTPEDMYAATAPYGNVENNFDVVNLAV
FT                   NSGATYVARSTVYHYAQMVTYIRKALKHKGCSVVEILTNCHTYFGRYNGMPVPTGMLQH
FT                   FKENAVLLTKAMKMSEEELTGKIITGEFVNVERETYTHRYEKLKEKLLEENEE"
FT   gene            complement(341966..342478)
FT                   /locus_tag="Kole_0321"
FT   CDS_pept        complement(341966..342478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0321"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   gur:Gura_2185 dCMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79046"
FT                   /db_xref="GOA:C5CDG2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDG2"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACR79046.1"
FT                   /translation="MKKDVIEAFLKKFKVEEKPRDSKDWDSYFMSLAHLIKERSSCLHR
FT                   KVGAIIVRENRILATGYNQPPSGFPHCNEIECIRDALSIQSGENQEICYAAHAEQNALS
FT                   QAAKFGISTDGATIYVTHKPCSICARLIINAGIKRVVYDVDYPDPLSEFLLEKTGVILE
FT                   HYENAGR"
FT   gene            complement(342483..342941)
FT                   /locus_tag="Kole_0322"
FT   CDS_pept        complement(342483..342941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0322"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: sfu:Sfum_3220
FT                   rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79047"
FT                   /db_xref="GOA:C5CDG3"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDG3"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ACR79047.1"
FT                   /translation="MFSPHEILEIALNIEVEGYKFYMTMAKNSNREDAKSTFQYLAKQE
FT                   EEHMQTFKTLLKRFEEEADNLINWDEASDYLKTMSEHKVFPDSATLVKRFANSEPEEVI
FT                   RYAIEREKETVIFYYELLEIITDNEAKEAVKKIIVEEKKHVVTLRELL"
FT   gene            complement(342925..344073)
FT                   /locus_tag="Kole_0323"
FT   CDS_pept        complement(342925..344073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0323"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number="1.3.99.22"
FT                   /note="KEGG: gur:Gura_0208 putative oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: HemN domain protein;
FT                   Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79048"
FT                   /db_xref="GOA:C5CDG4"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDG4"
FT                   /inference="protein motif:TFAM:TIGR00539"
FT                   /protein_id="ACR79048.1"
FT                   /translation="MKEVGIYIHLPFCKRKCDYCDFLTLPFDADQAETYNKALLSEIEL
FT                   WTSNNELMLKTLYFGGGSPSLYQPRFLEKLIDRLAFSSQFQVEELTLEANPWEITCENL
FT                   RDWKELGVNRLSIGIQTAPTEVLNNVGRKNPVDLLRRLGFAREAFDNVNFDFILGLPGE
FT                   SRETFENNIKLIERFLPEHISYYILDTDHDTPLMRRVLTGKIELPSVDLITELHEHLIK
FT                   TLEEKGYNRYEISSWSREGYQCIHNKNYWENGEYVGLGISAGGHFNRFRYVNTTSFSEY
FT                   VKAMNVGHFAREYEHQNNDLEELFETLFMGLRLVEGVRISRFQVNESLLEKVVERIEKS
FT                   LEGFVIVDNERIKLNDRGLDLSKVVFERLMGIKEEIEDVFTS"
FT   gene            complement(344073..344906)
FT                   /locus_tag="Kole_0324"
FT   CDS_pept        complement(344073..344906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0324"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79049"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79049.1"
FT                   /translation="MKKTFMIGLFIIFSVLIYAAPTVRFTLQDAFWSTEFELPLFFDSV
FT                   GLNISLFSGNPYLGVYYHDSWEEYSTGFFKIKVKDGNLFFGIIASDTGDFCAYGRLVSN
FT                   SYKAPLFSHSYNEVYLFSNGGYRSYSRVNLRMPIGAFNTGVRVINRSDNNSKFWDSELY
FT                   FFAKDFSRSFRLFLTESWGQLTLDIETIDSLGELGYGAGIGASIAEFSPGIALYLNRLV
FT                   KIGTTNLTVSAKMFIGLDEVKTHLLVSNLGNRELFALGIGLNNLDVVTMFVRFIY"
FT   sig_peptide     complement(344847..344906)
FT                   /locus_tag="Kole_0324"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(344903..346348)
FT                   /locus_tag="Kole_0325"
FT   CDS_pept        complement(344903..346348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0325"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB region; GatB/Yqey domain protein; GatB
FT                   central domain protein; KEGG: sfu:Sfum_1705
FT                   aspartyl/glutamyl-tRNA amidotransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79050"
FT                   /db_xref="GOA:C5CDG6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDG6"
FT                   /inference="protein motif:TFAM:TIGR00133"
FT                   /protein_id="ACR79050.1"
FT                   /translation="MYKAVIGLEIHAQLSTVTKAFCNCSADVFELEPNTAICPVCTGQP
FT                   GSLPVLNEKVVEYALKAALAFNCEINLFSSFDRKNYFYPDLPKGYQITQYFHPIAEHGY
FT                   LMIGTGESRKKVRIRRIHIEEDAGKMLHQGADSISGATESFVDLNRCGVPLIEIVTEPD
FT                   LNSPKEAREFMELLRDTLRYIEVCSGDMEKGALRCDANISVYDTETGKSSERVEVKNIN
FT                   SFKFVEKALEFEFERIKAALENGENIVRETRSWNFSARETTSMRSKEEENDYRYFPEPD
FT                   LPELKLTQEYVDKVKKELPELPWEKQSRFVQEYGIPEYDASVLCSDKELANFFEDVARA
FT                   TGKPKETSNWIMTEFLRELKQRNASVDQLGIKPEHFVDLFKLLDSGKISTKIAKELFSK
FT                   MVENKKMPSELVEELGLQQINDEKLIEELIRKAMEANPKAVKQYRSGKKGVAGYFVGIV
FT                   MKGTKGKANPALVNEIVRRLLEE"
FT   gene            complement(346350..347777)
FT                   /locus_tag="Kole_0326"
FT   CDS_pept        complement(346350..347777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0326"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /EC_number="3.5.1.4"
FT                   /note="KEGG: bha:BH0666 aspartyl/glutamyl-tRNA
FT                   amidotransferase subunit A; TIGRFAM: glutamyl-tRNA(Gln)
FT                   amidotransferase, A subunit; PFAM: Amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79051"
FT                   /db_xref="GOA:C5CDG7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDG7"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ACR79051.1"
FT                   /translation="MPNKFLRMKIKELVNLKDKESIFRFFNDRINTYNDELNAFTEIIP
FT                   DPDRTSGEGPLNGIPYALKDNILARGTKTTCGSKILSNYKSVYDATVTKRLRDSGAILM
FT                   GKTNMDEFAMGSSTEFSAFGPSKNPWDANRVPGGSSGGSAAAVAAGLVPFALGSDTGGS
FT                   IRQPAAFCGVVGYKPSYGLVSRYGLVAFASSLDQIGPITRCVDDAVEVAKVIIGFDPDD
FT                   STTIEHPLNFENEEPKDLTGLKFALPGEMIEYPGLQESVKEVFIKMVESIEKAGGIVEK
FT                   VSIPSLKYVVATYYLIAPGEASSNLSRYDGIRYGQRKDADRYEEVVNQSRDFGFGDEVK
FT                   RRILLGTFTLSAAYYDAYYRKALRVRKLISKEINEILSKYDFVINPTSPIVAPKIGEIS
FT                   DPLTYYLMDIYTIPANLAGLPAISLPAGAYEGLPVGFQMMARRFEDVRMLNTARILEKL
FT                   SPSYDENGLARIAERWY"
FT   gene            347887..348708
FT                   /locus_tag="Kole_0327"
FT   CDS_pept        347887..348708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0327"
FT                   /product="ribosomal L11 methyltransferase"
FT                   /note="PFAM: ribosomal L11 methyltransferase;
FT                   Methyltransferase type 11; methyltransferase small;
FT                   Methyltransferase type 12; KEGG: cla:Cla_1260 ribosomal
FT                   protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79052"
FT                   /db_xref="GOA:C5CDG8"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDG8"
FT                   /inference="protein motif:PFAM:PF06325"
FT                   /protein_id="ACR79052.1"
FT                   /translation="MFERYKHFVAIVNNETREELEDLSVKNGFFNIYFENVSDGEWIAH
FT                   LYLVADEEVPDFLKDFPFKYLEDESSDNWHKKFRESLKPFELCDGITVVPLEKPAPIYQ
FT                   NDQIGIIPGLAFGTGLHESTRLAAELLKKFLKPGDSLLDVGCGTGILSVLAAKLRAGHV
FT                   VGIDNDPNAIEKTRETSKINGVSLNILESNFLQALASDEKFHIIVSNMIVELLSKFYED
FT                   AKNFLYDDGILILSGIISNKEEKFTEELKRHYLLLERKAEGEWVALAMKKK"
FT   gene            348678..349214
FT                   /locus_tag="Kole_0328"
FT   CDS_pept        348678..349214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0328"
FT                   /product="protein of unknown function DUF501"
FT                   /note="PFAM: protein of unknown function DUF501; KEGG:
FT                   csa:Csal_3040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79053"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDG9"
FT                   /inference="protein motif:PFAM:PF04417"
FT                   /protein_id="ACR79053.1"
FT                   /translation="MGGFSNEKEIIKLQLGRDIENDFTVVRRCSWGYPQCIKSSLITNG
FT                   KPFPTLFWLTCPLLLKEISKLEEKGMIKTIESRLENDENFMKAYVKAHKETKDLKEQLL
FT                   ASLSISEWQRNAIIERGIGGIKDLKRVKCLHLQLANYMGGIKNPIGELIWKIIELQECP
FT                   PNDIICDRLVNKFEK"
FT   gene            349204..350928
FT                   /locus_tag="Kole_0329"
FT   CDS_pept        349204..350928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0329"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="KEGG: hha:Hhal_0022 excinuclease ABC, C subunit;
FT                   TIGRFAM: excinuclease ABC, C subunit; PFAM: excinuclease
FT                   ABC C subunit domain protein; Excinuclease ABC C subunit
FT                   domain protein; UvrB/UvrC protein; SMART: Excinuclease ABC
FT                   C subunit domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79054"
FT                   /db_xref="GOA:C5CDH0"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDH0"
FT                   /inference="protein motif:TFAM:TIGR00194"
FT                   /protein_id="ACR79054.1"
FT                   /translation="MKNKLLAKVRELPEKPGIYLFKNKKGEIIYIGKAKKLRKRVSSYF
FT                   RASTHEQNGKTRELYQEIDDLEFIVVPTEKEALLLEANLIYQHKPKFNVLLKDSKRYPY
FT                   IFISDDEFPYISITRIRDRKGFYYGPYTSITLVRNLLDLLQRIFKLRSCMDNRDCKKGR
FT                   PCFLYHLKMCSAPLAGEISHAEYQKQVRGFMDFLDGKTLDVRRQLERSMQRLAENLQFE
FT                   KAKEIRDVLVSFDRLYSKQAVDVSESYTADFIVLDSGIVTLLEVRGGLLLGKLTFDFPE
FT                   GNLKDFIQQFYYGQNHRKPPVLIVPGLNKSEIKEIAEDFEYIGNPRSEEEKRLLLIASD
FT                   NTIEELRIRLKVQQSLKMAKELLGLNKIPRIIEGVDISHTQGVYTVASVVVFRNGQPDK
FT                   ISYRRYRITELNEPNDFEALKILMRRRYSKHPPPDLLLVDGGAPQLAAVRESLEELGLK
FT                   KIDFIGLAKEEEEIVFPDNRGRLKLSPDHPVLRLLTTIRDESHRFAVNYHRVLRERKFS
FT                   TSRLDDIPGIGPKRKRALVRAFGSVTNIKKASKEELMKVIKNRKVVEQILAWTKKQG"
FT   gene            complement(350963..351235)
FT                   /locus_tag="Kole_0330"
FT   CDS_pept        complement(350963..351235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0330"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; KEGG:
FT                   pla:Plav_3229 histone family protein DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79055"
FT                   /db_xref="GOA:C5CDH1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDH1"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ACR79055.1"
FT                   /translation="MNKKELVAEIAGRTGVTKKRAAEILDCFIEIVGEKLSKGEEVKLV
FT                   GFGTFEVATRKPRKGVNPRTKKPIKIPGGKVPKFRAGKELKEKVK"
FT   gene            351635..352732
FT                   /locus_tag="Kole_0331"
FT   CDS_pept        351635..352732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0331"
FT                   /product="Xaa-Pro aminopeptidase-like protein"
FT                   /note="KEGG: bha:BH0491 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79056"
FT                   /db_xref="GOA:C5CDH2"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDH2"
FT                   /inference="protein motif:COG:COG0006"
FT                   /protein_id="ACR79056.1"
FT                   /translation="MTMRLNTVRKYYQSRNANGALFGKVSNIYWLFEGNIDPRMDLFSD
FT                   RGSFFILILSDRVLIICPTTIYRRLKEEVFTGFDFEYLEYPWYGDPLPLLEKLGHKFGT
FT                   IVTDLPELRGVKGYIGVDDSFYSEKMVLSERELTRLRAVGKLSESMLYEFSPELSPGLT
FT                   EIEIEKVLRALLNEMGLEVPFIGVCSDERITSYSQSHSTEKRVKRYLRISLTTQKQGLR
FT                   VSLTRFFYFGTIPSELITVHEKACALYAHLAFDTLNSETMEEVYNKIHRAYSVLGLKRE
FT                   KQELYVGGHTGYVDRSFLVYTRNVKIRPCTAYAYGIDYESARSEDTFLIKNDGNAEFLT
FT                   LGEDFPKIVVKVENLKVFRPWIMEL"
FT   gene            352894..353271
FT                   /locus_tag="Kole_0332"
FT   CDS_pept        352894..353271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0332"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   net:Neut_1719 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79057"
FT                   /db_xref="GOA:C5CDH3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDH3"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACR79057.1"
FT                   /translation="MRGREQYSMELKLKVVKEYEEGHKNTREIREEYGIPDSTLWGWIN
FT                   KYRAEGESAFEPKLRAGDFIVDPTKIPPVLYKEIGLDKIKKDPKELKGVLNEIEKYKLI
FT                   IAEKELEIRLLKEALKKTGKG"
FT   gene            353298..354200
FT                   /locus_tag="Kole_0333"
FT   CDS_pept        353298..354200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0333"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: ypy:YPK_3925
FT                   integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79058"
FT                   /db_xref="GOA:C5CDH4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDH4"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACR79058.1"
FT                   /translation="MGYGFSTSYLLRIFGITRSSYYRRKKPVFFLKKTKPGRRRNYCLK
FT                   TNGEKFEDKELEKLLKGIYSRVNPYEPEYYLKVLGSKKLSKYFLNEFGIIVNHKKVHRM
FT                   RKKLGYVRKYWPKQHHPVRRSTQHEIDRTGILWEADIKYITTIQEGNIALLDIIDVYSR
FT                   EIVGSYLGKSCKCKDFTRTLGRAMLYQETVPQLVRTDNGSLFTANYTREYFEKNEIIQE
FT                   FGIKHHPDSQAFIESQHSNVQREFVAMNVFERAEDVYRKYQVYMDFYHNLRPHGSLKYM
FT                   TPQAFKKHCSISMIQSVKA"
FT   gene            complement(354397..354597)
FT                   /locus_tag="Kole_0334"
FT   CDS_pept        complement(354397..354597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79059"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDH5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79059.1"
FT                   /translation="MSLSILSRFYFEASNLFQVDLFLRHYVSLAGNGVRFADANDAGLV
FT                   MVVGYRLCVVRIFFKPQTPTL"
FT   gene            complement(354575..355759)
FT                   /locus_tag="Kole_0335"
FT   CDS_pept        complement(354575..355759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0335"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bja:bll1898
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79060"
FT                   /db_xref="GOA:C5CDH6"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDH6"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACR79060.1"
FT                   /translation="MKNVVKEYSKRYRKARKKEKSEILDEFTRVTKYNRSYASFLLRGA
FT                   LKKRKATSPSQKKGRKKKYDHKVFVKLVKIWEIMDFPCGKRLEAVMDEVIDNLVRNGHL
FT                   TLAEETKRKLLSISASTIDRLLSSERKKMELKGRSHTKPGTLLKKHIRIKTHYEWDDTR
FT                   PGFVEIDLVGHDGGSVSGDFCYSLNMVDVASGWSVVAPIRNKAQIWTLKAIIQLRKTLP
FT                   FTLLGIHSDNGSEFINRHIYRYCEDEGLLFTRTRSYNKNDNCHVEQKNWSVVRRAVGYY
FT                   RYDTEEEFQILKELYASLNLYNNHFQPNQKIIEKIRKGNKVSKKYDRPTTPYERIMRSP
FT                   WVDQDKKDRLRRQHEALDIYKLKSIITHLQEQLLSIQIDKSKGGILNYVPLNFK"
FT   gene            355929..356004
FT                   /locus_tag="Kole_R0011"
FT                   /note="tRNA-Pro1"
FT   tRNA            355929..356004
FT                   /locus_tag="Kole_R0011"
FT                   /product="tRNA-Pro"
FT   gene            356010..356085
FT                   /locus_tag="Kole_R0012"
FT                   /note="tRNA-Gly1"
FT   tRNA            356010..356085
FT                   /locus_tag="Kole_R0012"
FT                   /product="tRNA-Gly"
FT   gene            356086..356161
FT                   /locus_tag="Kole_R0013"
FT                   /note="tRNA-Arg1"
FT   tRNA            356086..356161
FT                   /locus_tag="Kole_R0013"
FT                   /product="tRNA-Arg"
FT   gene            356180..356255
FT                   /locus_tag="Kole_R0014"
FT                   /note="tRNA-His1"
FT   tRNA            356180..356255
FT                   /locus_tag="Kole_R0014"
FT                   /product="tRNA-His"
FT   gene            356266..356342
FT                   /locus_tag="Kole_R0015"
FT                   /note="tRNA-Arg2"
FT   tRNA            356266..356342
FT                   /locus_tag="Kole_R0015"
FT                   /product="tRNA-Arg"
FT   gene            356392..356655
FT                   /locus_tag="Kole_0336"
FT   CDS_pept        356392..356655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0336"
FT                   /product="Stage V sporulation protein S"
FT                   /note="PFAM: Stage V sporulation protein S; KEGG:
FT                   bha:BH2375 stage V sporulation protein S"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79061"
FT                   /db_xref="GOA:C5CDH7"
FT                   /db_xref="InterPro:IPR007347"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDH7"
FT                   /inference="protein motif:PFAM:PF04232"
FT                   /protein_id="ACR79061.1"
FT                   /translation="MEVLKVASSSKPNAVAGALAGVIREKGVAEVQAIGAGAVNQAVKA
FT                   IAIARGYVAPSGIDLVCLPSFADVEIDGEVRTAIKFVVKPKE"
FT   gene            complement(356682..358697)
FT                   /locus_tag="Kole_0337"
FT   CDS_pept        complement(356682..358697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0337"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: eli:ELI_03145
FT                   alpha-amylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79062"
FT                   /db_xref="GOA:C5CDH8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDH8"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACR79062.1"
FT                   /translation="MYLKNIAAFLKEKIDSGKVDYAIPREWFPRDYEGTVRLKGQFIYV
FT                   NPYEFGYSIIRDILSKMEEGKNYLLSLSKINKESSPDWLNESIMYSAHIRSTSAYPHLN
FT                   PRVFTPIDSEGYTESGTVLKMIFMLPYLKAMGINTIYFLPVTKYSDKFRKGEVGSPYSV
FT                   KNFFEIDPRYHDTLLDGFSVEEEFKAFMEASHALGIRVILDFIPRTSARDADLILEHPD
FT                   WFYWIDVSELEDYAPPKIEGLGFELPSKENLEKVYSSDIVKQHLRKFRYAPNVMDPQRW
FT                   ENFVEANKGNQDFLEELVREFKVITPPGFSDWINDSQPTWNDITFLRLYEDHPEEAKKY
FT                   LDDPKQPPYILFDVIKSSLFPGTIPNSGLWKVLQDIMPYFNEHFGVDGARLDMGHALPE
FT                   ALERQIVEAARKADPAFAIIAEELVMSNDVKAKDSGYNGILGNVWWMEARFEEGKTKEL
FT                   CYEILPKLKLPALAAVETPDTPRACTRKYGKVFSKFMTALNFFLPNTIPFINAGQEIFE
FT                   RQPMNLGLDNSEEGRFVLPPEDPFYGKLAFFDHYVLHWNTEENLCKLTRHLSQLRISMN
FT                   ALLKEPHNLRLLFAEDKHVIGMLYWNSEKGLVIVGNINFNEMKNVTLDLGYYTWRGEHT
FT                   LKVCMKGKDIVDETWKTSGPLNLSLGPGDVFIAVVE"
FT   gene            complement(358746..358833)
FT                   /locus_tag="Kole_R0016"
FT                   /note="tRNA-Ser4"
FT   tRNA            complement(358746..358833)
FT                   /locus_tag="Kole_R0016"
FT                   /product="tRNA-Ser"
FT   gene            359039..359353
FT                   /locus_tag="Kole_0338"
FT   CDS_pept        359039..359353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0338"
FT                   /product="ribosomal protein L21"
FT                   /note="TIGRFAM: ribosomal protein L21; PFAM: ribosomal
FT                   protein L21; KEGG: csa:Csal_0474 LSU ribosomal protein
FT                   L21P"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79063"
FT                   /db_xref="GOA:C5CDH9"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CDH9"
FT                   /inference="protein motif:TFAM:TIGR00061"
FT                   /protein_id="ACR79063.1"
FT                   /translation="MYAIIEASGKQYKVEEGITLFTEKLKDFAEGDQVVFDRVLLLKDD
FT                   SGVKVGKPYLENVKIVGKVVRHGRGKKIRVVKFRPRKNYHRVKGHKQWFSEVLIEKIEY
FT                   "
FT   gene            359370..359621
FT                   /locus_tag="Kole_0339"
FT   CDS_pept        359370..359621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0339"
FT                   /product="ribosomal protein L27"
FT                   /note="TIGRFAM: ribosomal protein L27; PFAM: ribosomal
FT                   protein L27; KEGG: ftw:FTW_1465 50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79064"
FT                   /db_xref="GOA:C5CDI0"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CDI0"
FT                   /inference="protein motif:TFAM:TIGR00062"
FT                   /protein_id="ACR79064.1"
FT                   /translation="MAHKRSSGAGRNGRDSNPKYLGVKRGENAFVRAGTIIIRQRGTKI
FT                   HPGQNVGMGRDFTLYALIDGKVHFETRNNRKYVSVYAE"
FT   gene            359668..360192
FT                   /locus_tag="Kole_0340"
FT   CDS_pept        359668..360192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0340"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: dal:Dalk_2692 ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79065"
FT                   /db_xref="GOA:C5CDI1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDI1"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ACR79065.1"
FT                   /translation="MKIQKTPICKVGVRHFKVNTKRKGEIERVEKFVVAPDGSKLERKW
FT                   YLVDATDVPLGRLASQVAKILMGKHKPTYTPHVDTGDFVIIINASKVKLTGKKLDQKIY
FT                   YRYSGYPGGLKERTAREMLQKHPERVIKLAVKRMLPKTRLGAKMLKKLKIFTGPEHIHE
FT                   AQKPETIELVK"
FT   gene            360208..360612
FT                   /locus_tag="Kole_0341"
FT   CDS_pept        360208..360612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0341"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: bsu:BSU01500 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79066"
FT                   /db_xref="GOA:C5CDI2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CDI2"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ACR79066.1"
FT                   /translation="MAEIVEYIGTGRRKTSVARVRLRPGEGKFIVNGKELKDLKEYLHN
FT                   DAWVRHALKPAVLTDTLGRFDIFIRVSGGGLSGQAGAIRLGIARALLQFNEDLKPLLKQ
FT                   NGLLTRDARIVERKKYGLKKARRAPQFSKR"
FT   gene            360672..362405
FT                   /locus_tag="Kole_0342"
FT   CDS_pept        360672..362405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0342"
FT                   /product="DNA primase"
FT                   /note="KEGG: gme:Gmet_0394 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: DNA primase catalytic core domain; zinc
FT                   finger CHC2-family protein; TOPRIM domain protein; SMART:
FT                   zinc finger CHC2-family protein; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79067"
FT                   /db_xref="GOA:C5CDI3"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDI3"
FT                   /inference="protein motif:TFAM:TIGR01391"
FT                   /protein_id="ACR79067.1"
FT                   /translation="MFDKEIIDRIKSSIDIVELVGRYVNLQKSGSYYRGLCPFHSDSDP
FT                   SFYVSPGKQFFHCFGCGVSGDVITFYEKIENLPFSEAVEKLAEIAGIELPKKYSVRTEY
FT                   DKYTQSLNILAEAYHKELLSGKHPDVLEYLLKERGFSEETLREFRIGFSPGNRTFLKKL
FT                   VSNFGVKLEELLKAGVLVKKNSDYFDRFSKRIIIPIHNENGKVIGFGGRIIPGETGSKY
FT                   INSPETRYFVKGRVLFNLHRAKKSVKELDYVVITEGYFDSMALYEAGIENNVGVLGTNL
FT                   TRQHLKLLKTYTNNLLFLMDSDSAGKNATLRSLDLAESEGFSTAVAKITGTKDAGELFK
FT                   NEGPKALVDTLKNAIPGAVFRVDYLALKVDITTPQGKQKLLEFLIPTLSRYLQRADNAG
FT                   FQLTVKAISEKTNLLIKEIIAVAKGREKPQKILRERSTFKLKQIEKDLLSIYFGHPELR
FT                   SEVARVVDFLETSEAFRYLVKFIKKKQDFNEIIDEIDEKIGPSLMEAVEYSTDISMARK
FT                   MLKDIETHVDKKIIREQIEEIDRKLRKVIDPAMKESLMIRRMELTRLLKRTLKGGEADG
FT                   R"
FT   gene            362395..363612
FT                   /locus_tag="Kole_0343"
FT   CDS_pept        362395..363612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0343"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 3 domain protein; sigma-70 region 2 domain protein;
FT                   sigma-70 region 1.2; sigma-70 1.1 domain protein; sigma-70
FT                   region 4 domain protein; KEGG: bha:BH1376 RNA polymerase
FT                   sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79068"
FT                   /db_xref="GOA:C5CDI4"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDI4"
FT                   /inference="protein motif:TFAM:TIGR02393"
FT                   /protein_id="ACR79068.1"
FT                   /translation="MADKKNKAKMVEEPKEKNSSQKKTTEVVMLSDKEVQSRIKKLVKL
FT                   GKKKGYITYEDIDNAFPPDYEGFDSSLVEVIYEELEKNKVRILEKEPTEDQEESGQENP
FT                   AEDIETLLESAPEMYDNISLKDPIKMYLKEIGKIPLLTPSKERELARRAQKGDKKAREE
FT                   LITANLRLVVSIAKRYIGRGLSFLDLIQEGNIGLIKAVEKFDWKKGYKFSTYATWWIRQ
FT                   AITRAIADQARTIRVPVHMVETINKVNKVIREHLQEHGEYPTVEELGKLTGKTPEKIEE
FT                   ILAASKETVSLESPISGDEESTMGDFVHDESIEKPEEAAIKMLLREQIDEVLDTLSPRE
FT                   AMVLKMRYGLLDGKTKTLEEVGQFFNVTRERIRQIEVKALRKLRHPSRSKQLKALLGML
FT                   NSSKSE"
FT   gene            363715..363888
FT                   /locus_tag="Kole_0344"
FT   CDS_pept        363715..363888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79069"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDI5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79069.1"
FT                   /translation="MVFKKTSKNISTSPRIVAQIDLIKMAKSGDKQANDEVLRRLGSKN
FT                   DKRTDEDGQSQR"
FT   gene            363863..364606
FT                   /locus_tag="Kole_0345"
FT   CDS_pept        363863..364606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0345"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: abc:ACICU_01440 ABC-type
FT                   polar amino acid transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79070"
FT                   /db_xref="GOA:C5CDI6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDI6"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACR79070.1"
FT                   /translation="MKMGSLKDEAALYLKNFTLKVNNEVKLENISLDVKRGQVALIYGP
FT                   RGSGKSLLLRAFLHLNEEIFEVVQGEGEICFFGKSVLDIERKLLRKEIAYVDTSFLNAI
FT                   SFFSLHEFMRLLKGDHFVIEDLSDEELDLLKVLEIDDLLIGDPNVPLGVFQPFQRLALL
FT                   IYSTLVRNPRVIILDSVLDHLDDEVCTRVKNLLIDSKGDRTILLSSRYVFRFLDVADLL
FT                   IYLKSGKILYAGSTEEFVKGSHSSF"
FT   gene            364634..365593
FT                   /locus_tag="Kole_0346"
FT   CDS_pept        364634..365593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0346"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: baa:BA_4320
FT                   1-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79071"
FT                   /db_xref="GOA:C5CDI7"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR023314"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDI7"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACR79071.1"
FT                   /translation="MRVLTVTLNPALDRELVVENFTINNLHRVKNQKYSIMEPGGKGIN
FT                   VSLILSGFGIPSIAMGFIGGYIGAVVESRLRNLSDLVTTNFINVEEETRENITIIDPAS
FT                   DTITEINSQGPFVDKRDIDKFMKRYLVSLGRVNAVVISGSVPPGIPEDFYYLLGNTAKE
FT                   AGKLVVSESIGACFEYAVKRGAFTVARPDLRSDQKLFGQDLEDLDDYVEAGKKIVESGA
FT                   KMAILSYEIEGDVIATEEGVWFFKTHEHVERSHLLGTGDSFVAGVVEHLLKHPHDYLNA
FT                   AKRGMAAAITEAAYLGKERITLDDVETNLTAFDISRLR"
FT   gene            365598..366050
FT                   /locus_tag="Kole_0347"
FT   CDS_pept        365598..366050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0347"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; SMART: CBS
FT                   domain containing protein; KEGG: sfu:Sfum_2202 CBS domain
FT                   containing membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79072"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDI8"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACR79072.1"
FT                   /translation="MKVRDAMIHDVSAVFEDETIEDFIITCLRKMRTGLPVVDEEFRVV
FT                   GFISESDVIKSSLPSYFELLQSASFIPDTHQFVRRLGDIRNDPIASHMVSPAIAVKPDD
FT                   TLINAADLLIKKGLKTLPVVDDDHKLVGIITRLNLIYSALQGRVLE"
FT   gene            366047..367324
FT                   /locus_tag="Kole_0348"
FT   CDS_pept        366047..367324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0348"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="KEGG: geo:Geob_1978 MiaB-like tRNA modifying enzyme;
FT                   TIGRFAM: MiaB-like tRNA modifying enzyme; RNA modification
FT                   enzyme, MiaB family; PFAM: Radical SAM domain protein;
FT                   Protein of unknown function UPF0004; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79073"
FT                   /db_xref="GOA:C5CDI9"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDI9"
FT                   /inference="protein motif:TFAM:TIGR01579"
FT                   /protein_id="ACR79073.1"
FT                   /translation="MKEIVSFFTFGCKLNQYETEGMAELLQNDFRVTFDSEIADIFVIN
FT                   SCTVTAEAERKLRQLYRRLKAKNPGSKFVIVGCYSELSAGELKDLGFDLILGIKDKLKI
FT                   KEFLKENTENTCIKDYFQVTKGPYGRTRAYIGIQDGCLNNCSYCRIRLARGNKIISKPP
FT                   EVVAEELKTLVEHGFQEIVLTGINIGFYGFGEGYSLISLLKQLVKIEGEWRLRLSSLDP
FT                   RLVSNELITFMTDNPKIAQHVHLSLQSGSDKVLKSMNRNYTTNDVEQIVALFRSRNNRF
FT                   SFTTDVIVGFPGETDTDFVETLEFVKRIRFLKVHIFRFSPRPGTKAARMSNQISGNIKK
FT                   ERATVLKKVALEASKDYLNEHVGKESTVLIEKNDGIFSYGYDEFYIPHRVTGSIENGFV
FT                   KVQIGGIEELEAFSDVELSCRSVAVR"
FT   gene            367287..368144
FT                   /locus_tag="Kole_0349"
FT   CDS_pept        367287..368144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0349"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: baa:BA_2352
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79074"
FT                   /db_xref="GOA:C5CDJ0"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDJ0"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACR79074.1"
FT                   /translation="MLNYLAGQWLSDEEATINVKNTGILTGISVYEVLRTYNGLPFAAK
FT                   KHFERLKKSADYMGIPLPINFDEFLELLLEGVKKNHNSSGEELRIKVILVQSTNNFSEI
FT                   IVLYEELPKVSSDVYELGVKVGISKFIRPSAALVPSIIKIPGAPWKVLTRKAMGVYYDM
FT                   LLLNEKGDLCEGTISNVFLIKDEKLITPNIESGILPGITRENVIGLAKAMEIPVEERTV
FT                   KGWELFTAQEVFLTHTSAGIVPIRKIEDRVYIEDFADGITRILLDNFEGFIMTNESNWE
FT                   GLSK"
FT   gene            368141..368443
FT                   /locus_tag="Kole_0350"
FT   CDS_pept        368141..368443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0350"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   gbm:Gbem_3436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79075"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDJ1"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACR79075.1"
FT                   /translation="MKWNHQSLDKIFESLSGSNPFFKKLKVLLLQNNWEKIVGTPNAMH
FT                   TQIENFFDGKLFVSADDGVWLNELRMREKEILKRIHEELHGDFVRKIIFIPKKSK"
FT   gene            368458..370353
FT                   /locus_tag="Kole_0351"
FT   CDS_pept        368458..370353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0351"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: bsu:BSU00060 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79076"
FT                   /db_xref="GOA:C5CDJ2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDJ2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACR79076.1"
FT                   /translation="MSTDYNAQSIKILKGLEPVRQRPGMYIGSTGKAGLHHLIYEVVDN
FT                   SIDEVVGGYCDYIKITIFEDGSVSVWDNGRGIPVDIHPETGTSALEVVMTTLHAGGKFS
FT                   KDSYKISGGLHGVGVSVVNALSEWMEVKVYRDGKIYRQRYERGKPTTPVEIIGETDKRG
FT                   SLVAFKPDSLVFTTTDFDFDILESRFKELAFLNPRVTIEFEDRRYDEKRVFHFEGGIVE
FT                   FVKYLNRKKTAINKEPFYIEGTYNDVKIQLAMQYTNAYDENILTFVNNIKTVEGGTHLT
FT                   GFKTVLTKMMNDYARKLNVLKDKDPNLQGEDVREGLTAVLSVFVKEPQFEGQTKAKLGN
FT                   EEVYEAVIKVLRDKLPEVFDYHTKELKAIIIKALDAAKARVAAKKAREMIRRKNALENT
FT                   TLPGKLADCTSTDLETTELFIVEGDSAGGSAKQARDREFQAILPLRGKILNVEKSSFEK
FT                   LLKNEQINNIIVAIGTGIGDDCKLENLRYGKIIIMTDADVDGAHIRTLLLTLFYRYMTP
FT                   LINAGHIYIAQAPLYKVELNRKKYYFYSDEELEEFLKNNDGKKVSIQRYKGLGEMNPDQ
FT                   LWETTMNPESRKLIKIEMEDVEEADRVFTILMGSEVEERREFIERHALMITELDV"
FT   gene            370350..370991
FT                   /locus_tag="Kole_0352"
FT   CDS_pept        370350..370991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79077"
FT                   /db_xref="GOA:C5CDJ3"
FT                   /db_xref="InterPro:IPR032607"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79077.1"
FT                   /translation="MNLEARGFILLLILAVVWTIGLINFVVEIYFTRAHDMRILVVDNR
FT                   SVEVEFPKVFKRSWNTDIIVPPTTEFISEGRVYLPEADYIVYFLDRYYWASKELVLLDF
FT                   ADVEAVFLNPVISGLHFRFEDAGYVLANENSDLILRVLKSLYGRRSILRELSNIDFETN
FT                   KIFLKRGITIQVFDWRVVEEKPEIIQNLIDNAEDRSKYLLMSDGKILRVR"
FT   gene            370997..372286
FT                   /locus_tag="Kole_0353"
FT   CDS_pept        370997..372286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0353"
FT                   /product="cell division protein FtsA"
FT                   /note="TIGRFAM: cell division protein FtsA; PFAM: cell
FT                   division protein FtsA; KEGG: ilo:IL0440 cell division
FT                   ATPase, FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79078"
FT                   /db_xref="GOA:C5CDJ4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDJ4"
FT                   /inference="protein motif:TFAM:TIGR01174"
FT                   /protein_id="ACR79078.1"
FT                   /translation="MPRGKEYTVSIDLGTNTLKGVVVSSDPSSQLQLEAYGSVKSVGLD
FT                   KGEVKDAVALKQSIQKLVDDLTGQLGKKDIVADFRLCFTDGEYAVMSEIVEESISDDKP
FT                   VVVTQEIIDELMAKITQDKLKDNKNIHMKYVRKYIIDDEKVVFNPVDMLAKQLKVEMVF
FT                   VSSEGKSTEVFKRLFEELLGTGDFLIFPSLISGAEAVLTDTEKQHGVVCVSIGHAFSEL
FT                   VIYRENLPIYVSRIPLGVRHIVRDIALVLGTSLDEAERLLVTHGYASMYPPSGDSVVEY
FT                   FGLDERTRKNVSVRKLSTIIYARVKELLNKIRREIQYSKANYPEFAEEGIPGGVVFTGG
FT                   GAKLRGLSDTGVESLKMPVRVGTYETSFNPRIENAHDVVNDPIFSSCLGSLIVQDAVET
FT                   GIEEAIGKQKRRGFADFIRSLFFGGVEDEL"
FT   gene            372276..373331
FT                   /locus_tag="Kole_0354"
FT   CDS_pept        372276..373331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0354"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   bha:BH2558 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79079"
FT                   /db_xref="GOA:C5CDJ5"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDJ5"
FT                   /inference="protein motif:TFAM:TIGR00065"
FT                   /protein_id="ACR79079.1"
FT                   /translation="MSFEMSYEGKETDVRLPAIKVIGVGGAGGNAVNRMISEGIHGVTF
FT                   IAANTDVQVLEGNKAEIKIQLGNHLTRGLGAGGNPEIGERAAEESIEEVRKVLEDTDLL
FT                   FITAGMGGGTGTGAAPIVASVAKEMGILTVAVVTTPFFFEGNTRLRVASEGLRKLSKSV
FT                   DTLIRISNNKLLQELPPDTSIVEAFAKADETLHHGIKGISELITKRGYINLDFADVESV
FT                   LRDAGTAMLGIGIGRGEKRAEEAAKAALESRLLERPIDNAMGIILNVSAKNITLREMNI
FT                   AAAIVRQNCSEDADVKLGLIVDQEMPDDELHVTLIAAGLEMEESELFGEASDIPAIYRF
FT                   GLDTHEEEEGT"
FT   gene            373328..375016
FT                   /locus_tag="Kole_0355"
FT   CDS_pept        373328..375016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0355"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; SMART: AAA
FT                   ATPase; KEGG: geo:Geob_3374 type IV-A pilus assembly ATPase
FT                   PilB"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79080"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDJ6"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACR79080.1"
FT                   /translation="MRVYKRLGELLTERGLITPEVLQQAVTIQKKVGKPLGEILVGMGL
FT                   LSWEDIYTALSKQYNLELVEELPNMVPPELLKLVPRSVAERLKVVPIEFSPETNTLKVV
FT                   TPDVLKVPQIERELSFLTGNKIKVALTPPPNFEALYRASYEEASSSEIIEHTFDLEPSE
FT                   EVVEEEEVTSEETPVGKFINALLENAIRSDASDIHLEPFEKVAVGRFRIDGILRKILTY
FT                   PRRAHNSVVSRIKVMCGLDISEKRLPQDGKFFIRRGGEQYDFRVSTMPTIFGEKVVMRV
FT                   LRVSNAKKKLEELGLSDYNLKRFRKLLEAPHGIILVSGPTGSGKSTTLVAVLNEVTSEK
FT                   VNVVTAEDPVEYTIEGITQCQVNAEIGLTFARYLRAFLRQDPDVIMVGEIRDRETAQLA
FT                   IEASLTGHLVFSTIHTNSAPGAVARLVNMGVDPFLLSASLIGVIGQRLVRRLCSNCKVK
FT                   IPIREEILEIASKIFPNKNEFYEFVPGSGCNECRGIGYKGRTGIHEVLIVNNELRDLMV
FT                   RGASEHELSEAAKAAGMRTLYEDGIEKVLQGITSVEEVNRVATEL"
FT   gene            375167..376189
FT                   /locus_tag="Kole_0356"
FT   CDS_pept        375167..376189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0356"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   ade:Adeh_4039 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79081"
FT                   /db_xref="GOA:C5CDJ7"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDJ7"
FT                   /inference="protein motif:PFAM:PF01113"
FT                   /protein_id="ACR79081.1"
FT                   /translation="MAYRVLVWGLGAMGSGIARNIHSKLELKLVGGVEKKPEAVGKDIG
FT                   EFLGIGNIGAKIYDDPEKAILETRPDLVVIATNSFVREVMEKIELAAINHVDVLTIAEE
FT                   MAYPFYSHPEESTIIDNIARRYSISILGTGINPGFVLDLLIIAMTGACLNVERIEAKRI
FT                   NDLSPFGKTVMETQGVGTTPEEFEEGLKNGTIVGHIGFQQSIAMIADALGWELTKIEEI
FT                   REPIISKTERKTAVAHVKPGMVAGCKHIGRGYINDKVVIELIHPQQILPQLEGVETGDY
FT                   IDIYGDPEIHLSIKPEIPGGKGTIAVATNMIPYVIEAEPGFLTMADLPVPRTLLKDLGR
FT                   "
FT   gene            376195..376512
FT                   /locus_tag="Kole_0357"
FT   CDS_pept        376195..376512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79082"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDJ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79082.1"
FT                   /translation="MEAVRGQWVQIHKIILKPGERAPQVPEDTAKVPFELRVKGYLQDE
FT                   KAAIGDLVTIKTPIGREVKGQLIDIEPRYTHDFGDYVSVLDEAGAELQELMRKISESDE
FT                   R"
FT   gene            376509..377936
FT                   /locus_tag="Kole_0358"
FT   CDS_pept        376509..377936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0358"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: rpb:RPB_4420 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79083"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDJ9"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ACR79083.1"
FT                   /translation="MKELSYDAIMQRKNEIMKKSVGIDYGKYTISDIAFDYERMMNEVA
FT                   LDIDTVRKIQLETGVGNTNLIELKNITKLVRYISEPGKGARIFVKDEASNPSGSFKDRR
FT                   ASVSVYMAKKLGYEGVIAATSGNYGASVASQAAKRGLKCIIVQETYDSNGIGQPEILEK
FT                   GRACETYGAEVVQLTVGPELFYYFLVLLEETGYFNASLYTPYGIAGVETLGYEIALQCR
FT                   EQIGCDPDYVVVTHAGGGNLTGTARGLLKAGAKNTKIVAASVDLHGLHMASDRDFNRKS
FT                   FTTGHTGFGIPFAVYPDRSDVPKNAARALRYMDRYLLVTQGEVFYVTEMLARLEGMQRG
FT                   PAGNTSLAAAISLARELPKDNIVVVQETEYTGAGKLPSAQLTFAKKMGVEVVRGDPRKL
FT                   DKPGKRIVIPEHPSQLRALDVDLQKLKKSYIKELVKRGIKHLEEVDIEFLAEDLKTTRE
FT                   NVKTLFEEVIKDYGTES"
FT   gene            377920..378291
FT                   /locus_tag="Kole_0359"
FT   CDS_pept        377920..378291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79084"
FT                   /db_xref="GOA:C5CDK0"
FT                   /db_xref="InterPro:IPR015130"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDK0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79084.1"
FT                   /translation="MVQRADDFKERSKRLQNMTDEELDRYFWELAEKIVDPLIKLASTH
FT                   TSPSIERSVLLRMGFNSLEAKAIVEKVVDMGLLGKGAGNIVYTISQKTGKSILEAGREL
FT                   AAGKYWDLVEESFKGVGSK"
FT   gene            378288..380483
FT                   /locus_tag="Kole_0360"
FT   CDS_pept        378288..380483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0360"
FT                   /product="D-Lysine 56-aminomutase alpha subunit"
FT                   /note="PFAM: D-Lysine 56-aminomutase alpha subunit;
FT                   cobalamin B12-binding domain protein; KEGG: mxa:MXAN_4388
FT                   D-lysine 5,6-aminomutase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79085"
FT                   /db_xref="GOA:C5CDK1"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR015130"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR028991"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR036843"
FT                   /db_xref="InterPro:IPR037086"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDK1"
FT                   /inference="protein motif:PFAM:PF09043"
FT                   /protein_id="ACR79085.1"
FT                   /translation="MSLPPNERLNVEEILKDLEHYRPRRRGWTWRKKLPEGTKIGEFTY
FT                   DQISEPLKNSVPLPAAHHFGNIDPQPDVVITSEIASGRFEDDIRRMRMAAWHGADHIMV
FT                   IRTLGQSHMDGLIEGTPEGIGGVPITRKQIRASRKALDIIEDEVGRPINFHSYVSGVAG
FT                   PEIAVLFAEEGVNGAHQDPQYNVLYRGINPIRSFVDAAVAKKIMAWANMLQIDGAHNAN
FT                   ASAKMAWKVMPELIVQHAINCMFSLKAGMKKENIALSTVPPMVSPAPEFKLNFIYALTV
FT                   RELFKGFRFRAQMNTRYIESDLFDATRIHVLDTLISRLTSADLQSTITPDEGRNVPWHI
FT                   NSVRGVETAKHTLIALDGIKKFLKVNEEEVRPRIRELKMRAILFMEEILEIGGYFEAVE
FT                   QGFFVDNGYYPERMGDGIARPKDGGIGAGSVVPRDPDYMAPVCEHFGYNNLPEGIEKPC
FT                   DLIGGCTFHNPEKIQFIDELDENDNVTNRIQKVIEEREKGFIGPEVEWWGDGWIQIDMT
FT                   IPDDEAHAEAAAIEICKRLGLEEPTVISKTILHPVEGTYIELKARVPFKVNRNELELPK
FT                   KPETLPEEEIFQYVSKHPIKVVAGTAGNDEHSVGLREILDIKHGGIEKYGIKYTYLGTS
FT                   VPPEKFIDAAIETGADAILVSLIITHNDVHVQNMKKIHQLAIEKGIRDKIILIAGGTQI
FT                   NNDLAVSCGMDGGFGRGTKGIHVASFLVKKLREKHSN"
FT   gene            complement(380598..381215)
FT                   /locus_tag="Kole_0361"
FT   CDS_pept        complement(380598..381215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0361"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: sfu:Sfum_1749 BioY
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79086"
FT                   /db_xref="GOA:C5CDK2"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDK2"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ACR79086.1"
FT                   /translation="MRGLALTEHYFEVRQKLFKWPREQTVTRKLILAIGMAALTGLLAQ
FT                   VKFYLPWTPVPATGQTFAVLMAGILLGRWWGGVSQAIYVTLGAAGIPWFSSWSGGIHHL
FT                   TGPTGGYLVGFIFAALFIGYFCDRYPKSRNFVPMLGLMVVANFVIVHGLGLCQLAIWLN
FT                   LVKNNPITMKELLWMGTIPFIAGDITKIILAAGVVKAVTPKK"
FT   gene            complement(381350..381766)
FT                   /locus_tag="Kole_0362"
FT   CDS_pept        complement(381350..381766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0362"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   gur:Gura_2106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79087"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDK3"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ACR79087.1"
FT                   /translation="MKSYRKELWFHTRKRREFINITPLVEECVRESGVKEGLCLVNAMH
FT                   ITASVFINDDEPGLHNDFERWLEKLAPEKPYSQYEHNGFEDNADAHLKRTVMGREVVVA
FT                   ITDGKLDFGPWEQIFYGEFDGMRDKRVLVKIIGE"
FT   gene            complement(381850..382032)
FT                   /locus_tag="Kole_0363"
FT   CDS_pept        complement(381850..382032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79088"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDK4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79088.1"
FT                   /translation="MSLSILSRFVFEASILFQVDLFLRHYVVSTSLDKVIPQFLFGENF
FT                   VLADDSCCSFDNHIL"
FT   gene            complement(382010..383194)
FT                   /locus_tag="Kole_0364"
FT   CDS_pept        complement(382010..383194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0364"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bja:bll1898
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79089"
FT                   /db_xref="GOA:C5CDK5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDK5"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACR79089.1"
FT                   /translation="MKNVVKDYSKRYRKARKKEKSEILDEFTRVTKYNRSYASFLLRGA
FT                   LKKRKATSPSQKKGRKKKYDHKVFVKLVKIWEIMDFPCGKRLEAVMDEVIDNLVRNGHL
FT                   TLAEETKRKLLSISASTIDRLLSSERKKMELKGRSHTKPGTLLKKHIRIKTHYEWDDTR
FT                   PGFVEIDLVGHDGGSVSGDFCYSLNMVDVASGWSVVAPIRNKAQIWTLKAIIQLRKTLP
FT                   FTLLGIHSDNGSEFINRHLYRYCEDEGLLFTRTRSYNKNDNCHVEQKNWSVVRRAVGYY
FT                   RYDTEEEFQILKELYASLNLYNNHFQPNQKIVEKIRKGNKVSKKYDRPTTPYERIMRSP
FT                   WVDQDKKDRLRRQHEALDIYKLKSIITHLQEQLLSIQIDKSKGGILNYVPLNFK"
FT   gene            383373..383867
FT                   /locus_tag="Kole_0365"
FT   CDS_pept        383373..383867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79090"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79090.1"
FT                   /translation="MRTIIFVFSIIMISSIALAGISVGLDTLIASSYFIEPDATPVSTV
FT                   LVIGLDFQMDFARFFKVGLTTPIFGAFISDESDITPIPPGFLWYTYAGVKLPFGRFYAM
FT                   ADIGTILAIGGFVPESKFLRVGGGFYFGPRKFVELATVAKLEEFQESLGKIFTFKIGYQ
FT                   F"
FT   sig_peptide     383373..383432
FT                   /locus_tag="Kole_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.967 at
FT                   residue 20"
FT   gene            complement(383913..384551)
FT                   /locus_tag="Kole_0366"
FT   CDS_pept        complement(383913..384551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0366"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: geo:Geob_2390
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79091"
FT                   /db_xref="GOA:C5CDK7"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDK7"
FT                   /inference="protein motif:PFAM:PF02308"
FT                   /protein_id="ACR79091.1"
FT                   /translation="MFILDLFFRLVAATIAGAFIGFTRERIQRPAGLRTHALISVGAAF
FT                   LTELSVTVFAGNGGDPGRIAAQIVSGIGFLGAGTILKKGFSVKGLTTAATLWVTAAVGM
FT                   GFGSGEYLLSSLVTLIILLVVIFFKPIDFLIGKKKWKLLIEAERRPYLLTDLLDILKGL
FT                   EVEVTSIGIDTEGNETSLEIGIPYESLNILKKNLDKLSRIGGVKSVDVQ"
FT   gene            384638..385825
FT                   /locus_tag="Kole_0367"
FT   CDS_pept        384638..385825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0367"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   net:Neut_0214 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79092"
FT                   /db_xref="GOA:C5CDS3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDS3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACR79092.1"
FT                   /translation="MPTIRNKLPLLLTALFRFMAVLSFGMLLQLRLRELGASVLLITLL
FT                   STIRGAITTLSSPVWGAVSDHFKERKLFLLLSLGVPTLLYPIYAILDIPYTFIIIAGVI
FT                   AFFSSGYDPIAMAMSTDLADGSLVSTSHELALLNSASSIGMFLGRVSLSVLLLWLSVKN
FT                   TILFFSAISLMAFIQAFFIPEKANTPEVERRKKRSFIFPSAIFDINRMKRNGLWAVYLG
FT                   SFIRQFGIAGTTSLIAVYMTEVVGLSKSLAVLLSGLNPLLQIFSHIFFGKVIGKIGSKI
FT                   SLVIGIYLSGITPLFFALSKNWVLVALAYLSLGVAFGAFINGAATFITLNSPQHKKAEF
FT                   LGLLRSARALGFMLGPVTAGLIAEHSYAAMFIFMMTVTFFSGTMVLLFSRENPED"
FT   sig_peptide     384638..384715
FT                   /locus_tag="Kole_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.780 at
FT                   residue 26"
FT   gene            385838..387172
FT                   /locus_tag="Kole_0368"
FT   CDS_pept        385838..387172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0368"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: vch:VC1631
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79093"
FT                   /db_xref="GOA:C5CDS4"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDS4"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACR79093.1"
FT                   /translation="MKEFNRKLLSIALPITIQNLISMSLNLVDNLMIGQLGSAAIAAVG
FT                   LVNQINFVLILFLFGASSGTGVFISQYWGNRDLKNIGKTISHVLKITYVGGFVFFMLLF
FT                   FFPQQIISFFSRDITVVTAGVAYSKIISFTTFLIPFTFVMAMALRTIEKPKIPMYISFV
FT                   VLAFNTVGNYLLIFGVGPFPEMGVKGAAIATLLSRIIEFFLYLYVLLKPVTALTISRHE
FT                   FLDFDTVLFRKLMVVALPVIVNELLWSVGMTTYSFIMARIGTEALTVKNIVSTLESFGF
FT                   IIFGGMSAATVVMVGSELGKKNYEKAFKNAIKLLNLMVVIGVITGIGIILLSRFLIRMY
FT                   NVEEVIKSTVVMVMIIVGLAQPVKMFNGLNIVGVLRSGGDTKTAMFLELFSLWGIGIPL
FT                   VALSGIVLKWPLPFVFLMMLPEELFKASLGMLRVHSRKWLRNVID"
FT   gene            387290..387739
FT                   /locus_tag="Kole_0369"
FT   CDS_pept        387290..387739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0369"
FT                   /product="FeoA family protein"
FT                   /note="PFAM: FeoA family protein; KEGG: mgm:Mmc1_1730 FeoA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79094"
FT                   /db_xref="GOA:C5CDS5"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDS5"
FT                   /inference="protein motif:PFAM:PF04023"
FT                   /protein_id="ACR79094.1"
FT                   /translation="MKIKLSELPEGAKGKILELYIPVELRERLFGLGFVEGEQIEVLKR
FT                   APLGDPVVYKIKGSSVTLRNDIASKIVVDSSIFPLYYAEPGKYKIVRIFGGRGILMKLQ
FT                   QIGLILEKTIDVEKNSFGKVTILLDGKKHVLPRGQALKILVEEFK"
FT   gene            387736..389748
FT                   /locus_tag="Kole_0370"
FT   CDS_pept        387736..389748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0370"
FT                   /product="ferrous iron transport protein B"
FT                   /note="TIGRFAM: ferrous iron transport protein B; small
FT                   GTP-binding protein; PFAM: Ferrous iron transport protein B
FT                   domain protein; GTP-binding protein HSR1-related;
FT                   nucleoside recognition domain protein; Ferrous iron
FT                   transport B domain protein; KEGG: dal:Dalk_1642 ferrous
FT                   iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79095"
FT                   /db_xref="GOA:C5CDS6"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="InterPro:IPR041069"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDS6"
FT                   /inference="protein motif:TFAM:TIGR00437"
FT                   /protein_id="ACR79095.1"
FT                   /translation="MKADNRSPQQKFKPIKKIPEDNGSIIPTKRLSVALLGNPNVGKTS
FT                   IFNALTGARQYVGNWPGVTVEKRIGIMYHNNIEFKITDLPGTYTLSATSPDEKIARDFL
FT                   LYESPDIVIVISDAINLERSLYLLLQVLELRGDVILVINAIDEAKKSGIYIDKAEVEKH
FT                   LGIPVVLTSAVTGEGIPELKNIMSKMKEGKVHVHYVFDDELEEEISRISSILVARRELK
FT                   NYDARWLAIKILEGDTEIQKLTGIEINREFSQELAVTRYRFIKQILRDAYSRKTKTKWD
FT                   LNTAIDHVITHKFLGLLIFLIIMYSVFQLTFSFGAPFSSLIEEVIEGLAGFFSSLIPVQ
FT                   WLSSLISDGIISGVGAVLVFVPNIFILFLALGILEESGYLPRAAFVIDRIMYAMKLSGR
FT                   SFMSMILGFGCNVSSIMAARAINEPQERITTILVSPFISCSARLPVYVLIAGTFFGAKA
FT                   GLVVFSLYILSIVFTVLSALFFNKLLYKGKPAPMIMELPRYRRPTVKSLLIYTWNRGKH
FT                   FLEKAGTIIFAASIIIWFLSYFPSAGNVHDSYAAMLGRVLEPLFRPIGFSWQIVTSLVF
FT                   GIAAKEVIVSTLTMFYSTGANLGGGTLTLVNSLTPPTAFAFLIFVLLYVPCIATLVVMK
FT                   NETGSLKYPIISVVYSFTLAYVMALLFSFIGGYIP"
FT   gene            389745..390128
FT                   /locus_tag="Kole_0371"
FT   CDS_pept        389745..390128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79096"
FT                   /db_xref="GOA:C5CDS7"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79096.1"
FT                   /translation="MNNSRINVLLWLMGTLYFLLGLNTLLGFFLAEKDLMFAIMLMVNA
FT                   AIYLFGLLENPENLNRRAAHLLVGSFFSFLILFFKIFILIGLWLSGIVENMCMLSIPVT
FT                   NILVIFSGIVASFIYAATRKLFD"
FT   gene            390211..390837
FT                   /locus_tag="Kole_0372"
FT   CDS_pept        390211..390837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0372"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: dal:Dalk_4458 multi-sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79097"
FT                   /db_xref="GOA:C5CDS8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDS8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACR79097.1"
FT                   /translation="MMAKIFVIDNTLSIRRLMKDILEREGYEVESFATAEEALHEIEKN
FT                   EPDLVMVDLRLPSMDGITFIKTLEENGFIFPIVVVSDITSPEAITEAFRHGICDFISKP
FT                   FSPEEIGSAVERCIKNDESLQKRAREIERMLEKSDFRRALKHISKLFSDFPNSAYPHFL
FT                   YALALKESRRGEAIRHLKAALALEPGFMRAKNELEKLENSGDGEK"
FT   gene            390838..391290
FT                   /locus_tag="Kole_0373"
FT   CDS_pept        390838..391290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0373"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG: mca:MCA2849
FT                   potassium transporter peripheral membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79098"
FT                   /db_xref="GOA:C5CDS9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDS9"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACR79098.1"
FT                   /translation="MPIVKGALKKKGYFVVIFGCGRLGSRIANWLSSTGNSVVVVDKDE
FT                   RAFDALSYEFTGFKIVGNANELETLKLAKVNKADFVLSLTPDDNTNIMVALVSKEIFGI
FT                   PQVIARVYDPNNLDMFSQFGIEIICPTLLAVDSVKSALSFMGGEEK"
FT   gene            391287..391949
FT                   /locus_tag="Kole_0374"
FT   CDS_pept        391287..391949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0374"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: pla:Plav_3126 potassium transporter peripheral
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79099"
FT                   /db_xref="GOA:C5CDT0"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDT0"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACR79099.1"
FT                   /translation="MKVAIIGGKNLTYYLAKGLISRGYRVYVVNKDEEYCVDLAKRLKK
FT                   VTTIVGDGARRHVLEQLELSEEDQFIALTPNDQDNLIACLTAQRLLGIRRPIALINDPD
FT                   NKEVFAKMGITAAISPIEMISMTLEDSIFREQITNLIPASEKLSVFRIDLHSTAPVIGK
FT                   MVKDLELPEESVIGAIIRGDEVIIPRGNTQISENDTLIVLSNPAVQSKVFEALLGEV"
FT   gene            391950..393458
FT                   /locus_tag="Kole_0375"
FT   CDS_pept        391950..393458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0375"
FT                   /product="cation transporter"
FT                   /note="PFAM: cation transporter; KEGG: dol:Dole_3217 TrkH
FT                   family potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79100"
FT                   /db_xref="GOA:C5CDT1"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDT1"
FT                   /inference="protein motif:PFAM:PF02386"
FT                   /protein_id="ACR79100.1"
FT                   /translation="MYPKALKKRYKVIFGYIGELFVYFSVALLTPLIIGIWHPEEFSNA
FT                   EPFIYAALISFLFGMAFKLWLKVKPGTPLSVQEGAIIVVFVWIFGIVFSALPFVFGNIL
FT                   NFSQAIFESTSGWTTTGLTLVDVTKIPRVYLVWRSLMQFLGGAGFAIIMMSAILGPGGF
FT                   GLYHAEGRIDNLVPNIKSSVRRILLIYFTYAIGGIIAYKIAGMNWFDAFNHSLTALATG
FT                   GFSTRAGSIGEFNSVAIETVTIVLMILGTTGFGIHYTLWKGNFKAFAKNGEPKLMGLIL
FT                   LFFTPMLMSTTFNMLAASSSSSFRLAVFQAVSALTGTGFSTVDFTNWASKGLFTGLYLL
FT                   TLLMIFGGDMDSTSGGLKQYRLYALIKLIGLEIKKFFLPKNAVAVTEIWKGEKKRYIDS
FT                   NLVKEILIVFTMYFLTYTIGTGIISAYGYSLADSAFEFASALSTVGLSVGITRPDAPLG
FT                   IIWTETIGMFLGRLEFLVVIFGITKMFKDAFYIATVRKRKATEV"
FT   gene            393461..394720
FT                   /locus_tag="Kole_0376"
FT   CDS_pept        393461..394720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0376"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: geo:Geob_2622 histidyl-tRNA synthetase;
FT                   TIGRFAM: histidyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (G H P and S); Anticodon-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79101"
FT                   /db_xref="GOA:C5CDT2"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDT2"
FT                   /inference="protein motif:TFAM:TIGR00442"
FT                   /protein_id="ACR79101.1"
FT                   /translation="MITRIKGTQDVFFEEIKYWHYIENTIRKITKLYAFEEIRTPIFEH
FT                   TELFKRSVGESTDVVQKEMYTFNDKGGRSLTLRPEGTASVARAYVENGFINRGSPLKLF
FT                   YVGPMFRYEKPQAGRLRQFHQFGIEILGSHDSTADYEVIELGINFLKELGISGTKLYIN
FT                   SVGCNKCRPKYNEVLKDYYSDKLSTLCDDCKRRYNTNVLRLLDCKIDKEVAEGAPSIHN
FT                   YLCDDCKIHFEQLQYYLKSRNLDYEVDHKLVRGLDYYTKTAFEIRSNMLGAQDQVLAGG
FT                   RYDGLVEYIGGKSVPAVGFAAGMERMILLLKKMGIEPKVEELNTVAILPMNKEAFVKAF
FT                   EFAERLRKKGISTFVDVMERNLRNKFKHASRIGAKIAVVIGEEELEKGFVTIKVMEEGS
FT                   QYTVDSDWMADYIFKKLKEL"
FT   gene            394850..395614
FT                   /locus_tag="Kole_0377"
FT   CDS_pept        394850..395614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH1414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79102"
FT                   /db_xref="InterPro:IPR032585"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDT3"
FT                   /inference="protein motif:COG:COG3330"
FT                   /protein_id="ACR79102.1"
FT                   /translation="MKKEKILEFLEASPTIQDLRKFAKMLGLRIKRTMRKRDLIRLLKT
FT                   EANKMKDISSVTSKISTPESKDQPHLPSKPENFDLPNSYTKDKLVMLPVNSRWVYLYWD
FT                   FSTETQKRVFECGGKLVLRVYDVTNIIFDGSNAHKIKEITPSGKTNNWYLKVDFSDANY
FT                   LAEIGIIENNKFTPLIRSNIVRTPVAFPKFKEKEEWLILNNQEKKVVSALESEKFRKAA
FT                   FPFENKPTSFSNPSSEEFLNYLFRSISGRKEL"
FT   gene            395611..397212
FT                   /locus_tag="Kole_0378"
FT   CDS_pept        395611..397212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0378"
FT                   /product="Domain of unknown function DUF1957"
FT                   /note="PFAM: Domain of unknown function DUF1957; glycoside
FT                   hydrolase family 57; KEGG: ank:AnaeK_1135 domain of unknown
FT                   function DUF1957"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79103"
FT                   /db_xref="GOA:C5CDT4"
FT                   /db_xref="InterPro:IPR004300"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR015293"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037090"
FT                   /db_xref="InterPro:IPR040042"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDT4"
FT                   /inference="protein motif:PFAM:PF09210"
FT                   /protein_id="ACR79103.1"
FT                   /translation="MKKGYFVLVLHAHLPYVNHPDFPQFMEERWLFEAITETYIPLLRV
FT                   FEKLERDGIRFKITMSITPPLMEMLANPDLKKKYQEHLDKLIELSKKEVERTSKENPKK
FT                   HKMAKFYLQDFTNIKEYYSRLDGNLIGAFAKFQQKGYLEIITCNATHGFLPLMARYPEA
FT                   VNAQIEIGVQTYKRHIGNSPNGIWLAECAYVPGIDRFLKENNLSFFFVDSHALWYGDPA
FT                   PRYGVYRPVITPNNVFVFARDPESSQQVWSAEVGYPSDYRYREFYRDIGFDREDWYIAP
FT                   NIDPSGQRCNTGIKYHRITGKDVDLNKKELYDIDEAKKAVKEHAKDFATKKKLQVEKLY
FT                   DNFDGVEPVIVAPFDAELFGHWWYEGPLFIEELFRQLHAIDEVVPTTPPEVISSLEMIQ
FT                   IVTPAASSWGSNGYNEVWLNRKNDWIYRHLDEAVERMIELSKKYQNTHDPLTKRALNQM
FT                   ARELLLAQSSDWAFIMTTGTTVEYAVNRTKTHMKRFLELYDQVISGKINERELKILEWV
FT                   DGIFPDIDFRIYSKNF"
FT   gene            397226..397795
FT                   /locus_tag="Kole_0379"
FT   CDS_pept        397226..397795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0379"
FT                   /product="pyruvate/ketoisovalerate oxidoreductase, gamma
FT                   subunit"
FT                   /note="TIGRFAM: pyruvate/ketoisovalerate oxidoreductase,
FT                   gamma subunit; PFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; KEGG: ppd:Ppro_0322
FT                   pyruvate/ketoisovalerate oxidoreductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79104"
FT                   /db_xref="GOA:C5CDT5"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011894"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDT5"
FT                   /inference="protein motif:TFAM:TIGR02175"
FT                   /protein_id="ACR79104.1"
FT                   /translation="MPEKYFEVRWHGRAGQGAKSASQLLAEAALEAGMYAQSFPEYGAE
FT                   RSGAPMKAFNRISDVPIRVHHTVENPDIIVIVDDTLLGLSAITEGVKEDTVMIVNTVRG
FT                   SNFVREKTGFKGKIFTIPATDIALEEIGRGIPNTVMIGALLKASNDKIPLDAVLNRVKK
FT                   MFSGKLTEEKIEANLRAVRRGYEEVK"
FT   gene            397795..398091
FT                   /locus_tag="Kole_0380"
FT   CDS_pept        397795..398091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0380"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase,
FT                   delta subunit"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase, delta subunit; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: ppd:Ppro_0323
FT                   pyruvate ferredoxin/flavodoxin oxidoreductase, delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79105"
FT                   /db_xref="GOA:C5CDT6"
FT                   /db_xref="InterPro:IPR011898"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDT6"
FT                   /inference="protein motif:TFAM:TIGR02179"
FT                   /protein_id="ACR79105.1"
FT                   /translation="MAQKGWKDIPIGGIIDTPGSAREYKTGTWRIMRPIWDVNKCINCM
FT                   QCWLFCPDLAIIQNDAKMEGIDYDYCKGCGTCAAVCPKDAIEMRPETDFQGEE"
FT   gene            398097..399266
FT                   /locus_tag="Kole_0381"
FT   CDS_pept        398097..399266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0381"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; KEGG: nam:NAMH_0242 pyruvate synthase
FT                   subunit PorA"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79106"
FT                   /db_xref="GOA:C5CDT7"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDT7"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ACR79106.1"
FT                   /translation="MPVKKAITGAAAVANAMRQINPDVVAAYPITPQTPIVEYFAKFVA
FT                   DGIVDTETIPVESEHSAMSAVVGAAAAGARAMTATSANGLALMHEIVYIAASSRLPIVM
FT                   PVVNRALSGPINIHCDHSDTMAERDSGWIQLFCENAQEAYDLTLIALKLAERKEVRLPV
FT                   MVNQDGFIISHGVEVVELLDDDVVKEFIGESTPMYSLLDIDHPVTYGPLDLYDYYFEHK
FT                   RQQVEAMENAYKIFPEIAEAFEKISGRKYWYVEPYKVDDADYVMVALGSTNGSIKYVVD
FT                   ELREQGKNVGLLKITMFRPFPKEFIRKYLDGKKGVIVLDRSLSFGAEAPLYSEIKSILY
FT                   EANSRPAIGSYVYGLGGRDITPAMIKQAFEDALSGNLNSDEQRYLGLRE"
FT   gene            399284..400258
FT                   /locus_tag="Kole_0382"
FT   CDS_pept        399284..400258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0382"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: ppd:Ppro_0325 thiamine pyrophosphate
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79107"
FT                   /db_xref="GOA:C5CDT8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDT8"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACR79107.1"
FT                   /translation="MAINVIQLAKEFAKKDIGITQGHRLCPGCGAPNTAKMALMVAKHL
FT                   GYEPVVGFATGCMEVSTTIYPYSAWSVPYIHNAFENVGATISGAETAYRALKKKGKLPT
FT                   DKPIKFFAFAGDGGTYDIGLQSLSGAIERGHDFVYILYDNEGYMNTGNQRSGSTPPGSQ
FT                   TTTAPVGEKIPGKLQLKKNIVEIVAGHENVYAATAAIGEPIDYMNKLQKAIEFDGPAFI
FT                   AVMAPCVRFWRIKEDSAPAISKLAVETLYWPLYEYERGIYRITRKPRNIKPVEEFLKAQ
FT                   QRFRALLNHPDRDKIIDMLQNYVTKKWERLLALEEATKDKPLR"
FT   gene            400386..402407
FT                   /locus_tag="Kole_0383"
FT   CDS_pept        400386..402407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0383"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: bha:BH1177 protein secretion (post-translocation
FT                   chaperonin)"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79108"
FT                   /db_xref="GOA:C5CDT9"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDT9"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACR79108.1"
FT                   /translation="MHETRWMRKIQVPIIWTIAILFAAGVIWWSVATYMSGKSRETGST
FT                   TPTNSARPEDAFAYLTKDGTPLEDPIYWISYSEYDDTVRDVLSSLSQRNIQLDPYFKGS
FT                   AGMSEIDVRYMVLLDLIDQKILIYYAKKHNIYPTEDEINTRVEEIVSKYTSDENYKAQI
FT                   EQYYGSVEAFKEKVRKSIFPSVLKEKVQNDVLKDVDQKLKTYFEENKDEIKNKYERVEA
FT                   SHILLTSEASALELKNELLNGAINFSDAASEFSIDRNSAVLGGSLGSFGHGQMVKEFED
FT                   AAFSATPGEIVGPVETKYGFHLIKVATKTVFDTFDELKSSSAYDQFKNDYESDEFKKWF
FT                   ENYKNNEKFGYVINDEELKIYNEFKKVQNAGNTDEYLKKLSTTIFNESGGISVEGSYLP
FT                   IAIFVQLSDEKLNNLKYELNDLKEMKKLSETTPATILSLSNEEIEKKLSELNDSTDTKL
FT                   KDLYSDAKKLKEYQSKYGEDINSVNELLETKQKEFDELNSRFATAVKFLYNMMPYSFEV
FT                   LNYMYRVDSENPEVVLRYNEGVYTHNLKPLLDSPSTLQSYLDYYKQQLGDNARMFLIDY
FT                   PLQKIERDLNTKIINATNAATDLKVSALYLLVDAYEKLASLPDQNNILVELYLRGEKRY
FT                   LNELKKLLPNDNDVASKLEFVEKQIEELQQETTPPATE"
FT   gene            complement(402469..402544)
FT                   /locus_tag="Kole_R0017"
FT                   /note="tRNA-Gln2"
FT   tRNA            complement(402469..402544)
FT                   /locus_tag="Kole_R0017"
FT                   /product="tRNA-Gln"
FT   gene            402618..404282
FT                   /locus_tag="Kole_0384"
FT   CDS_pept        402618..404282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0384"
FT                   /product="Phosphoribulokinase / Uridine kinase family
FT                   protein"
FT                   /note="KEGG: Phosphoribulokinase / Uridine kinase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79109"
FT                   /db_xref="GOA:C5CDU0"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDU0"
FT                   /inference="similar to AA sequence:KEGG:TVAG_261130"
FT                   /protein_id="ACR79109.1"
FT                   /translation="MENIKVKINKLNTEIEVPKGIAFYELAERFQKHYDSPIMAARMEN
FT                   SLVELRRKLEKDAVIDFIDLSNIDGIRIYTRGILFILFMSVREVLGKVKLYVHHSLGSG
FT                   LVCEVVGKNVGKEELEKIESKMRDIVEQDLPFSKETIDKFEAIELFKLDQQMEKSLLFK
FT                   YRKKSTVNIYKCDNYFNYFYGYMPMSTGCLKHFELLPYGEYFILNLPTPSSPNKVPAFV
FT                   DQPKLASIFMEHEHWGKILNVKTVGELNKIIAKGPDSIAELIKIAEVLHEKKIAYIADK
FT                   IVNRKGTRLILIAGPSSSGKTTFSKRLMIHLRVHGLRPVQISLDDYFVDREKTPKDENG
FT                   EYDFESIYALDLELFNQQMTELLAGKEVHLSRFNFKEGRRYFRDETVKIEEDQPIIVEG
FT                   IHGLNELLTSSIPREKKFKVYVSALTQMNLDDMNRIPTTDVRLLRRIVRDHKFRGHPAQ
FT                   QTIHMWGSVRRGEERNIFPFQEEADVMFNSALVYELAVLKMFAEPLLLEIDNSVPEYSE
FT                   VKRLLRFIDYFLPITNLEEIPRTSIIREFIGGSSFKY"
FT   gene            404298..404567
FT                   /locus_tag="Kole_0385"
FT   CDS_pept        404298..404567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0385"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   sat:SYN_00719 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79110"
FT                   /db_xref="GOA:C5CDU1"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDU1"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ACR79110.1"
FT                   /translation="MNENISKDDLIKRLRRIEGQIRGLQRMIEEDRNCPDIMTQVSAVM
FT                   SALSKVSEMIAKGYAHQCLMEISEKKDIAELDNLIETLLKFRRL"
FT   gene            404569..405357
FT                   /locus_tag="Kole_0386"
FT   CDS_pept        404569..405357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0386"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase"
FT                   /note="PFAM: tRNA methyltransferase complex GCD14 subunit;
FT                   KEGG: dvl:Dvul_0323 protein-L-isoaspartate
FT                   methyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79111"
FT                   /db_xref="GOA:C5CDU2"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDU2"
FT                   /inference="protein motif:PRIAM:2.1.1.36"
FT                   /protein_id="ACR79111.1"
FT                   /translation="MLKYGDKVLIYLEDGSEYIITLEEGKFLGTHFGNIFHEDIVGKEY
FT                   GDSISLRKHSAYILNIGIVDHIFSLKRKTQIVYPKDMGFILLMLDVKNGDLVVECGSGS
FT                   GSMTSALARAVAPDGRVVSYERREEFHKLAKENVECFGHSENVVFKLKDISEGIDESNV
FT                   NAFFLDVPEPVPHLKTVSNSLIGGGRFCVVCPTANQVQDVLRELRRLPVIKVEIWETFI
FT                   RKMKLNPERFRPEDRMVGHTTYMVFGIKVNEGGVRYEENR"
FT   gene            405341..406564
FT                   /locus_tag="Kole_0387"
FT   CDS_pept        405341..406564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0387"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: mgm:Mmc1_3509 carboxyl-terminal protease;
FT                   TIGRFAM: carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79112"
FT                   /db_xref="GOA:C5CDU3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDU3"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ACR79112.1"
FT                   /translation="MKRIVKSVLIVGIIAVVFVLSAFKALTYDEMLNKFQPVFEIISYV
FT                   QHSYYDIEKVDYDKVLDETLKGVMKGLDDPFAWYFTPVQKTENKIDTESKYGGIGAVVQ
FT                   YNTKYDALEVVAPMVGSPAERVGLKVGDIIFEVDGHKVSETGYYESVNLLRGKPGTDVT
FT                   VKVYRKGEDEPLVFTITRAEIEIKTVKYSAIDYNNHRIGYVRITHFSEPTYNEFQKAMF
FT                   SLLEADGLIIDLRNNPGGLLGSVLNISSLLIPEGLPVITIRDRNGEERIYRSWGSNFSD
FT                   FIKGKPIVVLVNGGSASASEILTGALKDHKIATVVGTKTFGKAAVQTVYDLSNGGEIWL
FT                   PTAHYFTPSGSDIHLKGIEPDITVEASETSTNDGRELTVSKVQLDPETDVQLKTALEII
FT                   ADKLGGAE"
FT   sig_peptide     405341..405415
FT                   /locus_tag="Kole_0387"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.616 at
FT                   residue 25"
FT   gene            406571..407224
FT                   /locus_tag="Kole_0388"
FT   CDS_pept        406571..407224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79113"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDU4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79113.1"
FT                   /translation="MRPLAYVLLIGIFAITFGSVIVITSSKALTINNTIERYPVPVFKA
FT                   RNFFKPVFDELKKKLERNRILVSVLKWIEDRQFDKLHLQISDTTVELCTPDIEIYEAII
FT                   NRLVMEIGARGEKKQEYLKFFGKRYVEFSEIRLGAFIVRYIPGYIPVNEDDFDTAELPE
FT                   YYVLEDDSPGKIVMSVLKGKAPIVVYSSENELKNLEATLQKYSLLALPAKDYLR"
FT   sig_peptide     406571..406657
FT                   /locus_tag="Kole_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.658) with cleavage site probability 0.281 at
FT                   residue 29"
FT   gene            407228..407716
FT                   /locus_tag="Kole_0389"
FT   CDS_pept        407228..407716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79114"
FT                   /db_xref="GOA:C5CDU5"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79114.1"
FT                   /translation="MEIFFDLIFRPRRAMKKSNIYSLITLLFIVGVFIPFHLQFSKRLS
FT                   SLTGYEILGVKAFIIFVMIVIFYVFGTAGIYFILLTFDEKFRYSLILSYFPYVFTPISL
FT                   FFGNMGSCFFLVLIGWSFYLEYLAVKLNTKADMTKSLMTMLIFKSLRVISILWLIFLW"
FT   gene            407713..410115
FT                   /locus_tag="Kole_0390"
FT   CDS_pept        407713..410115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0390"
FT                   /product="exporter of the RND superfamily protein-like
FT                   protein"
FT                   /note="KEGG: ppd:Ppro_1642 putative rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79115"
FT                   /db_xref="GOA:C5CDU6"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDU6"
FT                   /inference="protein motif:COG:COG1033"
FT                   /protein_id="ACR79115.1"
FT                   /translation="MIIMQKLSRFVFTYRVPIVVFFVVISAIGFYLSTNLVVDSDLLKL
FT                   LPRESDVVKRYENFVKWSSTDDVTFIVLKTNNKTQKGLDELKAAAKKLYQDSYTFPHIE
FT                   DFIRFDLLSNLGALSLVLVDPSVLKELSPEEFDFSDEFKRLVNYDFSAIHDIGIAFSET
FT                   LQLKDKILSDSTTTFESFVRIPSEFPENDPMILVMGIKLDGPSSDVDYVDLVIPQLRKW
FT                   VKSEISEYNISFNLTGDHQATYESHKQASRDFMVTTIVSLIGIALLFYLAYSSFKVTMY
FT                   IFISLATSMFTTLGLAFLIFGRLNIVTTFVNAITLGLGIDYGIHIITRLSDEVKRRRDP
FT                   VLSLKHTYYAVTKPLLVSLLTTILVFILLAIIDSPAIRELGILTSVGLFVFFITMYIFL
FT                   PALSIGSFLKPGKVMKIHSLDRFFYATSAVVKRYSMISLSIIVTILLIFSYIGFVSISN
FT                   FSYTPPGLMSEESEMLSTLHLLERVFKADVTNSVPILADNIEQVEEISRILDENEYVEG
FT                   SFSILTIFKEDSDEYMKQFKEVVRTLDRFRGNPLMEAFLKKANYYDELFVLLDESEKIE
FT                   SGKELIDFISETLPESLKKQFIYLSPDGKKYYIVTAYPAAHLYSSNFIKRFFDSLGELV
FT                   ERVEGYPRIFYYIMDIIKKVSLPVSGVAILLVFLIVSLERKNIFDGLKVTFLMIGILLS
FT                   MFGIMNLIGIKTTFITIITAPLIIGIGVDSLVHMIHSSTTYNLFEAGRTLKSVTMSSAT
FT                   TMLAFFSFSLAEGRLLRNFGLTLTVGVFLALLVAAFAIPVLPWNKER"
FT   gene            410131..410745
FT                   /locus_tag="Kole_0391"
FT   CDS_pept        410131..410745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79116"
FT                   /db_xref="GOA:C5CDU7"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDU7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79116.1"
FT                   /translation="MPLHLLVAYLVADHAFVNNYKLGDLAKTGWIKHLIWVFLVFLAFT
FT                   FDRFLGNAFGLLLLIGAFVWEIALRFLRIRLGNDLSEVLSIGFYILLSFLSADLLKTSY
FT                   ITPEFSWYLMGMLVVTVGVTYFLRKGIIDRNATDTVGISERLVIFIFTFAGHYEWVAIS
FT                   ILLGLVYRLIFSKEKKIEWFISPTVGIVISIVWKITMLGVF"
FT   gene            410749..411375
FT                   /locus_tag="Kole_0392"
FT   CDS_pept        410749..411375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0392"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: sat:SYN_00526
FT                   calcineurin-like phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79117"
FT                   /db_xref="GOA:C5CDU8"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDU8"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACR79117.1"
FT                   /translation="MIYAIGDIHGCLESLKKLIEKINPSRTDMLIFVGDYIDRGPNSKG
FT                   VVDFLIKLSRSRKCIFIRGNHEQMLLDYLNGGKTRKLWHFNGMEYTINSYGGIDKIPEK
FT                   HIRFFEKTILFHETDEYVFVHAGVRPGIPLNKQKDGDLLWIRDEFIYAEWPVKDKVVIF
FT                   GHTPVLQEPLIMKDKIGIDTGCVYGGKLTALRLDDMCFFSVKSIF"
FT   gene            411402..412931
FT                   /locus_tag="Kole_0393"
FT   CDS_pept        411402..412931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0393"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; KEGG: gsu:GSU0489 Mg
FT                   chelatase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79118"
FT                   /db_xref="GOA:C5CDU9"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDU9"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ACR79118.1"
FT                   /translation="MSHYSKVKSVTMQGLKAIEILVEVDLDKKAILQDVDIVGLGDTVI
FT                   KESKKRIKSALKNSGFSFPNGRITVNLAPSDVKKEGSYLDLPIAVGILKANGIINSSTD
FT                   NYIFFGELGLDGSVRKIRGVLPVLLQLSGKHAAAVKFILPTENTHEASTVEGIEIYTVK
FT                   DIRELVLMLNGDIQKSPLSYVEPTFEATDSEDFSDIKGQEFAKRAAEIAAAGGHNLLLR
FT                   GSPGCGKTMLARRMPGILPSFTLEEAMETTIIYSVAGLLNGKGLVTKRPFRAPHHTAST
FT                   TSIIGGGSDAKPGEISLAHNGILFMDEFPEFRRDVLEALRQPLEDGEVTISRAKISATY
FT                   PARFMLVAAQNPCPCGWYGDKTHECTCSWHEIKRYNKKTSGPIEDRIDIFVDMPRLEFS
FT                   EYSSVKSGESTKTIRERVERARKRQNLRLKKYKIFSNSQLNHRQLEEIVDLDSEGKKLL
FT                   EAAVDKLKLTGRSIDKILKVALTISDIEEEKHVFPRHLAEAIQYRKRELSF"
FT   gene            413150..414550
FT                   /locus_tag="Kole_0394"
FT   CDS_pept        413150..414550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0394"
FT                   /product="biotin and thiamin synthesis associated"
FT                   /note="PFAM: biotin and thiamin synthesis associated;
FT                   Radical SAM domain protein; KEGG: dps:DP2377 thiamine
FT                   biosynthesis protein ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79119"
FT                   /db_xref="GOA:C5CDV0"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024007"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDV0"
FT                   /inference="protein motif:PFAM:PF06968"
FT                   /protein_id="ACR79119.1"
FT                   /translation="MRTEVRSFINVEEIEEHLEKNSFPSRERIEEIIQKSLDKNRLNPD
FT                   EVAALLNVRDPELRELIFEGARELKKRVYGNRIVLFAPLYIGNKCINNCVYCGFRVSNK
FT                   EVVRRTLNFDELKLETKALVNRGHKRLILVYGEHPDYNADFIAKTVEIVYSIKEGNGEI
FT                   RRVNINAAPLEVEDYKKVKEAGIGTYQIFQETYHPGVYKKMHPTGPKADYLYRLYGLDR
FT                   AMEAGIDDVGIGALFGLYDWKFEVMGLLYHTIHLEERFGVGPHTISFPRIEPAIGTPIS
FT                   SKPPFSVNDEDFKHLVATLRLAVPYTGMILTAREPIEIRREVLKLGVSQIDAGSNIGIG
FT                   AYSKEDKEAYKKSQFTLGDTRPLDVVIKELAQEGYIPSFCTACYRLGRTGEHFMEFAIP
FT                   GFVKRFCQPNAVLTFAEYLADYASEETKEVGSKLIKKEINNVEDEKLKETLRRYYERVL
FT                   NGERDLYF"
FT   gene            414510..414785
FT                   /locus_tag="Kole_0395"
FT   CDS_pept        414510..414785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79120"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79120.1"
FT                   /translation="MREFSMEKEICISKILEILERFANKDTKVWIAEKFGRRWSYIKGF
FT                   GEEQYVPVEIVLEFGKYAVFAENLSEVQKEKLQQEIMRKLRENDGE"
FT   gene            414775..415866
FT                   /locus_tag="Kole_0396"
FT   CDS_pept        414775..415866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0396"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: sfu:Sfum_0841 biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79121"
FT                   /db_xref="GOA:C5CDV2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024021"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDV2"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACR79121.1"
FT                   /translation="MASSRFDIAKKIEVEGSKELQRIVKKVLTEEELSKEEIIYILSLE
FT                   RGEKDRELLFEFSNAIRKDYVGEMFFIKGVIEFSNYCRKNCDYCGIRAANKIPRYRMSE
FT                   KEIIEIAKTMLPIGVDTIILQSGEDPYYDIEKLERIVSRIKKETHLPVSLSIGERPKTE
FT                   YLKLKAAGASKTLLKHETMNRKIFESVHPDDDYDKRIDLLLYTVSIGYIAGSGNIIGLP
FT                   GQTIEDVADDVLFLRDSGVRMVGLGPFIPAKGTPLENHPYGDPELTLNTYAAVRLCIPK
FT                   VFMPSTTALGTIDEDLQFEGFKVGCNVIMCNFTPEKYRKNYTIYSDKIKVDFFKTAKRM
FT                   KDMGLKLNPRILKNLEEYKKVII"
FT   gene            415863..417092
FT                   /locus_tag="Kole_0397"
FT   CDS_pept        415863..417092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0397"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; Miro domain protein;
FT                   KEGG: dde:Dde_2276 small GTP-binding protein
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79122"
FT                   /db_xref="GOA:C5CDV3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR023873"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040644"
FT                   /db_xref="InterPro:IPR041606"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDV3"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ACR79122.1"
FT                   /translation="MIATGGYRKYLAFFGKRNVGKSSLINALVGQDVSIVSDVPGTTTD
FT                   PVYKSLEIHPIGPVTVVDTPGVDDVGELGELRVKRALKAMYKADIAILVVDQRWNEYED
FT                   WLIEQFIKMDLPFVIAVNKIDQSWNTSEIEPKVSPYPHCFVSGLKKTGIEDLRRLISEN
FT                   LPQEEDIPLLSDLIEAGETVLLVVPIDLGAPKGRLIMPQVEAIREVLDREALCLVVKER
FT                   ELRWALQMMKEAPSLVVADSHLISRIAADVPDEIPLTTFSILEARHKGDLVEMVKGIKR
FT                   VEELTPESKIMIMEGCSHAPLVEDIGRVKIPRWLSNHIGGGLSFEIRAGRDFPEDIGEI
FT                   DLIIHCGGCTLTRAMMMRRIREARRRGIPIVNYGVLISYLHGVLERVLRPFPDAHTIYI
FT                   EEIEGVTHEN"
FT   gene            417082..418476
FT                   /locus_tag="Kole_0398"
FT   CDS_pept        417082..418476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0398"
FT                   /product="fumarate lyase"
FT                   /note="PFAM: fumarate lyase; KEGG: pca:Pcar_1630 aspartate
FT                   ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79123"
FT                   /db_xref="GOA:C5CDV4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDV4"
FT                   /inference="protein motif:PFAM:PF00206"
FT                   /protein_id="ACR79123.1"
FT                   /translation="MRIEKDALGKLEIPDDVYWGIHTARALKNFPSTGEKIDEEFIRCY
FT                   GYIKKSAAFLNKKLGFLETKIADAVIQAADELISGSLMKWVVVDPLCGGAGTSINMNIN
FT                   EVIANRATEILGGKLGEYIVHPLDHVNLHQSTNDTFPTAGKMATIALLKQLVENVTNLQ
FT                   DSLQKKEAEYRKMIKPARTQLMDAVPISLGQEFGAMAEAISRDRWRLYKVEERIRMVNL
FT                   GGTAVGTGIAADRKYVLSIVETLRTVSGIKIAKAENLIDATQNMDVFAEIHGLLKALAT
FT                   NLIKISNDIRLLGSGPGSAIGEIKLPKLQAGSSIMPGKINPVIPEYVVQLSLAVLGHDA
FT                   IINFAVSSGNLELNAFVPEIIHYTLKSLRFLTIAANSLANYILKIEANPEKMRENLLSS
FT                   SAILTPLITTYGYDKVQEWIELSSKTGKNLWEIVKDSLGEEAEKFKAKLISNKSTGIGF
FT                   SHQDFE"
FT   gene            418536..418943
FT                   /locus_tag="Kole_0399"
FT   CDS_pept        418536..418943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0399"
FT                   /product="methylglyoxal synthase"
FT                   /EC_number="4.2.3.3"
FT                   /note="KEGG: reu:Reut_A2504 methylglyoxal synthase;
FT                   TIGRFAM: methylglyoxal synthase; PFAM: MGS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79124"
FT                   /db_xref="GOA:C5CDV5"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDV5"
FT                   /inference="protein motif:TFAM:TIGR00160"
FT                   /protein_id="ACR79124.1"
FT                   /translation="MNKIHIALIAHDKKKIDLIVFVKEHLDVFEKCELYATKTTGKLLR
FT                   DKLKLKVNTVQSGPIGGDLQIGAMVANDNIDFVIFLRDPLTAQPHEPDVSALLRVCDVH
FT                   NIPLATNLATAEALIAEINALMEKTNMEDEK"
FT   gene            complement(418949..419251)
FT                   /locus_tag="Kole_0400"
FT   CDS_pept        complement(418949..419251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH0532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79125"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDV6"
FT                   /inference="similar to AA sequence:KEGG:BH0532"
FT                   /protein_id="ACR79125.1"
FT                   /translation="MKIRVRELSLKSFGRFLDIPVILNKRLKRSLGRLVYRKRGGNFEP
FT                   LRIELSPVILDNEELFNKTVLHELSHWFLMIEGKNFRHNSSDFKRLSKEFDFPVR"
FT   gene            complement(419268..421766)
FT                   /locus_tag="Kole_0401"
FT   CDS_pept        complement(419268..421766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppr:PBPRB1987 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79126"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79126.1"
FT                   /translation="MNKATILLAFFVLAFSIVFGYSSRDLDWMVAESEHFIYVYHAEAS
FT                   ELLAIVSRIAEETYVELQTLFGNIPHDKVIFILTTYEDFSNGYAESTGRMRVISLGNNY
FT                   YMRFDEYWLRTVITHELSHVFHLSRVSNVLKPIKIALSRFVSPQALSPAWLIEGIAQLG
FT                   SEYCGADTYDHRRLSFMLDQLELPNPFENETIISGYNPVGGEAYYNFGYAFVSYLVEHY
FT                   GMQKFRDFLRLRDGIEVLLGIDYAFKKVYNKTFEQLKTEFVEAEREKYKEKLKTDFSYV
FT                   EYITTKDNFVSVEKAIFKKENFYYLIYDRRMRISRIFKDDVNIFSTTKRITDFSALNGF
FT                   IAFTTLERVGDTLESRLYFLENGKLNFSGISHVLAVEILSKDLLVILKNDFGKLTLSTL
FT                   SLKNKRELKIYSAPDELVYISQLTANDGARFLAFRMNDSGKHYVGIYNFLQKKLELYEV
FT                   NTDVALGSWNNDTFLVALSDKTGTKIGEFDPENGKCFVVARFPRYCEYPLKNRNELLVV
FT                   SQNNGRKLFKVEKTNVIETIEFISKKPREQVKYDSRFLITKKYSPLNNMRFLTLVPYGK
FT                   GIGGIFEDYLSTSQVFMGLDLEDGIKDPAFTVGLSSRDYSKLDLQTDLTVSASELRLSF
FT                   SISRDYAIFSNFSVGWVLRYGIPFYMVFNTNATFADSIELFGGVSALSSVISFSGKQTD
FT                   DTNALELSLALSLSYRRKNWLISSQNLSRLVLFGDAAIFPVKFGSFYSESPLVFAGDLE
FT                   FQYLNSRRNLSLPGNILVFSREGYGFMTSTMIDSEDFQWQVSLYKFETLYPYLAFSLEI
FT                   RFGFSFGSTGILPYFSCEVK"
FT   sig_peptide     complement(421704..421766)
FT                   /locus_tag="Kole_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.878 at
FT                   residue 21"
FT   gene            complement(421910..423628)
FT                   /locus_tag="Kole_0402"
FT   CDS_pept        complement(421910..423628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0402"
FT                   /product="oligoendopeptidase, M3 family"
FT                   /note="TIGRFAM: oligoendopeptidase, M3 family; PFAM:
FT                   peptidase M3A and M3B thimet/oligopeptidase F; KEGG:
FT                   baa:BA_3093 Peptidase_M3, peptidase family M3"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79127"
FT                   /db_xref="GOA:C5CDV8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011976"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDV8"
FT                   /inference="protein motif:TFAM:TIGR02289"
FT                   /protein_id="ACR79127.1"
FT                   /translation="MLYTQEKITKKPRKYFTEDLDVIDWKIVEREFKGILEQEISSADD
FT                   LVKMMEKFSELMNIIGEENAWRYIRMTRFADKNEYREAYNDFLSNIVLRSEPYQMKIAK
FT                   RFYESPYRSQLDSERYENLDRIIANKIEMFKEENLPLKAREAKLASKYGAIIGSITVKF
FT                   KGEEKTLQQLGAYQLDPDRNTRENSWRLRMQKILEHSVELDKLFDDLKEIRVQQAKNAG
FT                   FDNYRDYKHKEKGRFAYTPDELFEFHESVEKVVVPFVTELNEKKRNKLNLDSLRPWDTS
FT                   VDPDGKVLKPFKTIDEFVEKAIRILYKVKPEFGVNLNKMCNSGLLDLENRKGKAPGGYN
FT                   YSLAETGAPFIFMNAVGTEDNVRTILHESGHAMHSFAMANEPIHFYRRPPMEASELASM
FT                   SMELLTLDHWDEYFPNEEEYIHAKRRELEGTVKFLPWCMIVDAFQHWIYTNPEHTPEER
FT                   TEYFKKLMDRFNTGVDWSDLDKEKGVVWMQQLHIFTSPFYYIEYGIAQLGAIAIYRNYR
FT                   RKGKRAIEDYEKFLKLGYSKPLEELYKTAGIKFDFSQDYIGELVEFIEEELKQLS"
FT   gene            complement(423801..425363)
FT                   /locus_tag="Kole_0403"
FT   CDS_pept        complement(423801..425363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0403"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: glo:Glov_1050 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79128"
FT                   /db_xref="GOA:C5CDV9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDV9"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACR79128.1"
FT                   /translation="MKVQRLRLWIQIFFVALIVFISVGHYLDEKNIYTIPGVASIHAIC
FT                   PFGGVVTMYNFVTTGDYVKKLHQSNFIMILALIILLVLTGASFCGWICPLGSVQEWFGK
FT                   LGRKIFRKHYNKVPKKLDKVLRFGKYFVLGYIVIQTARTVNLVFADFDPYYNLFNIWTD
FT                   EIALSGYIVVALTLGLSLLIERPFCRYACPLGAINGLFNSFSLLNIKRYENTCVNCGQC
FT                   DRACPVGIVVSKTDALRSPSCIRCLKCVESCPINEKNKDTLKLDLIPAKKEKKPRKVIP
FT                   NTAYVVLVLVAFIAPIAIAMANGAFITERIKTYETTDDIRGSSTLQEILDHYDVSKGVL
FT                   YGSLGIPQSIPTETKLKDLAELIGIPEEEEIISPEVIRTAVEVINQPVEELYSVANIDS
FT                   SELSEIIKNAGLDEGATVKQLVMKSEPGVLAYIISGKWPSDYIAQTGEDELVYQPEKET
FT                   TEVSIKGSTTLGEIKELVPDFEAFLQEFGISEDEPLTAMLKDLKSKYGFEISAIREYVD
FT                   SQQ"
FT   gene            425938..427125
FT                   /locus_tag="Kole_0404"
FT   CDS_pept        425938..427125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0404"
FT                   /product="Cystathionine gamma-lyase"
FT                   /EC_number="4.4.1.1"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aminotransferase class V; aromatic amino
FT                   acid beta-eliminating lyase/threonine aldolase; KEGG:
FT                   bha:BH0799 methionine gamma-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79129"
FT                   /db_xref="GOA:C5CDW0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDW0"
FT                   /inference="protein motif:PRIAM:4.4.1.1"
FT                   /protein_id="ACR79129.1"
FT                   /translation="MENKDLHFDTLAIHAAEKTDQNQALNPPIYMTSTFTFTDLQQADD
FT                   TFSFKRKAFVYTRGGNPTINLFEARMAALESGVDSVAFASGMAAITSVLLSFVKNGDEI
FT                   LAHRNLYGSTFGATAHLFPNYGIITRYVNMSDLKQVEKSITPKTKVLYLETPTNPSLEI
FT                   IDIAELSKIARNYGIKVVVDNTFATPYFQKPLELGADVVVHSATKYISGHGDVVAGVAI
FT                   SKDQEYIHRLKFGYMCELGGVLSPFNAWLLLRGLKTLSLRMKRHEENAMAIVRYLKNHP
FT                   LVEKIMYPGLEEHPGHELARKQMTGFGGIVSFELKGDVETAKAFVRNLKLIKLAVSLGD
FT                   AETLVEVPALMTHRDYPEEKLHEFGFSRKTVRISTGLEHPDDLIEDIERALKGVE"
FT   gene            427127..428086
FT                   /locus_tag="Kole_0405"
FT   CDS_pept        427127..428086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0405"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   sus:Acid_1558 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79130"
FT                   /db_xref="GOA:C5CDW1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDW1"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACR79130.1"
FT                   /translation="MRALYFDEKLSMVEVPKPSPEDGEALIKVLAAGICNTDIEIVKGY
FT                   MGFKGIPGHEFVGIVEKSADPRWVGKRVVGEINIACNECDLCKIGLKKHCRNIKVLGIK
FT                   DWNGAFAEYLVLPVENLHEVPSKVSNRQAVFVEPLAAAIQILEQVHIKPTDRVCVIGDG
FT                   KLGLLISLSLNAHGVKHILVGKHPEKMKIVSDRGVSTLFPGDVQSFDRFFDVVIEATGN
FT                   QAGLETALNIIRPQGTVVLKSTYASKASVDLSKVVVNEINIIGSRCGPFEPALQLLEKD
FT                   LIDVNPLVSQVLPFEKALEAFELAKTKGTLKVILEVEK"
FT   gene            428083..428766
FT                   /locus_tag="Kole_0406"
FT   CDS_pept        428083..428766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0406"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: baa:BA_3891 haloacid dehalogenase-like
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79131"
FT                   /db_xref="GOA:C5CDW2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDW2"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACR79131.1"
FT                   /translation="MKYEIVYFDLDGTLLDFERSEAEALTALMASGGYSLNAKELALYK
FT                   EINKKWWKALADGKYSKEYIVVARFQEFFETIGFNKITPEEASKSYLIELSKRAYFLPG
FT                   AEKFLLKLKKTGKRMAAITNGVDLVQKNRSKIANLDRFFEFILTSEKVGKAKPAPDIFF
FT                   EAAKISGVPIDRSLYVGDNLETDYVGAKNVGMDFILYAPKGKGISKLNDLKIAKSYDEL
FT                   FEMIM"
FT   gene            complement(428793..429668)
FT                   /locus_tag="Kole_0407"
FT   CDS_pept        complement(428793..429668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0407"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: smd:Smed_4013 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79132"
FT                   /db_xref="GOA:C5CDW3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDW3"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACR79132.1"
FT                   /translation="MIVVIGNINFDIIARTSRSENREENRVTSLRLVLGGTAANTAVQL
FT                   SRLGNEVALIGAVGDDLFGDWLIKELENRKVYTKGIKKLSTYHTGLCFANVADKGERYL
FT                   YTYRGANEAFIPELSDFPESELYYLAGLSVKQAEHVVRTLEEKPIFYSPGGIVTFESPE
FT                   RVLRIARNVDTLFLNEAEWGFLKEYGEPKAKRVIVTRGHLGSTSIKDGIKAPAYKIDVV
FT                   DTTGAGDAFAAGFIHALLREENAPIEDCLSFGNVMGAMVCSHYGATGEFTIRDIRKFIE
FT                   EREFSLLKYL"
FT   gene            429800..432928
FT                   /locus_tag="Kole_0408"
FT   CDS_pept        429800..432928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0408"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   aeh:Mlg_0652 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79133"
FT                   /db_xref="GOA:C5CDW4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDW4"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACR79133.1"
FT                   /translation="MWKHILETFARKPISVFLLTISLILLGIVAWQDIPIDLFPNISFP
FT                   YAAVVTPYLGAGPEEVEVNVTNPIEEAVGLVSGVKRISSRSFDSFSVVEVEFEWGTDIS
FT                   YAVSKIRELIDAFARDLPEDVDPIVVEFNPAMIPVYVVGIGTKEPNNIETLSKDLQQNL
FT                   SRLDGVANVEILGIPDKEVLIDVDPEKLEKMEIPFDSVKIMLSAGTKYPMGKITEEDNV
FT                   YPLSVSTKFASLKELEETIIGFRGMSRYINFQSLSSISDGLKLPPFFVPVRLKQVADVG
FT                   IKQKEVRGGVRVNAESAAVLVVQKRGGMNTIKVAKKVRERLSLWKEEHPGVVIQTITDT
FT                   SEFTNMAINGLFKNLLLGAIVATIVIYLFLRSVSATLAVTVSIPLSLLTAIMLMYFSKL
FT                   NFDLMTLGGLTVAVGMVVDNSIVILEAIYRYLEEKMNPVEAASKGGREVVGAIFASTMT
FT                   TLAMFVPFAFITGFAAQLFKFFAISLSFTLIASFFIAITVVPAFANIVKAKPSRDHRIL
FT                   KGYKRVLDKLLTHKKGVIIAFVIIFVISVFGLLSKGLEFIPEVDSGVLNVSFALPSNTP
FT                   YTVVSKALEEIESYLMENKDELHIVSTYSVFGQPGTILSALRGIQENEADMQINLTPSN
FT                   KRDKSSSEIAESLRSHIEKVMKKYNGSYKISSGAIEVESIFGTQIRVTFYDNDLEKLRQ
FT                   LAEEFARKLEKISGVIDVTTSFRKQQQVYELSIDRGKALTAGVFFMQALGAVQPYTVGI
FT                   NTGNIFIDGENIPIILHLKDSLNPDTIRKIKIPSFSAKDAYMGMIADLKKKVVPSTIFH
FT                   RDGQRIAFVNASVFNRPLGDVVKDIENMVDSEYKAENRPEIGGQAANLQETVTQFLKAM
FT                   IMGIILMYLIIGAQFESLVYPLVIFFTLPMALVGVALVVYLTGITVNVSTLMGMLTLAG
FT                   ITVNNGIVMITYINQLRERGMEKREAIIEGAARRSRPILMTTLTTIIALIPTAVSNAAG
FT                   SELDRPMALTVVGGLLMGMVFTLFLIPLLYDIIDKISLRFTKKKTFSEKGIRC"
FT   sig_peptide     429800..429898
FT                   /locus_tag="Kole_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.779) with cleavage site probability 0.602 at
FT                   residue 33"
FT   gene            432950..434200
FT                   /locus_tag="Kole_0409"
FT   CDS_pept        432950..434200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0409"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   mxa:MXAN_6303 beta-glucosidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79134"
FT                   /db_xref="GOA:C5CDW5"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDW5"
FT                   /inference="protein motif:PRIAM:3.2.1.21"
FT                   /protein_id="ACR79134.1"
FT                   /translation="MKSFPAGFMWGVATAGHQIEGGNYFSDWYKWEMEGKVKNGDTSET
FT                   ACDSWNQLDRDLEILKKLSVKAYRYSIEWARVEPKLNKFDEESLNKYRDFTIKLVEANI
FT                   KPIITLHHFVNPQWFAEIGGWESRENLRYFLRYVNKVVDTLGEFVPFWITINEPNVYAI
FT                   KSYLMGEWPPEVKDRGRAFQVLKNLLIAHTEAYDIIKSRYPSAMVSVAYNFVPFYPYRK
FT                   WHPLDIITAFTLNKTYNYAFLDSIKHGKFYKPIGSGEKNKKLKDKLDFIGVNYYTRYFV
FT                   KYSKPEPELVDTGNKKTDMGYEFYPEGLRTIIMKCHKDYSLPILITENGIADATDEKRW
FT                   KYIKKALEAVHKSLKGGAKVIGYMYWSLMDNFEWSEGYSMKFGLYKTKRNPLELVPRSS
FT                   ASKYADVIKNNALTDDD"
FT   gene            complement(434203..434838)
FT                   /locus_tag="Kole_0410"
FT   CDS_pept        complement(434203..434838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79135"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDW6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79135.1"
FT                   /translation="MDRKRWLDMYRAPNESTPEDSSNSLLSDTAFRGIFSEFMSYFKPG
FT                   EIIVDVNCSAYALWKKLIESNTKIVGLLLEDSNEVVKSNKKGVCKVLLEKTAMGYVGTF
FT                   NGFLCINVMNTCTPESTLNLIGWLYRALKHSAKGLVVAETSEAERASKTVNAMKSRGIP
FT                   AFIGEFIEAGVYHFKPPENVLRGLFIGAGFEVLKVVSKNNKLYMLLRK"
FT   gene            434991..436001
FT                   /locus_tag="Kole_0411"
FT   CDS_pept        434991..436001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0411"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbd:CBUD_0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79136"
FT                   /db_xref="GOA:C5CDW7"
FT                   /db_xref="InterPro:IPR001531"
FT                   /db_xref="InterPro:IPR008947"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79136.1"
FT                   /translation="MKKFLDVIILLLLAGTIFAWSGHDVLTYYILKSLNMDFSFEVPIT
FT                   VYSYENLETREYNLEKASFDDLLGKDYIPGEDNRLFKPVFENSKLENGKAPIWQILSVY
FT                   SYEPDLGMDQNLELSNLQWMTGGSQGWRHMEYHLFWLRFGEVSESVAYFTELSKKAWEK
FT                   GDPYWAFRFMGRAIHYFEDIGQPYHTFPAPFCELLKLMIDMNKWMTVFTNYHLVYDYYS
FT                   GYLLWNQNAKVVEAIKTAKPIKITDPRKDALRLRIYARRKLHKIYYEMKKIMKDDLEVS
FT                   SEFMPSPAYFDLLTVEGKTKKLEELTADLLGKVASYIKGYLIYMNEEMRWEDNLH"
FT   sig_peptide     434991..435050
FT                   /locus_tag="Kole_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.587 at
FT                   residue 20"
FT   gene            complement(436022..436660)
FT                   /locus_tag="Kole_0412"
FT   CDS_pept        complement(436022..436660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79137"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79137.1"
FT                   /translation="MKKVFLFTILLVSTFALSCVFSFEPEVVSGKVGDIVIIKVSVEKT
FT                   HWRCVLDSMDDYHFEFENVQVLGETSWNQIDSRIYEKWFKLSLSEVGEGFVKIWKNCTK
FT                   EGYDESILPVTVSANTELLEKISEGSFPVDTPLNVESTLVESFYQDAEKTVNKITLKDV
FT                   EFELPIEVYLKAGDVYVLYSKDYPYPIAVAGEDFFYRFDYYILASMSRE"
FT   sig_peptide     complement(436592..436660)
FT                   /locus_tag="Kole_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.510 at
FT                   residue 23"
FT   gene            complement(436662..437558)
FT                   /locus_tag="Kole_0413"
FT   CDS_pept        complement(436662..437558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0413"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: tmz:Tmz1t_0663 FMN-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79138"
FT                   /db_xref="GOA:C5CDW9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDW9"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACR79138.1"
FT                   /translation="MKNIRRFFLVVLVIFFTYILFADSFPGDLDFNLPGSQTQIQDQVQ
FT                   QSSYWKHDLLWKTLAVGGLSAIGIWITLRRAFKYRKVLMIVSIAILGFLFGGVLCPVTT
FT                   VQNVLFKYETAYLLMFLIPVIISFIFGRIYCGYVCPFGGVQELLYMKKYGKKVPYKTDK
FT                   LLRYVKYIVLAIVVIAALSAGRVFSGFTPFKSLFTFEFAIIGILITTVFAILSIFIYRP
FT                   FCKYLCPYGALMAFASRFSIFKVKKNDSCVNCNLCLKKCPMGAMETPGEVSDECIMCGE
FT                   CCCACPKNSLEIKSGGD"
FT   sig_peptide     complement(437490..437558)
FT                   /locus_tag="Kole_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.946 at
FT                   residue 23"
FT   gene            437700..438431
FT                   /locus_tag="Kole_0414"
FT   CDS_pept        437700..438431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0414"
FT                   /product="protein of unknown function DUF34"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   vsa:VSAL_I0840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79139"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDX0"
FT                   /inference="protein motif:PFAM:PF01784"
FT                   /protein_id="ACR79139.1"
FT                   /translation="MKIFEIENYLNEILEPWNYTDYCYNGIQIEGRHEVKKVAVGVSFN
FT                   KAFIDHALEERVDMLLVHHGIFGSGFFSLKGYIKRRVEKVIKNDLTLMGYHLPLDAHRE
FT                   YGNNATILKLLGLEPGEQVEVGYIGEYEEAVSFDDFYKRLKQIFPNQPILKYVNSDFVK
FT                   KVCVISGGAAGDLRKVEGKVDTFITGEVKEQTRDEAREMGINFINAGHYATETFGVKNL
FT                   GKLLEENLGLEVVFIDVWNEV"
FT   gene            complement(438406..438744)
FT                   /locus_tag="Kole_0415"
FT   CDS_pept        complement(438406..438744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79140"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDX1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79140.1"
FT                   /translation="MLCPYNSGSRVSIVVLSVNFLNCEAVYNNHEVVRNNSAGVRVNPE
FT                   GIRVRCEAAFSDLESQFSKLFPNPGPYTRPFVLAAFASVAPSADSLASVLFFLELSDSR
FT                   FRPHSKHL"
FT   repeat_region   439744..442252
FT                   /rpt_unit_range=439744..439773
FT                   /note="CRISPRs"
FT   gene            complement(443357..444289)
FT                   /locus_tag="Kole_0416"
FT   CDS_pept        complement(443357..444289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0416"
FT                   /product="tetratricopeptide domain protein"
FT                   /note="KEGG: shm:Shewmr7_0048 tetratricopeptide domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79141"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDX2"
FT                   /inference="similar to AA sequence:KEGG:Shewmr7_0048"
FT                   /protein_id="ACR79141.1"
FT                   /translation="MIFEREIDDVVESLRNAKIHGRKTALLIGTGCSAQAGVPTAAKVV
FT                   DMIKETRPLDYERAPKKTYSKCMSQLAPGERRDLIANFTDETKVNWAHIVIAQLMKSGY
FT                   VDRILTTNFDSLVIRACALLGEFPAVYDLTTSANFKPDFIPDKAVFYLHGQRTGFELIN
FT                   TEKEFEEHVKRIEPAIMDTARGRMWIVVGYSGRNDPVFDHLAKFQRFDYRLYWVGYKDS
FT                   EPPKHVQEKLLQEGKYAFYIRGYDADSFFVKLAQKLDCFPPDFVSQPFSYLQNLLSNLT
FT                   PCPLSENSKEDVVELTKEKVKKAIELFEE"
FT   gene            complement(444382..445152)
FT                   /locus_tag="Kole_0417"
FT   CDS_pept        complement(444382..445152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0417"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce6765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79142"
FT                   /db_xref="GOA:C5CDX3"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79142.1"
FT                   /translation="MLYKKGFTLVELLIVLAIIAVLVAALIPPAMNSIRKAKAVQVARN
FT                   LKNLSIGFENKILVDNVPPLSIDEIGRNIPDNYGVAYEVSNGTWLVVVYYTGKDVDYDT
FT                   LKTILPDVSQDYVPLSSPTVLSGSPSYSEDPENIYYSYVISIGGGTLEADVEITNIEYA
FT                   ANPEVVHIKNLGTLSVNLLGWKLKDIANHIFTFPNFVLEPGEEVRVYSHVTASSPMPEG
FT                   ENNLKWTGQYVWNNDGDTAYLYDSSGATVTTYSY"
FT   sig_peptide     complement(445054..445152)
FT                   /locus_tag="Kole_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.872) with cleavage site probability 0.601 at
FT                   residue 33"
FT   gene            complement(445302..447494)
FT                   /locus_tag="Kole_0418"
FT   CDS_pept        complement(445302..447494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0418"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; Vault protein
FT                   inter-alpha-trypsin domain protein; SMART: von Willebrand
FT                   factor type A; KEGG: sfu:Sfum_3690 vault protein
FT                   inter-alpha-trypsin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79143"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013694"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDX4"
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /protein_id="ACR79143.1"
FT                   /translation="MKKMVGALLVLFLVISSIAIADGIVIPNWESHVMPPLPDVQMFYM
FT                   TYHYVTITVENGIAKVRIEEEFVNPNSMPIEAEYIFPVPLGAVIDRFSMIVGDQVYEGK
FT                   VLPAEEARKIYQDIVRRMKDPALLEYANSRMVRMKVYPFEPGEHRRFVIEYVQPLELWG
FT                   SSYTMTYPLKIESMLSRSIENVRIEVVADPNEISDVFSPIHSFNYIKKGDESSWVFSAS
FT                   DYVPRSDVSLALTVTGGTLSSSIMNYWDEADRRGYFLLTLVPPREPERIIPKDIVFILD
FT                   ISGSMSGQKIEKAKLALLQVLQMLHEGDRFSIITFNNEVNNLTERLLPFSDRTEWYPAV
FT                   KQIMAGGMTNIHDALLEGIEVLGTQSTDDRYKVVLFLTDGAPTEGITDIGTIIRDSTKL
FT                   AKVRDVHLFVFGVGYDVNAELLDELAEKGGGKVKYIVENEEIDEKVLELYRMIETPVMS
FT                   NVHLEINGTDISYVLPKGPYTLFSGTALRISGVYYHEGVVNVTLSWEEKLNGVIVQNKI
FT                   KYKFDLTRNSSFPFIATLWAQKRISELANIYRYDETLTPAQREEIRQEIINLSKKYNII
FT                   NEFTSYLIDPESEMAADYNVPIRTGNKSVMPTLVAPLGGVINYVEVGDILASKAVSEMK
FT                   EDIIIAGEENRQYVGDKLFAKYDGIWTQEGFEEYKGLEVHIKSFSDAYFHLFSRDFWIA
FT                   DVLKLGDKVRFIYEGYKIITGNDGMETVDELPEVLR"
FT   sig_peptide     complement(447429..447494)
FT                   /locus_tag="Kole_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(447632..449515)
FT                   /locus_tag="Kole_0419"
FT   CDS_pept        complement(447632..449515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0419"
FT                   /product="M6 family metalloprotease domain protein"
FT                   /note="TIGRFAM: M6 family metalloprotease domain protein;
FT                   PFAM: peptidase M6 immune inhibitor A; KEGG: pin:Ping_2144
FT                   peptidase M6, immune inhibitor A"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79144"
FT                   /db_xref="GOA:C5CDX5"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDX5"
FT                   /inference="protein motif:TFAM:TIGR03296"
FT                   /protein_id="ACR79144.1"
FT                   /translation="MKKAIIVFLLLIVTSLAFSVPAYPGEIALSQPDGTILTVRVIGDE
FT                   FAHVTLYNGFPIIKNVDTGWWEYAVFDEIGKLIPSGSKAGIDALPELFEISTVYDYLSA
FT                   VERPQYVACAPTSGVLKFPVILVNFSDTTPTYTPDDIEPVFTGDSNSVKSYYLEVSGGE
FT                   DTLKLEFVVVGWYTVSATHGYYGEDDAHCWELVREAVQLADNDDFDFSQFDNDGDGYVD
FT                   SIIVIHQGEGQELSGDPYDIWSHSGDIWPYLYLDGVYIKHYTIQPETVGGKLLTIGVAC
FT                   HELGHVFGLPDLYDTDYSSDGIGLWGLMAAGAWNGIHRAADSPAHMCAWSKKELGWVTV
FT                   GSLNGFNGHELLSPVETNFEVLMFENADRPAGEEYFLLENRQLLGYDAALPGAGLLIYH
FT                   IDEDAYQTNDLHRRVDVEEADDDNALDTYGGDNGSAGDPFPGTSANIEFGPGTSPSSTF
FT                   YDGTSKLSVENITVNGLDIEFDVRTGVVLKAPLPYVIYGESNTLVYEFISEIVSYNLIS
FT                   QDATIIDCTLAPDRLSLDVQVLSPDHPFELTLEATDGTGESEVLTQRFLPFIYLIVHDG
FT                   VSENHLITVKELNWDEVEYEAPDGTWNGDAPLYWKWIDSLPVEVFGHQLEE"
FT   sig_peptide     complement(449456..449515)
FT                   /locus_tag="Kole_0419"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.952 at
FT                   residue 20"
FT   gene            complement(449517..450089)
FT                   /locus_tag="Kole_0420"
FT   CDS_pept        complement(449517..450089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0420"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ccv:CCV52592_2067 TPR repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79145"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79145.1"
FT                   /translation="MRNLLLAFIVKKTVLSVVTLLLLLLAVTSCVKIDEALTSGFDYLK
FT                   LGDYNSAISKFNKVLLFSNDEQKEALAREGIGWAYYMKDFLSTSENNFLLSLEMVPSNA
FT                   NVKAGLVLVNIRKGNWDEALGHGEFIVDETEFQIDYLPDPLGREELLKLLAIASIHAHD
FT                   DAAYSTYTGMITDQDFVDRLEQLKGGE"
FT   sig_peptide     complement(449994..450089)
FT                   /locus_tag="Kole_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.559 at
FT                   residue 32"
FT   gene            450350..451426
FT                   /locus_tag="Kole_0421"
FT   CDS_pept        450350..451426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0421"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: ilo:IL0120
FT                   membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79146"
FT                   /db_xref="GOA:C5CDX7"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDX7"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACR79146.1"
FT                   /translation="MNNRRKCLIIWIISVFLIAISAIKITMPFIQSESVKNVVYNSVNK
FT                   IKTHSGNFSFAVLGDNKNSISTFGKIIEQINTNPEITFVVNTGDMVFDGSVTKYNFFLK
FT                   QLSKLQKPFIPVPGNHDIADGGMNNYVEFFGPLYYAFAVDQVYFIVLDSSNEETIGAWQ
FT                   MKWLEEQLKNSQKHKYRFVFLHVPIFDPRLPMDKQPGHSLKNTKNAMELLKLLQKYNVT
FT                   MVFAGHIHGYFRGEWEGVPYIVTGGAGAELVGLNKEHYFYHYLIVRVKDTGIDYEVVKV
FT                   NSPDFNVIDRIGAFLWLYLYSFVVINYWWIVFIIGVFIFTILLVRGFKKEIMNIWRWLM
FT                   KRRIIRFISRLFVESKPH"
FT   sig_peptide     450350..450415
FT                   /locus_tag="Kole_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.836) with cleavage site probability 0.538 at
FT                   residue 22"
FT   gene            complement(451427..452977)
FT                   /locus_tag="Kole_0422"
FT   CDS_pept        complement(451427..452977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0422"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; cobalamin
FT                   B12-binding domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB; KEGG: gbm:Gbem_3595 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79147"
FT                   /db_xref="GOA:C5CDX8"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR025274"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR034530"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDX8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACR79147.1"
FT                   /translation="MKNILMVYPEYPDTFWGFKHALKFASKRAALPPLGLLTIASYLPD
FT                   EWNIKLVDMNCERLKEKDVRNSDYVFISAMAVQRESVKDVIRRCNELNVPVIAGGPLFT
FT                   MEPDHFPNADHFVLGEAEEIMPELVEDIENGKLKRYYASPDFPDITKAPVPRWDLLHLK
FT                   WYYSMGIQYSRGCPFDCEFCEIGALNGHVPRSKSTEQIIQELQTLYDLGWRRSVFFVDD
FT                   NFIGKRFDLKRKVLPAIIEWQKAHNYPFTFYTEVSIDLADDDELVNLMTRAGFNRVFVG
FT                   IETPDKESLKETNKYQNIKHNLEKSVEKLHSSGLEVQGGFIIGFDHDTPSIFKRQFSFI
FT                   QRTGIVTAMVGMLNAPRGSKLYERMRNEGRLISEFVENNVEISINFIPRMNIKTLISGY
FT                   QRLMKQLYSPVNYYRRLRKFLSVYKFPNTFRLKKITFIEIKAFLRSLVVIGIFGKERFE
FT                   YWKLLIWSLFKKRRHFPLVVALAISGYHFRKIAEKISKKKVSLIFEKPFSSGNLAAKM"
FT   gene            453169..454032
FT                   /locus_tag="Kole_0423"
FT   CDS_pept        453169..454032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0423"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; KEGG: bsu:BSU11110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79148"
FT                   /db_xref="GOA:C5CDX9"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDX9"
FT                   /inference="protein motif:TFAM:TIGR00762"
FT                   /protein_id="ACR79148.1"
FT                   /translation="MIGILCDSATDVPDGIAKSGHVEVVPVRVVIDSQTFRDNEIKREE
FT                   LLRLMENGTIPKTSIPAYSDVEKGFFRLMSKGINEIICINIAGSQSGTLNLFRMTAESF
FT                   QKTFSHLKIKIVDSRSVSIGSALLIFKAFKLIESGNNIDKIVSTLKEYVEKKIKVLFTL
FT                   PTLKFLKAGGRIGKISATIAELLNIKPVIGLEKDGTFYSAAKVRGMNRAIKKMAELTQE
FT                   FINERDVEALAIYRSSDDEGTLNLAKMLLHEFKNVKIEKLFTGIISPALLVHGGRGLVG
FT                   ISTMVR"
FT   gene            454065..454976
FT                   /locus_tag="Kole_0424"
FT   CDS_pept        454065..454976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0424"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   nis:NIS_0078 cation efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79149"
FT                   /db_xref="GOA:C5CDY0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDY0"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACR79149.1"
FT                   /translation="MAYSHRKKHGHSHSFEDTSERRLLFSIVLNLGITLVEFIGGIVSN
FT                   SLALISDSLHNLTDSSSMIVSYSAKRIARKKRTPFHTYGFKRAEILAAALNSIVLLAIA
FT                   LFLFVEAFKKVFTPSEINGTVMLTVAVIGLLGNLFTAILLFNDAKKSLNVKSTFIHIVS
FT                   DTLSSVFVIIAAVLIRNYGWIILDPLFTGVVGVFILFQSISILKESVHILMQGTPKDIE
FT                   LEKISKEIEKFDFVKNVHHLHVWTTDGHDKYLECHVELFDNNLEKADAYLDEINDLLEK
FT                   QFHIEHSTIQFERDRCKKNGKQ"
FT   gene            455192..455923
FT                   /locus_tag="Kole_0425"
FT   CDS_pept        455192..455923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79150"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDY1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79150.1"
FT                   /translation="MIGWSMPMKHNQKKENQAYFTLLDLIENEKNVCPICLATEKSVVN
FT                   YFDILLYELVNDPRIMGTIDNAMGFCKKHTALLMSMGDPFGQSIIYKSILEQATKVLPS
FT                   LLLKPKNNVKLFKNKRSLIYETIKSRCPACALEKEFEKLYINEFISALEKQEFREYFSL
FT                   SNGLCIPHFIKIMEACKNRNSATFLFNTQLKIMNNIIAELGEFIRKNDYRFSKERINNE
FT                   KDAWKRAARLLGGKHILDKLH"
FT   gene            455952..456893
FT                   /locus_tag="Kole_0426"
FT   CDS_pept        455952..456893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0426"
FT                   /product="ATPase associated with various cellular
FT                   activities AAA_3"
FT                   /note="PFAM: ATPase associated with various cellular
FT                   activities AAA_3; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: bha:BH0604
FT                   methanol dehydrogenase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79151"
FT                   /db_xref="GOA:C5CDY2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDY2"
FT                   /inference="protein motif:PFAM:PF07726"
FT                   /protein_id="ACR79151.1"
FT                   /translation="MQVKKFGEKVLKNIAKVIIGKDNVIEKTLAVMISGGHVLLNDVPG
FT                   VGKTMLARSLAISLGLEFKRIQCTPDLLPTDITGLNVLDMRTKEFVFRPGPIFTDILLA
FT                   DEVNRTTPRTQSALLEAMAEKQVTIDGKTYPLNDCFFVIATQNPVEFEGTFSLPEAQLD
FT                   RFSICLSMGYPDKEQEIKMLEGMQKVHPIESIKPVTEASELTKVRELVKNVRIDPSILE
FT                   YITTVVENTRKHPDLLLGSSPRGSIALMNISRGLAALSGRNFVIPDDVKKIAVDVLSHR
FT                   IMLKPEARLMKRTPEEIIHEILNTVEVPLIND"
FT   gene            456886..458175
FT                   /locus_tag="Kole_0427"
FT   CDS_pept        456886..458175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0427"
FT                   /product="protein of unknown function DUF58"
FT                   /note="PFAM: protein of unknown function DUF58; KEGG:
FT                   gur:Gura_0188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79152"
FT                   /db_xref="GOA:C5CE44"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE44"
FT                   /inference="protein motif:PFAM:PF01882"
FT                   /protein_id="ACR79152.1"
FT                   /translation="MTELKPTKLISSSSNVVIMTIIALIWLTLQVNGFSLLFAAFVAIL
FT                   WVEFFMSRFLLKNLTVKRKIQRNRAFIDQKIKIDYTIHNKSPIKLIVWFLPMVESASSA
FT                   SKIRKKKLILKPREEAKISSHIYFGKRGIKDVSKCLLSYPDPLGFFKHWITYEAPEEIL
FT                   VLPSLMEFENFPLRLRELLPGLKSDFKLMEDMTYMKGIREYSGDPLNKIHWKISAKMNS
FT                   LYVKEFNYTAISRTHLYLDLNLSKEVFARDVWSRIREFYEEQAILAASSLIHWSAKIGH
FT                   KIDLTVVGKKVLRSTGSFSNDWVKTVELLAISEGTNTGPELSDVLSTDVEKLTPATTVV
FT                   LFSMYLTDSILPVLLKARARCSRVIVILMPYGFRDPRYKPARSYELLPIDMRDLKEKAA
FT                   ALEEEQIIVRILRDNQSLQEVVMEIEQQSV"
FT   gene            458156..459589
FT                   /locus_tag="Kole_0428"
FT   CDS_pept        458156..459589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79153"
FT                   /db_xref="GOA:C5CE45"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE45"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79153.1"
FT                   /translation="MSSRVFKKTIVMVYAIFLSIYLFSGEFSLTSTITLTGIIVLIALQ
FT                   SLSRMGCSIFLSVPFSIIAMVIFTTGAEKLPAKESLAFIMMFAAIVLIISEKLISSGLG
FT                   VFLLGIALAINPILGVPMDIVAFLLVLLGWLLIHSQEIPLRILILLVLASSTIILFTEN
FT                   LEISPTAKLLEVLNTTNTATAVEGHLTNNHQIPISSKTGNSIDIEHPVNAPEILNAHKS
FT                   FEDKLSDFVVLLLLIVGASTMLVLYARATRIKGFWNSLIIGAVVFVLVLSLAIMGFMYL
FT                   REQPDKPVFGAAVPNEQPGYTGAPSANLNSQPIEKDNKEKGIEDTVPLIGITLRSFLTI
FT                   GTVIVGVVFAILLFSFLIRILKEKKEKEQPEEAPEEIPEGIILYPLDEVPAFSPTVNYI
FT                   LGAYWWLRRKYYSGFHHLTPYELLEKEKESDFEKNLKLVTELYVLVKYAGRKPLHRDLE
FT                   SFHKNLLKIVNALSENKEM"
FT   sig_peptide     458156..458230
FT                   /locus_tag="Kole_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.810) with cleavage site probability 0.739 at
FT                   residue 25"
FT   gene            459687..460166
FT                   /pseudo
FT                   /locus_tag="Kole_0429"
FT   gene            460215..460799
FT                   /pseudo
FT                   /locus_tag="Kole_0430"
FT   gene            460777..462111
FT                   /locus_tag="Kole_0431"
FT   CDS_pept        460777..462111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0431"
FT                   /product="Na+/glutamate symporter-like protein"
FT                   /note="KEGG: dal:Dalk_0153 Na+/glutamate symporter-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79154"
FT                   /db_xref="GOA:C5CE46"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE46"
FT                   /inference="protein motif:COG:COG0786"
FT                   /protein_id="ACR79154.1"
FT                   /translation="MYWSMIDNFIYISIFFAIAIILKRFLPFLRKFIIPNAILAGFIGL
FT                   ILGPNLFKVVPLDYEKLGQTIYHLMGIGFISLALRKTKSRKTRSTMNAGFIIVSTYLFQ
FT                   GIIGMIMAYGFNLFNKNVSPIIGLLLPLGFGQGPGQAFSIGSQWEKLGLLNGSSIGLAV
FT                   AAAGFTWATIGGIIFLNIFAHGNHKKPRVKVIEKKVLEVKDYEFSDMDGMTIQLVIIGG
FT                   IYFAVMVFLTLLEKVLAPLGALGETFATVMWGFHFVFGAIFAMLFRKIYDKLHEKGITS
FT                   ENYLNNFILQRIAGGVFDFMVAASISAVVYAKISTVFFPLFVITFLGGIFTYIYISYVV
FT                   KKTMKDYIVENTLAFFGMLTGTISTGMALLREVDPALETGTAENLVFGSGFSIFVGIPM
FT                   IAVLNVPAFALRTGNSVYFLYTLLTMLAYGFFLYIVWFRRFSKST"
FT   gene            complement(462189..462692)
FT                   /locus_tag="Kole_0432"
FT   CDS_pept        complement(462189..462692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79155"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE47"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79155.1"
FT                   /translation="MARTCSSCGKIVPRGEAIKIDGAIYCLECAANLGNKTKNKGWSAE
FT                   FGVPDVILLSVETIPVEITAYFQAISSEVLVSINPEKFRLYGEKDSPIKVVSLTYDIDT
FT                   FKLQLMEDLKIQAGIVGANVVLGVKVFYNTISFIDDEKLLIVSMSGTPVLVEDTSFIEH
FT                   HHRK"
FT   gene            complement(462739..463617)
FT                   /locus_tag="Kole_0433"
FT   CDS_pept        complement(462739..463617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0433"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; KEGG: baa:BA_3394 DUF194, uncharacterized protein,
FT                   DegV family COG1307"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79156"
FT                   /db_xref="GOA:C5CE48"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE48"
FT                   /inference="protein motif:TFAM:TIGR00762"
FT                   /protein_id="ACR79156.1"
FT                   /translation="MLAIAIDRVLDIPENIAKKKGVYILPIPVYIDGKMYLDGVDITSE
FT                   EFYRKFHPGVVLKTSAPSLKVIEEFYERIKSDGYDELLFFHVSPELTSVPNAIKLVASQ
FT                   IKGLKVHFFDTRQISIGGGFAVMRAIKLLEKGKSVKEIIDILKDFSKNVCVRFTVFNLE
FT                   YLIKGGRLTKIEGLIGALLKIKPILGIDKTGSIIPFHKARSTKLVMKKMTDDIVEHLRN
FT                   RRKNNILAIGWGHSRMKEYALELKAILEKKLSDFLEEVPEFIHIYLPPVLACHSGPELF
FT                   GCAAYGEPLSE"
FT   gene            complement(463782..464303)
FT                   /locus_tag="Kole_0434"
FT   CDS_pept        complement(463782..464303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0434"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; KEGG: pin:Ping_2327
FT                   chromate transporter, chromate ion transporter (CHR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79157"
FT                   /db_xref="GOA:C5CE49"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE49"
FT                   /inference="protein motif:PFAM:PF02417"
FT                   /protein_id="ACR79157.1"
FT                   /translation="MIELFLTFLKIGFLAFGGGYGALGLIQDEVVVVHSWIDHDAFLDL
FT                   LSISQMTPGPIAINTATFIGYRLYGLPGSFVATAGVVLPSLFWVFLITGALGIVAKKSD
FT                   ISRVLEALRFAVIALIISVTFRIGMSSITDLYSLSLLVFVIWLKVRYRLSVIWIVLISG
FT                   LIGVGLEFLN"
FT   gene            complement(464300..464830)
FT                   /locus_tag="Kole_0435"
FT   CDS_pept        complement(464300..464830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0435"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; KEGG: vei:Veis_3786
FT                   chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79158"
FT                   /db_xref="GOA:C5CE50"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE50"
FT                   /inference="protein motif:PFAM:PF02417"
FT                   /protein_id="ACR79158.1"
FT                   /translation="MNAFGLFLTFSKISLLTVGGGYAMIPVIREQLVVKRGLISDSEFL
FT                   DAVVRAQSVPGAIAVNLSLIIGKRIAGIPGSIGSLLGVVVPPFLVILLIAMIFTEFVST
FT                   PVFSGFLKGVRIGITAALIILSFSLIKESTKQIKTLVTIAVFAFAIVIFQLPSFWGLLL
FT                   CGALIYIFHGGKR"
FT   gene            464913..465527
FT                   /locus_tag="Kole_0436"
FT   CDS_pept        464913..465527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79159"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE51"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79159.1"
FT                   /translation="METRLRWGAKVISSDGKNLGRLTRVVVHPVNNEVTHIVIEKGMFN
FT                   RKAKLVPINSIYFAAPDEIRLRVKASEVEKLQDFEEIYFITGEGAEGRVTPVYWLRPVG
FT                   DYAELYPLPSFSVSSNISEDSTAIEPGALIITAEDKEAGRVRSILLDETGHITHLVIEI
FT                   SSQGKKKEKLLPIDWVTEIEQSSVKVSASYIMLEKLPDKDE"
FT   gene            465520..466077
FT                   /locus_tag="Kole_0437"
FT   CDS_pept        465520..466077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79160"
FT                   /db_xref="GOA:C5CE52"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE52"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79160.1"
FT                   /translation="MNKRFLFIYYLACMALLYGLSVSLHSLLVSLLPLGLIFAYILITK
FT                   RTKKLSRSLKFEDFFSGDIITLSTIEKELCDIKEITAQTEEFQRLKRHINLLLKQLKNG
FT                   IKFQRWLYYASVLIAPLFPVVSTVFMFFFKSQRWIITVVSGYIAMFLLLIIVVSGSDNL
FT                   LKNLEKIEKELKDLLRKYKNEN"
FT   sig_peptide     465520..465600
FT                   /locus_tag="Kole_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.599 at
FT                   residue 27"
FT   gene            466077..466793
FT                   /locus_tag="Kole_0438"
FT   CDS_pept        466077..466793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0438"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vha:VIBHAR_02834 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79161"
FT                   /db_xref="GOA:C5CE53"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE53"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACR79161.1"
FT                   /translation="MEQEIEVIFLAFVKAQDLVKIYKNGEIEYRALNGVSFEINEGEIL
FT                   SILGPSGCGKSTLLNCLSGIDDPTSGKVFVDGVNLHALSDNEKTRFRALKMGFIFQFYN
FT                   LIPVLTALENVELTMLAIGAENKSARRAAMEALEQIGMKDRVDYLPSQLSGGERQRVAI
FT                   ARALVHKPKIVWADEPTGALDSKTGAEIMELIKHLNEEFNQTFVIVTHDDRVASYSERI
FT                   LHMDSGKIISIEKRQG"
FT   gene            466800..469826
FT                   /locus_tag="Kole_0439"
FT   CDS_pept        466800..469826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0439"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   gbm:Gbem_2168 protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79162"
FT                   /db_xref="GOA:C5CE54"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE54"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACR79162.1"
FT                   /translation="MLIKTLTFAVIFGSSWVILSMLRNRIILKISFKNIFRRKAEALLI
FT                   IAGSLIGTALIVGSMSMNDSFQKFLYSRVEEQLGEIDEVITLRQINGTAPPFFTLNDVS
FT                   DLIKRLKHSEYVDEVLPILRKEVSCGSIGTVRSLEPGAAANANLIGVDFAQLSQFGYAK
FT                   GVFDTNIPEELDGDIPVVINETLAEKLNLGEGDVFEILPDPSYKLLVWLKLPKVRVYKI
FT                   VEGKGIVNYSGTNLSNDTGKLFLSIENARKILGIKVPDSYNEILVSNTGDYLSGEKFSS
FT                   RIEEIVRVWDKDKKFEVAKVKSEAIEAASGNNIGLVFFALSFFAIIAGILLLSNIYMML
FT                   AQERKSELGTLRALGYTRSKTSKVIVYEGFLYSLLSSIVGLPVGVGISYFILSKFVNLF
FT                   TDLSTMVPTERAGQALNTFQSSFTFYVKPQTLFYGFFLGLIIPMMVVLWTGRRISRMNI
FT                   VNAIRGIPEEITQRTKYLFKVFVVFSLFAGVVIVMSGYLSGSGTAFLSGTTLLLLLFPY
FT                   VLNIRDKRLIESITSVAVIVLVMFSDYIPFITEESATSVPLIITKGFSILFSGILLVVY
FT                   NLKTFEIVLSRLFHGTGKKAAVLKISTAFPARNRTRTGLTIAMYALVIYIITLVSILPY
FT                   SQEQNLKRSKDTMFIGFDCAVFSTIGNLNLKASELSEMKQVTTAVELSRLNIIVNKQAQ
FT                   TESYRADLYIFDDGFITKAEFKLNDIEVIPELKKKFNSSTDLWNYLKEHPTDIVVSKSA
FT                   LPGLTPGDIIEIFTDSTPVFSRPPRHSEIGTKITETGKKILEARVVATLPENDINFFNG
FT                   LFLYHGNLSLSDETDGSKIILMNVAGSSKEEKKSNFYTLKKLLGANIFIFYVDDMIELI
FT                   TTAISGIIDILRSFLYFGMIVGIVGVSILMFKALYERKRLIGMLKAIGFTKKMVFDAFM
FT                   IETSFIVILGILLGFTTGTLTSIEIFNSVLSGSMEMSVPWGYMAILSIIFYVISLISTI
FT                   IPSYLASKLTPAEALRYFE"
FT   sig_peptide     466800..466991
FT                   /locus_tag="Kole_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.598 at
FT                   residue 64"
FT   gene            469863..471008
FT                   /locus_tag="Kole_0440"
FT   CDS_pept        469863..471008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0440"
FT                   /product="response regulator receiver modulated serine
FT                   phosphatase"
FT                   /note="PFAM: response regulator receiver; Stage II
FT                   sporulation E family protein; SMART: response regulator
FT                   receiver; protein phosphatase 2C domain protein; KEGG:
FT                   sat:SYN_00230 response regulator receiver domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79163"
FT                   /db_xref="GOA:C5CE55"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE55"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACR79163.1"
FT                   /translation="MKRVLVIDDDRTVRMLLKVILKKAGYDVVECANGKTSLKKAESFK
FT                   PDLILLDLMLPDINGLQLLETFTSKENLKDVPIIVLTGSTDEENKLTALRSGAVDFITK
FT                   PFLSEEVLLRVRTQLRIHSLIHSLQEAVEKLQDDVAAAAKIQKALVPVSTPQGFRDRVN
FT                   WIYEPSYNVGGDIFDFIKLNDEKELIYLADVAGHGVKAAMLSVIFHRFVEDYVENIKNQ
FT                   GEKLELSKLIRALEDNFKFDKFDLFITTVAVVIDRKNMRIEIGNAGHPSPFFMKKKDRK
FT                   TFFVNDPVESMLGLGLVEGKTKVLEINRGDRIYLFTDGVIEVVNSSGTQFGLENLKKNL
FT                   EKNIWSKLEESVKDLFNEVKTYKNGEHFEDDVTIIGIEFTG"
FT   gene            471042..471401
FT                   /locus_tag="Kole_0441"
FT   CDS_pept        471042..471401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0441"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: esa:ESA_01838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79164"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE56"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ACR79164.1"
FT                   /translation="MFSFKVVDEKFAIISVEERSRITGKIPAEFKKWFESKKLDTYKAV
FT                   ILDGRNIEFVDSMGIASFISLYKILSQKNIPFAVCGLNSEVRNLFKLLKLDKIFVMDCN
FT                   SPEDFIKNLGDDSHD"
FT   gene            471394..471705
FT                   /locus_tag="Kole_0442"
FT   CDS_pept        471394..471705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0442"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: bha:BH1536 anti-sigma F factor
FT                   antagonist (stage II sporulation protein AA)"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79165"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE57"
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /protein_id="ACR79165.1"
FT                   /translation="MIKELVIDQDRFTASSCSELLSTIEKLTDFDILALNMKNVQLIDS
FT                   SGVATLLILRRKLEFKGKRLVILSPTPNVKRVFMIMGINKVLEIVDNLSEVSDNREKK"
FT   gene            471692..472096
FT                   /locus_tag="Kole_0443"
FT   CDS_pept        471692..472096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0443"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: sfu:Sfum_4032 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79166"
FT                   /db_xref="GOA:C5CE58"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE58"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79166.1"
FT                   /translation="MKRNKWSFEIKASLEAVDALASQIFRMVASEKSNELGFKVGLIII
FT                   EVCSNIVRHGYNKKNDEKIYIDLEYLDESVLLTITDNAPPFNPLIARPPDLNDINSLEK
FT                   GGMGIYLIKQFAQQINYKFKDNQNILTILV"
FT   gene            complement(472079..474955)
FT                   /locus_tag="Kole_0444"
FT   CDS_pept        complement(472079..474955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0444"
FT                   /product="Hpt sensor hybrid histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; Hpt domain protein; histidine
FT                   kinase HAMP region domain protein; histidine kinase A
FT                   domain protein; SMART: response regulator receiver;
FT                   histidine kinase A domain protein; ATP-binding region
FT                   ATPase domain protein; KEGG: nis:NIS_1346 two-component
FT                   sensor histidine kinase/response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79167"
FT                   /db_xref="GOA:C5CE59"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE59"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACR79167.1"
FT                   /translation="MKKLSNKVSLEFFIFVLSVLIVVVIAFSLSLSHSARDEYTRYLEI
FT                   KKQNVYKWFAELRNEYKQLYEVYIETGIVDDDIDLLIELEGDGRVNIVKNLIGVGFDEI
FT                   ASLVQSGSKVVLLNSEPVYLMVFETPNKQAIIGSIFDGELIGSLSKYLGEDATVFISYN
FT                   DHYIVPQEFIQTGIYVRSVIQQSKEATSRPFVVSQPRGILSIFGWGQVYLTDSVDIAGV
FT                   KVFVLQSETLLVQLVNRLIPIMFLIVVGVVFFSLVFSWSLNRYISTALDSILSGFTSIR
FT                   DGSFERVKFKSNDELGKISMELNKTMEFIEMTLEKLRKSNELLRKATAEARQASRMKSE
FT                   FLANMSHEMRTPMNAILGFTELLLSEETNEEKRKHLVTIYRSGEHLLSLINDVLDLSKI
FT                   ESGKMQIYEEIYSPRNLLKELVETYLPMAYSKGLHLAYSLDNNVPEYVVGDAFRIKQIL
FT                   TNLVSNGIKFTSQGYITIQANYKEGKITYIVNDTGIGIPEEKLDKIFEPFTQLDRTMSR
FT                   KYGGMGLGLAITKKLVDLMNGKLYIESHIGKGTKVVVSLPTKLPSKEEIEKVINKKEDT
FT                   NKVVLIAGKDKNFFENIASLLSRYNIKHRTTLNISMLPLLCKEAKYMLVIVDLDRISEN
FT                   DLSILDTVKKSETPVVLVAKDARENIEGFEVLTRPISEKKLIEIISRYLKEDLYPVHEF
FT                   SSKEILVVEDNKANQVLIKKMLEKVGFKVDVAGNGKEALEKIKEKTYSLIIMDMQMPVM
FT                   DGYTATRKIREKGLKVPVIALTAHTLRGDEAKSLEAGCDGYLGKPVKQKELIDAIVYFL
FT                   RIQEELETTRFEPVQTPDQKTGKAEEKIGEPPKNPRNDIEKRIQELSTNMGLTLEEARE
FT                   MFEEYENYLRESIMQLKELSLKEDFEAIDREGHSLKGSGKMYSVVEVSEIGVKLQNAAK
FT                   AKKKDKILQLISELEKLIDQIWGSDQNS"
FT   sig_peptide     complement(474851..474955)
FT                   /locus_tag="Kole_0444"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.525 at
FT                   residue 35"
FT   gene            475175..475378
FT                   /locus_tag="Kole_0445"
FT   CDS_pept        475175..475378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79168"
FT                   /db_xref="GOA:C5CE60"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE60"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79168.1"
FT                   /translation="MTEFLAIIGALFLLYIAIRAFPVLIGVVVGIGVLLLVVFLIIGLT
FT                   FLLLPLLGIIALIVLVAKLFAV"
FT   gene            475543..476067
FT                   /locus_tag="Kole_0446"
FT   CDS_pept        475543..476067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0446"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: dal:Dalk_4989
FT                   ATP/cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79169"
FT                   /db_xref="GOA:C5CE61"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE61"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ACR79169.1"
FT                   /translation="MSISTGGGDKGETSLWSGERVSKDDLRVEAYGTIDELNSHIGEAR
FT                   HYCKSKETKELLLRIQNDLFKVAGQLASKGKLFIEPITETDVQWLTEKVHHYEKIIKLK
FT                   GFVISGTTIQSAKLDICRTVARRAERRIVSLCKTEEIANELLKYMNRLSDFLFILARFE
FT                   EHLEGKLTYKR"
FT   gene            complement(476113..476748)
FT                   /locus_tag="Kole_0447"
FT   CDS_pept        complement(476113..476748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79170"
FT                   /db_xref="InterPro:IPR025324"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE62"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79170.1"
FT                   /translation="MLFAIVILGALVTLLLYILFRITRKTEFKSTSIVSRIEKVPELST
FT                   AKLTITQIYEMEKRSFVPGLSGKYTLIVPITVRGFLDLSTLKEENIEVLETSDAKRVTL
FT                   RLPLPNLEITVTLSQLNEIKVINESGMLVKMFGPKDKLRILKENTNAIREKAIKESEKT
FT                   GIIDIAKESARNFFHGLLLGMGFDEVIIYFQEDVPLENKVSPLKIEEK"
FT   gene            complement(476796..478820)
FT                   /locus_tag="Kole_0448"
FT   CDS_pept        complement(476796..478820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0448"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: dat:HRM2_44070 HutU2; TIGRFAM: urocanate
FT                   hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79171"
FT                   /db_xref="GOA:C5CE63"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE63"
FT                   /inference="protein motif:TFAM:TIGR01228"
FT                   /protein_id="ACR79171.1"
FT                   /translation="MISNFDISQAMTIKLDPVLPPDPEFLPGIRRAPKRELTLNKKEIK
FT                   LALKNALRYIPEELHEKLAPEFLNELLTRGRIYGYRFRPKGPIKGKPVHEYKGKTLEGK
FT                   ALQVMIDNNLDFDVALYPYELVTYGETGQVFQNWMQYQLTKKYLEVMTEEQTLVVMSGH
FT                   PLGLFKSSRNAPRVIITNALMVGMFDNQENWIKAQALGVANYGQMTAGGWMYIGPQGIV
FT                   HGTFNTILNAGRQKLGVPEDGDLRGYLFVSSGLGGMSGAQGKAVRIANGVGVIAEVDYS
FT                   RIQTRLEQGWIDVVLDDLNEVFKTALEYKKNGKSIAIAYYGNVVDLLQYAVDNNIHIDL
FT                   LSDQTSCHAAYDGGYCPQGITFEERTELLRTNKQKFRELVDKSLRKHFELIKTLVERGT
FT                   YFFDYGNSFMKAVFDAGVKEIAKNGVDTSEGFIFPSYVEDIMGPMLFDYGYGPFRWVCL
FT                   SGKHEDLVKTDKAAMECIDPTRRGQDRDNYIWIRDAEKNKLVVGIQARILYSDAEGRIR
FT                   IALKFNEMVRRGEVGPIMIGRDHHDTGGTDSPFRETSNIKDGSNIMADMATHCFAGNAA
FT                   RGMTLVALHNGGGVGIGKAINGGFGLVLDGSRRVDEVIKTAIAWDVMSGVSRRAWARNE
FT                   HSIETAIEYNKKNVGEDHITLPYLVDDGLVDKLVDNLEA"
FT   gene            479181..479810
FT                   /locus_tag="Kole_0449"
FT   CDS_pept        479181..479810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0449"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   gur:Gura_2115 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79172"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE64"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACR79172.1"
FT                   /translation="MVFPKKWICAIILILLLLSPQSFALDDTVTKQHYVFGGDHDYPPY
FT                   EFIDENGNPAGFNIDLLGAIAEVMGMDIEIRLGPWNEVRTALERGELDGLTGMYYSEQR
FT                   DKLVDFSTGFLIVHTTVFVRKDYNGITSEEDLAGKEIIVPYGDIMHDYLLEKKITDKII
FT                   TVESPAQALRLLASGKHDCALLGNLQGFYLAKKLKLDNIKAIKSVL"
FT   sig_peptide     479181..479255
FT                   /locus_tag="Kole_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(479824..480426)
FT                   /locus_tag="Kole_0450"
FT   CDS_pept        complement(479824..480426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0450"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   dol:Dole_3091 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79173"
FT                   /db_xref="GOA:C5CDD4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDD4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACR79173.1"
FT                   /translation="MTKTCKTHTAQRRRRTGKYKDPQSSWTKTTKGWEYGRKVHMSLDA
FT                   QNLLIQDWMTTPAAVHDSTVAKAQIDSGQGYKYFLADSAYDSQQIYRYIFDCSSMIPVI
FT                   DTNKRKGVSLEKQCQARWLGIQLRQIYAEKYKNRWEIERTINILQEYFNLEYIWYVRNR
FT                   NYDAVLGLAILAYNLCVMFNILNSRPHRKVADIIGCY"
FT   gene            complement(480410..480790)
FT                   /locus_tag="Kole_0451"
FT   CDS_pept        complement(480410..480790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79174"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDD5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79174.1"
FT                   /translation="MVPQELTKSDIVKIIEQLDKLLPSNFVNKQGRGRRKAYSDKSILK
FT                   LSILLKLCDVSYRGAKNFLEKNPKYMELLDLKNIPPFQTISRRVRELPLHRINKDVVNL
FT                   FLDIEGLERIELVVDSFRDQDL"
FT   gene            480827..483121
FT                   /locus_tag="Kole_0452"
FT   CDS_pept        480827..483121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0452"
FT                   /product="diguanylate cyclase and metal dependent
FT                   phosphohydrolase"
FT                   /note="KEGG: gur:Gura_2803 metal dependent
FT                   phosphohydrolase; TIGRFAM: diguanylate cyclase; PAS sensor
FT                   protein; PFAM: GGDEF domain containing protein; GAF domain
FT                   protein; metal-dependent phosphohydrolase HD sub domain;
FT                   PAS fold-4 domain protein; SMART: GGDEF domain containing
FT                   protein; metal-dependent phosphohydrolase HD region; GAF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79175"
FT                   /db_xref="GOA:C5CE67"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE67"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACR79175.1"
FT                   /translation="MVPPLELGRPAFFRDTLSVLFTQEYCFATKEGNDQLLSSLNEGLA
FT                   IIKETGKYKEIYENWFGTLSAQHLIIKNLTKYGSIILLILTVGFLLALSWSRVLKIRVE
FT                   EKTKELRKELLERMITEEKLRVSEERYRKLFESMLDGFILLKPVADKDGNINNFKIIEA
FT                   NTSFLKAVGKKKEEVVGKMLWDIFPTVYKSHIKVYEKVIETGRPTHFEIHSDETNKTFE
FT                   IVGFTPQTGYFAAIVRDITQRKQAEKALKDNLEKIRKLHEIALKMEKSKSEEEVYHLIV
FT                   EAAKKILEFDIYSLDIVEGNKFVVKAISEKVASPEIMEAPLNEGIAGKTFRTGKTIVVK
FT                   DIANEPEAKPRSKEYRSAISIPIGNIGVFQTISTKRNAFSKEDVELAELLIFHATEAIE
FT                   RIRSEAKIKYLIFHDHLTGVYNRAFFEEELKRFDAESHLPLSIIMGDVNGLKLVNDAFG
FT                   HTEGDRLLKTVATSIISSCRPQDIVARWGGDEFIILLPRAGYMLAEGILKRIKMNLEKS
FT                   DEGSYIPISVAFGIATKENANQNIQEILKKVEEQMYKNKLLKSMSTRNSIITSLEKMLL
FT                   EKSNETEEHARRMRKIAYEFGKYINLTDSEINDLVLLAALHDIGKISVPESILKKPGPL
FT                   TVEEWEKIKEHPETGYRIAINSPDLVTIADGILYHHEWWNGSGYPRGLKEEEIPFIARV
FT                   ISIIDAYDVMTSGRPYKKRLSKDKALEEIKKSSGIQFDPRLARLFMEFMQSLEDSEKSD
FT                   RNSDKDKSYHE"
FT   gene            483133..484155
FT                   /locus_tag="Kole_0453"
FT   CDS_pept        483133..484155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0453"
FT                   /product="nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="KEGG: gsu:GSU3009
FT                   nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase; TIGRFAM:
FT                   nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79176"
FT                   /db_xref="GOA:C5CE68"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE68"
FT                   /inference="protein motif:TFAM:TIGR03160"
FT                   /protein_id="ACR79176.1"
FT                   /translation="MAKKDLENKIKERLNSLTKPKGSLGFLEDIALKMGKIQGKVLPNL
FT                   PEKKAVFVFAGDHGVTEEGVSAYPKEVTAQMVLNFLNGGAAINVFSRHVGSEVYVIDAG
FT                   VDYDFPAHERLLNKKVGKGTKNFSKEPAMTREEAEKSIEYGKEIARFAKEKGFELVAVG
FT                   DMGIGNTTTATTIAIALGHNLSELIDIGTVITGQQLEKKEAVVRQAISIHEPFMDPIDV
FT                   LSKVGSYCLGEMAGFILECAQLNIPVVIDGFPTTAAALIAAQLNPEVLDCMFAGHCSKV
FT                   KGHRVLLDALNLRPILDLDMRLGEGTGAVLSFSIIEAAIKMINEMATFDDANVSKGKEK
FT                   "
FT   gene            484152..484640
FT                   /locus_tag="Kole_0454"
FT   CDS_pept        484152..484640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0454"
FT                   /product="Adenosylcobinamide-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.62"
FT                   /note="PFAM: cobalbumin biosynthesis protein; KEGG:
FT                   hne:HNE_1521 cobinamide kinase / cobinamide phosphate
FT                   guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79177"
FT                   /db_xref="GOA:C5CE69"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE69"
FT                   /inference="protein motif:PRIAM:2.7.7.62"
FT                   /protein_id="ACR79177.1"
FT                   /translation="MILITGGERSGKSRLALELALKKGEKRAFIATAEAIDEEMSSRIA
FT                   KHKEERGNLFVTYEEPLDIHEILKKTGDYDVVVVECMTTWLGNLFHYGRNIDEMVEKFI
FT                   GSINGNEIIVSNEIGMGVIPENPITRTFVEALGRLNARIAQIADEVYFVVTGIGVKIK"
FT   gene            484637..485236
FT                   /locus_tag="Kole_0455"
FT   CDS_pept        484637..485236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0455"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dvl:Dvul_2481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79178"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE70"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79178.1"
FT                   /translation="MIGSTSWVIPGTYYENALLLEGLVDFVELLVYTWDEDTKTLLFNE
FT                   MDKLLQLDLSYTVHLPMDRLDNVIRAYNFFEEARFPVINYVLHPIKGWRRTLGEKVALE
FT                   NLKELIEPHNRMVFDVGHHFLGKKFPAHLKEAIVEIHAMGVIDGRDHLPLDRETAAFIK
FT                   GFMGDLITENVLINFEVFDLEDLKNSLKVWSDTFVE"
FT   gene            485226..485921
FT                   /locus_tag="Kole_0456"
FT   CDS_pept        485226..485921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0456"
FT                   /product="cobalamin-5-phosphate synthase CobS"
FT                   /note="PFAM: cobalamin-5-phosphate synthase CobS; KEGG:
FT                   smd:Smed_1604 cobalamin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79179"
FT                   /db_xref="GOA:C5CE71"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CE71"
FT                   /inference="protein motif:PFAM:PF02654"
FT                   /protein_id="ACR79179.1"
FT                   /translation="MWNDMKLAIAFLSRVPVPLKQNKGNLKKICAYFTFVGYLAGVFYF
FT                   SMKLISENFLWTLLSVALGFYLFDLFHFDGLLDTLDGFFYQGTKERRFEIMSKGDIGPF
FT                   AFFYAALYIVAYLYAFLHVDPIDLIYVAVLGRFSMNILLHFGKPAKNTGLGKLLHPYEK
FT                   KHTLISLVFTIPLVYFPLNYIISLSIALLLGSSMHFITNRKIEGYTGDVLGATCMFSQL
FT                   SIMVALSLI"
FT   gene            486047..486481
FT                   /locus_tag="Kole_0457"
FT   CDS_pept        486047..486481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0457"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   ecn:Ecaj_0411 BadM/Rrf2 family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79180"
FT                   /db_xref="GOA:C5CE72"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE72"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACR79180.1"
FT                   /translation="MLIQKTVRYALRILVKLSIENRALNSKEISLSENLDHGFTLKILY
FT                   YLKKAGLVRAIRGRKGGYALAKNPEDITITKIFEAIPDVEERLIDCDTSCKFHKECYVK
FT                   DFWELTNHIIGYTFSNVSIANIINNNFKEKIKFLEGEFHQ"
FT   gene            486478..486939
FT                   /locus_tag="Kole_0458"
FT   CDS_pept        486478..486939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0458"
FT                   /product="DNA polymerase IV (family X)-like protein"
FT                   /note="KEGG: cbc:CbuK_1370 DNA polymerase X family"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79181"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE73"
FT                   /inference="protein motif:COG:COG1796"
FT                   /protein_id="ACR79181.1"
FT                   /translation="MKSKSVNKYQLAKQFQLLARLLEVLKENPFKIRTYHFAANVIGSL
FT                   DKRELDLKDVQELSKIKGIGKAIVEKSREFIETGKIRKLEEIRAKIPDTIRILAEQTTL
FT                   SSKTLAVMWKDYGIEKKEEIISFLNDYKRSLKLSDSDLEKVKEVLNNES"
FT   gene            486974..488191
FT                   /locus_tag="Kole_0459"
FT   CDS_pept        486974..488191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0459"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dat:HRM2_41620 permease of the major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79182"
FT                   /db_xref="GOA:C5CE74"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE74"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACR79182.1"
FT                   /translation="MAFTKDRQFYKFAAYGFLKNLRFFEPFLILFFREMGLSFLQIGML
FT                   FSIREIATNLLELPTGLVADIYGRRISMLFSMTSYIISFIIFYFFPNFYIYALAMVLFA
FT                   FGEAFRTGTHKAMILEYLRMNKILDKRVEYYGSTRAASQLGSAINSLIAAAIVFYSGNY
FT                   KVVFLAATLPYIFNLINLATYPKELDGEIKKTGKQETFKEFFGIFKNKDSLKGIMNSSI
FT                   FDAFFKTVKEYLQPVLKSLALSLPVMLAFSNNERTAVVVGIVYFFIYLATSYASKNASK
FT                   VAKKIGNKEKAINITYLLGAVLIILSGVSQRLNFQIGAVIFFLILFVIENIRRPLNVAY
FT                   ISEKISHKTMASGLSAESQLKTLLTAVLAPTIGFLADKITIGGALVVCGFVMSIFYLLI
FT                   RLREEK"
FT   gene            488211..489335
FT                   /locus_tag="Kole_0460"
FT   CDS_pept        488211..489335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0460"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; transferase
FT                   hexapeptide repeat containing protein; KEGG: har:HEAR0727
FT                   putative mannose-1-phosphate guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79183"
FT                   /db_xref="GOA:C5CE75"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE75"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ACR79183.1"
FT                   /translation="MKAMILAAGKGTRVRPLTNKIPKPMIPIVTKPTIEFLIELLKNHD
FT                   VTEIMINISHLGWLIQDYLRNGSKYGVNIGYSFEGKLLPDGTLETEPIGSAGGMKLIQE
FT                   RYNFFDETFIVLCGDAIVDLDITEAYNFHKSKGALATIITKEVSKDQVSNYGIVVTDEK
FT                   GKVLSFQEKPSPEEAKSNIANTGIYIFEPEIFEHIPSGEFYDIGSQLFPKLVSEGKPIY
FT                   AYSMDFNWFDIGRNKDYLVILEKALSGEIKNFYPGGKEIYPGVWVGTGAVISQGVEIKP
FT                   PVYIGSSTILEKGVTITGPAIIGANCYISKDSHIANAFVMDYCYLKPGTSLSRILVTPE
FT                   YFVHSDGESGEISESHLSKSVKDVRTLGIEMKEA"
FT   gene            complement(489398..491890)
FT                   /locus_tag="Kole_0461"
FT   CDS_pept        complement(489398..491890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0461"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: cja:CJA_3247
FT                   alpha-amylase, putative, amy13H"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79184"
FT                   /db_xref="GOA:C5CE76"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019248"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE76"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACR79184.1"
FT                   /translation="MLFLLLLVCVLALAVPSPKWEDQIIYFVMIDRFANGDPTNDNFGM
FT                   GEYGKDNARYNGGDLAGLIEKLDYIKELGATAIWITPPIANQWWNPWVNYGGYHGYWAR
FT                   DFKKIDEHFGDLELYKKFVEEAHKRGLYVIQDIVANHVGDYFKFVGGKFYKNTESVPTS
FT                   APEQYPFSLNDYLKDKDKNIYHWTPDITNYSDPNQKLNYQMAGLDDLNTENPVVIEALK
FT                   DSYTYWIKEAGVDGFRIDTVIYVPHEFWKEFLNGKNGVYETAKALGKEDFITFGEAWIR
FT                   SDPYDDSGEKILESYFEDGMSAMLDFPLNIEIRRVFKEGKATANLRYRLERREQFEHPE
FT                   RLVTFIDNHDMERFLKGAGLATVKQALAFLFTVPGIPVIYYGTEQGFVETRAAMFKEGY
FT                   ASGGVDHYDTSFEMYQFIRELTEFRKSNPVFRHGHIEVLKDDPNGPGIFAFKISDEEVT
FT                   AFVMLNTSNERRIITNLKTGLEPGTVIEPLYTLNTLKKKYSADKDGELNLVLNPRSVYV
FT                   GIATTQKKKVKMPTVEIYPNLKQGQKITGNFVITGTAKNAKSVKIIFDTRIDASVSVDV
FT                   IDGKWSYEWDISKFDPGIHTIVFKVYGQKRTDTTYSEDYQVILDIPEKLLAQVEDPEGD
FT                   DHGPFGKYLYPTDVTFKRQMDLLGVTIKQIGASLVITMKIKDLTTSWSPQNGFDHVTFQ
FT                   IYIDDPSKTGAKDLPFQNAKMPDGLDWDYFIFANGWSIVAYSSEGSGSQAFGTPISPTP
FT                   QVKTNKMTREVTLIIPSEVLGRPDSFDGFKFYITTWDFDGIEARYRDLYPKPKAFHFGG
FT                   GEKTDPYIMDDVLIDLGK"
FT   gene            complement(492324..493262)
FT                   /locus_tag="Kole_0462"
FT   CDS_pept        complement(492324..493262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0462"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dvm:DvMF_3028 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79185"
FT                   /db_xref="GOA:C5CE77"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE77"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACR79185.1"
FT                   /translation="MNEMNSIFITTLQATVRAGTPLLFAVLGDIFTERSGVMNLGLEGM
FT                   MLVGAISGFVVSYHTNNLLLAVLAAMIAGAVLGLVHAFFTITLRINQVVSGLAITMLGT
FT                   GISGLWGKNYIGVVAKQFQVIELPVLSKIPYIGDILFSHDLLVYVSYILVPIMWFYIYK
FT                   TKPGMILRAVGEAPDAADARGINVFAIRYLYTIFGASITAIGGAYLSLAYTSMWIENMT
FT                   AGRGWIAIALVLFATWDPAKALLGAYLFGGVTALGLRMQALGTTISSHILMMFPYLLTV
FT                   AVLVFTSTEKMKVKVGAPAALGVPYSREEKS"
FT   gene            complement(493259..494371)
FT                   /locus_tag="Kole_0463"
FT   CDS_pept        complement(493259..494371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0463"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dde:Dde_0138 branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79186"
FT                   /db_xref="GOA:C5CE78"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE78"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACR79186.1"
FT                   /translation="MRLRIEKRANIPAYMNLLVPVVSIAFSLLVMGIILVIFFQGRGQT
FT                   WGEAFRETLSAYKEMFSWPFGNIYGLYQTLVKMIPLAFVGLGLSFAYRMKIWNIGGEGQ
FT                   LYMGAFAATWGALYLFNGIESKPLMIFLLLVMGAIFGGLWGAIPAFMKAFAKTDEIVVT
FT                   LMLNYVAIFWVDYLVYGPWKDPKGYNFPITAEFPESARLPALFNGEVHIGIIFVIILAF
FT                   ILQYVYSRTKWGFNSRIVGDNPMAAKYSGIDVKTYTIVSLIISGMIAGMGGAVQMMGIQ
FT                   HRLQHGFSPGYGYTAIIIAWLAKLNPIGVLVAAFLFGGLLVGNEQLQMFFGLPLSLVYI
FT                   FQGLVLFSLLGGESIFRYRIRFVKEEEVRS"
FT   gene            complement(494368..495900)
FT                   /locus_tag="Kole_0464"
FT   CDS_pept        complement(494368..495900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0464"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: baa:BA_4398 simple sugar transport system ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79187"
FT                   /db_xref="GOA:C5CE79"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE79"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACR79187.1"
FT                   /translation="MEEKRTVLEMKHITKSFPGVLANDNVSIDLKEGEVLALLGENGAG
FT                   KTTLMNILFGIYRADYGEIFINGRKVHIASPHDALKSGIGMVQQHFTLVPSFSTSENIV
FT                   LGLKELGFIVKTRDVEAKIEQLGKHYGLAVNPKAKVWTLSVGERQRVEILKLLYTGAKI
FT                   LILDEPTAVLTPQEAEALFRAVRKMTAEGTSVIFISHKLDEVMEISDRITVLKQGKVVG
FT                   TVNKEDIDKKGLAKMMVGRDVILDIEKPDVEIGETVLKIENLKVRNDKNLFAINNLSLE
FT                   LKAGEILGIAGVAGNGQRELAESLYGLRKVESGKIILKGKDITHTSVSRRIKEGISYVP
FT                   QDRKGMATCPNLSVAENLFLKNYITHYVPMSPYYLNKRLITQTAEKLIDEYSISTPSPK
FT                   TPVKLLSGGNIQKVVLARELSTTPSVIIAAHPTRGLDIGAMEFVYRTLLQQKAKGAAVL
FT                   LLAGELYEIFRLSDRVAVIYEGQIMGYTPPDPAYIEEIGLMMGGTKRMGDAV"
FT   gene            complement(495983..497041)
FT                   /locus_tag="Kole_0465"
FT   CDS_pept        complement(495983..497041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0465"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: dps:DP0677
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79188"
FT                   /db_xref="GOA:C5CE80"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE80"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ACR79188.1"
FT                   /translation="MKKFLVFALLILVIAGLAFSAKLKVAFIYVGPIGDAGWTYAHEQG
FT                   RQYIEKVFGNQIFTSFIESVPEGAESESVLRNFAARGYDIIFATSFGYMDPVIKISKMF
FT                   PKTVFMHCSGYKTAPNVATYFGRMYEPRFLTGLIAGIMTKSNIIGYVAAHPIPEVIRGI
FT                   NAFALGVKYVNPEAKVHVVWSNTWYDPATEKEAAISLLDIGADVIAQHQDSPAPQQAAQ
FT                   SYGAYSIGYNSDMEAFAPKAYLGAPVWNWGPYYEKVVRDVMNGTWKSEQYWGGMADGVV
FT                   DIVVSDLVPESVKNLVSVFKEAIIEGKFHPFTGPIYDQEGNLRVPAGEVLSDGELLEMD
FT                   WFVDNVVGTIPR"
FT   sig_peptide     complement(496979..497041)
FT                   /locus_tag="Kole_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 21"
FT   gene            497309..498172
FT                   /locus_tag="Kole_0466"
FT   CDS_pept        497309..498172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0466"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bha:BH1003 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79189"
FT                   /db_xref="GOA:C5CE81"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE81"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACR79189.1"
FT                   /translation="MIEVKGLKKYYGKNRGIENVSFMINDGETYGLIGPNGAGKSTTIR
FT                   ILTGLLNEDSGEAYIGGFRIPKQINKVKAAIGYIPGEVNFYGDMRVKDFLELNRNFYKN
FT                   VDIDYERYIVDLLGIDTNKRFKELSLGNKKKVAILQAFVHKPHYLVLDEPTNGLDPLIQ
FT                   QKFYSLLEDHRRTGAVVLFSSHVLSEVEKVCQRFGMIKEGKMIKEGDVNTLKELTYKVV
FT                   EIRGFSGTIHGYEGKINRNGITFHVKIEELKDFLKRVTEHEFEDIEIKNPTLENIFLKY
FT                   YKEEVK"
FT   gene            498169..498972
FT                   /locus_tag="Kole_0467"
FT   CDS_pept        498169..498972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sde:Sde_3735 heavy metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79190"
FT                   /db_xref="GOA:C5CE82"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79190.1"
FT                   /translation="MNVFKKDFRGRFRSFFIWTIIISLFGFLYIPFTDKLLEESEPMLK
FT                   MLENIPKVLLNMFNMDVAMFSKPEGIFGSEGMSFVYILTGVFAAMMAGALFSREFEEKT
FT                   IEYLLVKPISRRRIFLEKSFTLITFVILLSGLFTITTVLLFRTLVHTAPYNEHILFGFG
FT                   LYVLSIQLFFAAVSTLVSLATQKSSLTTSLTLGILIFMYFGNSLSSVNKNLAWMGKISV
FT                   FHYLPLIDTVVKEKIFVSNALVIILVALLIFYGALEFFKRKDVLI"
FT   gene            499664..501163
FT                   /locus_tag="Kole_0468"
FT   CDS_pept        499664..501163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0468"
FT                   /product="WD-40 repeat protein"
FT                   /note="PFAM: WD-40 repeat protein; SMART: WD-40 repeat
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79191"
FT                   /db_xref="GOA:C5CE83"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE83"
FT                   /inference="protein motif:PFAM:PF00400"
FT                   /protein_id="ACR79191.1"
FT                   /translation="MLKTIGFPVENNPLTLLVLIGGVFFIYLVSLIFRGLRTLKEKKAN
FT                   STRKNTHNFGLVNKKVTPNADEMPRFISLQGHSGPVSSVAISPDGKYIVSGSWDNTIKL
FT                   WNINGECLRTFEGHTDWVRTVAISPDGKYIVSGSENGKIRIWNLKGNCLRILSGHSGSV
FT                   LSLAVSPDGKYIVSGSWDNAIKLWNTNGECLRTFEGHIDWVRSVAISPDGKYIVSGSED
FT                   GKIRLWDLKGNCFGILSDHSGPVMSVAISPNGKYIVSGSWDNTIKLWNVNGECLKTFKG
FT                   HTDWVRSVTISPDGRYIVSGSENGKVRIWDTEGNCLKILNGHSGPILSVAISPDKRYIV
FT                   TGSRDKTLKLWSLGNYLEIKKPFLVSEEPQPENRILNYENKSENQNLEIEKEEQYFEEN
FT                   DSPIQSDDKILLYFMNQIQELTELQKAELRKVLVLEPKKEYSISEAGVNQLVLFQLLPR
FT                   ISYNRIPLIELIEKNGLMIIWGNQYSDELCEKLKSTIIGGM"
FT   gene            501181..501756
FT                   /locus_tag="Kole_0469"
FT   CDS_pept        501181..501756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79192"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE84"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79192.1"
FT                   /translation="MEKSLREKYTEAFSGNWQYLLKFALKIAEAGGEFPPKTTISSMRG
FT                   CMEFLYSKYIERVPVDIKLIAYGHGITPETLKKHVKKIENAAIVYLKSIGNKIDGYVAL
FT                   FRTAAKQIKLITGKESIEVKTFIKYVQYLCNYWRSDKTEEIEKFFTRYFYLTGLKAETG
FT                   RNAASGLDLYTSPRVKGTYVILRFEGDN"
FT   gene            501757..502971
FT                   /locus_tag="Kole_0470"
FT   CDS_pept        501757..502971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0470"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_03464 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79193"
FT                   /db_xref="InterPro:IPR021228"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE85"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79193.1"
FT                   /translation="MDYRPMFEAIRTGVSVPEEYAAHLIIGRTFEKEIIENDIDYVISY
FT                   QASKIRIFLGDYGFGKTTLAKYAITRASEKGMVYSMLTEKDYKSIYRQDEFFRSIMKNL
FT                   RMVGFQGDLLRFILNNWAEQFLKENKDSLETLERDQIVAYLKSSNQLFDGFFADVCGAY
FT                   LYNYINEKSNNELLAFIRGDKVPKRTLRDYGITHFLEDDGWNFLDAFMKLLLTFGIKGL
FT                   LLVMDELENLRQNRKDIRDKIYNHLRELLDKLPGGEIKAINCIWLGTREWFDDQERGIK
FT                   SYTALYDRIQKEVSGVQTKESTLVELKPMNTDDLNKLVEKVSGMYKETYNITLSQKQIN
FT                   TIKSTATQQFTNINGEVSVAPRRVIKWLTELLDVFKEGNKDIINAINSVSKSVEVDDDR
FT                   YSSIF"
FT   gene            502991..505141
FT                   /locus_tag="Kole_0471"
FT   CDS_pept        502991..505141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0471"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: acp:A2cp1_1160 DEAD/DEAH box
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79194"
FT                   /db_xref="GOA:C5CE86"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE86"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACR79194.1"
FT                   /translation="MPKLSSSVASFLTNNLGWKSLTAIQKKAIPEIISGKNVLIIAGTA
FT                   SGKTEAAMIPILQKMSKNRGKGIICIYFAPLKALINDIAQRLKGIFERFDFYVGKWHGD
FT                   VSQSDKIYALKEAKILVTTPESMEGLLTSKKFSPEIFSDLRFVVIDEVHNFANNPRGAQ
FT                   LMSLIERLQIISRNEIQRVAMSATVGNPEKLLQWITGCSERESVVIETNSASRREINVR
FT                   KEEEIELSDLVKNLLSENKKIIIFADSRKEVEHYTRKLLDSGIEALPHHSSVSKTIRES
FT                   IEKAFKANDKSCVIIATSTLELGIDVGNVDTVIFLNVPYSTSSFLQRIGRSGRKSKISK
FT                   AWILIPREEDLIRFLGIATMLQDGEVEKVRPLWYYPQLFAHQIIALTYEKQKLLIEHLK
FT                   VLKNASPFKEIKKDDFELLRDHLLNKHYLELNSENYLVPGSETLEIMESGYKKKNFVVL
FT                   FPTTVDFIVYHKGVEIGTLHPIFAQTLQESFQKEGYAVFSLAKENWRVEKIDTRKRKID
FT                   VVPTNESQIPKWMSFGSKMDFDFAQAIRKALISQEIPKNVNVSETIKSELLDLMDVEKN
FT                   TVATDRYLVTSQLATPNMYEIDVFTYFGNQGNLLLKYLIKMLGIEKIKINWRSINIKSE
FT                   KSIDRILAGLKELISKPDSEILDLLTAFLLKNNKEISTLYLQLGDTLKRYIPPELQARS
FT                   LAKYLLDDRVVDALRSDLVGES"
FT   gene            505528..506094
FT                   /locus_tag="Kole_0472"
FT   CDS_pept        505528..506094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79195"
FT                   /db_xref="GOA:C5CE87"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE87"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79195.1"
FT                   /translation="MLALRGVKPGLTLVEVLISLVVFTIVMVSVTNLYTESNRYTNQLL
FT                   KRTDAYSELFTAENVLQMELAKAGPDIRYISLVKEAGNEDYKAVRYSVFIPMINYKITK
FT                   QLYFKDGRIKVWEKLFNTSDFSSDVVPTLEPPGINIIFSTTEFENIDIKFTSVATQKIE
FT                   YTIIVDTGGGNTVTHNSTVFLINME"
FT   gene            506142..506522
FT                   /locus_tag="Kole_0473"
FT   CDS_pept        506142..506522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79196"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE88"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79196.1"
FT                   /translation="MFMKRGFSLIEMVLTLLVISLVLVSIFQSFTSTNSLLNKSYTKLT
FT                   AVTDLKQGTLALWFFRDSDQAGEYTTSTNFSRDDSVFDELREEGVSEDIVERFENSIEF
FT                   WVLETEKASEIYIAVKLLKDWR"
FT   sig_peptide     506142..506237
FT                   /locus_tag="Kole_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.880 at
FT                   residue 32"
FT   gene            506549..509275
FT                   /locus_tag="Kole_0474"
FT   CDS_pept        506549..509275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79197"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE89"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79197.1"
FT                   /translation="MNRKTGVILPLTMILLLTVSILAISMLSRSSATAKILVEKISKSE
FT                   LQMNAGNIFLANLAYIQEKYLEHGALLIDEYTEYTKLFSAPYWYTNFLSSFNEATLEGQ
FT                   GWTEFFGMFYEDRFYIPGDDLRKVFQKLAEGKNIDLVMIPHKKFPSSLLTIVQVEYHGI
FT                   KGYCWGVVSPRYFSNWSRFELESNTTAYWSPGSIITGPTFFGSAGLGGAGNGGLRISAI
FT                   VPPDPDNVSEYGPIFNGESWYESWNMNLSLNPDLSERRRIFVDQDNDGDYETNLGIKTY
FT                   AIYEDGSRKWIYLSDFTQVIVATDYKTENGNLKVKGEIKDFIPHGVSGDFSAEFLPWYL
FT                   PSGARKVDQESIEQLETRFNEIADYYDTQYGNVSPLEDILTTSYFATQTMLQAVNSFGI
FT                   HFKDTERNLGSGDKTVVESDIQNITRQLDETNVINDIIDDVREWIDSDEKLRESVNYDL
FT                   GYPINSRSFLSDGDIEYWLENFVLIELSTPEVIVEQKKIITERQTTGSVTIVDFASNVS
FT                   ISGDVVTGNTLKTILQRDDIPLNLSEKYSVLEFSWPREVRIGNGGTIRERYRIATRKAL
FT                   SYSKAPVDVNLIYHGQTIRRIWWWIWWKPKIWTKTGLTAYVPSEVDSWSDWSYSGWSGW
FT                   ETIAGGRGRGHTHTYTADVDFYLITDPGNFDNINFSSIAVYKVDSDDEGAYPSFTSTPV
FT                   EVVHRGLMVVEDNVEIGGAGITGGIGKNLGREATVIDGKFTILSREGDISTNGDIVYND
FT                   MLNDPTFRNYFITPGRPFNPDYDPNDAVNNTQTDDMLNLVVADGTIKLPYHNTREWYNK
FT                   VKNIKITANLFAFGKGSRGQIIIEGYQRYAENMGYRHLFGTMVDRDSGAAGIIDRWGNI
FT                   TGFRSRNYYDERLYGNEDMPFATPESNLIRATGISFK"
FT   sig_peptide     506549..506653
FT                   /locus_tag="Kole_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.825 at
FT                   residue 35"
FT   gene            509432..510310
FT                   /locus_tag="Kole_0475"
FT   CDS_pept        509432..510310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0475"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: tgr:Tgr7_2207 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79198"
FT                   /db_xref="GOA:C5CE90"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE90"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACR79198.1"
FT                   /translation="MKLPTHLETSIENLIQQAWQIRVENFPAEIEFVLPKRTKSISVTG
FT                   TYCELNCAHCGGHYLKGMLPLSKNLEDLDYDSFLISGGCDKNGKVPIRPYMQILKKLKQ
FT                   HRRFNFHVGLLDEEDMEGLEEIADVISFDFVGDDATIREVYGLEKTVEDYLRTYRQLKK
FT                   LVRVVPHISIGLRCGTLSGEFKALELLKNEGVDELVFIVFIPTHGTKLAHCSPPPIENV
FT                   LHVLATARIMFPDIPIHLGCMRPGGAYRKQLDPLALRCGINKLVTPAPQAKEEAINLGL
FT                   TIKHGEECCAL"
FT   gene            510307..511260
FT                   /locus_tag="Kole_0476"
FT   CDS_pept        510307..511260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0476"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: tgr:Tgr7_2204 radical SAM domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79199"
FT                   /db_xref="GOA:C5CE91"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE91"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACR79199.1"
FT                   /translation="MIRISVGTAKVMGLTDLQIDVLPTTGYFMIGQSCIYDCAFCSQSR
FT                   TSHTRSDQLSRVTWPEYDLEQVMKHLSTTTDREVIRRICLQVVHQPGIKDTVQKILHRL
FT                   SQSSELPICVCMRVNHVKEAAELIESGAERVCIALDAANPRVYEQIKNGSWHNRMKLIE
FT                   EAAAMFPGHISTHLIVGLGETEKEMVETIQHMYQIGVTVGLFAFTPIRGTRMSKNPSPP
FT                   LDQYRRIQVAHWLIRHGICDGSNFSYKNGSITGFGLSSKELLKHLADGEAFRTSGCPDC
FT                   NRPYYNERPGGPMYNYPRPLTPDEITKAIAELKIKL"
FT   gene            511281..512123
FT                   /locus_tag="Kole_0477"
FT   CDS_pept        511281..512123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0477"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   bha:BH2812 lipoate protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79200"
FT                   /db_xref="GOA:C5CE96"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE96"
FT                   /inference="protein motif:PFAM:PF03099"
FT                   /protein_id="ACR79200.1"
FT                   /translation="MDNEWRFIQTGFQDGAMNMAIDEAILIFHSKGLVPPTLRFYGWSP
FT                   PAFSLGYFQKVERVVDLEKCRLAGVDCVRRITGGRAVFHDKELTYSVIASQRLPQVSGR
FT                   VIESYLKLSKGLLEGLALLGIPAKMVEKPSKKRHTTAACFDAPSWYELVVDGKKLVGSA
FT                   QTRKFGCVLQHGAILLDLDVDKMFELMAFSNEALRNRQKEIFQKKACTIKSVLGREVTY
FT                   DEISQVILTGFKKSLGVKLVPSELTDKELKLASKLREEKYSRLDWSSLDSMKIPDLQI"
FT   gene            512310..514913
FT                   /locus_tag="Kole_0478"
FT   CDS_pept        512310..514913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0478"
FT                   /product="glycoside hydrolase family 38"
FT                   /note="PFAM: glycoside hydrolase family 38; glycosyl
FT                   hydrolase 38 domain protein; KEGG: efe:EFER_2372
FT                   alpha-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79201"
FT                   /db_xref="GOA:C5CE97"
FT                   /db_xref="InterPro:IPR000602"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR011682"
FT                   /db_xref="InterPro:IPR015341"
FT                   /db_xref="InterPro:IPR027291"
FT                   /db_xref="InterPro:IPR028995"
FT                   /db_xref="InterPro:IPR037094"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE97"
FT                   /inference="protein motif:PFAM:PF01074"
FT                   /protein_id="ACR79201.1"
FT                   /translation="MEKKKIRVHVLSHTHWDREWYAAFETFRKRLLNLIDSLIENLPEN
FT                   PHFKHFMLDGQTIVLEDYLELRHQKKDELVEFIREGKISVGPWYILPDEFLITGEALIR
FT                   NFLIGKSVLDKLGIGGNVMKIGYLPDMFGHSAYTPVILKGLGFEGAVLWRGIGDKSRKT
FT                   EFLWKAPNGDEILVINLIRSYSNGAHFGRDIELMKSVFKKEIEELSKHATTENILIMNG
FT                   TDHEFPLFNLPERFQEWSEEFGAKIIHSSLQEYLKSVKSQKPELKTVEGELKDPKYEPV
FT                   LKDITSTRIYLKLMNFEAQLLYQRYLEPLSTLFFNEENSLPNEIEYGWRLILKSQPHDS
FT                   ICGCSIDKVHRDVDLRLSNALEIGLETLGSYLKKLSDEDTSENEKSLIVYNPYERERVT
FT                   VVKGIVALDPSKNYVVVDEEGNICETSIEPLNPLETVDLLHRVGDNDYIQGSSFITQYI
FT                   TAISPNVAFGIKPVRISFMAQLPAIGFKKFTIKESEITRSVDDVSTNFENKFYYFKLNE
FT                   DGTFQAFDKQNNTLYEKMNFFEDVADAGDEYNFSPIPDDRAIASPKNVRMKGVKNRGFS
FT                   KEIDLLVEYEIPEELTNDRKARSERTVTVPIEVKYILFRDEPRIDVKLSLQNNAKDHKL
FT                   MVGFHFPEKLDQVVNDGYFGLVKHPTSVEPDESATEEVTSRYAMESFVSLLGEKGKLLI
FT                   TSRGLHEYETQITNEGLDLKLTLLRAVGWLSREDLLTRKGHAGPGIPTPEAQCIGRYNY
FT                   RYSLRFLGDGSSEEMFDASRRFLLDPVLMETSEDTKIPTISFFELEDGIHLSALKISQN
FT                   KDAVIARFLNVSNVPRKISFRKDVEIVNLAEEPTGKIISEFVLESGKVLTVKSSK"
FT   gene            514970..516238
FT                   /locus_tag="Kole_0479"
FT   CDS_pept        514970..516238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0479"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH1864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79202"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE98"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACR79202.1"
FT                   /translation="MRKFLFALTVVLLSSIVLAGTVEVVFWHNMSNPVDKRAIDEIVQK
FT                   FNETHPNIKVKVVLVPGSETEVTKLMTAVAAGTGPDVYYLDRFTVAQRAHQGVLEPLED
FT                   YLESIGIDTTELRSQFFKFSVDEASYNGKLYALPWDTDVRVLYYNKKLFREAGLDPDKP
FT                   PVTIDELDEYAEKLTIKQGNRYVQLGFVPWFGQGWHYTWGWAFGGKFYDEKTQKLTFAN
FT                   DPKIIESFKWQKKYADKYGMKNLGAFFSMFGAEINPFIGGKLAMVVDGNWFLAQIRNFA
FT                   PKDFEYGVAPIPYPPYGEPNSTWAGGWSLVIPKGAKHPKEAAEFILYMATEGQTIYAVK
FT                   SGHLPTYKAALPKLIESDPAQEAFAEILPTAHCRPVIPVGALLWDKLTEAREYILWGKK
FT                   PVEQALMDAQIEVQEALDKALGK"
FT   sig_peptide     514970..515029
FT                   /locus_tag="Kole_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            516452..517354
FT                   /locus_tag="Kole_0480"
FT   CDS_pept        516452..517354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0480"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH1865 sugar transport
FT                   system (permease) (binding protein dependent transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79203"
FT                   /db_xref="GOA:C5CE99"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE99"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACR79203.1"
FT                   /translation="MPDAMKMTKKTRKNLKIGLLFALPWLIGFAVFTVYPVVASFYFSF
FT                   TEYHVTTPPQWIGLENYHKLFNDILFTKSLTNTLYYVAGLVPLGLLVGLILAVLLVQPL
FT                   KEIVIYRSMIYLPSIVPAFAFATVGLWFFNPYLGFVNSFLSLFGIEGPMWLSDEKWAKI
FT                   TIILLSQWGAGGTALIYMAALKDIPKELYEAAALDGATRWQMFRKITLPLISPATLFYL
FT                   ITSSLAAFQIFDLPQIMTGGGPANSTLSYVMYLYRHAFTYVNMGYASAMAWFLFLLALL
FT                   VTFIIFKTSKRWVFYYGSK"
FT   sig_peptide     516452..516553
FT                   /locus_tag="Kole_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.570 at
FT                   residue 34"
FT   gene            517373..518215
FT                   /locus_tag="Kole_0481"
FT   CDS_pept        517373..518215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0481"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: sme:SM_b20969 putative
FT                   sugar uptake ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79204"
FT                   /db_xref="GOA:C5CEA0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEA0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACR79204.1"
FT                   /translation="MKFGKKTKELLRLNIIRIGLLLVTFVYMLPFLWMITTSLKADQDL
FT                   FLFPPKWIPIPPVWSNYKKAVEYFPFFRYFMNSVIITAGSVVGAILSCPLVAYSFSKIK
FT                   WPGRDFFFYLMLSTMMLPFAVTMIPTFIIFKKLHLVNTLWPLIIPSFFGSPMYIFLIRQ
FT                   FFNTIPDDFIDAARVDGASEFQIYWKLMLPISKPILFLVGLFQFLASWNNYIGPLIYLT
FT                   DEEKYPLALGLPLFLSRYGTHWNWMMAAATLGLIPTIIFFLIAQKYLIEGIKLSGIKG"
FT   sig_peptide     517373..517495
FT                   /locus_tag="Kole_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.509 at
FT                   residue 41"
FT   gene            518229..520376
FT                   /locus_tag="Kole_0482"
FT   CDS_pept        518229..520376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0482"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Gm50; gene model 50, (NCBI)"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79205"
FT                   /db_xref="GOA:C5CEA1"
FT                   /db_xref="InterPro:IPR026071"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79205.1"
FT                   /translation="MRKYILILAFSIILPVFVLGIVTIEIRGYTTSDWTQIEMNSPVID
FT                   GEVIEYKGIGNCQIIPWGIAIHKPQFDESKASFHIKLTFEDFIIEPEVVIKKGDIGETY
FT                   VEIYASLESETVKIATLKNSENIADDPTNRKEFKITLNKLGENTNNDKKTEYERKTPRL
FT                   TLAFYYAWYGTPEGPMGNGRWLHWYGAGMYYQGTNHPEIGLYDSWDEEILRAHMSEAVE
FT                   SGIDGFVVSWWGPGSYETDTIKKMLNIAKELNKKGKRFYISLYYEGYERWATRQETVDE
FT                   LCFALEEFAKDEYFLKVNGKPVIFIYSRAINSLSKEDWEYVVSQVREKCGPALFIADTL
FT                   GAKFAKLFGGLHTYNVCGTFRKLPQMKLGLRFMNFQARKNGIIHVMNIMPGYDDTHVRV
FT                   PGFSVDRENGKLYEELWKLVLNLDPDMVIITSWNEWHEGSEIEPSLEYGRKYLEITKKW
FT                   SELWKERDQTKINKEALTGFFKKQFVPEINLLRASMYVKPDNKRIYIASDNLLAAYALR
FT                   LLNDPLADTIEKELEKYNNGYDEKHEIIIGVKIPAIFYRRYNEYITSEFTEKFGLIDIL
FT                   YEKPDKSVIINSWKNYADLVVYRALNFLLDGNVREAENLFKTLMKMCDGYGFKDKAFKS
FT                   YYETYKTGLMVLLAKRLEKAGSKIADDYRYEIEKAKLILTKTQAPEGGFTVGYEAKSGE
FT                   IIQADDTNTETTSIVTIALLE"
FT   sig_peptide     518229..518291
FT                   /locus_tag="Kole_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.752 at
FT                   residue 21"
FT   gene            520393..522639
FT                   /locus_tag="Kole_0483"
FT   CDS_pept        520393..522639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0483"
FT                   /product="alpha-1,2-mannosidase"
FT                   /note="TIGRFAM: alpha-1,2-mannosidase; PFAM: glycosyl
FT                   hydrolase 92; KEGG: shm:Shewmr7_3384 putative
FT                   alpha-1,2-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79206"
FT                   /db_xref="GOA:C5CEA2"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEA2"
FT                   /inference="protein motif:TFAM:TIGR01180"
FT                   /protein_id="ACR79206.1"
FT                   /translation="MKSFFVSLMLVFSIISPASVLDYVDPFIGTGGHGHTFPGATVPFG
FT                   MVQLSPDTDIKGWDWCSGYHYSDSSIMGFSHTHLSGTGAADYGEIRIMPIVGNLKTLPG
FT                   PKDDPDGGYRSRFRHETEIAKPGYYSVFLDDYGILAELTASTRVGVHRYTFPKTDEAYI
FT                   ILDLYHRIGDMAEKAWVKIVGNDEIEGYITGGHFCGARSPHTIYFVAKFSKPFEEFGTW
FT                   KVFRIEPGNRKEKLRSRSDPFVGAYVRYSTEENEKIIIKVAVSYTGIEGARKNLSEVPD
FT                   WDFDRVKKEAFAAWVKELNKIEVEGKIGDKIKFYTALYHSFIAPNIFSDIDGKYIGPDD
FT                   KVHSADYPHYTVFSLWDTFRALHPLFVLLQPERNVDMIKSLLDIYDQSGWLPKWYKANR
FT                   FTNCMIGTHADSVIADAYVKGLEGFDLQKAYKAMLKNATKTSRCFYEARGGLKYYIKKG
FT                   YVPADRVGEATSRTLEFAYDDFCIAQFAKKLGKLKDYEKFMERSKNYKNVFDRETGFMR
FT                   GRKYNGRWMDENNFDPAKVYKYFTEGNSWQWTFFVVSDMYGLIGLMGGKEAFSKKLDRF
FT                   FSEDSNVDGPPDITGLIGQYAHGNEPSHHAAYLYVYANEPWKTQKMVRYIMDNLYQTGP
FT                   EGLCGNDDCGQMSAWYVFSAMGFYPVCPGTPYYVIGSPIFNKVVVHLNNKRDFEIVAKN
FT                   NSKDNLYISRAILNDKEIKRAWINHEEIIKGTKLVFEMSAKPDFSWGLENVPME"
FT   sig_peptide     520393..520455
FT                   /locus_tag="Kole_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.830 at
FT                   residue 21"
FT   gene            522656..523711
FT                   /locus_tag="Kole_0484"
FT   CDS_pept        522656..523711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0484"
FT                   /product="transcriptional regulator, GntR family with LacI
FT                   sensor"
FT                   /note="PFAM: regulatory protein GntR HTH; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein GntR HTH; KEGG: sus:Acid_4349 GntR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79207"
FT                   /db_xref="GOA:C5CEA3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEA3"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACR79207.1"
FT                   /translation="MTPKAPYKLIIDFLREELKTKYSPGDKIPSENELAKMFGVSRLTA
FT                   RKAVEKLTDEGLLVRIPGIGTFVSEISKLAKNKVTYVGVAIGNVADVRGEAMVSKIVKT
FT                   LRDFSVHAIFVDIGKSYSEDFEKKLSRLLDENVSGLIISPIKNLEESHTFKKFIEKKLP
FT                   IVFIDRTISGFEEIPFVESNNYHGGYLLGEHLKNVHDSKKAIFVTEEGMDIFSVKERYN
FT                   GFKNAFEKHVDVLFVEDIEDMRDKFIKTIKEGKYDSIFFCHDLLALSGITSLMMNGIRI
FT                   PEDIRVVGFDDRIISKYTFPHITTVRQNFSEMGKVAALFMVKLLKGEKIPRAEHIPVKL
FT                   VIRESCGCSTK"
FT   gene            complement(524065..525126)
FT                   /locus_tag="Kole_0485"
FT   CDS_pept        complement(524065..525126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0485"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   dde:Dde_1586 2-nitropropane dioxygenase family
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79208"
FT                   /db_xref="GOA:C5CEA4"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEA4"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ACR79208.1"
FT                   /translation="MKVIKLNIGGLKPKIPLIQGGMAVGISLDNLASAVANEGGIGVIG
FT                   TAGIGMMVGGNRRNFEQASIEGLKRIIRNAREKTNGILGVNIMVALTNYKDMVTTAIKE
FT                   KIDVIISGAGLPLDLPSFLSEGSKTRLIPIVSSLRSAQLIFRRWLKRHNYIPDAFVVEG
FT                   PKAGGHLGYRPEQLDDPESSLERTIPQIRDFTEEIKREYGKEVPVIAAGGIYSSDDVKR
FT                   VFSLGASGIQVGTPFIATEECDADIRFKETIVNAKKEDIVIIKSPVGLPGRAVRNKFIE
FT                   DVEAGKKKPFRCGFHCIKTCNVKDAPYCIAEALLNASKGNLEDGFAFIGAMGYKINKIT
FT                   TVKEVIRKLFKGV"
FT   gene            526135..527256
FT                   /locus_tag="Kole_0486"
FT   CDS_pept        526135..527256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0486"
FT                   /product="Malate/L-lactate dehydrogenase"
FT                   /note="PFAM: Malate/L-lactate dehydrogenase; KEGG: malate
FT                   dehydrogenase ; K00025 malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79209"
FT                   /db_xref="GOA:C5CEA5"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEA5"
FT                   /inference="protein motif:PFAM:PF02615"
FT                   /protein_id="ACR79209.1"
FT                   /translation="MEVVYDDVVWLDFDVLENFMVDVFKALGVPEEDAKIVANVLITAD
FT                   KQGIDSHGVGRLKPIYVERIQAGIQNPITNFEIVRESPTTAVVDGHNGMGHVIGYKAMK
FT                   LAIEKAKKYGMGMVAVRNSTHYGIAGYYVQMAVDEGMIGITGTNARPSIAPTFGVEPML
FT                   GTNPLTFGMPSDEEFPFILDCATSVSQRGKIEVYARAGKEIPEGWVIGEDGKTRTDTEQ
FT                   ILEDLKKGKAALVPLGGIGEETAGYKGYGYATVVEILSAALQGGNFLKMLTGFDEQGNR
FT                   VPYRIGHFFIAINIEAFTELENFKKTTGEILRALRNSKKAPGAERIYTAGEKEYLTWLE
FT                   RKDKGAPLNHVLREQLVQLRDEFNLDQYKFPWE"
FT   gene            527290..528444
FT                   /locus_tag="Kole_0487"
FT   CDS_pept        527290..528444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0487"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating)"
FT                   /EC_number="1.1.1.38"
FT                   /note="PFAM: malic protein NAD-binding; malic protein
FT                   domain protein; KEGG: bar:GBAA4848 malate dehydrogenase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79210"
FT                   /db_xref="GOA:C5CE92"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE92"
FT                   /inference="protein motif:PRIAM:1.1.1.38"
FT                   /protein_id="ACR79210.1"
FT                   /translation="MDLKEKALKQHELWQGKLEVISKAKVETSEDLSIAYTPGVAEPCR
FT                   KIAEDPEKVYKYTMKGNTVAVVTDGTAVLGLGDIGPEAALPVMEGKAVLFKEFAGIDAF
FT                   PICLDTKDVDEIVKAVKYIAPGFGGINLEDISAPRCFEIEERLKAELNIPVFHDDQHGT
FT                   AIVVLAGIINSLKIVQKKPNEMKVVINGAGAAGIAITKLLIKFGFKHIILCDKPGAIYR
FT                   GADWTNPAQTKIAEITNPDNVKGTLKEVIKGADLFIGVSAPNIVTEEMIASMNKDAIVF
FT                   AMANPVPEIMPDKAKAGGARIVGTGRSDFPNQVNNVLAFPGIFKGALKCRKQITDKMKI
FT                   AAAYAIAGMIPESELNEENILPKPFQPGIADAVAEAVIKAAEEE"
FT   gene            528463..529245
FT                   /locus_tag="Kole_0488"
FT   CDS_pept        528463..529245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0488"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="TIGRFAM: CRISPR-associated protein Cas6; PFAM:
FT                   protein of unknown function DUF57"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79211"
FT                   /db_xref="GOA:C5CE93"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE93"
FT                   /inference="protein motif:TFAM:TIGR01877"
FT                   /protein_id="ACR79211.1"
FT                   /translation="MRIKVILKEAKNKAFKRDHYHQLAGMIYNMIRKSNPEFSSWLHEK
FT                   GFMDGNKKFKFFCFSRLIAPRNHYEYIGENKELILFKTDQVSLYISSPVEEFLTNLIEF
FT                   FLAEDYVKLGDHTLKVDSARALTTPDFGDKTVFKAITPIVLSKRVEGYNTPFYIRAYQS
FT                   PDEFDEYLTKNAKEKWKIFTGQENADISLQVDRTYLEKKGKRTSCKINLSPNQTIIGSV
FT                   VPVIAIGDSEIIRFLYDVGIGQKNSLGMGMVELAGYKY"
FT   gene            529285..529443
FT                   /locus_tag="Kole_0489"
FT   CDS_pept        529285..529443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79212"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE94"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79212.1"
FT                   /translation="MLYKIRDPRPEIREGCFAADTNPFGIGTNSCGVVSNHFVVVINCF
FT                   AVEKIDT"
FT   repeat_region   530300..530659
FT                   /rpt_unit_range=530300..530330
FT                   /note="CRISPRs"
FT   gene            complement(530970..532361)
FT                   /locus_tag="Kole_0490"
FT   CDS_pept        complement(530970..532361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0490"
FT                   /product="ATPase"
FT                   /note="PFAM: ATPase; DUF234 DEXX-box ATPase; KEGG:
FT                   sat:SYN_01513 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79213"
FT                   /db_xref="GOA:C5CE95"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CE95"
FT                   /inference="protein motif:PFAM:PF01637"
FT                   /protein_id="ACR79213.1"
FT                   /translation="MFIGRRMELEKLDRLWKKGNFQLVVVYGRRRVGKTTLLKKFSEGK
FT                   NSIFFVCDEVNEKVMLDSFSKFVLEHFGLSETIAPFESWEKVFRFIGERARKEQLLLVI
FT                   DEFPYMVNASPEVPSLLQRMIDHEFANSKLFIALCGSSIGFMEKEVLGSKSPLFGRRTA
FT                   QFKIEPFNYLEASNFFPSLGAEEKVITYGILGGVPQYLLKWDEALSIKQNIMNNFLDTS
FT                   AYLYEEPRFLLKQELREPALYNAIIETIAFGASRLNDIANKIGQRNDKTGKYIKILMEL
FT                   EIVGKEIPVTEKENSKKSLYFIRDELFRFWYTFIFPNRTLVETGMSEYILNSKILPGLS
FT                   EYTGKTFERVCADFVKRKNAKGEFTVRLEKIGRWWGNNPFKKRQEEIDIVGLGNEGMLF
FT                   GECKWQNRKVDISDLNKLVEKSELFNTEKKIYVLFSKSGFTYKLLERAKNDETIRLYTL
FT                   EELFE"
FT   gene            complement(532699..533991)
FT                   /locus_tag="Kole_0491"
FT   CDS_pept        complement(532699..533991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0491"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: bxe:Bxe_B2763
FT                   putative transposase IS110"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79214"
FT                   /db_xref="GOA:C5CEG8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEG8"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACR79214.1"
FT                   /translation="MDIVGIDWSWNFHTCYSIEQDKVFKIKDGIAGYEKLLKRVSKDAV
FT                   FVIEESFNRLGDFLLSRGKEVYLLPPKRSKEARGYHSNGVKTDSTDARCIALTYKEHPE
FT                   YCIKATHDELGMLFRELLRHYRYYTDMASRLKNKLQNELHNYFPEYARVMGNSWTDCDG
FT                   RIFLLTICPDVTELRKISDKEINRHFKANHLRYTSSLKRKVKELREKAIDWGMSKYTRD
FT                   MIANVATQLLEAKREKKKITKEMEKELRKSKYNIILTLPGVGVATGVALVTAFLTHEFK
FT                   NYRDFQKYCGTMPIVSQSGNFRMCRMRKNCDKKLRGILHMMAINAKKCGAWMKGYYDKK
FT                   TNKEGKKPSLALRALANILVKIAFAMLRNLKAYDEELFLSSRGNKSPRLNYTTRNSIPG
FT                   TKKMTKEKLSLPVSVAQTNCHLGTVSGSLSP"
FT   gene            complement(534222..534779)
FT                   /locus_tag="Kole_0492"
FT   CDS_pept        complement(534222..534779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0492"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79215"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79215.1"
FT                   /translation="MKKVFVLVVLVISVVGLGYRVTTVSWYDNGLEDYRYRLECLTGEK
FT                   ATETVYTVIVADSTGEFCRLSGLPYWVLAGVRDDTIFMQPLSLNYDPIRSIAHELSHIA
FT                   FRKYGFPYWVEEGLVCIVTCEWMGANIKELADIETVEPSKLDFYSYQKYSFTAWKRVSL
FT                   LLQEHTFEELVKFFSESGGGRF"
FT   gene            complement(534776..539263)
FT                   /locus_tag="Kole_0493"
FT   CDS_pept        complement(534776..539263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0493"
FT                   /product="alpha-2-macroglobulin domain protein"
FT                   /note="PFAM: alpha-2-macroglobulin domain protein;
FT                   alpha-2-macroglobulin; KEGG: ppd:Ppro_1300
FT                   alpha-2-macroglobulin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79216"
FT                   /db_xref="GOA:C5CEH0"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR041246"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEH0"
FT                   /inference="protein motif:PFAM:PF01835"
FT                   /protein_id="ACR79216.1"
FT                   /translation="MKKSVVVFLLVMLTVMAFSFTVRDYVKRVNDIIVEFKDAKEIPAI
FT                   YPEEYDGTIVISIYELKPENIFGVKKISDVIIPAKPAKVIKVQSHPGMKIELPFEDLKG
FT                   INYVVIDSERMTERFIMLYRNLSPKVVATENQLLIATWNRETGKLVEDLKVYRLEDGSL
FT                   LSESGVDGVVEITDMIDENRTLLFASKEGYFLWKPGKLSESVPSSTMVFVFTDRPAYKA
FT                   GETVNYRFFFRTITSKGYSLAENLENVNLKILDPLNREVFKKDIALDEFLSYTGKFETN
FT                   SEMLRGSYKLVLNWKKDDKNQEYVYYFKIADYKKPTFKAEVEPTRRYFQKGSPITVRVS
FT                   ASYYYGDPVIRGEVVYTILQNGRFIDTGKTFLDNKGRTVIGYGKELEPGDYTMMVTVSD
FT                   DTGMESQYQIPFSVVTAPYRFQVEYTKEDSQIVFDVKTIDLDNSPVSKTFEAKVWYLLK
FT                   YYEKINGEYKEKKLKVYIYDFKMKTNESGGVRFTVPLENLPVDKDVYLTLIGEDGAKYE
FT                   VRLDYKDELVSSEKKTLLSIKKIPDAVPGKPLEIEFEASKETDVWFVADFSGVLYSKVV
FT                   TAKRGKNTVLLDIPESYIFGTFALEVISFLEDKNTTYEKKTIVKVKDQKGYYRLSIHNE
FT                   PVYLPGSQVSLKLKVTDNNGKPVETSFTVAVVSQALLDVFEKGRDSWKETLGSGVQNSF
FT                   VTMRFLDLDTVKNSFYPSISNLINYTSDYYIAAESKVFRPVLTEIGSNANYLPPTVEEQ
FT                   IRKDFSDTALWQVVGISDSSGVATITFTLPDNLDKWTIRALAAMKDGSFGYSNSEFETK
FT                   KPVDVISYLPEFFISGDEAYLSFLVNNHTDQDIKGRYFFELEDCIKQSKEISIEAGSAA
FT                   TLRFKVRIKEIPPLTSDEATLRFVFTGGQFSDGIEKKIRIKPRFVQREQSYKLFMKSER
FT                   EIIVPDNFKGELIINNDLNRELFSAIKYLVKYPYGCVEQTMSKWLPLIAAKRLLSYGDK
FT                   SFRKKVDEYLDYGLKRLYGFQHYDGGWGWWKDDSSDDFMTAYVMYGFYLAEKADLKIND
FT                   SVQKMGFDYLKRNKSNPFAQYVISLYAKRYNYEFKPYLPKKDPASVILIALAFCETGDK
FT                   AAAQEYLRTLWDSIDLESNRIFKNTFNYFFDDTVTLSFLLELLQKLDYPDESITAVANK
FT                   ILSLSIGGRWSRTISTALAVMELSTFGERSLYEDTKVAVRQGDKVLFDDTVHAGEQISI
FT                   PLKTGKFIVSVSEPIWLNLIGDFYYPMEMMKAMGNGFKLTRVFRKVEYVEEGTEKGQKL
FT                   EVEIDSPYRIYSINRFNPGEYEELSLNPVVVIDGQQVHFNDGELMIGDNHLGWFLMRPE
FT                   ILGVNEEGIFVRDEAEESYYIVKIKERTPELKVGDLIIVETDISNKKYLPYVVIEDPVP
FT                   SAALVTDTSVVGARREWFYDKFYTYRYPDASFIERRFDRAAYFFRYISKNTIRTSYRLI
FT                   APGVYIIPPAKCWAMYEEEFFAFTEGAVIEVKER"
FT   sig_peptide     complement(539204..539263)
FT                   /locus_tag="Kole_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.531 at
FT                   residue 20"
FT   gene            complement(539260..540225)
FT                   /locus_tag="Kole_0494"
FT   CDS_pept        complement(539260..540225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0494"
FT                   /product="protein of unknown function DUF1175"
FT                   /note="PFAM: protein of unknown function DUF1175; KEGG:
FT                   ecz:ECS88_2377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79217"
FT                   /db_xref="InterPro:IPR009558"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEH1"
FT                   /inference="protein motif:PFAM:PF06672"
FT                   /protein_id="ACR79217.1"
FT                   /translation="MFAFVAIFSFVYLSVERVVKTDLDVSCGSRVGSLLVVSAPTCPFE
FT                   QIDSLSYAGVTLEEKRVLPDKNIYLFRVIAKDVSISILYNREIKHRKSVQLHFESWKDD
FT                   NSDGFPDELVLKGEDSYILRSWFVNIALCQSLQLSPNWRENQRDCAGLVRFAMKEALKH
FT                   HNKKWFQETGIDPEIWLEKTGVDLRSIPDVSAYNYPEAPVGGTNIFVVGKDRLSSFATA
FT                   YAILKYNVNFVGFDLSAALPGDLLFFHNPNPVTFHTMIYTGEGLVYHTGPVSEEDPGKI
FT                   KLWRLDDYMRIMPIQWLPIRENTCFLGIYRLKILGEGEIR"
FT   gene            complement(540544..541716)
FT                   /locus_tag="Kole_0495"
FT   CDS_pept        complement(540544..541716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0495"
FT                   /product="acetyltransferase involved in intracellular
FT                   survival and related acetyltransferase-like protein"
FT                   /note="KEGG: bha:BH1812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79218"
FT                   /db_xref="GOA:C5CEH2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEH2"
FT                   /inference="protein motif:COG:COG4552"
FT                   /protein_id="ACR79218.1"
FT                   /translation="MYEYRKSEDVEALMEIAKFSFVVEKSKHEFLRKYIRTALVSGVEM
FT                   FGVYDSKKLVAAHLLYPYQMRFRNSMVSMGGISKICSRPDYRGKGTIRFMLEKSIETMR
FT                   DKGMVVSMLHPFNVSFYRKYGWELFFRKKLVLLSPGSLIAKENPSITAEYLKFPDEVCK
FT                   EFYNEHARREYNLALRDDPHWKRHLELSNNEAANGVVKFERDGKIVGMMALYLSSGEAM
FT                   FESIVTVKDFIYNDNETKETMLNYLKRLSLQVTKLRMVLPEDFLLWPYLSDQPSEEKIG
FT                   NAGMIRIVSVEKLDGLSVDFELEPLIVSVNDKFSEENTGNFEIKAEGGFLRISRSTKSP
FT                   DIECDVSCLSSIISGFTSFKEMIEAGRVQVFEDYRGQDLPKVVTFNLEPF"
FT   gene            complement(541869..543116)
FT                   /locus_tag="Kole_0496"
FT   CDS_pept        complement(541869..543116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: baa:BA_3344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79219"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79219.1"
FT                   /translation="MINNEEKIIETLKRINKIIEDEGIRKKYWFDYPKLPVALYNDEKI
FT                   FLVGYPGKPAGFEESDGILIGKKDERFYGNTAKDLEGQQVAIWDLTTISPTVSFERFLS
FT                   LIFHEGFHGYQKSVGEKRWANDLQVLDYPFTPMNLAVRFLERRELLRATFADEKREFEE
FT                   RLSSFIAIREFRRKLIGDALNYELAQESVEGVAVYVETKAYSDFGSIPLKYAIAYQANG
FT                   MSEFPASLSSFRLSCYAPGMCLAFLLDRFQAGWQKDYMESGEYIYDFLKKLSGLSFNNF
FT                   SEDSVPSEVLENAGYILDKHRKYIDEEFRNFENSAGYRITLKGIFPLMGMDPMNILWKE
FT                   DYIINKYFFATQFKGVPVFLKQKSMVKRIEKSFTFSEVVFYLPEKPVQNGDKVEIPGIG
FT                   VFPARLEEDVRGFAVV"
FT   gene            complement(543113..544420)
FT                   /locus_tag="Kole_0497"
FT   CDS_pept        complement(543113..544420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79220"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEH4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79220.1"
FT                   /translation="MIFVVVEKGGNSVTNDFSGLIKQLDTLESIKKLFRIQQKQAELGG
FT                   GFYGVIPDPIENPEQIPIPDTPDKFLDLLSYLSQIRDEQRKIVAGTGFPVDFLGRNYVP
FT                   KDVKSSGRIKIILDLHAVREVLEYFAKENPTLEEAREIAGGEIFTEMIKHRNSLGYVPG
FT                   PEFTTEFLANFLFFAANKESIYEIWKQLNPWNFFDFADIACNRDDYERVLNELEENKDN
FT                   IEARISARIEKYVPEDFEFQERFVFSVGWAIRGWATGKYGGINIEHIKDNYDFLLDIII
FT                   HETFHRIQAILYPGNKGKEFRMLEKPLKDKGKDALYKAITYVFLEGSATYVQKGDFPVE
FT                   DISDVQAGVELFKDLYNTIFQQKKYNELEKFLNRGLRSNGPFYALGHYMSYIIDKKYGN
FT                   KAIADCLKKGSQEFFKLFADTEEGRIFPEEIKEVLL"
FT   gene            complement(544438..545610)
FT                   /locus_tag="Kole_0498"
FT   CDS_pept        complement(544438..545610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0498"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bha:BH1812 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79221"
FT                   /db_xref="GOA:C5CEH5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEH5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACR79221.1"
FT                   /translation="MYEYRKSDDVEALMEMAFFSFAVKRTEQELIKRFIDTGLSSGTEI
FT                   YGVYDSNKLVAAYLLYPFQIRFRNSMIPMGGIGLVCSRPDYRGKGTIRFMLEKSIETMR
FT                   AKGMVVSMLYPFNVSFYRKYGWELFFRKKLVLLSPGSLIAKENPSITAEYLKFPDEVCK
FT                   EFYNEHARKEYNLALRDDHHWKRHLELSNNEAANGVVKFERDGKIVGMMALYLSSGEAM
FT                   FESIVTVKDFIYNDNETKETMLNYLKRLSLQVTKLRMVLPEDFLLWPYLSDQPSEEKIG
FT                   NAGMIRIVSVEKLDGLSVDFELEPLIVSVNDKFSEENTGNFEIKAEGGFLRISRTTKSP
FT                   DIECDISCLSSVISGFTNFKEMIEAGRVQVFEGYRGQDMPKVTTFNLEPF"
FT   gene            complement(546277..547532)
FT                   /pseudo
FT                   /locus_tag="Kole_0499"
FT   gene            complement(547939..548169)
FT                   /locus_tag="Kole_0500"
FT   CDS_pept        complement(547939..548169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79222"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEH6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79222.1"
FT                   /translation="MALNHRRRIRYSIHEPCTLARTHGSVRGRGDSPLLLDPDFVRGKH
FT                   SSGVGENFFAVDKRLRRIEPKERKSLNTFRK"
FT   gene            complement(548327..548440)
FT                   /locus_tag="Kole_0501"
FT   CDS_pept        complement(548327..548440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79223"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDK9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79223.1"
FT                   /translation="MSDGGNRNRKGLLLAKGGRVEEMAQREANITGARNGG"
FT   gene            complement(549123..550379)
FT                   /locus_tag="Kole_0502"
FT   CDS_pept        complement(549123..550379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0502"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bar:GBAA2664 permease, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79224"
FT                   /db_xref="GOA:C5CEH8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR022324"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEH8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACR79224.1"
FT                   /translation="MKNPLRNFWLYAMGRLVSLIGSGIQSLALSLYVLDLTGSGTMMGT
FT                   FLVMSMIPRVVFAPIAGVIGDRFNRKAIMVYMDFARGVLIFLLAFMAYRGTLSLSIIYI
FT                   SQLIMSIMDTFFDPATSAMLPDIVPEENLTRANSILGAINSISYIVGPAMGGVLYPLGI
FT                   GIVFIINAASFIVSGISEIFIHYRQTTEKKKMSAGQFFEDLKGGFAFLKERSDISTVML
FT                   FAMITNFLLTPVLVIAIPYFVRTVMGFSSQQFGIFRSSGVVGSLIGNLLIASFLSKSKP
FT                   GKLFDIGLFGQIITFFIINILMFPWGAKFFGGATWLYLGTLAIVFMSTGMLNAFVNTPL
FT                   SVFFQKTIPTDVRSRVFSVLSVMSQLIVPLGTALYGFLVDHMPVHYLVLIALIMTVIAT
FT                   IPFLMAGKLNILRKETSCA"
FT   gene            complement(550647..551249)
FT                   /locus_tag="Kole_0503"
FT   CDS_pept        complement(550647..551249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0503"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   dol:Dole_3091 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79225"
FT                   /db_xref="GOA:C5CDD4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDD4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACR79225.1"
FT                   /translation="MTKTCKTHTAQRRRRTGKYKDPQSSWTKTTKGWEYGRKVHMSLDA
FT                   QNLLIQDWMTTPAAVHDSTVAKAQIDSGQGYKYFLADSAYDSQQIYRYIFDCSSMIPVI
FT                   DTNKRKGVSLEKQCQARWLGIQLRQIYAEKYKNRWEIERTINILQEYFNLEYIWYVRNR
FT                   NYDAVLGLAILAYNLCVMFNILNSRPHRKVADIIGCY"
FT   gene            complement(551233..551613)
FT                   /locus_tag="Kole_0504"
FT   CDS_pept        complement(551233..551613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0504"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79226"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDD5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79226.1"
FT                   /translation="MVPQELTKSDIVKIIEQLDKLLPSNFVNKQGRGRRKAYSDKSILK
FT                   LSILLKLCDVSYRGAKNFLEKNPKYMELLDLKNIPPFQTISRRVRELPLHRINKDVVNL
FT                   FLDIEGLERIELVVDSFRDQDL"
FT   gene            551927..553021
FT                   /locus_tag="Kole_0505"
FT   CDS_pept        551927..553021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0505"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase;
FT                   3-dehydroquinate synthase; KEGG: vvy:VV0158 glycerol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79227"
FT                   /db_xref="GOA:C5CEI1"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEI1"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACR79227.1"
FT                   /translation="MISTTIFPGRYVQGSGALERLGSEMVRFGKKGFVICDSFVLENLL
FT                   PDFRQSMEQSLEVVVEKFGGECSDEEISRLADLAKGAGCELIVGIGGGKTLDTAKAVAY
FT                   ELKLPVVIVPTLASTDAPCSALSVIYTPNGEFKRYLILPKNPDLVLVDTKIIAQAPARF
FT                   LVSGMGDALATWFEAESCMKKYAKNMTGNVGSMTAYALAKLCYETLLEYGVAAKSSCEA
FT                   NAVTPALEHIVEANTLLSGLGFESGGLAAAHAIHNGLTVLEQTHKYYHGEKVAFGTLTS
FT                   LFLTDKPREIIDEVYSFCESVGLPTTLADIGLDGVSDEELMKVAEAACAEGETIHNEPI
FT                   PVTPEAVYSAIKTADAEGKRRKAV"
FT   gene            553128..553424
FT                   /locus_tag="Kole_0506"
FT   CDS_pept        553128..553424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79228"
FT                   /db_xref="InterPro:IPR019254"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEI2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79228.1"
FT                   /translation="MKALPWEILEEEDWKILKDLYSTAPDCAKFLSRRLRLDLGETMRR
FT                   LRTLESKGFLERVEGRFLKKKGLRKPKHMNHTYYELTRPARLYLRKILFEEQK"
FT   gene            553543..553725
FT                   /locus_tag="Kole_0507"
FT   CDS_pept        553543..553725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_0885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79229"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEI3"
FT                   /inference="similar to AA sequence:KEGG:Dde_0885"
FT                   /protein_id="ACR79229.1"
FT                   /translation="MEDKKEVVFEALKKAGKPLRPGDIAKMTGIDSKEVSKVIKELKSE
FT                   GKVESPKRCYYAPKD"
FT   gene            553966..554940
FT                   /locus_tag="Kole_0508"
FT   CDS_pept        553966..554940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0508"
FT                   /product="Poly(3-hydroxybutyrate) depolymerase-like
FT                   protein"
FT                   /note="KEGG: scl:sce5021 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79230"
FT                   /db_xref="GOA:C5CEI4"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEI4"
FT                   /inference="protein motif:COG:COG3509"
FT                   /protein_id="ACR79230.1"
FT                   /translation="MKHLYAKVVIVFLVVVLSVSSFCGIFDEADLLPGTHSIFFNYSGH
FT                   QRHFYIHIPEKKRYEKYPVVIMLHGGVSNSKFSMKRFGWMELSDKEGFIAIFPDALPPI
FT                   GGSSPDNTIFRPQSWWEGLNIDPRKLVFNDSVDDVGFIATIIQELKSEDLIDEKRVFLT
FT                   GYSNGATMAMFLGLKLSNVIAAVAPVCGLYVPKDQQKISSPISVMVIIGMDDPFNPYYG
FT                   GLILPPWSIKIVKKPPVETTIMKWVNLLGLPEQPVEQYENEDEKFVLYSNGETDFYFHV
FT                   FKKLGHFWPQADLDYPLWYFGGRYDEINATEMIWEFFKKHPKR"
FT   gene            complement(554966..555658)
FT                   /locus_tag="Kole_0509"
FT   CDS_pept        complement(554966..555658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0509"
FT                   /product="aspartate racemase"
FT                   /note="TIGRFAM: aspartate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase; KEGG: pol:Bpro_4755 aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79231"
FT                   /db_xref="GOA:C5CEI5"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEI5"
FT                   /inference="protein motif:TFAM:TIGR00035"
FT                   /protein_id="ACR79231.1"
FT                   /translation="MAKHIGIVACSAEGAALCYRTICIEGENLIGRKYAHPEITMHTFS
FT                   FEEYMQYIEAGDWQRVADLMVASAHKVAKTGADFAICPDNTIHHAFDLVVEKSPIPWLH
FT                   IAEEVAAEAKRKNYKCLGILGTRFLMESPVYPAKLDAAGIGYRIPETKNRERINEIIFN
FT                   ELVYGRFYPESRAYFNEVIGKLKDQGCDAVVLGCTEIPLLVIPEESPLPTLDSTRILAR
FT                   AALKKALE"
FT   gene            complement(555708..556994)
FT                   /locus_tag="Kole_0510"
FT   CDS_pept        complement(555708..556994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0510"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: gur:Gura_3277 FolC
FT                   bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79232"
FT                   /db_xref="GOA:C5CEI6"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEI6"
FT                   /inference="protein motif:TFAM:TIGR01499"
FT                   /protein_id="ACR79232.1"
FT                   /translation="MDYKEALDYLYSLRRFGIKPGVRRIKMLLELLGNPQDSLNVVHVA
FT                   GTNGKGSTVAFISSILKEAGYRVGTYISPHLIDFTERMTINGLQIKEEVVVEILNKIRP
FT                   HITEVANSKFGSPTFFEVVTAMAFVYFKQQKVDFAVLEVGLGGENDATNVVKPLVSVIT
FT                   NSDYDHMDILGNDITSIAKEDAGIIKENGFVVTAAEGEALDVIKKIGEEKRARIYQIGR
FT                   DIKYEFVNSDLKWQRFNVKGIFSESDNLKIPLLGKYQLINASCAVGAIEILRFYDIEIS
FT                   DESIRKGLENTFWPGRFEIVQDAPMVVLDGAHNHLAAKRLKEALMEVLEKKDKLILVIG
FT                   IMKDKEVEKIVKELAPLAYKVVATSPKTPRATTSHDLREIVVKFNKNISVVEDVETALE
FT                   LALSEAKENDIVCVTGSLYTVGEARKFLL"
FT   gene            complement(556984..558450)
FT                   /locus_tag="Kole_0511"
FT   CDS_pept        complement(556984..558450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0511"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: Mur ligase middle domain protein; cytoplasmic
FT                   peptidoglycan synthetase domain protein; KEGG: bsu:BSU15180
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79233"
FT                   /db_xref="GOA:C5CEI7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEI7"
FT                   /inference="protein motif:TFAM:TIGR01085"
FT                   /protein_id="ACR79233.1"
FT                   /translation="MEMVLRELIKDLKEKRVEGRQDLVIRGIECDSRKVEEGFLFVCIP
FT                   GFNFDGHKFIPEAIKRGSRVVVVEKDVKTAKDVTVIKVPNTRYALAVLANRFYGYPSKK
FT                   LQVVGIAGTNGKTTTTYLVRDVLKKAGKKVALFGTIEYDLGNRTLPASTTTPQSLELQA
FT                   MLNELVNKEFEYVVMEVSTHATVLDRVTGCEFDIGVFTNISRDHMDFHKTMENYLEAEI
FT                   KFFRLLSRTGRRAVINIDDPYAEHIIKNTRTEILTYGINDKNADIRAFDIKVSKTGSRF
FT                   NVITPLGETVFYLRLPGRYNVYNALAAVGVGISEGLNLNEIREAIAHASVPGRFERIDC
FT                   GQSFDVIVDYAHTPDALQKALETARGLSEGRIIVVFGCGDDKDRRPLMGVVAARMSDIA
FT                   ILTSDNSRNEEPSEIISDIESGIKKVDNSFQYLVIEDRFEAITQALEMAKEGDLVLIAG
FT                   KGHEEYQIIKDRKIPFNDRKVAERILKNGL"
FT   gene            complement(558465..559871)
FT                   /locus_tag="Kole_0512"
FT   CDS_pept        complement(558465..559871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0512"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase; PFAM: Mur
FT                   ligase middle domain protein; cytoplasmic peptidoglycan
FT                   synthetase domain protein; KEGG: sat:SYN_01742
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl- D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79234"
FT                   /db_xref="GOA:C5CEI8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEI8"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ACR79234.1"
FT                   /translation="MEPISLSKIIEATGGTLLSGTPDVEIFGISTDTRTIHKGDLFVAL
FT                   EGERFDGHYFIDEAFKKGAIGAIVSREVESKNIIIKVRDTLKTLGDIAKIYREEFDIPV
FT                   IAVTGSNGKTTTKEMLGYILTREFKTVKAKGSYNNFVGVPLTLLEMDRHTQLAVLEMET
FT                   NLLGGIKRLCEIAKPSVGVVTNIGDTHLQFLKTREGVYQEKSELVESLPEDGVAVLNAD
FT                   DPYVLKMKEISRTKRIVTFGVENKSEFSASNIRVGDTFLEFTLNNNYRVKLNTISYCNV
FT                   YNGLAAIAVSHVVFGLSLEKVIDILKDFKFPSLRMELIEIPLIDRATSNEESVRIINDC
FT                   YNANPQSMQEALVAVGKMNSYTNKIAILGEMLELGEKAPEFHYQIGKICADCGFDMLIT
FT                   VGDLAQYMAHGAEDEGMPRENIFVSVNNVEASDRLLRILRPGDIVLIKGSRGMKMEEIV
FT                   ERLRKRLGVF"
FT   gene            complement(560338..564183)
FT                   /locus_tag="Kole_0513"
FT   CDS_pept        complement(560338..564183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: DNA-directed RNA polymerase, omega subunit
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79235"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79235.1"
FT                   /translation="MKKIVVVMFFLLFCFCAFSASNDALQYRINITSELNKSYLKTIQG
FT                   IINYNGLFKSGRDVFLEMLYSKDPLLARFQKETQEAVRKMQEARSRGASSEEILRLQLE
FT                   YQEARLRENKQLTALIESNLYNSIDYLASETLKGSMKTAGKVIDDVLSNWKTILEPLLE
FT                   GDFGGVVKNAILQLIDSTYKVTFIDYCKRNYGATEKIAQYWWKTYFVEPFETSEEKKLV
FT                   DKVLTKASDDLKDKLKDRLTKRLELEILSKGGKLTKEAIEKTVKEKAESILKNIIETPS
FT                   LLVELFTKYYNVVDFQIMFNDIAANEVVFIKKIRELVGDNEDEINKCYFDKAYFLSKIK
FT                   ALNKGKIQVQGKKEPSKKLAKSEEVIPAEVIVKAEETARTHDPLREVSTIQNIEDKIET
FT                   LSELQVEEKIPSPDNAKQIIEYAFGQLENDEITLSAFTYEVNQVVSSYISQMNEAKAKI
FT                   ASALKMDYNKGLIDWNEYSEKVKSINEDVKQNLEELNTFISSKKQEIERNQKAFRQKLS
FT                   QLIRSFNPGNEMKLIQDKLSTKIVEFLKLYKQKTGQYVSIYPYSSFSAMMKEFNEGFGQ
FT                   SFINQLTSKAPSLFLLQNGGWILENLLGICYEDEHLTGTLIEKVNSLSEKINALFDSVP
FT                   EYYYTDRDGRIVYSRDLASIEAFKKSLLGRMKGTLDWKATVSQWAYMAELKNEKTKQYL
FT                   EVYLAFLTQKVELFQNMLQIVVDGFNSLEPLYMEKWVSKIEQMAYTIRNMWEQKITPDE
FT                   ARNKLRKISQITKDVDSKYAYWLETRDVLEAIASDVYRIKSNGVAMLNFEPSKKYSDYI
FT                   NSLIVKNNQLKKRASQMIEEYEKASLFDYTHDLKTRVLDFVSKYRSYLGHGFCAQKAGI
FT                   SFPLGPDDPDIMGIVGGDLEKALNLCERYEQFLEMAEKREKAAKEADRVLDSYLDKIQA
FT                   EVEAIEKAGGYTTSEKKEELIRLLAEAVEKATETFKSYGFEYSNWSSSRERNLRSRIEN
FT                   IRVLESNVGQSVGKTTNKFREIEKPEKITLGDLVWLNVMKDGYPSYRFRLSPDGKKLLI
FT                   ERNNNSGNSFSLYNIETGTLDEFPLSEPVKAILSKGYNFDWISEDKIYLYAYSGEGFEI
FT                   DKSGSYKDRPVTTIKGMGLVLQGISPSGEYILARKLDGGIYVLKISDATIEKIGITYAD
FT                   KILQWVPGTDSVLFKDQNSKLNIYDVKSRTLKTYETTFEGYVCAILPGGKWIVYGNPFE
FT                   VVAQNLNDSQKITLWKGEGGANILTGIYPLQGNTVLLVWMHHGESFDYGVQVCKIE"
FT   sig_peptide     complement(564124..564183)
FT                   /locus_tag="Kole_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.674 at
FT                   residue 20"
FT   gene            complement(564347..565486)
FT                   /locus_tag="Kole_0514"
FT   CDS_pept        complement(564347..565486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0514"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   aha:AHA_3839 transporter gate domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79236"
FT                   /db_xref="GOA:C5CEJ0"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEJ0"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ACR79236.1"
FT                   /translation="MENVKKKKIIEPILLLLFLSLFLFLFGSRMGLGNMFKTIMYTAHD
FT                   LLLNTVFFIMAVAVLTGALGGLLSEFGVVEMLNKLLSPLMKPLYNLPGAAAIGIVTTYL
FT                   SDNPAILSLVKDRNFIRCFKQYQLPLMCNLGTSFGMGLMLTTFMIAQSAIAGYSLLVPA
FT                   LVGNVAAILGSVVSVRIMAFYTKKAFRHSAAFGDIELTDSTLSHTDKGLFERFMDAVLE
FT                   GGKSGVELGVSIIPGVLIISTFIMMLTYGPASPEGYSGVAYEGIAVLPWLGERLFWVLK
FT                   FLFGFSSPELIAFPLTSLGSTGAALALVPKFIADGVLMPNDVAVLTAIGMCWSGYLSTH
FT                   VAMMDSLGSRQLVGKAIFSHTIGGISAGVFAHFVYVLIS"
FT   sig_peptide     complement(565391..565486)
FT                   /locus_tag="Kole_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.578 at
FT                   residue 32"
FT   gene            565861..566199
FT                   /locus_tag="Kole_0515"
FT   CDS_pept        565861..566199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dal:Dalk_3208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79237"
FT                   /db_xref="InterPro:IPR024227"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEJ1"
FT                   /inference="similar to AA sequence:KEGG:Dalk_3208"
FT                   /protein_id="ACR79237.1"
FT                   /translation="MRAYCGIDCFRCPVYIATVNNDDKLREETAKKWSKEINLEITAKD
FT                   LVCYGCKSSQTWKMCRDCPFVKCCKGKGLDNCGECDSYPCAEINKFLKNLPEESAFLDQ
FT                   VHKQRFPD"
FT   gene            566247..566654
FT                   /locus_tag="Kole_0516"
FT   CDS_pept        566247..566654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79238"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79238.1"
FT                   /translation="MEKAFLLHLDKIQPSQLYISQAKLKRVLDIIEKEGFEALPPIPVI
FT                   RLKGFIIYTDGHTRAMAAYLSGLEEVLVYWDEDELDLQAYEICVDWCLDEEIKSISDLK
FT                   DRIIPHSDYEILWYERCRKMQEDLENKKERR"
FT   gene            566661..567005
FT                   /locus_tag="Kole_0517"
FT   CDS_pept        566661..567005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sml:Smlt1976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79239"
FT                   /db_xref="GOA:C5CEJ3"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="InterPro:IPR041595"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79239.1"
FT                   /translation="MNFWERFEAFITEHEIVIDRPKGSQHPKYPQIVYPLDYGYLKGTT
FT                   AGDGSGIDVWIGSMDERKITGVVITVDSLKRDSEVKILIGCNEDDKKKILKIVNNSHMS
FT                   GIIIDNPIIE"
FT   gene            567135..568367
FT                   /locus_tag="Kole_0518"
FT   CDS_pept        567135..568367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0518"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: mmr:Mmar10_1566
FT                   LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79240"
FT                   /db_xref="GOA:C5CEJ4"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR022170"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEJ4"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ACR79240.1"
FT                   /translation="MQFVLLIGFVVMLLCVLFAMQNLKKKRLIDDTPTSKVKGVFIGLV
FT                   ELKGKVKTTRPLTSYLTEKPCVYYRWSIEEHWTKRTTETYTDSHGKTRTRTKTESGWKT
FT                   VASGGDEIPFELCDDTGCILIRPEKARVEAITVMNRVCGRSDPLYYGKGPDRAIMYSDH
FT                   RRRFVERIIPPDADLYVFGQAREREDIVAPEVAYDKEAPMFLISTREEKKLSRRYSLYY
FT                   WLLVAVGIIAAIATAYFSIDRTFSLPQEPIQPYIVTIGSFLVMLFIGWFWVTHNSLKSL
FT                   QRRVQQGWSQIEVQLKRRHDLIPLLVNVVKGLVKHEQDTQEKLAELRGELENMSGKEVL
FT                   KVLIERYPNLKSQEAFIKLQKELSDTENRIALARGYYNEIASFYNARLERFPDLIVAKL
FT                   GRLKHQRLWKQ"
FT   sig_peptide     567135..567194
FT                   /locus_tag="Kole_0518"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.859) with cleavage site probability 0.618 at
FT                   residue 20"
FT   gene            568414..569046
FT                   /locus_tag="Kole_0519"
FT   CDS_pept        568414..569046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0519"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: baa:BA_2572
FT                   PGAM, phosphoglycerate mutase family"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79241"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEJ5"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACR79241.1"
FT                   /translation="MDLLLIRHGHSVGDDERRIKGSWDVELTPKGLKQAKLLKERLEKE
FT                   NYKCDLLFSSPLKRAAQTAEAVSQAVGKPIIYDSRLREQDSGKFAGMTREEASKFSPPP
FT                   DEKGYRNYVPIPGGESLLDHIRRVSEFYLELIDKHMDKRVCIVTHGGTINVLLRIIYNL
FT                   PVNQPYVDKHIYLFAMNDTAMSRLIIRGPQDVITYYLNNFSHLTAIK"
FT   gene            complement(569121..569567)
FT                   /locus_tag="Kole_0520"
FT   CDS_pept        complement(569121..569567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0520"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: sfv:SFV_2366 putative
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79242"
FT                   /db_xref="GOA:C5CEJ6"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEJ6"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACR79242.1"
FT                   /translation="MDRKWCIVNVEAAIFNGDKWLVIKRSEKEEHAPGAISFVGGKVEV
FT                   KKASLNILEETLKREIMEEVGIEVYDDLQYVESKSFFTDKGDPVVDIVFLCRHRSGEPR
FT                   CVNEDEVAGVFWLTAQEILEDVNTPIWVKQSLRIAEKMRLNQKN"
FT   gene            complement(569957..571704)
FT                   /pseudo
FT                   /locus_tag="Kole_0521"
FT   gene            complement(571691..573520)
FT                   /locus_tag="Kole_0522"
FT   CDS_pept        complement(571691..573520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0522"
FT                   /product="glycoside hydrolase clan GH-D"
FT                   /note="PFAM: glycoside hydrolase clan GH-D; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79243"
FT                   /db_xref="GOA:C5CEJ7"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEJ7"
FT                   /inference="protein motif:PFAM:PF02065"
FT                   /protein_id="ACR79243.1"
FT                   /translation="MRIQIPGMSGIEIDGQLKTKVVSAGLEFNYKLNILDSGYLINLSL
FT                   TNIETVPIKLSSFTVAKFSDLDFPFYCNNWGSWFPFRLYKSIPNTKEAVAFAQSAGTTL
FT                   FSATPIPELFNIDIFPSDYFIANKGFLAGFLDSKVSHPYFTIDEATKTVEARIELFGKP
FT                   LQPGETIEIEPLVVFHSDKLNRMLENYAEMIRDYKKPVFKELEGIGWCSWYHYFTDITF
FT                   EELKKNVKLLANLREERGLPYTLVQLDDGYQKDIGDWLITNEKFPSLEEIANEISVKGF
FT                   IPGLWLAPFCASETSDLFREHPEWFVKDSSGNPKRAFRNWGKDIYALDLSNREVLGFIK
FT                   DLMSKIKKSGFKYIKIDFLFAGAIPGIRQNENITPIEAYVKGLETIRGALGDDVYLLGC
FT                   GAPLLPSVGLVDAMRIGADTAPIWGGELPDLGIPSAKYSIRNALTRYFMHKRLWINDPD
FT                   TPILRSQAAKLSDNEKELFSYVCGLLDNPIIESDDMTLVDEEGIEILRKTLSLRGGKPR
FT                   VFFDDTGEIFTVAVKGGKEKNSVAVINLSDEKARVKIPEDALSWSGVNTEEMDVEIEPH
FT                   SIWLRSVSSVAVELKKTVEYKEDGRQVNYYEEA"
FT   gene            573951..574328
FT                   /locus_tag="Kole_0523"
FT   CDS_pept        573951..574328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0523"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   net:Neut_1719 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79244"
FT                   /db_xref="GOA:C5CDH3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDH3"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACR79244.1"
FT                   /translation="MRGREQYSMELKLKVVKEYEEGHKNTREIREEYGIPDSTLWGWIN
FT                   KYRAEGESAFEPKLRAGDFIVDPTKIPPVLYKEIGLDKIKKDPKELKGVLNEIEKYKLI
FT                   IAEKELEIRLLKEALKKTGKG"
FT   gene            574355..574702
FT                   /locus_tag="Kole_0524"
FT   CDS_pept        574355..574702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79245"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79245.1"
FT                   /translation="MGYGFSTSYLLRIFGITRSSYYRRKKPVFFLKKTKPGRRRNYCLK
FT                   TNGEKFEDKELEKLFKDIYSRVNPYEPEYYLKVLGSKKLSKYFLNEFGIIVNHKKVHRM
FT                   RKKLVSTSIIK"
FT   gene            574791..575894
FT                   /locus_tag="Kole_0525"
FT   CDS_pept        574791..575894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0525"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   sfu:Sfum_2833 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79246"
FT                   /db_xref="GOA:C5CEK0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEK0"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACR79246.1"
FT                   /translation="MLTEKQVFEIRILYREGLSKLAIARRLGIAPNTVNKYLNKEWCQM
FT                   AKRGSKLDPFKDYIEKRLQEYPELTATVLFKELVERGYTGKLTILRMYVSSIRPKGKPE
FT                   IVVRFETEPGRQFQVDWGTGTTVIAGEKTTVKFFIMVLSYSRMLYAEIVPDEKLETLIQ
FT                   AHLHAFEYFGGYPSEGLYDNMKTVVKKLQKQKEYNARFMDFANFYGFKVITHRPYNPKA
FT                   KGKVERLVPYVRENILYGQSYSSLTELKNVLRDWLAIANQRLHSELKETPLERFEREKN
FT                   HLNELSKLYPIRRLNTRLVRNKGQIVYKERAYHVGKKYVGERVNLQVEGSLLKIYSNDE
FT                   LITVHPLKDQVEKRSLREYQALVGDAV"
FT   gene            575891..576688
FT                   /locus_tag="Kole_0526"
FT   CDS_pept        575891..576688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0526"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: sfu:Sfum_2832 IstB domain protein
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79247"
FT                   /db_xref="GOA:C5CEK1"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEK1"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACR79247.1"
FT                   /translation="MSYEKVHSLLKELKLEGISRVLDSSLQNWSKGDKDVLELIEELLI
FT                   AQKKENENKKYITALRYSGLPFHKTLEEFDFSFQPSIDRKQVMELKTLRFMYEKENVVF
FT                   LGPPGVGKTHLAVGLGMEALREGKKIYFVNAITLVDRLKKAFVERHLEKTIRFYKSLDL
FT                   LIIDELGYLPLDTEGAKLFFELVSQKYEQGSIILTSNRSFTEWDKIFEDEVLATAVLDR
FT                   LLHHCTIVNIRGKSYRLKEKQKTGLVGIQTTIGRTDKLRKSER"
FT   gene            576738..577322
FT                   /pseudo
FT                   /locus_tag="Kole_0527"
FT   gene            complement(577626..579743)
FT                   /locus_tag="Kole_0528"
FT   CDS_pept        complement(577626..579743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0528"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1474 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79248"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEK2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79248.1"
FT                   /translation="MWSEYQKYRITYLCDLLEIGTDYTGPEFNWEELRQEVDSEKFDQL
FT                   SSLLKDAFGLDSKVLNDNKYFLLYFWGIFLWDEDIPFETRFRIAQKIINLGRLIRKANE
FT                   REVDNVESDSVKNDEEVIAIILGEPEYGNTEIARWYLLAGLDAIAFFLQNFKLSDNEED
FT                   DNGNDRELIKIVAEAMNLARNCPRFFLKALDITFNLTLGYFESTITSYALGLNPNIGPD
FT                   YLELPFEVFFPDTLFGTDPSILSLVCLLRHEDDEVRRKAAYAGASLLTWGSSFKSHIYV
FT                   LNRMAPTSGLLPVIIAGIAENTSFSFVGKRIINFLEELGRTEEKTEVPLIIRAVCDSLL
FT                   KKKTKRKSRALEEFIKYIMDLKTNSRARLAGALLAQAYGYKEYALVLYESLSKRDQKAF
FT                   ESFVENGVIPKLRDKDSEESAIVSSVVSTNYEIARKMHRTIFEEKDSLFPGFEIDSSER
FT                   VPSLRYNLPPREYYLKKMLENKEDKVQILEKVLEKHPYEFTAYMELANEYFTLGMEEDC
FT                   RRTLETGVEKIQELLRKLNLRNYMIEFSHHHNRPILMLFKDFGDFLRMRGSNLAKATQI
FT                   FEWMLVVEPMDFLNAKNSLLNCYFRQRNFIKAEKLLEWYEDENSLDFVMGRAFIYYIRR
FT                   NIERANLELSLAKRMNPYVIDILLMGIDPEELDNVEIELEKKEAIIYALEYEKVWKSYP
FT                   RVMRWLKNQRR"
FT   gene            complement(580272..580925)
FT                   /locus_tag="Kole_0529"
FT   CDS_pept        complement(580272..580925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0529"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; PFAM: Radical SAM domain
FT                   protein; KEGG: dat:HRM2_04840 PflA"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79249"
FT                   /db_xref="GOA:C5CEK3"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEK3"
FT                   /inference="protein motif:TFAM:TIGR02495"
FT                   /protein_id="ACR79249.1"
FT                   /translation="MDFAGWQKVSLVDYPGKVSTTLFTSSCNFDCEYCHNAELKKRIPH
FT                   PIKEVDVYKYLSLRKNLIDAVVITGGEPTLHGHALLSFFKELKKRFPGKFIKVDTNGSN
FT                   PEVLKELIEIVDFIAMDLKSLDYSLFSNVGFETILESLEITKNAKDYEIRITVYPPYIK
FT                   PDNFPKFAELLKGIKNVAIQQYRPVNSVSPYPREILLDFEKALKPYVENVVVRG"
FT   gene            complement(580843..582996)
FT                   /locus_tag="Kole_0530"
FT   CDS_pept        complement(580843..582996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0530"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; PFAM: ATP-cone domain protein; KEGG:
FT                   sat:SYN_03522 anaerobic ribonucleoside triphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79250"
FT                   /db_xref="GOA:C5CEK4"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEK4"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ACR79250.1"
FT                   /translation="MLLVRKRDGSLVEFELSKIILAVKKAFEATDTAYTDDILERLALR
FT                   VTSDFQGKIKENIVDIEDIQDSVEKTLEDLGFNKVAKAYILYRKQREKLRNLKSSMLDF
FT                   AKTVNNYLNQRDWRVKENSTVTYSIGGLILHNSGTVTANYWLSEIYDEEIGKAHKNGDF
FT                   HIHDLSMLSGYCAGWSLRQLIEEGLGGVPGKVSSKPARHLSTLANQMVNFLGILQNEWA
FT                   GAQAFSSFDTYLAPFVKVDNLTFKEVKQCIQSFVFGVNTPSRWGTQSPFSNITLDWTVP
FT                   KRLKDEPAIVGGEPQDFTYGDCQKEMDIINRAFLEILKEGDANGRGFQYPIPTYNITKD
FT                   FDWENPNSELLFEITSKYGTPYFQNFINSDLNPDDVRSMCCRLQLDKRELRRRGGGLFG
FT                   SDEYTGSIGVVTINLPRLAYLSKNEVEFFQRLSKMMDLAKRSLEIKREVIEKLNDEGLY
FT                   PYTKRYLKNFDNHFSTIGLVGMNEACLNARWLKKPIYEENSRRFAIRVLDFMRERLKIY
FT                   QEETGNLYNLEATPAESTSYRLAKIDKKLFPDIITAGKDAPYYTNSTHLPVDYEIDIFS
FT                   ALELQEELQIKYTGGTVFHAFLGESVDDWRTTRELVKKIAENYRIPYFTISPTYSICRN
FT                   HGYIKGEEYSCPICGQPTEVYSRITGYYRPVQHWNIGKQEEFKSRKEFRVERTEIDGFR
FT                   RMAESKSGGLSGKGIDNSLYLKL"
FT   gene            complement(583172..583714)
FT                   /locus_tag="Kole_0531"
FT   CDS_pept        complement(583172..583714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0531"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rce:RC1_0992 exonuclease, putative; TIGRFAM:
FT                   DNA polymerase III, epsilon subunit; PFAM: Exonuclease
FT                   RNase T and DNA polymerase III; SMART: Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79251"
FT                   /db_xref="GOA:C5CEK5"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEK5"
FT                   /inference="protein motif:TFAM:TIGR00573"
FT                   /protein_id="ACR79251.1"
FT                   /translation="MEFVVIDTETTGSSPHKGAELIEIAGVVVRDWEIIYEESFNELIK
FT                   PKRHVPISITMITGINNLMLEDKLPIEIVLPRFYDFVRDRVLVIQNAPFDLSFLDYFGK
FT                   KIGIGELPNPFVDTISLSRSLFRGRHNLDIILARLGIFCEDRHRALGDAVATAKAFIKM
FT                   VKMIGVEEIEKFVVKRI"
FT   gene            complement(583716..584858)
FT                   /locus_tag="Kole_0532"
FT   CDS_pept        complement(583716..584858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0532"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: bha:BH2668 hippurate hydrolase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79252"
FT                   /db_xref="GOA:C5CEK6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEK6"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACR79252.1"
FT                   /translation="MIEIGKVHELRHRLHKNPEGGFREYETKKILLKFLSDLPKNYFKI
FT                   YEVLETGLVVEYRNAENKSFVLFRADMDALPIEEETNVDFASENPGWMHACGHDIHMSV
FT                   LTGLIKQVARELSEANILFFFQPAEEGPGGAKPFLESGFLDSYDVKAAFALHVSPDYKM
FT                   GTVASKEGVIFASPTEFDVIFKGESAHGAKPDEGRDTILPASEFITAFYSALTRFIPEE
FT                   ERYVFTIGKLVAGDRRNIVAEKSIIEGTYRVLDIKTKEKIDELMERFTENISKTWKVQG
FT                   EVRYGAYYPVLMNDSRLFKALAKTVKSIGLEFAECETKFTGEDFAFFSQRYPSLMFWLG
FT                   CATETMKAGLHTSKFLPEDRCIDFGVKVFYSLLKEVSKED"
FT   gene            584959..585294
FT                   /locus_tag="Kole_0533"
FT   CDS_pept        584959..585294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79253"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEK7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79253.1"
FT                   /translation="MEMENSSTPKSLDEGLIKALQSAIQKAPIRNGGKIYLTDIWVITS
FT                   LPEDMIIELFRRNQFALPEGVLAVVDDRRRRKKVIYDVRETKTEKHEENPEETEDGENG
FT                   DITPTTK"
FT   gene            585320..586780
FT                   /locus_tag="Kole_0534"
FT   CDS_pept        585320..586780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0534"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: pfo:Pfl01_4532 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79254"
FT                   /db_xref="GOA:C5CEK8"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEK8"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ACR79254.1"
FT                   /translation="MGYILAIDQGTSSSRAIIFDEDLYQVASAQKPFKQIYPKPGWVEH
FT                   DPNEIVLSVMSCVEKAIQDAKISFKDIEAIGITNQRETIVAWDAETGKALYNAIVWQCR
FT                   RTADRAKELERQYRNFIHSKTGLLPDPYFSATKMEWMLRNVPEVRKAAKKGTLRFGTID
FT                   SWLIWNLTPDRQHVTDHSNASRTMLYNLNELKWDEELLEFFGIEKEFLPKVVDSSKLLI
FT                   RSVYGPVISGIAGDQQASLFGQTAFNVGDVKCTYGTGSFILMNTGDKPRFSREGLLTTV
FT                   GWKINDEIVYAIEGSIFTTGALINWLKDGLQIISTPEETELLATSVEDNGGVYFSGALA
FT                   GLGAPYWDSKARGLIIGLTRGATRAHIVRAVLEYIAFRTKEILEIMERDTGIKVNRLLV
FT                   DGGVTRNNFLMELQSKVLGVTVDRPIVKETTALGAAMLAGLAVGLWDKETLAGIRKSEV
FT                   VFTPTRKELEDEYKKWKEAIKRSMNWAE"
FT   gene            586738..587247
FT                   /locus_tag="Kole_0535"
FT   CDS_pept        586738..587247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0535"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   rsq:Rsph17025_2955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79255"
FT                   /db_xref="GOA:C5CEK9"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEK9"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ACR79255.1"
FT                   /translation="MERSDKTFYELGGMNEKAVRHLAFEIAKRLEGGEILLLKGDLGTG
FT                   KTTFVKALAEGLRIDPDDVRSPTFTIVNTYVGRNLTLLHADLYRLSDPSEVLELDLLGL
FT                   LGPETVLAVEWPELLAGFIGKNALKIELEYEDEKTRRLKLSGSYKWIERMVKDFFKKER
FT                   QTKEVK"
FT   gene            587247..589622
FT                   /locus_tag="Kole_0536"
FT   CDS_pept        587247..589622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0536"
FT                   /product="ATP-dependent protease La"
FT                   /EC_number="3.4.21.53"
FT                   /note="KEGG: rsh:Rsph17029_1493 ATP-dependent protease La;
FT                   TIGRFAM: ATP-dependent protease La; PFAM: peptidase S16 lon
FT                   domain protein; AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   peptidase S16 lon domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79256"
FT                   /db_xref="GOA:C5CEL0"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEL0"
FT                   /inference="protein motif:TFAM:TIGR00763"
FT                   /protein_id="ACR79256.1"
FT                   /translation="MAQKFQLLEKAAVNPEKKAQIPDVLPAIATRTNMLIYPSLVMPLY
FT                   VGRDKSLTALEESIAKYDQLIFLISQKDVTTENPTVEDLYKVGTVARIVQLMKMPDGNY
FT                   KILVEGLARAKIVDVVEKDNLFVFKIEVLKAKYRRTKVLEALIRKVKELAMKYVNMSRR
FT                   YPDESIVALEDTANPDKFADFVSSLLPLPLEEKQKLLDAVSPKERLELLLEILTREVEI
FT                   LNLEEELDRRVKEKIEQSQKEYYLREKMKAIQEELEGEEDIEIKELKEKLEKGNYPKEV
FT                   RDKAEQEISRLEKMSPYSAEATVIRTYLDWLLNLPWTEETEDHIDIKAVRKTLDANHYG
FT                   LEDVKERVLEFLAARNFSKNLRAPILCLVGPPGVGKTSLGRSIAEAMGRKFGRISLGGM
FT                   RDEAEIRGHRRTYVGALPGRIIQMIRKLNSKNPVIVLDEIDKLGVSFQGDPASALLEVL
FT                   DPEQNNTFTDHYLEVPFDLSKVLFITTANVLYTIPPALRDRMEIIEIPGYTDTEKLHIA
FT                   KDYILPKLYEEYSITKRKVNITEGAIKKIITEYTREAGVRNLDRNLSKIIRRAILKLSE
FT                   GQKSVKVTKNNIEEYLGIPKYKESDLRKRPEIGVCTGLAWTAVGGEIMHIEVLPIPGKG
FT                   KFITTGQLGDVMKESAQIALSLAKKLCDGKKYVKVFETNDFHIHVPEGAVPKDGPSAGV
FT                   TLLTAIISAVTGTPIKHDVAMTGEITLRGRVLPIGGLKEKLMAAYRAGIKTVILPETNK
FT                   RDLEKVPDEIKDKLKFVFVETVKEVIEEALVKDVDKKG"
FT   gene            589603..590175
FT                   /locus_tag="Kole_0537"
FT   CDS_pept        589603..590175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0537"
FT                   /product="small GTP-binding protein"
FT                   /note="TIGRFAM: small GTP-binding protein; PFAM:
FT                   GTP-binding protein HSR1-related; KEGG: dat:HRM2_10790
FT                   EngB"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79257"
FT                   /db_xref="GOA:C5CEL1"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CEL1"
FT                   /inference="protein motif:TFAM:TIGR00231"
FT                   /protein_id="ACR79257.1"
FT                   /translation="MLIKKVELVKTAFKPGDYPEPVKREVAFAGRSNVGKSTLLNTLFQ
FT                   RKLAHTSSKPGKTRSINFYLVNSKYYFVDLPGYGFASASKQELARWKELIEDYFSTRDN
FT                   LNLVTILMDSRHPMQKNDYKMLEWIKDYSIPFIVVLTKTDKLSGNELKKMIQIYEKELK
FT                   LWGSPPIIPFSAKTRRGLNELLKILIP"
FT   gene            complement(590563..592044)
FT                   /locus_tag="Kole_0538"
FT   CDS_pept        complement(590563..592044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0538"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: tcx:Tcr_1150 diguanylate
FT                   cyclase/phosphodiesterase; TIGRFAM: diguanylate cyclase;
FT                   PFAM: GGDEF domain containing protein; SMART: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79258"
FT                   /db_xref="GOA:C5CEL2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEL2"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACR79258.1"
FT                   /translation="MKMNELNKCFLKSKKIQISVLVVLISILIISSIICYSVEFRTKLD
FT                   EFKLSEKSKAESFSMILEKTLEKEIAEFKFFAGLLDLKILDEERVKQLLIAFTDSRFED
FT                   DPGAKVYIVDNSGKVLQKHAQIYCKKIEEIIQELISTNAISESTETVIDFIYISPLNFE
FT                   EKLWITFGAPLYNGKDKVGTIFLLHSEDWLRKVFRNFLRNNDLVFGVFSKNSEVSFRNL
FT                   YTDILVPIIPKEDILRNGQTQWLSTEGIWTLSTIKIDNLLENRMIGILTLYPDAEIKRG
FT                   QLVVLKRIFVYDVVFLAIIMIGYVMASIQLKALKEFKNLEIKQSQIVRDPITGLLERKE
FT                   FLKTLDYMIEFSEKENKKLALIFLDIDDFTSVNQLLGPVLADNVLKRFGERLRRVLRKD
FT                   DIIGRVGGDEFGIIALVSEEEDVVKLIDKITVSIKDPIELGKFKLFLNATSGIAMFPKD
FT                   GHNPDVLMTKAFEALRIAKSSDTKKKYRFFGVLNG"
FT   sig_peptide     complement(591931..592044)
FT                   /locus_tag="Kole_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.930) with cleavage site probability 0.926 at
FT                   residue 38"
FT   gene            592387..593037
FT                   /locus_tag="Kole_0539"
FT   CDS_pept        592387..593037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0539"
FT                   /product="protein of unknown function DUF47"
FT                   /note="PFAM: protein of unknown function DUF47; KEGG:
FT                   lpn:lpg0584 phosphate transport regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79259"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEL3"
FT                   /inference="protein motif:PFAM:PF01865"
FT                   /protein_id="ACR79259.1"
FT                   /translation="MGWFFGKKEEEILNSFFKHIEKIQEGIDLLERFFDAYEDNDWDLV
FT                   EEIRNKISDIEHEADVIRRDTENGMYSGAFLPNFRGDLLGIIESADKIMNKIQTVADLI
FT                   WMQHVEAPLEIRKDLKEQVNLVIKTFKSLATSLREMFDNMDKAQAYIEETEKFEHEEDL
FT                   KEKVMISTLFKLKDMSLAEKLQIKELILNIGDIADLTEDTSDRVQIVIMKRKV"
FT   gene            complement(593073..593681)
FT                   /locus_tag="Kole_0540"
FT   CDS_pept        complement(593073..593681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0540"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: sfr:Sfri_3885
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79260"
FT                   /db_xref="GOA:C5CEL4"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEL4"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ACR79260.1"
FT                   /translation="MINGHVDAGKLVKIMLSWVGTPFGAFVFGFVLYIILSYPFRLIKN
FT                   VKTQDLTIKVATWIFGAYASYSLGANNVANVTGALVGRLLNIQLLALIGGLSIAFGILT
FT                   FSRRVMLTVGKSIVELDYFSSLVVVLGSALTVWIYALIGVPVSSSQAIVGAVIGAGFAR
FT                   GTRIGNTKMVMRVVYGWVGTPIISGLMCVTMLGIISVFL"
FT   gene            complement(593756..594358)
FT                   /locus_tag="Kole_0541"
FT   CDS_pept        complement(593756..594358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0541"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   dol:Dole_3091 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79261"
FT                   /db_xref="GOA:C5CDD4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDD4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACR79261.1"
FT                   /translation="MTKTCKTHTAQRRRRTGKYKDPQSSWTKTTKGWEYGRKVHMSLDA
FT                   QNLLIQDWMTTPAAVHDSTVAKAQIDSGQGYKYFLADSAYDSQQIYRYIFDCSSMIPVI
FT                   DTNKRKGVSLEKQCQARWLGIQLRQIYAEKYKNRWEIERTINILQEYFNLEYIWYVRNR
FT                   NYDAVLGLAILAYNLCVMFNILNSRPHRKVADIIGCY"
FT   gene            complement(594342..594722)
FT                   /locus_tag="Kole_0542"
FT   CDS_pept        complement(594342..594722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79262"
FT                   /db_xref="UniProtKB/TrEMBL:C5CDD5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79262.1"
FT                   /translation="MVPQELTKSDIVKIIEQLDKLLPSNFVNKQGRGRRKAYSDKSILK
FT                   LSILLKLCDVSYRGAKNFLEKNPKYMELLDLKNIPPFQTISRRVRELPLHRINKDVVNL
FT                   FLDIEGLERIELVVDSFRDQDL"
FT   gene            complement(594807..595091)
FT                   /locus_tag="Kole_0543"
FT   CDS_pept        complement(594807..595091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0543"
FT                   /product="phosphate transporter"
FT                   /note="KEGG: sse:Ssed_0370 phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79263"
FT                   /db_xref="GOA:C5CEL7"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEL7"
FT                   /inference="similar to AA sequence:KEGG:Ssed_0370"
FT                   /protein_id="ACR79263.1"
FT                   /translation="MVMLIYILPSLFLGWSLGANDAANVFGPPVVNGVIRFRTATIVAS
FT                   IFVVLGAVLQGSKGLSTIGGLTEINLATSAVSMFAAALTVTIMTFFGLP"
FT   gene            595343..595816
FT                   /locus_tag="Kole_0544"
FT   CDS_pept        595343..595816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0544"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: vpa:VP1487 putative
FT                   MutT/NUDIX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79264"
FT                   /db_xref="GOA:C5CEL8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEL8"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACR79264.1"
FT                   /translation="MFKMTHHACVRGVVIDKGKVLVVEHSHSNRPPFWCFPGGHVEENE
FT                   TLVEAVKRELKEETHLDVDVGQIVFVQEFVKEHLIELFFECFIVDGEARLGSDPDNPGM
FT                   PILTRMKWVEPEELLELPVYPKALSQILFEDHRNFPKIGFQALYEKEEIQKDK"
FT   gene            595944..596480
FT                   /locus_tag="Kole_0545"
FT   CDS_pept        595944..596480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0545"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   baa:BA_0277 ribosomal_S30, Sigma 54 modulation protein /
FT                   S30EA ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79265"
FT                   /db_xref="GOA:C5CEL9"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEL9"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ACR79265.1"
FT                   /translation="MKYNIYAKDIPVTDTMKEHIDKKLAKVFRAIDEDHFTSMDVRVMK
FT                   ERGLYKVEITGHLPGFVVRVEERGDDFYGVVEAIANTLERRIKRYKERARMRHRASAKE
FT                   ILEAIPEVPDEEERGLQITRTKRFSIKPMKIDEALLQMEMLGHTFFVFRNVDTDEVNVL
FT                   YLRKNGTVGLIEMSE"
FT   gene            596551..597996
FT                   /locus_tag="Kole_0546"
FT   CDS_pept        596551..597996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0546"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="KEGG: gme:Gmet_3192 ribonuclease G; TIGRFAM:
FT                   ribonuclease, Rne/Rng family; PFAM: RNA binding S1 domain
FT                   protein; SMART: RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79266"
FT                   /db_xref="GOA:C5CEM0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEM0"
FT                   /inference="protein motif:TFAM:TIGR00757"
FT                   /protein_id="ACR79266.1"
FT                   /translation="MEITKKKRTQAIVFSSLEDEVRIAILDEGKIQEVFFEEMDNESYM
FT                   GNIYLGKIENVVPSLEAAFVNIGIGKNGFLRFKDTRNNQKLEKGKKVLVQVKKDPIGSK
FT                   GPQLTLKISIPGRCLVYMPFSKHVGISKKITDQAERERLISIAKGIIENDEGIIFRTAA
FT                   NGVGEDTLREELENLRTIWKKINEKFRRARKPQILYEEPSLVEYILRERLTEDVKEIVV
FT                   DSEDLWHDVVAGISKFKSGFKPIVRYVEEDAFLHEGIYEKMKVLYTRVVPLPNGGNIFI
FT                   DKTEAMTVIDVNSASNTHGSDVSEMSLNTNLEAAVEIARQLRLRNIGGIIVIDFIDMKS
FT                   EADRKKVISLLSEELKKDKAHSLILGFTRLGLLEMTRKRSTATINSRIYSTCPICRGTG
FT                   QIESPKITYQRLVSDLQRLFKDKKIKSATVQVYQNLSGILTPEVQKQLSKQFKREIKVS
FT                   FTWPVPATYDIKGSTKSEAKSKK"
FT   gene            complement(598025..598101)
FT                   /locus_tag="Kole_R0018"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(598025..598101)
FT                   /locus_tag="Kole_R0018"
FT                   /product="tRNA-Arg"
FT   gene            complement(598109..598198)
FT                   /locus_tag="Kole_R0019"
FT                   /note="tRNA-Ser3"
FT   tRNA            complement(598109..598198)
FT                   /locus_tag="Kole_R0019"
FT                   /product="tRNA-Ser"
FT   gene            598761..599039
FT                   /locus_tag="Kole_0547"
FT   CDS_pept        598761..599039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0547"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: pca:Pcar_0183 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79267"
FT                   /db_xref="GOA:C5CEM1"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEM1"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACR79267.1"
FT                   /translation="MKEMVDFFKALGCEWRIRLVEILSENNKCMCEIEAEFPIDKTTLS
FT                   RHLKALKDAGIVREEKVGTRKNLFITDERVLEVIELVKKIIEDRKFA"
FT   gene            599111..600211
FT                   /locus_tag="Kole_0548"
FT   CDS_pept        599111..600211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0548"
FT                   /product="permease"
FT                   /note="PFAM: permease; KEGG: dat:HRM2_48210 putative
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79268"
FT                   /db_xref="GOA:C5CEM2"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEM2"
FT                   /inference="protein motif:PFAM:PF03773"
FT                   /protein_id="ACR79268.1"
FT                   /translation="MEFKKFSLLVGGFLLFYLLPFENSNVQQAILGGFTMLSSYAKEHV
FT                   LFCLIPAFFVAGTITVFVKKSAILRVLGPQAKKIIAYPVAASAGGILAVCSCTILPLFG
FT                   GIYKRGAGLGPAIAFLFTGPAINVAAIFLTGRVLGWELSIIRLVATISSAIVIGLIMQA
FT                   IFAEKGEGGFTIVEDEPELSWAQILVFLGLQFVFLIAGGLKINVIIKTTIMVIAALGII
FT                   LMALNFKPSYSARWIEETWEFTKKILPYLFFGVFIAGIISHSLPKTVVQTFLGGNRLFS
FT                   NFFASIFGAFMYFATLTEVPIIQSLMELGMGKGPALALFMAGYTLSLPNMIVLTKLLGK
FT                   KKAFTYFALVIVFSTFWGYLYGNLMK"
FT   gene            600229..600462
FT                   /locus_tag="Kole_0549"
FT   CDS_pept        600229..600462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0549"
FT                   /product="redox-active disulfide protein 2"
FT                   /note="TIGRFAM: redox-active disulfide protein 2; PFAM:
FT                   glutaredoxin; KEGG: sfu:Sfum_3598 redox-active disulfide
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79269"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEM3"
FT                   /inference="protein motif:TFAM:TIGR00412"
FT                   /protein_id="ACR79269.1"
FT                   /translation="MKIEIYGTGCPKCKQTEKIIRMAVEELEIDAEIVKIEDLMEIMAR
FT                   GISITPAIRIDGEIVLSGKIPSLEEAKKLLQR"
FT   gene            complement(600817..602187)
FT                   /locus_tag="Kole_0550"
FT   CDS_pept        complement(600817..602187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0550"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   gsu:GSU0452 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79270"
FT                   /db_xref="GOA:C5CEM4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEM4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACR79270.1"
FT                   /translation="MKTITIRTKLTIWYVTFLAIVLITFTVVLYFSFSTNLRRTIDKNL
FT                   EFIASQLIINIDYDDNKLAFQNTENGANLIKNFIGKELFARILDENGNVIDGFGNYFLL
FT                   PADPKILKKGFLTILTDSGEWRVYTVKLSLGWLQVAEFTEPFGETLEKFRSLLVIFIPL
FT                   TLIIASIGSYLLAKKTLKPIDRITNLAREINAEKIDRRLDIDLPDDELGRLSKTFNQML
FT                   DRLENALNSQKQFSANAAHDLRTPLTSIKGIIDVTLNRERDALEYKDSLIQIRKQVERM
FT                   SKLVDTLLIVARFDSKAIKLHKEKIDLTELLEVVVEQMQYAANRKGIILKADLQDNLTI
FT                   VGDFDLVVRLFLNLIDNAIKYNQPGGQVTVTAKLSEKKKGLKHVLVSICDTGQGIPENE
FT                   LERIFDKFYRIDKSRSRVEGAGLGLSIVKEIALAHNAEIQVKSQLGKGSIFIVKFPI"
FT   sig_peptide     complement(602089..602187)
FT                   /locus_tag="Kole_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.613) with cleavage site probability 0.343 at
FT                   residue 33"
FT   gene            complement(602197..602898)
FT                   /locus_tag="Kole_0551"
FT   CDS_pept        complement(602197..602898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0551"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: gsu:GSU0451 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79271"
FT                   /db_xref="GOA:C5CEM5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEM5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACR79271.1"
FT                   /translation="MRILLVEDEEAITEFVKKGLSEEGYIVDTVDNGEDALNKIFDVDY
FT                   DLIILDIMLPVKDGLKVCREVRENGISTPILMLTALDSTEDKVTGLNAGADDYLVKPFS
FT                   FSELLARIRAILRRPPTILNLKLQVGDLVLDTVTHHVERSGKRIDLTPREYALLEFLMR
FT                   HPNQVLSRTRIVEHVWNLDFYTESNIVDVYIRYLRKKIDNGFENKLIHTVHGVGYMIGE
FT                   IQPNKSKGGES"
FT   gene            complement(602976..603497)
FT                   /locus_tag="Kole_0552"
FT   CDS_pept        complement(602976..603497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0552"
FT                   /product="Propeptide PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4; KEGG:
FT                   bha:BH0375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79272"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEM6"
FT                   /inference="protein motif:PFAM:PF03413"
FT                   /protein_id="ACR79272.1"
FT                   /translation="MKKKTVPILIVLMLVSMLLVANFTFANSSSSAQTPSYATTQTADD
FT                   DTKEQVKNEESEATEANEQSESVENTEKQAEVQEPSYTGSVMVSNPEPKDLSTLAKISK
FT                   EEAANVVMSSYPSANIKSIKLENENGFLVYGVILDNGQEVKVDAGTAKILHVEDADSES
FT                   ENIQEEMENE"
FT   sig_peptide     complement(603399..603497)
FT                   /locus_tag="Kole_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.775 at
FT                   residue 33"
FT   gene            603881..605266
FT                   /locus_tag="Kole_0553"
FT   CDS_pept        603881..605266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0553"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   ppr:PBPRB1170 putative TldD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79273"
FT                   /db_xref="GOA:C5CEM7"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEM7"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ACR79273.1"
FT                   /translation="MIDGRTANEVIGVLLKHGAEFVELFIEERDTSNFSLVNGQLERAL
FT                   SGKTFGIGIRAFSKNRSLYAFTNDLSKETLVQIAANLGEVINGNGEPLSLDFREQSIEN
FT                   RHLFILEPSSVSKTDKVKVMKMAFNGAKSVSKLITQVLVDYWDYDQRITIINSEGLKVS
FT                   DRRLRTRLMITAVASRYNEKETGFYGPGAAMGFEFFNTFDVFEAGQKAGRIAARMVEAE
FT                   YAPAGRMPVIIANEFGGVIFHEACGHALEATSVAKGSSVFTGKLGQKIAADCVSAVDDA
FT                   TIPNAWGSTNIDDEGTPTRRNVLIENGVLKSYLIDRFNGIKMGMESTGSARRQDYRYAP
FT                   TSRMSNTFILPGPYYPEEIISNTEYGLYAKSLGGGSVNTGTGEFNFAVREGYLIEKGRI
FT                   TKPVRGATLIGKGSEILMKIDMVGNDLKRGQGMCGSASGLIPAEVGQPTIRVSELTVGG
FT                   RNR"
FT   gene            605263..606633
FT                   /locus_tag="Kole_0554"
FT   CDS_pept        605263..606633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0554"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   gme:Gmet_0947 peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79274"
FT                   /db_xref="GOA:C5CEU0"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEU0"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ACR79274.1"
FT                   /translation="MTFENFKKMVFEYAAAKKTNDFEIYIKKTHEFDVSIQKGEIEKYK
FT                   DATTLGVSFKVLKDGKVGYSFSEVLDEQAVKLLVDEALENVTVIESEESDFLHDGSGEY
FT                   TDFPTLYLGEFDRLTTREKIKIAMELEKTIINSHQEIFMLPYNAFNHRTSETYIANSSG
FT                   MEMYSRSDGGYAYVMALGKKNGSPKSAFYFTAGKSLQDLELSNIPIRISRDIELLLTAK
FT                   PVKSGKYAVIFRNDAFGSLLAAFAQMFSAKSVQKGLSLLKDQLGKKIASEKFTLIDDSF
FT                   LKMSPVSRTFDDQGVPTRKKAIIENGELKTYLYDLKTARIDNRESTGNALKIGSYKDPT
FT                   SISYFNLVLGNSGIPFEDMVKAIERGLVIIELDGLHSGTNPISGDFSLGARGFLIENGR
FT                   IVGGVEGITVSGNILGVLKNIVETGNDAKFSLPGITGFSSFAFLPSVLVEEIDVAGL"
FT   gene            complement(606719..607060)
FT                   /locus_tag="Kole_0555"
FT   CDS_pept        complement(606719..607060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0555"
FT                   /product="Zn finger protein HypA/HybF (possibly regulating
FT                   hydrogenase expression)-like protein"
FT                   /note="KEGG: nam:NAMH_1055 hydrogenase
FT                   expression/synthesis, HypA"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79275"
FT                   /db_xref="GOA:C5CEU1"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEU1"
FT                   /inference="protein motif:COG:COG0375"
FT                   /protein_id="ACR79275.1"
FT                   /translation="MHHELSIAERVKIFIEQNFKPEEFGNIEKIVIGIGKLVVADKNQI
FT                   EEAFNVIKKESDFPDLEIKFITDELLFECKDCGKKFSSQGYEIHCPYCGGDLRVLSCDE
FT                   VYIKEVVFK"
FT   gene            complement(607109..608089)
FT                   /locus_tag="Kole_0556"
FT   CDS_pept        complement(607109..608089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0556"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypE; PFAM: AIR synthase related protein domain protein;
FT                   AIR synthase related protein; KEGG: wsu:WS0795 hydrogenase
FT                   expression/formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79276"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEU2"
FT                   /inference="protein motif:TFAM:TIGR02124"
FT                   /protein_id="ACR79276.1"
FT                   /translation="MKERIITLHHNSGKKQFKLLKHIEKLLGSTLVSTENDSGFLEEVV
FT                   DTVTTDSFTISPVFFPGGDIGKLSVCGSINDLVMTGAKPKYITLSVVLEEGFEFSRLDK
FT                   IIDSIRKELDENGVKIIAGDTKVMEHGALDKIVINTTCLGEVLYEKLCVKRIETNDLII
FT                   ITGPIGLHGAAIMAERKGFQIDFQSDCRVLTKLLAVIKGLRVHAMRDPTRGGLAQILNE
FT                   FSHSTKRNFAIYEDKLPIPGGVKTVSEILGIDPLYLACEGTAVIICHPEDAQDLLERLK
FT                   NAGFDPSTIGFVGGIIERPLLILKTRNGAKRVLPMLVEELTPRIC"
FT   gene            complement(608094..609110)
FT                   /locus_tag="Kole_0557"
FT   CDS_pept        complement(608094..609110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0557"
FT                   /product="hydrogenase formation HypD protein"
FT                   /note="PFAM: hydrogenase formation HypD protein; KEGG:
FT                   sfu:Sfum_4014 hydrogenase expression/formation protein
FT                   HypD"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79277"
FT                   /db_xref="GOA:C5CEU3"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEU3"
FT                   /inference="protein motif:PFAM:PF01924"
FT                   /protein_id="ACR79277.1"
FT                   /translation="MEAKKYRVMEICGTHTHALMRYGLKELYSERLELVCGPGCPVCVT
FT                   SQSDIDRILYLCDLGMRIYTFGDLMKVPGKNGNLRERKALGACVREVYNPLWIVDDMKK
FT                   DPARGAVFVAIGFETTAPLIASLIEEIERERIENLYVYLLLKLIPPAMEALLEDEENKL
FT                   DGFICPGHVSTIIGERPYIKLAEKVKKPFVIAGFTREELTVALEKMSEMLEKSAYGVVN
FT                   VYASAVKPEGNLDAREKIKNFFEVTDTLWRGLGTIPNSGLKLREKYRRFDVMAHFQMEN
FT                   VSSEDPCPCGEVLTGKIKPEECQLFGTLCLPETPVGPCMVSSEGACHASFLYGRKGE"
FT   gene            complement(609100..609327)
FT                   /locus_tag="Kole_0558"
FT   CDS_pept        complement(609100..609327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0558"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC);
FT                   KEGG: dat:HRM2_11590 HypC"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79278"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEU4"
FT                   /inference="protein motif:TFAM:TIGR00074"
FT                   /protein_id="ACR79278.1"
FT                   /translation="MMCLAIPLKVIKIKDNKALVGREGIKLEVDIRLVPDVSPGDFVLV
FT                   HAGFAIQTIDTEAARKILEIAERIDEARGS"
FT   gene            complement(609324..611567)
FT                   /locus_tag="Kole_0559"
FT   CDS_pept        complement(609324..611567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0559"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="TIGRFAM: [NiFe] hydrogenase maturation protein HypF;
FT                   PFAM: SUA5/yciO/yrdC domain; acylphosphatase; zinc finger
FT                   HypF domain protein; KEGG: gsu:GSU0306 hydrogenase
FT                   maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79279"
FT                   /db_xref="GOA:C5CEU5"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEU5"
FT                   /inference="protein motif:TFAM:TIGR00143"
FT                   /protein_id="ACR79279.1"
FT                   /translation="MQEIEVFEIMINGIVQGVGFRPFVATLAEDLGLHGYVENCESGVR
FT                   IVLDCDETKLREFIEILNERKPMPAKIRELSFSKKAVKTNKIRGFRIINSKKTGKINTS
FT                   IPPDIAMCDKCIGEMFSKGNRRYLYPFTNCARCGPRFSIAYVLPYDRDKTSMDDFSMCH
FT                   DCNTEYTNLRDWRYHAQTNCCEDCGPKYWIVEIIKNEIVSHFSGEEAVKQAIGIIRAGG
FT                   TVAIKGIGGIHLVCKPDPDAIKKLRNLKDRPRKPFAIMAKDLETVKKFAYVGEVEERLL
FT                   LSPARPIVLLRKRGDIFYDVSPGFHTIGVMLPYTGIHYLLLEDFFVLVMTSGNISGEML
FT                   CADNFEALTKLSKLSDGLLLHDRKIVNRCDDSVIKVLAGKPVFVRKSRGFIPEVIKIPL
FT                   RNRKHPEILATGADLKSSFGFFREESFYGSQYLGDLSYYINQVQYQKMLKRFEKLFDLH
FT                   ARVVVTDLHPDYFSKTLGEEYAENRDCEIYSCQHHVAHIYSVMAEKALKKCIGVAFDGT
FT                   GYGFDGKIWGGEFFSIDNSKCMRFAHLRYIPMPSGELAIEKPELMAYAYLIDSGVDLKD
FT                   EKAHLLYENAPVKTSSAGRLFDAAAAVLDVCKENTFEGEAPMKLESVAKRHSESFSWVL
FT                   DKSALPWQIDFRKMIRELYSEKDKNSISELASKFHRTLAEAISVVCGEIKKLTGEKNVC
FT                   LSGGVFQNKLLLEVAVALLEKKGFNVWFNEKVSPNDEGIAFGQIYWHVIGSDG"
FT   gene            complement(611555..612004)
FT                   /locus_tag="Kole_0560"
FT   CDS_pept        complement(611555..612004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0560"
FT                   /product="hydrogenase maturation protease"
FT                   /note="TIGRFAM: hydrogenase maturation protease; KEGG:
FT                   rru:Rru_A0322 peptidase M52, hydrogen uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79280"
FT                   /db_xref="GOA:C5CEU6"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEU6"
FT                   /inference="protein motif:TFAM:TIGR00072"
FT                   /protein_id="ACR79280.1"
FT                   /translation="MKLRKRQVLFVGLGNPLRSDDTAGLLIIDRILEFPLSENWKAVKC
FT                   YQTPENYLDALSKGKHDVIVFIDTVQGIEENYRIYEKEEIRDFSFSTHSFGLASIIDFL
FT                   NRKKRFEIYLVGLRPAVLSLGTTLSLEMKRIIETIVKGFERECRK"
FT   gene            complement(612021..612629)
FT                   /locus_tag="Kole_0561"
FT   CDS_pept        complement(612021..612629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0561"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: rru:Rru_A0318 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79281"
FT                   /db_xref="GOA:C5CEU7"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEU7"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACR79281.1"
FT                   /translation="MMTPKIREIKEAISNIFSKRFTTKFPFEVYEPVETYRGKPLFNPE
FT                   KCVGCGACVQVCPAKAIDMVDDLVEKVRVLTVKYTDCIYCGQCQEKCIVEDGIVQTTDF
FT                   TTATFDRSEERNYNCIEKELVFCERCGAIITTVDHLKWLIKRLGAYTYGNPNLVLIKLT
FT                   DLGYSFPEMRPREIIRREELFKLLCPKCRHLVVVEDAFK"
FT   gene            complement(612610..612969)
FT                   /locus_tag="Kole_0562"
FT   CDS_pept        complement(612610..612969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0562"
FT                   /product="monovalent cation/proton antiporter, MnhG/PhaG
FT                   subunit"
FT                   /note="TIGRFAM: monovalent cation/proton antiporter,
FT                   MnhG/PhaG subunit; PFAM: Na+/H+ antiporter subunit; KEGG:
FT                   mgm:Mmc1_2214 putative monovalent cation/H+ antiporter
FT                   subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79282"
FT                   /db_xref="GOA:C5CEU8"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEU8"
FT                   /inference="protein motif:TFAM:TIGR01300"
FT                   /protein_id="ACR79282.1"
FT                   /translation="MIRTVIGYMLICFGLAFDFFGALGLLRLPDVFNRLQAATKCVTFG
FT                   SAGILVGVFVLEGFSAGGMKALICMVFILLTSPVAAHAISRAAYRSGVKPFKGTVVDMY
FT                   GESLKESENNDDSEN"
FT   gene            complement(612962..613300)
FT                   /locus_tag="Kole_0563"
FT   CDS_pept        complement(612962..613300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0563"
FT                   /product="multiple resistance and pH regulation protein F"
FT                   /note="PFAM: multiple resistance and pH regulation protein
FT                   F; KEGG: atc:AGR_C_1665 putative cation efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79283"
FT                   /db_xref="GOA:C5CEU9"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEU9"
FT                   /inference="protein motif:PFAM:PF04066"
FT                   /protein_id="ACR79283.1"
FT                   /translation="MKILKWLIGLVVIIAFFIGNFFLVDLAFVARLINILLACTLMTIL
FT                   RVIFGPSAADRIVAVDIFGILIVGLLALLYVFTTASFFIDIAMAWALQSFIVSLALAKF
FT                   LEGRALDD"
FT   gene            complement(613297..613800)
FT                   /locus_tag="Kole_0564"
FT   CDS_pept        complement(613297..613800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0564"
FT                   /product="cation antiporter"
FT                   /note="PFAM: cation antiporter; KEGG: mgm:Mmc1_2216
FT                   membrane bound protein complex subunit MbxA"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79284"
FT                   /db_xref="GOA:C5CEV0"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEV0"
FT                   /inference="protein motif:PFAM:PF01899"
FT                   /protein_id="ACR79284.1"
FT                   /translation="MKLSTKSKITVFTLSFFVWILITAITDVQEIIAGLVVALFVSLVA
FT                   GKILFKSGRSIIASKAPYFLLYLLVLFWEMLKANLNVVMIVVNPYLPIKPGFIRIKSKL
FT                   KEDASLTVLANSITLTPGTLTVDIDKDEGFLYIHWINVKAFEVDKCTELIGDRFESILR
FT                   RFMR"
FT   sig_peptide     complement(613714..613800)
FT                   /locus_tag="Kole_0564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.721) with cleavage site probability 0.299 at
FT                   residue 29"
FT   gene            complement(613797..615275)
FT                   /locus_tag="Kole_0565"
FT   CDS_pept        complement(613797..615275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0565"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: ppd:Ppro_0589 NADH dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79285"
FT                   /db_xref="GOA:C5CEV1"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEV1"
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /protein_id="ACR79285.1"
FT                   /translation="MIIPYLVIIPLAAGFLIVLLGRKNKVLPELIALTATFSLLAISLL
FT                   LFPMIESEGGAILYELSGWKIPYTISFVIDYLSAFLVTMVSALAVLSTIYSVGYMRKFS
FT                   GIWNYYALLMLMITGLNGVAITGDLFNLFVFMEIALIATYALVAFHGEAEHYEAAFKYA
FT                   IMSSLSSSLVLFGIGCVYSMTSSLTLMQISNKMIGVGETNLVYALFLTGFGLKAAMFPF
FT                   HSWLPDAHPSAPSPVSAMLSGVLIKVLGAYTLIRVFYMVFGVSELVKELFLIFGTLSMV
FT                   IGALVAVMQKDIKRMLGFSSVSQMGYIIFALGIGTPLGVLGAIYHMLNHAVLKGLLFMD
FT                   AGAVELIEGTRDMEEMKGVSDRTTYVTSLMASLGISGVPPFGGFFSKLIIITAAIYTGK
FT                   FIYAIIALAVSVITLGYYLGMLKKAFRKRNKEVNDKGSLPASLKIPMIILAVLTLATAL
FT                   FYVPVVRENILEKVVSCITDRTAYIALFTAGGGR"
FT   gene            complement(615272..615616)
FT                   /locus_tag="Kole_0566"
FT   CDS_pept        complement(615272..615616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0566"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   mgm:Mmc1_2211 membrane bound protein complex subunit MbxG"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79286"
FT                   /db_xref="GOA:C5CEV2"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEV2"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ACR79286.1"
FT                   /translation="MNLYILCFALFLVGLYGMLVKRNIVKVILGFGIMGYATNLFLILI
FT                   AYREGARFPIFLPGEEHELILMVDPLPQALVLTSIVIELGVTALLITLAINIHRKYGTF
FT                   DLRKIRRLRE"
FT   gene            complement(615619..618413)
FT                   /pseudo
FT                   /locus_tag="Kole_0567"
FT   gene            complement(618398..619606)
FT                   /locus_tag="Kole_0568"
FT   CDS_pept        complement(618398..619606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0568"
FT                   /product="NADH-ubiquinone oxidoreductase chain 49kDa"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 49kDa;
FT                   KEGG: ppd:Ppro_3524 NADH dehydrogenase (ubiquinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79287"
FT                   /db_xref="GOA:C5CEV3"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR018194"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEV3"
FT                   /inference="protein motif:PFAM:PF00346"
FT                   /protein_id="ACR79287.1"
FT                   /translation="MSKEFNLPVGPFHPLLEEAEYFKIKLDGERVVDIEMETGWMHRGI
FT                   EKISEESTFDQSIFVVERICGICSASHPFACINAFEDIGEIEVPLKARYIRSLIGELER
FT                   VHSHLLWLGLAGHFIGYDTLWMWAWKYREPVLEVIEMITGNRNHYGTFKIGGVRRDYDV
FT                   SLNSVVHEKLDFLEKKLTMVAKAVANDPVVRSRLCGVGVLTKEEAISYCAVGPTARASG
FT                   VAIDVRKDEPYAAYDLLDFGVVVREEGDIFAKTVVRILEVFESIKMIRQIIEKLRKVKG
FT                   PIYNDVKEIPAGEGIGRHEAPRGEVFHYIRTDGSNRPVRHKIRAPSYVNIPTYKASCIG
FT                   ENLADVLITLASVDPCYCCTERSVRLQTEKGMEITSNLLKLSQDKTDRLIKNMGEYKLW
FT                   KSL"
FT   gene            complement(619599..620039)
FT                   /locus_tag="Kole_0569"
FT   CDS_pept        complement(619599..620039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0569"
FT                   /product="NADH dehydrogenase (ubiquinone) 30 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 30 kDa
FT                   subunit; KEGG: sus:Acid_0110 NADH (or F420H2)
FT                   dehydrogenase, subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79288"
FT                   /db_xref="GOA:C5CEV4"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEV4"
FT                   /inference="protein motif:PFAM:PF00329"
FT                   /protein_id="ACR79288.1"
FT                   /translation="MNPIERKKELFAAIQENIELLSEKRKRIYFKVDAKNITNVAKILF
FT                   TRGVRLSTITAIENIETFELIYHFSDDLTGCYYCPKVFVPVEKPVVPSIAKIIEGASWI
FT                   EREIHELFGVGFIDHPGLKPLLTENNEKIPKKPLRVERRKHE"
FT   gene            complement(620041..620454)
FT                   /locus_tag="Kole_0570"
FT   CDS_pept        complement(620041..620454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0570"
FT                   /product="NADH ubiquinone oxidoreductase 20 kDa subunit"
FT                   /note="PFAM: NADH ubiquinone oxidoreductase 20 kDa subunit;
FT                   KEGG: rru:Rru_A0321 NADH dehydrogenase (ubiquinone), 20 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79289"
FT                   /db_xref="GOA:C5CEV5"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEV5"
FT                   /inference="protein motif:PFAM:PF01058"
FT                   /protein_id="ACR79289.1"
FT                   /translation="MGFYTKILKRSLWVFHVSASPCNNCDIEILDMLTPRYDLERFGIK
FT                   LVGSVRHADVLLVTGMGGCKVSERVIRIYNQAPKPVFVIAVGTCPVAGATFKESYTRCG
FT                   PLDRFVPVDLYIPGCPPKPETMIAGLSELLGRL"
FT   gene            complement(620457..621368)
FT                   /locus_tag="Kole_0571"
FT   CDS_pept        complement(620457..621368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0571"
FT                   /product="respiratory-chain NADH dehydrogenase subunit 1"
FT                   /note="PFAM: respiratory-chain NADH dehydrogenase subunit
FT                   1; KEGG: ppd:Ppro_3523 respiratory-chain NADH
FT                   dehydrogenase, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79290"
FT                   /db_xref="GOA:C5CEV6"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEV6"
FT                   /inference="protein motif:PFAM:PF00146"
FT                   /protein_id="ACR79290.1"
FT                   /translation="MIVFYTIVFPGILFTGFAGLIIWWLERKLSALFQHRVGPPWYQNF
FT                   LDVFKLFGKESIVPELSASVVYVLAPIVSFSTVTTLSTVLGCAVFLGIRIAGDVILIIY
FT                   LLILCSMATFLGAAASRNVYAGIGASRELKMLLADELVLIMVILVPVVKSGFDFNLLRL
FT                   IYGSPAITSISGVIAYILGLVCIQAKLAIQPFDLPEAETELAGGVEIEYSGVLLGLWKL
FT                   SKGMKFLVVPLLLSVLFFGVPQEISIVRYLWIVAFYLITFLIVVVVKNINPRVTIEKML
FT                   GFFWKKLAPMAFIALLIALLGG"
FT   gene            complement(621365..621865)
FT                   /locus_tag="Kole_0572"
FT   CDS_pept        complement(621365..621865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0572"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dde:Dde_2085 iron-sulfur cluster-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79291"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEV7"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACR79291.1"
FT                   /translation="MKKLLIDIEKLIKSDISRIKCEYLYHGKNNGVLSIVEVAEFAVYC
FT                   RQCKNAHCVKACPKDALERQPDGTVKRYNLLCVGCKSCVLACPFGTLFPETISYVTTHC
FT                   DFCLSQMNADSNYVPLCAETCSGNTIRVLDVEREQPENGFYFAGKYLAIRAPNWRYKEG
FT                   RII"
FT   gene            complement(621862..622683)
FT                   /locus_tag="Kole_0573"
FT   CDS_pept        complement(621862..622683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0573"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   gur:Gura_3587 oxidoreductase FAD/NAD(P)-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79292"
FT                   /db_xref="GOA:C5CEV8"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012165"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR037117"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEV8"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACR79292.1"
FT                   /translation="MTNVFEAIKTKCIEIVEESSVIKTFVLECGEDFEFKTGQFVEVGL
FT                   PGIGEGPFTPSSSQYAKNPIEVTIMKVGYMTEKMHEIKPGATVALRGPYGNGYPLDRFK
FT                   GKDVLIVGGGVGLAPLRSLLLTLMHDIDDYRSITACFGARTPEDLIYKDQLKEWEETGK
FT                   VRITLSVDRVPENQKWEGNIGVVTTLLKPLEFDAKNTVAAVCGPPIMMKFTSLMLLEKK
FT                   IKPSNLYLSMESKMYCGVGLCRHCTIEHYFVCKDGPVFTYDQFENPGEIWA"
FT   gene            complement(622680..623687)
FT                   /locus_tag="Kole_0574"
FT   CDS_pept        complement(622680..623687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0574"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: glo:Glov_0867 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79293"
FT                   /db_xref="GOA:C5CEV9"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEV9"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACR79293.1"
FT                   /translation="MLVFFEEFVEFLERLAERTELFAPVKENGEIFLKCWKSMDSDGIP
FT                   VLDKYHPIDPLKILLFQPRNDVLTYLESGERILLGVKSCDLRAIQLLDIALLEGDYVDP
FT                   VYKEFREKTLIISSDCTEAKSSCHCILQGINPYPEEHYDVSLSSIGKRLLLRSGSEKGE
FT                   RFLKLLSKNLTAFEETPDVVDVLKNQREKIRTLVCEINSQWSLGSKDKGEKLNIFDTSA
FT                   VDSCIECGGCNFVCPTCYCFIMSDESKNKSFSKVRTWDSCQLKGYARVAGGGNPRPELY
FT                   KRFNHRYNCKFNYMVKQLSMSGCTGCGRCIDVCPAGIDIRNTMRVMREEMKVKK"
FT   gene            complement(623771..624178)
FT                   /locus_tag="Kole_0575"
FT   CDS_pept        complement(623771..624178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79294"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEW0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79294.1"
FT                   /translation="MFAIDIKCPYCQRSLMNTTEVIDKHPSIQLEVVHEKHHGIIWLSS
FT                   VYGSYNYKITFNIPDGVTAKFFCPHCSEELLGELECAECGEKMVRLMLEAGGYVHFCPR
FT                   KGCKGHYIEYNKSETLIDEAYKHYPYIDSEE"
FT   gene            complement(624578..625231)
FT                   /locus_tag="Kole_0576"
FT   CDS_pept        complement(624578..625231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0576"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79295"
FT                   /db_xref="GOA:C5CEW1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEW1"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACR79295.1"
FT                   /translation="MIDAVIFDMDGVIVDTEGLYREACKEVVRRYGGIITEELFIRQMG
FT                   LRMKEAQKIVVELAKLPLAPEDFGKEYMEEFLKRAKSKLKPNDGLLELLDFLYSKVKLG
FT                   VASSTVSNVVYDILRTIDVLNYFDYVIGGDMVENAKPAPDIYLKCAEHLKVEPENCIAI
FT                   EDSPVGIKSAKTSGMIVYAIRHKENQGLDLSQADKVFDGLRQLKGFMVEKLQSN"
FT   gene            complement(625237..626292)
FT                   /locus_tag="Kole_0577"
FT   CDS_pept        complement(625237..626292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0577"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: baa:BA_3496 HTH_ARSR, helix_turn_helix,
FT                   arsenical resistance operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79296"
FT                   /db_xref="GOA:C5CEW2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEW2"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACR79296.1"
FT                   /translation="MKIITGYFEIYDLTMAIYFSFNTDVTRVLKILGVEYTPSKEMLSF
FT                   RDKLLKSLDWSTRIYTTFMNELGVIAPILFPVRVKMVDKTIVKIEDSLDFNDETLKIIR
FT                   ERFIQVLSVRRLKIPPDDVKKMIEEKPGELTRRVEEIEGISRDSKWFINQLLFFPRTAL
FT                   DFLESNTWKMLKIYEESGLRSVNFSEIGKFMKSYQSEMINNSIRNYFEYYDIHPDESKP
FT                   LYVALQNSVPHTNSGLMTYPSFHLLIMGLGEITKDFSESIPLEDRVRNVLKVIGDETRF
FT                   KIIQYLFDKPATQKELAEVTGLSKSTISYHISLLFKASLVDIDVFNNIVMLRRETIKKL
FT                   VKNLKSILNLR"
FT   gene            complement(626292..627350)
FT                   /locus_tag="Kole_0578"
FT   CDS_pept        complement(626292..627350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0578"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: dal:Dalk_3679 transcriptional
FT                   regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79297"
FT                   /db_xref="GOA:C5CEW3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEW3"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACR79297.1"
FT                   /translation="MRLVIGQVEFVDLVLACTAVNSDKQAEKAQLRSEPRNLDELFSFV
FT                   EQVESKASWDVKTVASVFADLREEIPVLSGFPLSSKFVELEETIDELDKEFDKRFEMLL
FT                   FVVLTNKLAVSEDKAEELLKDGKTLLSALQNTDKLSKNSIWFLSQFVLFPEHLREITLS
FT                   ALNELKRYFESSGLRSYINEMCRREVSNITENSLNKVPNYFYGSHVLNFDSEEEFYIYL
FT                   QFALPDFGTLPIKIFGKRYVVLYGDIESVTRKGFSEFSVNTVKELLKGLSDPTRFMIIK
FT                   ALSERPKYVDELAAFCGLSKATISHHLSYLQSLGLLEKKRESKKMYYSLKKDAISNLLA
FT                   LLESMFHEDGED"
FT   gene            627582..627689
FT                   /locus_tag="Kole_0579"
FT   CDS_pept        627582..627689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79298"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79298.1"
FT                   /translation="MKKNMKREPVNLKSVFEEIEKMKVSVMSKNGALNI"
FT   gene            627862..628302
FT                   /locus_tag="Kole_0580"
FT   CDS_pept        627862..628302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79299"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEW5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79299.1"
FT                   /translation="MKTLKRLELYLLTIAVLLGIIASLLAYDIVINPMIKSYQINRQKK
FT                   QEMKERTYDVLEEISRIIFAIKGYYYLNRSLPDPNEILNDTEHTYNYSIDFEEMDAAYR
FT                   ISIRGNFPLLTNQKYLDEFRLEGKLYSTENSFLYVVYLDKFM"
FT   sig_peptide     627862..627942
FT                   /locus_tag="Kole_0580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            628321..629097
FT                   /locus_tag="Kole_0581"
FT   CDS_pept        628321..629097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0581"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: sei:SPC_3671
FT                   ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79300"
FT                   /db_xref="GOA:C5CEW6"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEW6"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACR79300.1"
FT                   /translation="MNVVVFGGTFWDVFIYGNRPHDVEILELPGGSGLNIAFGLYKLGH
FT                   SVCFFSNIGNDWRGTELLKKLSENGLSTYGLTIREGKTGYHIALNDTPIGVDRGVNRLN
FT                   IEFDNDTLKNADIVVINSEIPVESIYKICSKAEKLCFIDLGPRFVIDTSKLRKLSKAKL
FT                   ILIGNEKECEKEGCDVIKMGSKGASWKGVTVEGDLQNYPFKVGAGDIFDVVLIDSFLKG
FT                   LDKRICLERAVTISQTAAKEIKGAFSKMMILEPQSG"
FT   gene            complement(629606..630442)
FT                   /locus_tag="Kole_0582"
FT   CDS_pept        complement(629606..630442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79301"
FT                   /db_xref="GOA:C5CEW7"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACR79301.1"
FT                   /translation="MKYGIRIESPRFGKHDFVVGTNPFGIGTTGCASGANSFRVVPNCF
FT                   AVVMRAQKRSVVFILIFSGSRLLGFSMFFEQPTTIIVIGVINGMKKFIAVMFLMVLLLR
FT                   FALAEGIPEEILPIFAIPEYDKSNGIVEVFVSQKECVRGIDYEITVVFKDEDHPDCFIN
FT                   VIYDIYRFFKYGRIEDIETFHIITDKNGKLLELRFFGTFSGKHHFKDTKDLHGDAIIPF
FT                   NEVVFRDGRPVICVNTWNHMFGIDPSFELEEMLLIKDYEVSEGTRYDAEVEYSFLY"
FT   gene            complement(630426..630695)
FT                   /locus_tag="Kole_0583"
FT   CDS_pept        complement(630426..630695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0583"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: acylphosphatase; KEGG: nam:NAMH_0944
FT                   acylphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79302"
FT                   /db_xref="GOA:C5CEW8"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEW8"
FT                   /inference="protein motif:PFAM:PF00708"
FT                   /protein_id="ACR79302.1"
FT                   /translation="MKTVRILLSGIVQGVGFRYFAYRKAKKMGVTGYVRNLADGRVEVV
FT                   AEAEDSVLNDFINEIENGPPFAYVSKVELEELSPVHFDSFEIRY"
FT   gene            complement(630712..631353)
FT                   /locus_tag="Kole_0584"
FT   CDS_pept        complement(630712..631353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0584"
FT                   /product="protein of unknown function DUF1121"
FT                   /note="PFAM: protein of unknown function DUF1121; KEGG:
FT                   wsu:WS1833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Kole_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACR79303"
FT                   /db_xref="InterPro:IPR003741"
FT                   /db_xref="InterPro:IPR009501"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C5CEW9"
FT                   /inference="protein motif:PFAM:PF06555"
FT                   /protein_id="ACR79303.1"
FT                   /translation="MRKELLKWKYDNLASIVVKNFAKRGINAVYLSTPEEVVPKLEELM
FT                   PAGSSAAVGGSITLSQCGVLDFLRNGRYDFRDRYAAKTPEEKRKIFKEMFEVDYFLCSA
FT                   NAITIKGEIVQLDGHGTRVAPMIFGPDKVIIIAGMNKIVSDMDEAIKRIKYISPMNAKR
FT                   LNLHTPCTSTGICMDCHSTQRICETYVVITDSSARKGRYTVLLVGEDLGL"
FT   gene            631488..633758
FT                   /locus_tag="Kole_0585"
FT   CDS_pept        631488..633758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Kole_0585"
FT                   /product="A