(data stored in ACNUC7421 zone)

EMBL: CP001635

ID   CP001635; SV 1; circular; genomic DNA; STD; PRO; 5626353 BP.
XX
AC   CP001635; ACEE01000000-ACEE01000115;
XX
PR   Project:PRJNA30453;
XX
DT   19-JUN-2009 (Rel. 101, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 6)
XX
DE   Variovorax paradoxus S110 chromosome 1, complete sequence.
XX
KW   .
XX
OS   Variovorax paradoxus S110
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Comamonadaceae; Variovorax.
XX
RN   [1]
RP   1-5626353
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G., Orwin P.,
RA   Leadbetter J.R., Spain J.C., Han J.I.;
RT   "Complete sequence of chromosome 1 of Variovorax paradoxus S110";
RL   Unpublished.
XX
RN   [2]
RP   1-5626353
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G., Orwin P.,
RA   Leadbetter J.R., Spain J.C., Han J.I.;
RT   ;
RL   Submitted (03-JUN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 084375b250e7bc295403ebb74346999a.
DR   BioSample; SAMN02598472.
DR   EnsemblGenomes-Gn; EBG00001063929.
DR   EnsemblGenomes-Gn; EBG00001063930.
DR   EnsemblGenomes-Gn; EBG00001063931.
DR   EnsemblGenomes-Gn; EBG00001063932.
DR   EnsemblGenomes-Gn; EBG00001063933.
DR   EnsemblGenomes-Gn; EBG00001063934.
DR   EnsemblGenomes-Gn; EBG00001063935.
DR   EnsemblGenomes-Gn; EBG00001063936.
DR   EnsemblGenomes-Gn; EBG00001063937.
DR   EnsemblGenomes-Gn; EBG00001063938.
DR   EnsemblGenomes-Gn; EBG00001063939.
DR   EnsemblGenomes-Gn; EBG00001063940.
DR   EnsemblGenomes-Gn; EBG00001063941.
DR   EnsemblGenomes-Gn; EBG00001063942.
DR   EnsemblGenomes-Gn; EBG00001063943.
DR   EnsemblGenomes-Gn; EBG00001063944.
DR   EnsemblGenomes-Gn; EBG00001063945.
DR   EnsemblGenomes-Gn; EBG00001063946.
DR   EnsemblGenomes-Gn; EBG00001063947.
DR   EnsemblGenomes-Gn; EBG00001063948.
DR   EnsemblGenomes-Gn; EBG00001063949.
DR   EnsemblGenomes-Gn; EBG00001063950.
DR   EnsemblGenomes-Gn; EBG00001063951.
DR   EnsemblGenomes-Gn; EBG00001063952.
DR   EnsemblGenomes-Gn; EBG00001063953.
DR   EnsemblGenomes-Gn; EBG00001063954.
DR   EnsemblGenomes-Gn; EBG00001063955.
DR   EnsemblGenomes-Gn; EBG00001063956.
DR   EnsemblGenomes-Gn; EBG00001063957.
DR   EnsemblGenomes-Gn; EBG00001063958.
DR   EnsemblGenomes-Gn; EBG00001063959.
DR   EnsemblGenomes-Gn; EBG00001063960.
DR   EnsemblGenomes-Gn; EBG00001063961.
DR   EnsemblGenomes-Gn; EBG00001063962.
DR   EnsemblGenomes-Gn; EBG00001063963.
DR   EnsemblGenomes-Gn; EBG00001063964.
DR   EnsemblGenomes-Gn; EBG00001063965.
DR   EnsemblGenomes-Gn; EBG00001063966.
DR   EnsemblGenomes-Gn; EBG00001063967.
DR   EnsemblGenomes-Gn; EBG00001063968.
DR   EnsemblGenomes-Gn; EBG00001063969.
DR   EnsemblGenomes-Gn; EBG00001063970.
DR   EnsemblGenomes-Gn; EBG00001063971.
DR   EnsemblGenomes-Gn; EBG00001063972.
DR   EnsemblGenomes-Gn; EBG00001063973.
DR   EnsemblGenomes-Gn; EBG00001063974.
DR   EnsemblGenomes-Gn; EBG00001063975.
DR   EnsemblGenomes-Gn; EBG00001063976.
DR   EnsemblGenomes-Gn; EBG00001063977.
DR   EnsemblGenomes-Gn; EBG00001063978.
DR   EnsemblGenomes-Gn; EBG00001063979.
DR   EnsemblGenomes-Gn; EBG00001063980.
DR   EnsemblGenomes-Gn; EBG00001063981.
DR   EnsemblGenomes-Gn; EBG00001063982.
DR   EnsemblGenomes-Gn; EBG00001063983.
DR   EnsemblGenomes-Gn; EBG00001063984.
DR   EnsemblGenomes-Gn; EBG00001063985.
DR   EnsemblGenomes-Gn; EBG00001063986.
DR   EnsemblGenomes-Gn; EBG00001063987.
DR   EnsemblGenomes-Gn; EBG00001063988.
DR   EnsemblGenomes-Gn; EBG00001063989.
DR   EnsemblGenomes-Gn; Vapar_R0001.
DR   EnsemblGenomes-Gn; Vapar_R0002.
DR   EnsemblGenomes-Gn; Vapar_R0003.
DR   EnsemblGenomes-Gn; Vapar_R0004.
DR   EnsemblGenomes-Gn; Vapar_R0005.
DR   EnsemblGenomes-Gn; Vapar_R0006.
DR   EnsemblGenomes-Gn; Vapar_R0007.
DR   EnsemblGenomes-Gn; Vapar_R0008.
DR   EnsemblGenomes-Gn; Vapar_R0009.
DR   EnsemblGenomes-Gn; Vapar_R0010.
DR   EnsemblGenomes-Gn; Vapar_R0011.
DR   EnsemblGenomes-Gn; Vapar_R0012.
DR   EnsemblGenomes-Gn; Vapar_R0013.
DR   EnsemblGenomes-Gn; Vapar_R0014.
DR   EnsemblGenomes-Gn; Vapar_R0015.
DR   EnsemblGenomes-Gn; Vapar_R0016.
DR   EnsemblGenomes-Gn; Vapar_R0017.
DR   EnsemblGenomes-Gn; Vapar_R0018.
DR   EnsemblGenomes-Gn; Vapar_R0019.
DR   EnsemblGenomes-Gn; Vapar_R0020.
DR   EnsemblGenomes-Gn; Vapar_R0021.
DR   EnsemblGenomes-Gn; Vapar_R0022.
DR   EnsemblGenomes-Gn; Vapar_R0023.
DR   EnsemblGenomes-Gn; Vapar_R0024.
DR   EnsemblGenomes-Gn; Vapar_R0025.
DR   EnsemblGenomes-Gn; Vapar_R0026.
DR   EnsemblGenomes-Gn; Vapar_R0027.
DR   EnsemblGenomes-Gn; Vapar_R0028.
DR   EnsemblGenomes-Gn; Vapar_R0029.
DR   EnsemblGenomes-Gn; Vapar_R0030.
DR   EnsemblGenomes-Gn; Vapar_R0031.
DR   EnsemblGenomes-Gn; Vapar_R0032.
DR   EnsemblGenomes-Gn; Vapar_R0033.
DR   EnsemblGenomes-Gn; Vapar_R0034.
DR   EnsemblGenomes-Gn; Vapar_R0035.
DR   EnsemblGenomes-Gn; Vapar_R0036.
DR   EnsemblGenomes-Gn; Vapar_R0037.
DR   EnsemblGenomes-Gn; Vapar_R0038.
DR   EnsemblGenomes-Gn; Vapar_R0039.
DR   EnsemblGenomes-Gn; Vapar_R0040.
DR   EnsemblGenomes-Gn; Vapar_R0041.
DR   EnsemblGenomes-Gn; Vapar_R0042.
DR   EnsemblGenomes-Gn; Vapar_R0043.
DR   EnsemblGenomes-Gn; Vapar_R0044.
DR   EnsemblGenomes-Gn; Vapar_R0045.
DR   EnsemblGenomes-Gn; Vapar_R0046.
DR   EnsemblGenomes-Gn; Vapar_R0047.
DR   EnsemblGenomes-Gn; Vapar_R0048.
DR   EnsemblGenomes-Gn; Vapar_R0049.
DR   EnsemblGenomes-Gn; Vapar_R0050.
DR   EnsemblGenomes-Gn; Vapar_R0051.
DR   EnsemblGenomes-Gn; Vapar_R0052.
DR   EnsemblGenomes-Gn; Vapar_R0053.
DR   EnsemblGenomes-Gn; Vapar_R0054.
DR   EnsemblGenomes-Gn; Vapar_R0055.
DR   EnsemblGenomes-Gn; Vapar_R0056.
DR   EnsemblGenomes-Tr; EBT00001666908.
DR   EnsemblGenomes-Tr; EBT00001666909.
DR   EnsemblGenomes-Tr; EBT00001666910.
DR   EnsemblGenomes-Tr; EBT00001666911.
DR   EnsemblGenomes-Tr; EBT00001666912.
DR   EnsemblGenomes-Tr; EBT00001666913.
DR   EnsemblGenomes-Tr; EBT00001666914.
DR   EnsemblGenomes-Tr; EBT00001666915.
DR   EnsemblGenomes-Tr; EBT00001666917.
DR   EnsemblGenomes-Tr; EBT00001666918.
DR   EnsemblGenomes-Tr; EBT00001666920.
DR   EnsemblGenomes-Tr; EBT00001666921.
DR   EnsemblGenomes-Tr; EBT00001666922.
DR   EnsemblGenomes-Tr; EBT00001666923.
DR   EnsemblGenomes-Tr; EBT00001666924.
DR   EnsemblGenomes-Tr; EBT00001666925.
DR   EnsemblGenomes-Tr; EBT00001666926.
DR   EnsemblGenomes-Tr; EBT00001666927.
DR   EnsemblGenomes-Tr; EBT00001666929.
DR   EnsemblGenomes-Tr; EBT00001666930.
DR   EnsemblGenomes-Tr; EBT00001666931.
DR   EnsemblGenomes-Tr; EBT00001666932.
DR   EnsemblGenomes-Tr; EBT00001666934.
DR   EnsemblGenomes-Tr; EBT00001666935.
DR   EnsemblGenomes-Tr; EBT00001666936.
DR   EnsemblGenomes-Tr; EBT00001666937.
DR   EnsemblGenomes-Tr; EBT00001666938.
DR   EnsemblGenomes-Tr; EBT00001666939.
DR   EnsemblGenomes-Tr; EBT00001666940.
DR   EnsemblGenomes-Tr; EBT00001666941.
DR   EnsemblGenomes-Tr; EBT00001666942.
DR   EnsemblGenomes-Tr; EBT00001666944.
DR   EnsemblGenomes-Tr; EBT00001666945.
DR   EnsemblGenomes-Tr; EBT00001666946.
DR   EnsemblGenomes-Tr; EBT00001666947.
DR   EnsemblGenomes-Tr; EBT00001666948.
DR   EnsemblGenomes-Tr; EBT00001666949.
DR   EnsemblGenomes-Tr; EBT00001666950.
DR   EnsemblGenomes-Tr; EBT00001666951.
DR   EnsemblGenomes-Tr; EBT00001666952.
DR   EnsemblGenomes-Tr; EBT00001666953.
DR   EnsemblGenomes-Tr; EBT00001666954.
DR   EnsemblGenomes-Tr; EBT00001666955.
DR   EnsemblGenomes-Tr; EBT00001666956.
DR   EnsemblGenomes-Tr; EBT00001666957.
DR   EnsemblGenomes-Tr; EBT00001666958.
DR   EnsemblGenomes-Tr; EBT00001666959.
DR   EnsemblGenomes-Tr; EBT00001666960.
DR   EnsemblGenomes-Tr; EBT00001666961.
DR   EnsemblGenomes-Tr; EBT00001666962.
DR   EnsemblGenomes-Tr; EBT00001666963.
DR   EnsemblGenomes-Tr; EBT00001666964.
DR   EnsemblGenomes-Tr; EBT00001666965.
DR   EnsemblGenomes-Tr; EBT00001666966.
DR   EnsemblGenomes-Tr; EBT00001666967.
DR   EnsemblGenomes-Tr; EBT00001666968.
DR   EnsemblGenomes-Tr; EBT00001666969.
DR   EnsemblGenomes-Tr; EBT00001666970.
DR   EnsemblGenomes-Tr; EBT00001666971.
DR   EnsemblGenomes-Tr; EBT00001666972.
DR   EnsemblGenomes-Tr; EBT00001666973.
DR   EnsemblGenomes-Tr; Vapar_R0001-1.
DR   EnsemblGenomes-Tr; Vapar_R0002-1.
DR   EnsemblGenomes-Tr; Vapar_R0003-1.
DR   EnsemblGenomes-Tr; Vapar_R0004-1.
DR   EnsemblGenomes-Tr; Vapar_R0005-1.
DR   EnsemblGenomes-Tr; Vapar_R0006-1.
DR   EnsemblGenomes-Tr; Vapar_R0007-1.
DR   EnsemblGenomes-Tr; Vapar_R0008-1.
DR   EnsemblGenomes-Tr; Vapar_R0009-1.
DR   EnsemblGenomes-Tr; Vapar_R0010-1.
DR   EnsemblGenomes-Tr; Vapar_R0011-1.
DR   EnsemblGenomes-Tr; Vapar_R0012-1.
DR   EnsemblGenomes-Tr; Vapar_R0013-1.
DR   EnsemblGenomes-Tr; Vapar_R0014-1.
DR   EnsemblGenomes-Tr; Vapar_R0015-1.
DR   EnsemblGenomes-Tr; Vapar_R0016-1.
DR   EnsemblGenomes-Tr; Vapar_R0017-1.
DR   EnsemblGenomes-Tr; Vapar_R0018-1.
DR   EnsemblGenomes-Tr; Vapar_R0019-1.
DR   EnsemblGenomes-Tr; Vapar_R0020-1.
DR   EnsemblGenomes-Tr; Vapar_R0021-1.
DR   EnsemblGenomes-Tr; Vapar_R0022-1.
DR   EnsemblGenomes-Tr; Vapar_R0023-1.
DR   EnsemblGenomes-Tr; Vapar_R0024-1.
DR   EnsemblGenomes-Tr; Vapar_R0025-1.
DR   EnsemblGenomes-Tr; Vapar_R0026-1.
DR   EnsemblGenomes-Tr; Vapar_R0027-1.
DR   EnsemblGenomes-Tr; Vapar_R0028-1.
DR   EnsemblGenomes-Tr; Vapar_R0029-1.
DR   EnsemblGenomes-Tr; Vapar_R0030-1.
DR   EnsemblGenomes-Tr; Vapar_R0031-1.
DR   EnsemblGenomes-Tr; Vapar_R0032-1.
DR   EnsemblGenomes-Tr; Vapar_R0033-1.
DR   EnsemblGenomes-Tr; Vapar_R0034-1.
DR   EnsemblGenomes-Tr; Vapar_R0035-1.
DR   EnsemblGenomes-Tr; Vapar_R0036-1.
DR   EnsemblGenomes-Tr; Vapar_R0037-1.
DR   EnsemblGenomes-Tr; Vapar_R0038-1.
DR   EnsemblGenomes-Tr; Vapar_R0039-1.
DR   EnsemblGenomes-Tr; Vapar_R0040-1.
DR   EnsemblGenomes-Tr; Vapar_R0041-1.
DR   EnsemblGenomes-Tr; Vapar_R0042-1.
DR   EnsemblGenomes-Tr; Vapar_R0043-1.
DR   EnsemblGenomes-Tr; Vapar_R0044-1.
DR   EnsemblGenomes-Tr; Vapar_R0045-1.
DR   EnsemblGenomes-Tr; Vapar_R0046-1.
DR   EnsemblGenomes-Tr; Vapar_R0047-1.
DR   EnsemblGenomes-Tr; Vapar_R0048-1.
DR   EnsemblGenomes-Tr; Vapar_R0049-1.
DR   EnsemblGenomes-Tr; Vapar_R0050-1.
DR   EnsemblGenomes-Tr; Vapar_R0051-1.
DR   EnsemblGenomes-Tr; Vapar_R0052-1.
DR   EnsemblGenomes-Tr; Vapar_R0053-1.
DR   EnsemblGenomes-Tr; Vapar_R0054-1.
DR   EnsemblGenomes-Tr; Vapar_R0055-1.
DR   EnsemblGenomes-Tr; Vapar_R0056-1.
DR   EuropePMC; PMC3127585; 21498748.
DR   EuropePMC; PMC3536118; 23087034.
DR   EuropePMC; PMC3754582; 23772073.
DR   EuropePMC; PMC5132249; 27907117.
DR   EuropePMC; PMC6595409; 31294068.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP001635.
DR   SILVA-SSU; CP001635.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4083788
CC   Source DNA and bacteria available from Jong-In Han (jihan@rpi.edu)
CC   Contacts: Jong-In Han (jihan@rpi.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Variovorax paradoxus S110
CC   GOLD Stamp ID         :: Gi02062
CC   Funding Program       :: DOE-CSP 2008
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Soil
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5626353
FT                   /organism="Variovorax paradoxus S110"
FT                   /chromosome="1"
FT                   /strain="S110"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:543728"
FT   gene            37..1416
FT                   /locus_tag="Vapar_0001"
FT   CDS_pept        37..1416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: aav:Aave_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16664"
FT                   /db_xref="GOA:C5CV71"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C5CV71"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACS16664.1"
FT                   /translation="MSTDGIGESLWQACVDQLAQELSEQQFNTWIKPLTAQVADDLSRM
FT                   TVFVANRFKLDWIRAQYAGKIAAMAEKMYGQPVAVELALAPREAPVRSAPVAVLAETDV
FT                   PRDVAGPGEEPANAGFKNRLNSGLTFDTLVEGTANRMARAAAMHVAGMPGHLYNPLFIY
FT                   GGVGLGKTHLMHAVGNRLLADRPDSKVLYIHAEQFVSDVVKAYQRKTFDEFKERYHSLD
FT                   LLLIDDVQFFANKDRTQEEFFNAFEALLAKKSHIVMTSDTYPKGLADIHERLVSRFDSG
FT                   LTVAIEPPELEMRVAILINKARAESAEMPEEVAFFVAKNVRSNVRELEGALRKILAYSR
FT                   FNQKEISIALAREALRDLLSIQNRQISVENIQKTVADYYKIKVADMYSKKRPASIARPR
FT                   QIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKISGERQQLTELNQQLHVLEQTLK
FT                   G"
FT   gene            1506..2612
FT                   /locus_tag="Vapar_0002"
FT   CDS_pept        1506..2612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: pol:Bpro_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain; SMART: DNA polymerase III
FT                   beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16665"
FT                   /db_xref="GOA:C5CV72"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C5CV72"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACS16665.1"
FT                   /translation="MIVLKATQDKVLAALQSVAGIVERRHTLPILANVLIRKTGGQLQL
FT                   TTSDLEIQIRTTAELGGDEGNFTTTIGARKLIDILRTMPADQTVSLESSASKLVLKGGK
FT                   SRFTLQSLPAEDFPLVQEAANFGPVFSVPQKTLKDLLSQVSFAMAVHDIRYYLNGILFV
FT                   AEGKQLSLVATDGHRLAFSSATLDVEVPRQEVILPRKTVLEMQRLLSDAEGAIEMQFAN
FT                   NQAKFSFGGMEFVTKLVEGKFPDYNRVIPKNHKNSVTLGRAPLLASLQRTAILTSEKFK
FT                   GVRLNIEPGTLRIASNNAEQEEAQDELDIDYGGDAIEIGFNVTYLIDALSNMDQDMVKL
FT                   DLADSNSSALLTIPENASFKYVVMPMRI"
FT   gene            2747..5371
FT                   /locus_tag="Vapar_0003"
FT   CDS_pept        2747..5371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: pol:Bpro_0003 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16666"
FT                   /db_xref="GOA:C5CV73"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C5CV73"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACS16666.1"
FT                   /translation="MSAEENKPEVPHTEPVYTPEIESAVPIEITPADTSYGEGSITILE
FT                   GLEAVRKRPGMYIGDTSDGTGLHHLVFEVVDNSIDEALAGHCDDIVVTIHTDNSISVTD
FT                   NGRGIPTGVKMDDKHEPKRSASEIALTELHAGGKFNQNSYKVSGGLHGVGVSCVNALSV
FT                   MLRLVVRREGKIHELEFSRGFVQNRLIETVNGVEVSPMRIIGETDKRGTEVHFLPDTEI
FT                   FKENADFHYEILSKRLRELSFLNNGVRIRLKDERSGKEDDFSGAGGVKGFVDFINKGKT
FT                   VLHPNVFYAMGEKPADTYGGIPGTHIGVEVAMQWNSGYNEQVLCFTNNIPQRDGGTHLT
FT                   GLRAAMTRVINKYIEENEFAKKAKVEVTGDDMREGLCCVLSVKVPEPKFSSQTKDKLVS
FT                   SEVRAPVEDIVGRLLTDYLQERPNDAKIICGKIVEAARAREAARKAREMTRRKGVLDGM
FT                   GLPGKLADCQEKDPALCEVYLVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKARYEK
FT                   LLTSNEILTMITALGTGIGRAGATSAGGGADDFNVAKLRYHRIIIMTDADVDGAHIRTL
FT                   LLTFFYRQMPELVERGHIYIAQPPLYKVKVGKEEQYLKDGPALDAFLLKVALKDASIET
FT                   GGPNSTTLSGDTLAELARKHQLAEAVIARLRNFMDAEALRAIADGVALDLDTTPAAEAS
FT                   AVALQAKLRELNTTGVPAEVSSEFDARTDKPLLRISRRHHGNIKSSVLTQDFVHGADYA
FT                   ALAEAANTFRNLLSSEGATVRRGEGERAKEEKVADFRIAMKWLIGQAENATSRQRYKGL
FT                   GEMNPAQLWETTMDPTVRRLLRVQIDDAIEADRVFTMLMGDEVEPRREFIEQNALRAAN
FT                   IDV"
FT   gene            5659..6645
FT                   /locus_tag="Vapar_0004"
FT   CDS_pept        5659..6645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0004"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: oca:OCAR_5419 transcription factor jumonji,
FT                   JmjC"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16667"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="UniProtKB/TrEMBL:C5CV74"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16667.1"
FT                   /translation="MCVTSMNSVGASETTYRVWTDDPGSFSTQRITPMHHNFHEHPLFQ
FT                   VPELVRLGMELSKLDQCRFMNPDRTVASRLAHDSRPPDGRSIAEFFKRVEEPGSSVAFY
FT                   NIEVIPRYQALLMSVVNSMRSLVEREQPDIFRVNGFVFFSAPPSVTPFHIDRENNFWLQ
FT                   LHGHKILNVWDHRDRSIVPAEAVEDFIVTQSLQKVRFNQAFLPRGLEFDAQPGDAVYFP
FT                   STSPHMTRSTADRAATPGGRLSISIGVTFYTASTRKVARIHQVNRLMRKCGMSPSYPSE
FT                   SPTADTAKSAVGGLVGACRARLGAARARFICMTSARRVKHAPPPGSY"
FT   gene            complement(6745..7032)
FT                   /locus_tag="Vapar_0005"
FT   CDS_pept        complement(6745..7032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0005"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16668"
FT                   /db_xref="UniProtKB/TrEMBL:C5CV75"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16668.1"
FT                   /translation="MTIGSRIEAIKQKDARRPGFPGEHLAVLGTGVLLLLTAGRSHSLA
FT                   RRLLAGAAGGALVGRAASGTGGLARVAQMMHGGRGERSAGRGRVHVHRSI"
FT   gene            7335..7847
FT                   /locus_tag="Vapar_0006"
FT   CDS_pept        7335..7847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbr:BB3068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16669"
FT                   /db_xref="UniProtKB/TrEMBL:C5CV76"
FT                   /inference="similar to AA sequence:KEGG:BB3068"
FT                   /protein_id="ACS16669.1"
FT                   /translation="MNLMRLRQPMAALVLGGTAAFFGAMTSAHAFSNPPIQMAQGVEYM
FT                   CGGTNKAEAAFMQMVSPRWAATIEFGINDSAQRGSFPARAAVQVREKYTGRPVMEAQSQ
FT                   GPYMLARLDPGAYDVNVTLGGLTMTQTLTVIAGVPARAVFMWPSNFDMASVMPPMPQAL
FT                   AQTSAAR"
FT   sig_peptide     7335..7427
FT                   /locus_tag="Vapar_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 31"
FT   gene            7977..8465
FT                   /locus_tag="Vapar_0007"
FT   CDS_pept        7977..8465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0007"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A1517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16670"
FT                   /db_xref="UniProtKB/TrEMBL:C5CV77"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16670.1"
FT                   /translation="MTPRISSHARPLAAAMLCGAVLLAALSSSAHATVNPPIRMAHGIE
FT                   YMSGGIGSDEAKLMETVAPRWPATFEFAIKDHAGAEFASDVRVTVRDSHGTVLLDNVES
FT                   AGPFMVARLDPGTYEVEARLRGNTLKQTLQVRPGAPARVAFVWPAGTDMASAGTRAVQ"
FT   sig_peptide     7977..8075
FT                   /locus_tag="Vapar_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 33"
FT   gene            8597..9844
FT                   /locus_tag="Vapar_0008"
FT   CDS_pept        8597..9844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0008"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: pol:Bpro_0021
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16671"
FT                   /db_xref="GOA:C5CVX3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVX3"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACS16671.1"
FT                   /translation="MRGMRLADAVSRATPVPIAPMPIRSLSVLTALLHVYIALRLLPAL
FT                   AMLTPAWPLALAALAISALTIPLPFVSRGRERGASAGELLQWTGLISMGWFSSLFVSTL
FT                   LRDAGLLLAWLASVLFGAPVPWHAVLPWSAMAVLVLATLVSMVGFLNARRTADVKRVEV
FT                   PIRGLPAALEGFTIAQLSDIHVGPTIRSAYIQRIVDAVNRLGADAIAITGDLVDGSVAE
FT                   LREHIAPLAGLRAKHGTFVVTGNHEYYAGAHAWIDELRRLGLRVLLNEHVVLQTRNVRG
FT                   AQNDEELFESQLVLAGVTDYTAGHFDAAHASDPHLALFDAPPLVHTRVLLAHQPRSATL
FT                   AAQAGYQLQLSGHTHGGQFFPWNLFVPMQQPFTAGLHRLHDMWVYVSRGTGYWGPPKRF
FT                   GAPSEITLLTLVMARG"
FT   gene            complement(9860..10360)
FT                   /locus_tag="Vapar_0009"
FT   CDS_pept        complement(9860..10360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A1029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16672"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVX4"
FT                   /inference="similar to AA sequence:KEGG:Mpe_A1029"
FT                   /protein_id="ACS16672.1"
FT                   /translation="MPSLTSVARLSNPLMLWVDVALKTQEMLLSSGSVIQMRTGRMAKA
FT                   GLAPSAADLAEFQLMGDEKIAAAGQSGAAMVRQWHSSHVSLANRALQQWILSAGAFLSM
FT                   AGSVTPAQAAERSDAFVQATARAAGTASRLSGAAVRIAREGLKPIHAAATSNARRLAAE
FT                   LRG"
FT   gene            10565..11140
FT                   /locus_tag="Vapar_0010"
FT   CDS_pept        10565..11140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0010"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16673"
FT                   /db_xref="GOA:C5CVX5"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVX5"
FT                   /inference="similar to AA sequence:KEGG:Aave_0023"
FT                   /protein_id="ACS16673.1"
FT                   /translation="MKTHRSASLGAAVFAGVLSLLGAPAHAFEDSARGYYFEGGHAPHG
FT                   DQGGTESATVGVTLPWSPRQPVHEGALTSYWDLFASHWHAPALGGGSRNYTQIGAIYTW
FT                   RYRFDSGSSPWFAEGGVGGTVMDHLYRTPDRSFSTAFQFTEVLGVGRSFGENGRHELTL
FT                   RLQHFSNAGIKKPNPGENFVRLRYTYHF"
FT   sig_peptide     10565..10648
FT                   /locus_tag="Vapar_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 28"
FT   gene            complement(11137..12108)
FT                   /locus_tag="Vapar_0011"
FT   CDS_pept        complement(11137..12108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A0046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16674"
FT                   /db_xref="GOA:C5CVX6"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVX6"
FT                   /inference="similar to AA sequence:KEGG:Mpe_A0046"
FT                   /protein_id="ACS16674.1"
FT                   /translation="MSISTAKPAHRPWWPWLRRIAVWAFFGLIAWLLVSQARAIDWQEV
FT                   FDAMRALPAATLWLAGALAAGSFATYSTYDLLGRHLTRHPLGARTVMGVTFISYAFNLN
FT                   LGSLVGGVAFRYRLYSRLGLPNGTITRVLGFSMLTNWLGYLVVAGVAFCFWPLVLPAEW
FT                   KVGNGGLRILGAVLLLLAAGYFVLCALASGHVFRLRHYPFKVPSLRMAWLQLALSCLNW
FT                   ALIGSVIWVLLQGAVAYHTVLAVLLVAAVAGVVTHVPAGLGVLEAVFLALLSHEVAQGR
FT                   LLGVLLVYRGLYYLLPLGVATVAYFVTELRARRWRHAAPLKR"
FT   sig_peptide     complement(11989..12108)
FT                   /locus_tag="Vapar_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.724 at
FT                   residue 40"
FT   gene            complement(12105..13373)
FT                   /locus_tag="Vapar_0012"
FT   CDS_pept        complement(12105..13373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0012"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; SMART:
FT                   phospholipase D/Transphosphatidylase; KEGG: pol:Bpro_0025
FT                   cardiolipin synthase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16675"
FT                   /db_xref="GOA:C5CVX7"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVX7"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ACS16675.1"
FT                   /translation="MDNVGQWVGGNRIALLENGEEFFPRVFDAIRGAQREVIIETFILF
FT                   EDKVGLALHAAMRSAAQRGVKIDLLVDGFGSPDLSREFISQLSAVGVRVRVFDPGQPVL
FT                   GKRLNVFRRMHRKIVVVDGELAFVGGINYSADHLLDYGPKAKQDYAVELRGPVVAQIHQ
FT                   FVLRAIALGDKGPRWFRRRLKQAPPVDRESVGDVEAVLITRDNRRHTSDIEREYLAAIR
FT                   AARKRIVIANAYFFPGYRLIKELRRAARRGVDVRLILQGEPDMPIVKTAATMLYHHLLH
FT                   AGVRIYEYCDRPLHAKVALMDDGWTTVGSSNLDPLSLSLNLEANVFARGRAFNQLLWER
FT                   MDKLMRESCQQIGEADLESGWSGWRLVRSFFIFHFLRWYPSWLGWLPRQVPRLTPAEAI
FT                   ELAEKREKREGAGDNGATPTEAA"
FT   gene            complement(13407..14135)
FT                   /locus_tag="Vapar_0013"
FT   CDS_pept        complement(13407..14135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0013"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   mpt:Mpe_A0048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16676"
FT                   /db_xref="GOA:C5CVX8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVX8"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACS16676.1"
FT                   /translation="MTVNTHKGFTALNRKFILPELRDAVRTVGADVVFLQEVLGTHSRH
FT                   SRKVNNWPEAPHYEFLADTMWPQFAYGRNAVYPRGHHGNAVLSKFPIVHFRNHDVSVAG
FT                   PEKRGLLHCVLRLPGRTVDVHAICAHLGLAEAHRQQQLELLLHIVRDEVPADAPLIVAG
FT                   DFNDWRGRAHQVLEEGAALREVFVHANGSAAKTFPARFPLLPLDRIYVRNAGVHAPVVL
FT                   PRKPWSHLSDHAPLVANIDL"
FT   gene            14401..14829
FT                   /locus_tag="Vapar_0014"
FT   CDS_pept        14401..14829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0014"
FT                   /product="serine/threonine kinase"
FT                   /note="KEGG: mlo:mlr2363 serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16677"
FT                   /db_xref="GOA:C5CVX9"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVX9"
FT                   /inference="similar to AA sequence:KEGG:mlr2363"
FT                   /protein_id="ACS16677.1"
FT                   /translation="MKHAILHATALAGLMAAAGAAMAQATSIPAQPDPAVSGQASTQTP
FT                   SGVPNPPQRPDASMPVSREAVKAEARAHNRNNANNPVPKGEASTTVNAQPNAMPQPTGE
FT                   MSRAEVSQMARKTKPRFGQPGERPDVPTNPSERTGTPQ"
FT   sig_peptide     14401..14472
FT                   /locus_tag="Vapar_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.889 at
FT                   residue 24"
FT   gene            complement(14922..15500)
FT                   /locus_tag="Vapar_0015"
FT   CDS_pept        complement(14922..15500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0015"
FT                   /product="protein of unknown function DUF1520"
FT                   /note="PFAM: protein of unknown function DUF1520; KEGG:
FT                   dac:Daci_0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16678"
FT                   /db_xref="GOA:C5CVY0"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVY0"
FT                   /inference="protein motif:PFAM:PF07480"
FT                   /protein_id="ACS16678.1"
FT                   /translation="MISLRQRIVWASLLGSAALASSGAFAQQAPAAPGTSPSTPTAAVA
FT                   QAEGSAAPKAQHKRMDPAQRMERMQEHRTKRLAALKEKLKLNAGQESAWTTFAAASQPP
FT                   ARTQRMDRAEFAKLTTPERLERMQARQAERSARFAKRTEATKAFYAALTPEQQKTFDAE
FT                   TVHVGMHGHRGHHRHGGADGQPSAAPAKS"
FT   sig_peptide     complement(15420..15500)
FT                   /locus_tag="Vapar_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(15650..16741)
FT                   /locus_tag="Vapar_0016"
FT   CDS_pept        complement(15650..16741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0016"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="KEGG: pol:Bpro_0028 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16679"
FT                   /db_xref="GOA:C5CVY1"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVY1"
FT                   /inference="similar to AA sequence:KEGG:Bpro_0028"
FT                   /protein_id="ACS16679.1"
FT                   /translation="MPHRTTKAPEVRKGQAPETLKRDQFHERFMQPFQDPAFQSEKEAL
FT                   RRIELIAWEAYEQGRKSPVTRKAGPGHADPDYELSVDWLEARARIDAAQAAWGSPQTRS
FT                   RALLVNGSPRNDGTCPGEISKSWRLLQLAREVLDGCGIEVDVLDLSLLASDYGRHIHPC
FT                   KGCVSTAMPLCHWPCSCYPNHALRQTGDWMNEIYERWVSAHGVILFTPTHWYQSASPLK
FT                   LMTDRLVCADGGNPDPTSTHGKKPDEAKALELQGWGYPKHLAGRVYGLVVHGDVAGAES
FT                   VRRNLSDWLDWMGLIDAGAQARLDRYIGYYEPYATSHDSLDADEGVQEEVRNVARAVAL
FT                   AVGELRAGKLQAPDRGLKPPRLK"
FT   gene            complement(16817..17716)
FT                   /locus_tag="Vapar_0017"
FT   CDS_pept        complement(16817..17716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0017"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: rso:RSc0541
FT                   pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16680"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVY2"
FT                   /inference="protein motif:PFAM:PF05726"
FT                   /protein_id="ACS16680.1"
FT                   /translation="MTNANHHANHPTDPVATPRGIDHIVAGVSTSDGDGVKLTRVLQQP
FT                   LQKRLDPYLMLDAFGSDNPGDYIGGFPSHPHRGFETVTYMIAGRMRHRDSAGHEGLLQN
FT                   GGVQWMTAGRGLVHSELPEQEDGLMEGFQLWLNLPAKDKMREPWYRDIQSEEIPEYTTA
FT                   AGVHVRVIAGASHGIEGAVRREHTEPLYLDITLPPGAEFAQPLPDDHNALVYAFRESVW
FT                   IAGSEVPTRRMAILANDPGSDGVVLRAGATNHSPARALLIAGKPLHEPIAQYGPFVMNT
FT                   QEQLKEAVQDFQSGKFGA"
FT   gene            complement(17773..18525)
FT                   /locus_tag="Vapar_0018"
FT   CDS_pept        complement(17773..18525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0018"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   pol:Bpro_2418 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16681"
FT                   /db_xref="GOA:C5CVY3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVY3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS16681.1"
FT                   /translation="MNEVEAIERATVAAVSPLVVEELDGWLLPFDDGTVKRARSAVPLH
FT                   REPVAGRTIDRIEDRYDRRHFVPAFRLADVPSFVALQSELEQRHYVGDSPTCVQVGSAR
FT                   RMREVAAAGAPLADVDLAPDDAWATLFLGEGFDPVDGAHRVRALSRAQGSLYASVREGR
FT                   QTVAAGAMAFGHGWASVHGMRTEQSQRGRGLAGRVLAGLAQAALARGFEQVFLQVDAHN
FT                   LAAHALYRRAGFSTRWQYRYWQRQQWPR"
FT   gene            complement(18522..19796)
FT                   /locus_tag="Vapar_0019"
FT   CDS_pept        complement(18522..19796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0019"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51; KEGG:
FT                   pna:Pnap_0025 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16682"
FT                   /db_xref="GOA:C5CVY4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVY4"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ACS16682.1"
FT                   /translation="MKQFLRFVIYGLLALVVTTCVAIFLIVKLVLAPAAGEWSTTVEAG
FT                   PLRFAVGVPTAVRLATSSWFAPRLDGHSFDSRFGTLHFAWKDAAGVLEVRCSPCSAEVA
FT                   ALGTQPIVFEGLVATVKREGNTLAGTIEATPRSAEAAAVLQGQWQGQLVPKGKGLQLSV
FT                   DIKDAPIARWYAVLAPSLPELQRARIGGTLALRGQVMLPEATFAVQPTVSQFTVEGLGT
FT                   EAMLGARTSCGAPSKLANDSWLARAVIAAEDQRFFTHAGYDLTEIVASIDNNQKEGQPK
FT                   RGGSTLTQQLAKMLVTGSDRTAERKLRELLYAVEMEQTLGKARILQLYLDNAPWGGNLC
FT                   GAEAAARRYFKRSARSLEPAQAVWLASMLHKPQAVLEQWRRDGQIDPDRTKWVAESVRG
FT                   ISRNQRESLLKSVAAARFTAPEAFP"
FT   gene            complement(19807..20376)
FT                   /locus_tag="Vapar_0020"
FT   CDS_pept        complement(19807..20376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_0026 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16683"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVY5"
FT                   /inference="similar to AA sequence:KEGG:Pnap_0026"
FT                   /protein_id="ACS16683.1"
FT                   /translation="MSTRFFEVLFANHFINRIGHKTAFALLMLLCMLWSTAAALRAPPE
FT                   PSMAMASHEWPSQWDGVPLRPLALGDVEQRFADRFPGAIGRMTDGTQTIVMRAVNAPTR
FT                   MLHPAADCYRALGFRIEQARLERDAQERLWRCFVAQRHSAQKIRVCERIVDAEGTAFTD
FT                   TSAWYWAAASGRSSGPWQAVTVARPM"
FT   sig_peptide     complement(20257..20376)
FT                   /locus_tag="Vapar_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.449 at
FT                   residue 40"
FT   gene            complement(20357..21286)
FT                   /locus_tag="Vapar_0021"
FT   CDS_pept        complement(20357..21286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_0027 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16684"
FT                   /db_xref="GOA:C5CVY6"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16684.1"
FT                   /translation="MSLAALAHRHPRIVDWGIHVDRAPAAGWLALQFAALAPTWAWMAR
FT                   RLRDGSDDPLGLLALAALAALAWHCRRELRAAPQLGWLALAGAGTVLATALRTGLGALP
FT                   ALPPLATGLVAVLALACGLLAFLPRRVAALPVAGLAVLALPLLSSLQFYAGYPLRVVTA
FT                   EASRWLLAPGFSVAREGSSLVVDGRLVIVDAPCSGVQMVWLGYFTACAVALWARRSDRG
FT                   FLRRLPMVGLMVLGGNILRNSMLIAFEGAGHPLAPWAHNLLGLLILAAVCGGIARLMVP
FT                   VRTEPAFADRPIPGLITTQGGRHVDTVL"
FT   gene            complement(21305..23380)
FT                   /locus_tag="Vapar_0022"
FT   CDS_pept        complement(21305..23380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0022"
FT                   /product="Vault protein inter-alpha-trypsin domain protein"
FT                   /note="PFAM: Vault protein inter-alpha-trypsin domain
FT                   protein; von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; Vault protein
FT                   inter-alpha-trypsin, metazoa; KEGG: pna:Pnap_0028 vault
FT                   protein inter-alpha-trypsin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16685"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="InterPro:IPR013694"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVY7"
FT                   /inference="protein motif:PFAM:PF08487"
FT                   /protein_id="ACS16685.1"
FT                   /translation="MDAHTSTRPGRWLWLATVSLATAGFVALSLNPVHAQEAPGPRLKT
FT                   ESPYFFVKSDDPAVDRLPLKATEVAVKISGVIADVTVTQTYRNEGQRAIEAKYVFPGST
FT                   KAAVSGLNVRLADRLITAQIREKQQAQIEYDSAKKEGKTAALLEQHLPNVFQMNVANIL
FT                   PGDDVKVELRYTELLVPQSGNYAFVFPTVVGPRYNSPQSENAQAKWVAQPTLRADVAPN
FT                   TSFRLKASIDTPMGLKEVRSSSHTIEVKKSDEDRHADIVLAADGRPADNRDFVLDYRLA
FT                   GERIESGLMLYKGQNTDGSAENFFLAMVEPPKAVAASAISPRDYIFVVDISGSMHGFPL
FT                   DTAKTVLERLIGGLRPSDTFNVLLFSGSNKMLSPRSVPATRANIEQALATIQNYGGSGS
FT                   TELIPALKRVYAEPKEEKVSRTVVLVTDGYVSVEREAFELVRKNLSKANVFAFGIGSSV
FT                   NRSLMEGIARAGMGEPFIITDPIQAPEQAARFRRMVESPVLTNVKVTFGGLDVYDVEPQ
FT                   ALPDVLGERPVIVFGKWRADAEGKAKGRVIVEGQGANGPYRQELRIDPQLRQDTAALRT
FT                   LWARHRIQSLSDQETLEGGSAFKERITELGLKYSLLTQYTSFIAVDKVVRNPAPQNSVG
FT                   VNQPLPLPQGVSELALGAEVPSTPEPETLGAIAVVLSMLAMLRRRARRNDPRRFTA"
FT   sig_peptide     complement(23273..23380)
FT                   /locus_tag="Vapar_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 36"
FT   gene            23591..25072
FT                   /locus_tag="Vapar_0023"
FT   CDS_pept        23591..25072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0023"
FT                   /product="Inner membrane CreD family protein"
FT                   /note="PFAM: Inner membrane CreD family protein; KEGG:
FT                   bcj:BCAM1996 inner membrane protein CreD"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16686"
FT                   /db_xref="GOA:C5CVY8"
FT                   /db_xref="InterPro:IPR010364"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVY8"
FT                   /inference="protein motif:PFAM:PF06123"
FT                   /protein_id="ACS16686.1"
FT                   /translation="MFQLLKALQGSMLVKVAGLLMLTLLLCIPLAEINAINRERGNSQR
FT                   EAAAELAATYAGPQTVVGPLLLVPYVERWMEPVRNAQGQVIGQEARSKEMTHVVFPDKL
FT                   HIEGSMAPHERYRGIFRIPFYTLSATLGGGFSAFDPKSVAHSETDSRIEFKAPFAVFGA
FT                   SDLRGLDGSPSIAMNGEALRFRQRVPGLADDALLADGIHAPLTGAALAAWEAKAPLSFE
FT                   MKLGLVGQDTLSMVPIAEETTAHLKSPWAHPSFGGRFLATQREVTPQGFDAHWRVSSLV
FT                   TSAREQVRAGLPGRGDAASAATAAAVAATSHAQRNLGPLQTFDVSLAQPVNVYSMSTRA
FT                   GKYGALFIGLVIMAAFMFELFRRQRMHPVQYGLVGLSIALFFLLLLALSEKLAFWLAYA
FT                   SAAGASVLLLGIYFSAVLQSWTRGAGFGAYVAVLYGALYGLLASESNALLLGALLTFGM
FT                   LTVLMLATRKVDWYALSAGNPRIPEPVLPEAAASV"
FT   gene            25121..27529
FT                   /locus_tag="Vapar_0024"
FT   CDS_pept        25121..27529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0024"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: pol:Bpro_0780
FT                   penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16687"
FT                   /db_xref="GOA:C5CVY9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVY9"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ACS16687.1"
FT                   /translation="MDDSSPSAEPARSQRSVKLRRAARWSAIALGCGALVLLVAAVVAV
FT                   ASIYPRLPDISELADYRPKLPLRVYTVEGTLIGEFGEERRMLTPFASIPKVMKDAVLAV
FT                   EDARFYDHGGVDYKGFARAAVASLKGGRKQGASTITMQVARNVYLSSERTLSRKAYEIL
FT                   LALRLEQQLSKDQILEIYLNQIYLGNRAYGFAAASEAYFGKPLQNVTLAEAAMLAGLPK
FT                   APGANNPVANPRRARARQLYVIDRMHETGFITAEQAAEAKKEELHLRDAADPERLHAEY
FT                   VAETVRQMMYAQYGDSIYTSGMKVYTSLVAADQAAAYRSLRKGIMDYERRQPYRGPERF
FT                   VDLPDDPKEVDEAVDDALAEHPDNGDVMAAVVLEAGSKEINAVRANGETVQITGEGLRP
FT                   AQSGLAAKAPPHIKIRRGAVIRVARTPKNTWEITQLPEVEGAFIGMDPRSGAIKSLVGG
FT                   FDFGKNKFNHVTQAWRQPGSSFKPFIYSAALEKGFTPATIVNDAPLHFEPGTAGGQPWE
FT                   PKNFDGGFEGPMPLRTALMKSKNLVTVRLLQAIGAPYAQEWITRFGFDKDKHPAYLPMA
FT                   LGAGSVTPMQMATAYSVFANGGYKVNPYLVTRITDLRDKVLVETEPPVLDESRRAIPER
FT                   NAFIMDSLLQSVVKGGTAARAYQALKRDDLFGKTGTTNDSFDTWFAGFQPTTVGIAWIG
FT                   YDTPRQLGVRGETGGSLSLPIWIGYMQAALKGVPVSKMAEPPGVVNIDGEWYFDDFTPG
FT                   HSVASLGVESEPPPVPAEELTGVPPAAVPVPLGPPPQPEERNRILDFFR"
FT   sig_peptide     25121..25261
FT                   /locus_tag="Vapar_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.793 at
FT                   residue 47"
FT   gene            27609..28214
FT                   /locus_tag="Vapar_0025"
FT   CDS_pept        27609..28214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0025"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_1227 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16688"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVZ0"
FT                   /inference="similar to AA sequence:KEGG:Pnap_1227"
FT                   /protein_id="ACS16688.1"
FT                   /translation="MEILTLATLIVVGAYILKSRDQRQRIALLGSHLGRYQIERLMESL
FT                   TEGYLRCLGEDNAERRQQIWSLLDSTEEKLSAQFDSFAAEFARVDAADARVSKLPVAIP
FT                   FAHRLFPAATFDLRQALAIHARGIAEVMRNDAGRTPKAKAFTMSAELFLMQHTCHWFCK
FT                   SKTVASARMLARHKTSYEQLLEAVSPATRRAYAALTGQ"
FT   gene            complement(28221..29663)
FT                   /locus_tag="Vapar_0026"
FT   CDS_pept        complement(28221..29663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0026"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: pna:Pnap_0029 sensory histidine kinase CreC"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16689"
FT                   /db_xref="GOA:C5CVZ1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVZ1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS16689.1"
FT                   /translation="MSRRTRIFIGILLIYTAGIAFLLYRVVSDIDPRYRESAEESLVET
FT                   SQLVASLVEQDVIAGALNTARLEPLFRTVYAREFSAQIYNLHKNRVELRVYVTDRSGRV
FT                   VFDSLGRHLGTDYSQWSDVSRTLAGLYGARTSRDVDGDPRTSVMYVGAPIRWNNEIVGM
FT                   VSVGKPVQSFGQFVEDARARTLWVGVGSGLALLLLAVIVSVWLVRPFGLISDYWAWVRA
FT                   QRTLSLSRMARRAVDAVRTGFSEMRDALTGRNYVADYVQTFTHEVKSPLSAIRGAAELL
FT                   QEPSMPHAERERFLKNIERETQRIQEIVDRMMELTALETRHGLDRTEPVALASLIEDIA
FT                   ISAQPAAAKRNIGVRVNIRAEARAEGDPFLLRRAISNLLDNAIDFSPQGSEVLLTLETT
FT                   SKLARVSVRDHGPGIPDYAQEKVFQKFYSLARPHSQKKSTGLGLAFVKEIAALHRGRIE
FT                   LGNAARGGAVATLTLPLLPSHH"
FT   gene            complement(29660..30442)
FT                   /locus_tag="Vapar_0027"
FT   CDS_pept        complement(29660..30442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0027"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: pna:Pnap_0030 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16690"
FT                   /db_xref="GOA:C5CVZ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVZ2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS16690.1"
FT                   /translation="MSFKPRILIAEDESGIADTLQYVLKSDGFTPVWCATAEDAIAQFA
FT                   QEPPALAILDVGLPDLNGFELFKRLRALNQSQGGAEVPMLFLTARSDEIDRVVGLELGA
FT                   DDYIAKPFSPRELVARVRTILRRSARAGAGGAAGPGDGVPPRIPGAAPPATAQPPAMPF
FT                   ALDNERMQIRYYGRLLELSRYEYGLLRLLVQRPGRVFTRDELLQMVWDDASDSFDRTVD
FT                   AHVKTLRAKLKAVAPEVEPIRTLRGTGYALNEELPQTP"
FT   gene            31014..31973
FT                   /locus_tag="Vapar_0028"
FT   CDS_pept        31014..31973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0028"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dia:Dtpsy_0973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16691"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVZ3"
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0973"
FT                   /protein_id="ACS16691.1"
FT                   /translation="MTPSETRAIVSLSLLAAFVDGEKHERERAEIKRIAEGLSQADGMN
FT                   LPTLYQDVLMKRVSLASVAGELKSTESKQLAYEMAVCVCDADGTQSDAERMFLADVRSS
FT                   LGLDASAAQFSQQAEEIAAAVPAAAAGTATAVAPAAVAAAAPSPDSAELDKSILNASIL
FT                   NGALELLPETLSTMAIIPLQMKLVYRIGKAYGYELDSGHVKDFLATVGVGLTSQYLEQA
FT                   GRKLLGGLLGKMGGGLLRGLGNQAVSSGMSFASTYALGHVAKRYYAGGRTLSAQMLKET
FT                   FSGVVQEGKSLQTQYLPAIQEKARTLDAGKVLSLVRGA"
FT   gene            complement(31986..32390)
FT                   /locus_tag="Vapar_0029"
FT   CDS_pept        complement(31986..32390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0029"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: dac:Daci_0034 MerR family transcriptional
FT                   regulator; TIGRFAM: Cu(I)-responsive transcriptional
FT                   regulator; PFAM: Transcription regulator MerR DNA binding;
FT                   regulatory protein MerR; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16692"
FT                   /db_xref="GOA:C5CVZ4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVZ4"
FT                   /inference="protein motif:TFAM:TIGR02044"
FT                   /protein_id="ACS16692.1"
FT                   /translation="MSGFGTVSIGEAARLSGVSARMVRHYEGLGLLPPVARTDSGYRQY
FT                   GDADIHTLRFIKRSRDLGFSMEEIAELVGLWHNRRRASASVKRIAQRHLGELEQRIADM
FT                   QSMRSTLAHLVHCCHGDARPDCPILDDLAK"
FT   gene            complement(32387..32581)
FT                   /locus_tag="Vapar_0030"
FT   CDS_pept        complement(32387..32581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0030"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: bxe:Bxe_A3162 heavy metal binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16693"
FT                   /db_xref="GOA:C5CVZ5"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVZ5"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /protein_id="ACS16693.1"
FT                   /translation="MSQKFQVSGMSCGHCVSAVQNAVQTVDPEAQVTVDLETGHVDVVS
FT                   AQPRKDIVAAIENAGYRVQ"
FT   gene            32717..34960
FT                   /locus_tag="Vapar_0031"
FT   CDS_pept        32717..34960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0031"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: aav:Aave_0034 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16694"
FT                   /db_xref="GOA:C5CVZ6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVZ6"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACS16694.1"
FT                   /translation="MDNLLHNLHDPMSTLDLSVGGMTCASCVMRVERALKNVPGVQDVS
FT                   VNLATESARVVTAAGGEDMNARLRRAVRAAGYEPRAASSAADDAAALSPWYGFGPVGVG
FT                   LLLSIPLLAPMLGQPFGQDWMLAPWLQLLLAAPVQFWLGARFYRAGWHAARAGTGNMDL
FT                   LVALGTSAAFGLSLWLWWRAATGDHAGHGGMPHLYFEASAVVITLVLLGKWLEARAKRQ
FT                   ATSAIRALQQLRPETAHLVGPRGESDVPLAEVMVGDRLAVRPGERVPADARVIEGQSEV
FT                   DESMLTGEPLPVPKGPGDALTGGAVNGDGRMVVEVSAVGAESVLARIIRLVEDAQAAKA
FT                   PIQRLVDQVAAVFVPVVLAIALATLAGWLLAGAGIELAMIHAVAVLVIACPCALGLATP
FT                   VAVMAGTGVAARRGILIKDARALELAHRVGTVAFDKTGTLTLGRPVLTALVPVAGGGDE
FT                   AALLAIAASLQGGSEHPLARAVMAAAAQRGLQPPPLSAMQAMPGRGVRGLVDGEPWAIA
FT                   SLRWCAELGAMPDAAQLERLHAQGATVSALLRFDAAGAARVQALLAFADEPKPEAAQAI
FT                   RTLHARGLRVVMISGDNLRAAQAMAARLGIAAEDVRAEVLPADKAAQVSALKKNGQVVA
FT                   MIGDGANDAPALAAADVGIAMAPAGGGTDVAMEAAGITLMRGDLALVAEALELSARTVA
FT                   KIRQNLFWAFAYNVAGIPLAAFGLLSPVVAGAAMALSSVSVMANALLLRRWKP"
FT   gene            complement(34974..35456)
FT                   /locus_tag="Vapar_0032"
FT   CDS_pept        complement(34974..35456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0032"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   psa:PST_2720 acetyltransferase (GNAT) family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16695"
FT                   /db_xref="GOA:C5CVZ7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVZ7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS16695.1"
FT                   /translation="MRRLATPQDLEAVFTIYMHESVVPFLGYDPMPLDEFRAIYKELVD
FT                   SRSFYLYEAEGRVAGFYRATRYPGRARHVACFGTLAVDPSLHGKGIAQAMVNDAIARLK
FT                   AEGVKRIELYAESDNAPGLRFYEKLGFEYEGTLRRFYKRAGEADYIDDHLLALLID"
FT   gene            complement(35524..36750)
FT                   /locus_tag="Vapar_0033"
FT   CDS_pept        complement(35524..36750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0033"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: dar:Daro_1172
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16696"
FT                   /db_xref="GOA:C5CVZ8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVZ8"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ACS16696.1"
FT                   /translation="MSGARVHVTGIGLVTPLGGTVESFDDALFSGRSAVRARALEIAGL
FT                   DPITLAVAACDFDAAAVPSNSRLPLDRGTAMALAAARDAAAQARLAAGSVDPERLGIYW
FT                   GSGLAGAGSFDDTTRALYGEQRRMRPTTVLTVMPNAAVAELALQFGAQGAAIAYACACA
FT                   SSAVAIGEAMRAIRGGWIDVAIVGGHEAMLTPGVMASWHAMRVTAPPPPGAPASACRPF
FT                   SSDRAGFALGEGAAALVLESEAHASARGAVHASSLFLAGYATNCDATHITNPDSAGQVR
FT                   AMRAALRDAGIEAAQVGHINAHGTATIAGDAAEAASIREVFGNATPVSATKAIHGHALG
FT                   GGGAIELVAALRTLAQGVLPPTANLRVPDAAFDLDFVRGEPREARHLRYVLSNSFAFGG
FT                   TNAVLVAGR"
FT   gene            complement(36747..37049)
FT                   /locus_tag="Vapar_0034"
FT   CDS_pept        complement(36747..37049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0034"
FT                   /product="phosphopantetheine-binding"
FT                   /note="KEGG: mch:Mchl_5008 phosphopantetheine-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16697"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C5CVZ9"
FT                   /inference="similar to AA sequence:KEGG:Mchl_5008"
FT                   /protein_id="ACS16697.1"
FT                   /translation="MSSSSSSSSSSTVFNSIAAILVNQFDVARDAIAPGAALSELGLDS
FT                   LSLMEFVFAVEDAFHLRLPEDRLDPREAGITLGHLCEAIEAQIDCKLDSPMAAQA"
FT   sig_peptide     complement(36993..37049)
FT                   /locus_tag="Vapar_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.845) with cleavage site probability 0.812 at
FT                   residue 19"
FT   gene            complement(37067..37945)
FT                   /locus_tag="Vapar_0035"
FT   CDS_pept        complement(37067..37945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pnu:Pnuc_0952 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16698"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW00"
FT                   /inference="similar to AA sequence:KEGG:Pnuc_0952"
FT                   /protein_id="ACS16698.1"
FT                   /translation="MSARDPSDLLSVVHPAVRRTAIVLLHGLCSTPDELLTVQSSLRAS
FT                   GYPVHPMRVDGYSFDAAAPVQQALPYERWIDAIEARVKALRTAHDRVVLVGISAGSSLA
FT                   LGAAIRCGSGVDALVLMSTTLRFDGWAVPRTQVLLPLAFYTPLGRFWQYRERAPYGVKN
FT                   ERVRAWIERELRHRKVSSAGSAVIGVGHLREHDRLIRHVRRNLHRVQCASVLALHARED
FT                   EVASLANVDLLARGLRCQSFRSVVLGNSYHMITIDNDRHQVVRETCAFADAVAHGTPEP
FT                   FGALSARPLAA"
FT   gene            38088..38777
FT                   /locus_tag="Vapar_0036"
FT   CDS_pept        38088..38777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0036"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: aav:Aave_0041 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16699"
FT                   /db_xref="GOA:C5CW01"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW01"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS16699.1"
FT                   /translation="MRILLVEDDAVLRDVMLRSLADAGHRVDVSTNIEDADHLWRVQPF
FT                   DAVLLDLNLPATASPTSGLASGLNALRQARARGDRTPVLVLTARGRTEERIAGLDAGAD
FT                   DYLGKPFDLAEVEARLRALVRRAKGTEDIVLLGQLKLDRKARRFSTASGPLDLPAREFE
FT                   VLWELMSPPGRTVSKRALSDKLSSFDESLGDNALEAFISRLRKKLAGSGAGIRTLRGIG
FT                   YLLEAEV"
FT   gene            38774..40186
FT                   /locus_tag="Vapar_0037"
FT   CDS_pept        38774..40186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0037"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   Two-component sensor kinase domain protein; histidine
FT                   kinase HAMP region domain protein; histidine kinase A
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   aav:Aave_0042 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16700"
FT                   /db_xref="GOA:C5CW02"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW02"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS16700.1"
FT                   /translation="MSRTQPAAPGPSKAAPSLTRRVLRNVLVPLALTWMVGAVIALVIA
FT                   NYFSEQAFDRAMLDDAYALSANVQAGERGIELLLTPREVATVLFDQVDKIYFAVQRLDG
FT                   TLISGQPGLTAPLPTGDARYRFSDVNFDGKVLRAVVLEPVAEAGTLMPYRVVIAQTTLS
FT                   RAALVQRLLGYALAPQVLLLVLLAVWLWHGIRSDLRPLGELQQALDRRDVYDLSPVAVV
FT                   RTSREVQRLGDAVNALFDRLNHSVRAQREFVGNVAHELRTPLAGIRALAEYGLAQHDST
FT                   VWREQLARVAERQARASHLIDQLLALALADEARTGLAREPVRLDMLAEQTVLRHLARAD
FT                   AHGVDLGARGLDERVTVLANEALVEGILDNLIDNALRYGGRTITVELAGRTLSVIDDGP
FT                   GIPLEAQRDLMQRWSQGPAGQKLGQGSGLGLSIVARYAELLGAELRLDAAEPTGLRVSI
FT                   SFAELRLAAAGD"
FT   gene            complement(40183..40668)
FT                   /locus_tag="Vapar_0038"
FT   CDS_pept        complement(40183..40668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0038"
FT                   /product="Endoribonuclease L-PSP"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: bpy:Bphyt_7184
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16701"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW03"
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /protein_id="ACS16701.1"
FT                   /translation="MARIEQRLATLGLVLPPPVTPPPGVVLPFTFVRIAGRRAIISGHG
FT                   PLNADGTIAAPLGKLGRELTVEQGYAAARLTALAMLGSLQRALGDLDRITAWTRVFGMV
FT                   ASAPGFDRQPAVINGFSDLVLELFGPEIGAHARSAVGMAELPFNLPVEIEGEVEFGD"
FT   gene            complement(40691..41794)
FT                   /locus_tag="Vapar_0039"
FT   CDS_pept        complement(40691..41794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0039"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   pol:Bpro_0063 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16702"
FT                   /db_xref="GOA:C5CW04"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW04"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ACS16702.1"
FT                   /translation="MPSLFDPVQAGDLQLANRIVMAPLTRNRSPNAIPQDIAATYYAQR
FT                   ASAGLLITEATAISHQGQGYADVPGLYGTEQLDAWKRVTDAVHAKGGKIVVQLWHVGRV
FT                   SHSELQPGGGKPVAPSAITARTKTVLIKEGMPTFVETSEPRALDAEELPGIVHTYAAAA
FT                   RNAVETAGFDGVELHGANGYLLDQFLKDGSNKRTDDYGGSIENRARLLLEATRAVVDAV
FT                   GGGKTGIRLSPVTPANDVHDSDPQPLFTYVVKQLAPLGLAYIHVIEGATGGPREIEDRP
FT                   FDYEALKAAYREAGGKGAWMVNNGYDKPLADQAVKEGDDLVAFGKPFIANPDLVRRLRE
FT                   NAPLNAVDKATMYGGGTQGYTDYPALD"
FT   gene            complement(41879..43729)
FT                   /locus_tag="Vapar_0040"
FT   CDS_pept        complement(41879..43729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0040"
FT                   /product="protein of unknown function DUF1446"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   cti:RALTA_B0801 conserved hypothetical protein; DUF1446"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16703"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW05"
FT                   /inference="protein motif:PFAM:PF07287"
FT                   /protein_id="ACS16703.1"
FT                   /translation="MNASSNNSSERIVRIGGASGFWGDSSVGAPQLVASGQIDYLVFDY
FT                   LAELTMSILAGARLKKPELGYATDFVSIAMKAVLKDVVQQGIRVVSNAGGVNPQGCADA
FT                   LAALAAEQGVALKIAVVSGDDVSPLLPQLRQQQPPVRELQSGAPLPGRVLTANAYLGAR
FT                   PIQAALDAGAQVVITGRCVDSAVTLGVLMHAFGWQPGDHDLLAAGSLAGHIIECGCQAT
FT                   GGLHTDWDTVPDWPNIGYPIVECSADGGFIVTKPAGTGGKLTPAVVGEQLLYEIGDPSA
FT                   YLLPDVVADFTQVRIAQAGEHRVRVHGARGRAPTASYKVCATYAEGFKTAAQLTIVGFD
FT                   AVAKARRTGEAILARTGALFDQQGLGPYSGTQLEVLGAESCYGPHAQALQTREAVLRLA
FT                   VTHAHKEALELFAREVAPAGTSWAPGTTGAGGRPSVAASIRQYAFLLDKTMVEARVSID
FT                   GQHIEIPRDAVVAAAADAPSPRQAAVDANAVASVDADAIEVPLIRLAWARSGDKGDTSN
FT                   IGVIARHPALLPLLRSQLSEARVAEWLAHLVKGPVTRYEVPGIGAFNFVCEQALGGGGM
FT                   ASLRNDPLGKGMGQILLAMPVRVSAELLALAGSDRSALNA"
FT   gene            complement(43726..44517)
FT                   /locus_tag="Vapar_0041"
FT   CDS_pept        complement(43726..44517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0041"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   cti:RALTA_B0800 putative enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16704"
FT                   /db_xref="GOA:C5CW06"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW06"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACS16704.1"
FT                   /translation="MAEAPAFHHHQELREEMRGPVMWLTIDREERRNAISPGVLAALSA
FT                   ALSRADADRDVRAVVITGAGTRAFCAGADLQGGASFRFDPAEPYQGFANLLRQARQLTV
FT                   PLVARVNGACMAGGMGLLGMCDMAVAGSHAVFGLPEVKVGLFPAQVLSVLGNLLPRRVL
FT                   AQMCLTGEPITAAQALEHGLVNRVGENVDESLDWLLGRMLDKSPAAIRRGLYTMKKIEA
FT                   MAFEESIAFTESQIGLFALTEDAAEGQLAFREKRKPQWSGR"
FT   gene            complement(44670..45278)
FT                   /locus_tag="Vapar_0042"
FT   CDS_pept        complement(44670..45278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0042"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   aav:Aave_0048 glutathione S-transferase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16705"
FT                   /db_xref="GOA:C5CW07"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW07"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ACS16705.1"
FT                   /translation="MKLYYSPGACSLSPHIALHEAGLAFEPVLASTKTHKLQDGTDYYG
FT                   INPLGYVPMLELDDGTRLREGPAIVQYIADLAPTKNLAPAAGTLQRYRLQEWLTFIGTE
FT                   MHKGYSPLFNPNMPEEAKAIFKDKLKSRYQWLDGQLADKQYLMGEQFSVADGYLFTVTN
FT                   WAKSTGVDISGFANLQAWHARVAARPAVQAAMKAEGLLK"
FT   gene            45467..45652
FT                   /locus_tag="Vapar_0043"
FT   CDS_pept        45467..45652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0043"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   pol:Bpro_0066 protein of unknown function DUF1328"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16706"
FT                   /db_xref="GOA:C5CW08"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW08"
FT                   /inference="protein motif:PFAM:PF07043"
FT                   /protein_id="ACS16706.1"
FT                   /translation="MLKYAIIFALISLVAGVLGFGGIAAGAAGIAKLLFGLFLVLAVVF
FT                   VVLAALGIGAVKKAID"
FT   sig_peptide     45467..45547
FT                   /locus_tag="Vapar_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.446 at
FT                   residue 27"
FT   gene            45652..45798
FT                   /locus_tag="Vapar_0044"
FT   CDS_pept        45652..45798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16707"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16707.1"
FT                   /translation="MQHPAPVWPRPRPLGLLLQSPAHRVVRVLLVTQTHWQLPEHRSRR
FT                   RHA"
FT   gene            45983..47941
FT                   /locus_tag="Vapar_0045"
FT   CDS_pept        45983..47941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0045"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; FAD dependent
FT                   oxidoreductase; KEGG: dia:Dtpsy_0045 glucose inhibited
FT                   division protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16708"
FT                   /db_xref="GOA:C5CW10"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CW10"
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /protein_id="ACS16708.1"
FT                   /translation="MLYPEEFDVIVVGGGHAGTEAALAAARMGAKTLLLSHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRVLY
FT                   KAAIRHRLENQPNLSLFQQAVDDLMVEGDRVVGAVTQVGIAFRARTVVLTAGTFLDGRI
FT                   HVGLDNYQAGRAGDPPAVSLSARLKELKLPQGRLKTGTPPRLDGRSIDFSKCTEQAGDG
FT                   MPGGAGPMPVFSFMGRADMHPQQMPCWITHTNARTHDIIRSGFDRSPMFTGKIDGVGPR
FT                   YCPSVEDKINRFADKESHQIFLEPEGLTTNEYYPNGISTSLPFDIQYQLVRSMPGLENA
FT                   HILRPGYAIEYDYFDPRELKSSFETRSIKGLFFAGQINGTTGYEEAAAQGLFAGINAAL
FT                   QCRGEEAWLPRRDEAYLGVLVDDLITKGVTEPYRMFTSRAEFRLQLREDNADMRLTEAG
FT                   RKLGLVDDARWDAFSRKRDTVSRETERLKSIWVNPRNLPAAESERVLGKAIEHEYNLAD
FT                   LLRRPDVNYETLMSLDGGKYSAGSPLSEIEIEQIEISAKYSGYIERQHDEVERAAHFEN
FT                   LRLPADFDYSQVKALSFEVRQKLDKHRPETLGLASRISGVTPAAISLLMIHLRKGGHKA
FT                   FNRDAATEAAAESQPAQ"
FT   gene            47938..48579
FT                   /locus_tag="Vapar_0046"
FT   CDS_pept        47938..48579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0046"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: dia:Dtpsy_0046
FT                   methyltransferase GidB"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16709"
FT                   /db_xref="GOA:C5CW11"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW11"
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /protein_id="ACS16709.1"
FT                   /translation="MSAPIDTLRQGAAALGTALSDAQAEQLLAYGTLMLKWNKVYNLTA
FT                   LRDPASVLTHHLLDSLAAVAPLQREWAGKGKLLDVGSGGGLPGVVIAVLRPDLEVSCLD
FT                   AVAKKAAFVQQVAAELELPNLRGLHARVESLTGSYEVISSRAFASLPDFFNGSRHLLAP
FT                   GGVWLAMKGKMPTDELAALPQGIAVFHVEQLTVPGLDAERCIVWARQEAA"
FT   gene            48695..49309
FT                   /locus_tag="Vapar_0047"
FT   CDS_pept        48695..49309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0047"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   pol:Bpro_0075 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16710"
FT                   /db_xref="GOA:C5CW12"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW12"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACS16710.1"
FT                   /translation="MFGIADYGAFVAAIVLFLLIPGPGNLALITSTSKGGIRGGLAATL
FT                   GVIVGDQFLMWAAVAGVAAVLAAYPAAFKAVQWLGAVYLAWLGAKMLLAKPGAAPILNI
FT                   RPSHFMRQALAITLLNPKAIVFYMAFFPLFVDPARHQGVVTFGAMAVTIAALTFLYGLT
FT                   STLLTHFLAERIRANPRISGRLEKLAGVFLIAFGIKLAISR"
FT   gene            49317..50231
FT                   /locus_tag="Vapar_0048"
FT   CDS_pept        49317..50231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0048"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   rfr:Rfer_0051 cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16711"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW13"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACS16711.1"
FT                   /translation="MAKIFCIANQKGGVGKTTTTVNLAAGLAKVGQRVLMIDLDPQGNA
FT                   TMGSGIDKRQLELTVYDVLLESASVAEARVKADKLVEGGCGYDVLGANRELAGAEVEMV
FT                   ALDRREKRLRTALATVGAEYDFVLIDCPPSLSLLTLNGLCAAHGVIVPMQCEYFALEGL
FT                   TDLVNTIKQVHANLNKNLQIIGLLRVMFDPRITLQQQVSEQLKAHFGDKVFDTVIPRNV
FT                   RLAEAPSYGLPGVVFDPAARGSQAFVAFAKELVEKMPPASAFASGAVAPPIAPVGPVAP
FT                   PNLAVPEDVLSPAGGPDSGEKSF"
FT   gene            50231..50782
FT                   /locus_tag="Vapar_0049"
FT   CDS_pept        50231..50782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0049"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   ajs:Ajs_0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16712"
FT                   /db_xref="GOA:C5CW14"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW14"
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /protein_id="ACS16712.1"
FT                   /translation="MGVLSRVFLLPGWQNSGPGHWQTRWESVHGDHRVEQHDWMRPLRG
FT                   DWSARLEEEVLAAPEPVVFAAHSLGCILVAAWAAHSRNTHKVRGALLVAPGDVERDDLR
FT                   QLIPGWAPIVRQPLPFASVLIAANDDPYCEAARSRQMAADWGARFVDAGAGGHLNAESG
FT                   LGDWSQGRQLLNEISTKDTH"
FT   gene            50782..51729
FT                   /locus_tag="Vapar_0050"
FT   CDS_pept        50782..51729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0050"
FT                   /product="parB-like partition protein"
FT                   /note="KEGG: dia:Dtpsy_0050 ParB-like partition protein;
FT                   TIGRFAM: parB-like partition protein; PFAM: ParB domain
FT                   protein nuclease; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16713"
FT                   /db_xref="GOA:C5CW15"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW15"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ACS16713.1"
FT                   /translation="MATKKPKGLGRGLEALLGPTAAPSADSSGTDEGAAAQNPNTLMLD
FT                   EMVAGVYQPRTRMDEGALYELAESIKAQGIMQPILVRRLDAESAAAKNAEYEIIAGERR
FT                   FRAARLAGLDRVPVLVRDVPNEAAAAMSLIENIQREDLNPLEEAQGLQRLVSEFGLTHE
FT                   AAAQAVGRSRSAASNLLRLLNLAEPAQQMLMAGDIDMGHARALLSLDRGTQITAANQIA
FT                   AKKMSVREAEALVKRLAAEFTLTPSRRSNDGEKSRDLQRVEEELADLLTAEVEVRIKKR
FT                   SKRGGKVEESGELAIHFGSIEALNGLIERIRRTA"
FT   gene            51838..52737
FT                   /locus_tag="Vapar_0051"
FT   CDS_pept        51838..52737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0051"
FT                   /product="peptidoglycan-binding domain 1 protein"
FT                   /note="KEGG: dia:Dtpsy_0052 peptidoglycan-binding domain 1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16714"
FT                   /db_xref="GOA:C5CW16"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW16"
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0052"
FT                   /protein_id="ACS16714.1"
FT                   /translation="MKFRTRFPFAAVAVGALLLTGCATTDMQMGSQSAKTMATGSAAGS
FT                   ATAGESSQLERCESPLGTVSLIENVNAGWYTILTGEYRLPPTANLLRLLVQQSNCFVVV
FT                   ERGAAGMNAMTRERALMQSGEMRGGSNFGRGQMVASDYGLSPEIVFSNSDAGGIGGALG
FT                   GLVGGGRGRALATIGGNMQTKEASALLTLIDNRSGVQVAASEGSASKTDFGAFGALAGR
FT                   SAGGGLGGYTNTAQGKVIAAAFMDAFNQMVRSLRSYKAQTVRGQGLGGGGRLGVDGGAA
FT                   PSQTYVPAEQPAPARRRR"
FT   sig_peptide     51838..51915
FT                   /locus_tag="Vapar_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.612 at
FT                   residue 26"
FT   gene            complement(52820..54244)
FT                   /locus_tag="Vapar_0052"
FT   CDS_pept        complement(52820..54244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0052"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   pol:Bpro_0111 FAD linked oxidase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16715"
FT                   /db_xref="GOA:C5CW17"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW17"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACS16715.1"
FT                   /translation="MNAPTPTSHLLPELHLRNVPDSLIEGLKARFGSNCSTAMAVRTQH
FT                   GRDESSFDAPPPSAVVFAESTQDVADAVKLASEHSVPVIPFGVGSSLEGHLLAVQGGIS
FT                   IDVSRMNRVLSVNADDLTVTVQPGVTRKQLNDEIKSTGLFFPIDPGADASIGGMTATRA
FT                   SGTNAVRYGTMRENVLALEVVTASGDVIRTGTRAKKSSAGYDLTRLMVGSEGTLGVVTE
FT                   VTLRIYPLPEAVSAAICSFPSIEAAVRTTIETIQLGVPIARVELIDVNTVRMVNTYAKL
FT                   DLREEPMLLMEFHGSPAGVKEQAETVQELASGHGGNAFEWASTPEERTRLWTARHNAYF
FT                   AAVQSRPGCRVISTDTCVPISRLADCLLDSVAEADASGIPYFLVGHVGDGNFHFGYLLD
FT                   PNIPEERVKAEELNHSLVSRALALEGTCTGEHGVGLHKMDFLVTEAGVGAIDMMRTIKR
FT                   ALDPKNIMNPGKIFAL"
FT   gene            54331..54837
FT                   /locus_tag="Vapar_0053"
FT   CDS_pept        54331..54837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_3701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16716"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW18"
FT                   /inference="similar to AA sequence:KEGG:Bpro_3701"
FT                   /protein_id="ACS16716.1"
FT                   /translation="MNPTTLAALAAFPSQLEAHYAAIPHAFRHWAPPSWEGVPSEAFTA
FT                   IEQLCHVRDIEVEGYHVRFRRTLEESHPTLASIDSEPLAIARAYGMADAEKVLAEFRIA
FT                   RARTMDIVSNLTDVQLARTAVFEGYGALTMRSLVHYLCSHDQQHLAGLQWLARKIDASK
FT                   AAAAA"
FT   sig_peptide     54331..54387
FT                   /locus_tag="Vapar_0053"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.912) with cleavage site probability 0.901 at
FT                   residue 19"
FT   gene            54854..55462
FT                   /locus_tag="Vapar_0054"
FT   CDS_pept        54854..55462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0054"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: pol:Bpro_0113
FT                   ATP:cob(I)alamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16717"
FT                   /db_xref="GOA:C5CW19"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW19"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ACS16717.1"
FT                   /translation="MGNRLSQIATRTGDDGTTGLGDNTRVPKDHLRVHAMGDVDELNSQ
FT                   IGLLLCEPMPEPVRELLVDVQHQLFNLGGELSMPGYTLLKADALLQLDNALAEHNAALP
FT                   RLAEFILPAGTRAASLAHVCRTVARRAERAVVALGATAELNDALRQYLNRLSDLLFVLA
FT                   RVLNRMNGGDDVYWKSERMARAAAAADAAEPIDEEGSPS"
FT   gene            55459..55827
FT                   /locus_tag="Vapar_0055"
FT   CDS_pept        55459..55827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16718"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW20"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16718.1"
FT                   /translation="MTIKKTPAHGFALAAASAALLLLSAATVHAQSADNPPRAQPAHTL
FT                   KPPPRDSKVVNSVQRGTNAAGRGIDRAENATRRGVNNVSEKASRPVRRVGEAFGRKLAP
FT                   GSSGRTAPPPVGPQGSAP"
FT   sig_peptide     55459..55551
FT                   /locus_tag="Vapar_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.977 at
FT                   residue 31"
FT   gene            56158..56676
FT                   /locus_tag="Vapar_0056"
FT   CDS_pept        56158..56676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0056"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: geo:Geob_2046
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16719"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW21"
FT                   /inference="protein motif:PFAM:PF01928"
FT                   /protein_id="ACS16719.1"
FT                   /translation="MARNIEIKARIDSVERVALIAAKLADSGPIEIAQDDTFFRCDNNA
FT                   DRLKLRTFAPDRAELIFYRRANSSGPKESFYLISPTTTPDALRESLTLAWGQAGRVRKQ
FT                   RRLFIVGRTRVHLDRVEGLGEFLELEVVLKDGEPAEVGTAEAHALMAQLGIASEQLVQG
FT                   AYVDLLQAA"
FT   gene            complement(56686..57324)
FT                   /locus_tag="Vapar_0057"
FT   CDS_pept        complement(56686..57324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0057"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   nmc:NMC1592 putative lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16720"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW22"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ACS16720.1"
FT                   /translation="MKRRHLLHLLAGVPAAALVAACGKRKPSAAALKSDARVLALGDSL
FT                   TFGYGAPPEAAWPVKLGELTGWQIENAGLNGDTSAGALERLAPLLAAGSYDAVLIGIGG
FT                   NDMLRGVPPAATRENLAALVSQARAHTPYVALLATPSPDAMRAVVGSLSDALFYEEVAK
FT                   SGQALLVPNVYSSVLSDASLRSDRIHANAEGYARIAQQLADQLKAAGWR"
FT   sig_peptide     complement(57259..57324)
FT                   /locus_tag="Vapar_0057"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.572 at
FT                   residue 22"
FT   gene            complement(57338..57520)
FT                   /locus_tag="Vapar_0058"
FT   CDS_pept        complement(57338..57520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16721"
FT                   /db_xref="GOA:C5CW23"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW23"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16721.1"
FT                   /translation="MRDKIIGAIGIVWGGGMLLRWLMSGPPAGIGGYQGGQTAMALLGA
FT                   VMLVAGLYRFFKRPD"
FT   gene            57699..58130
FT                   /locus_tag="Vapar_0059"
FT   CDS_pept        57699..58130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_0343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16722"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW24"
FT                   /inference="similar to AA sequence:KEGG:mma_0343"
FT                   /protein_id="ACS16722.1"
FT                   /translation="MIIKSKSMAVAAAALAMCMAAGSAFAQGRGHDGDHDNRGNGRYEQ
FT                   QHRDFDRHDDRRGDRYGREDYRPGRQFDRRGYPQPHAEWRRGGRVPSEYRGRNYVVNDW
FT                   RSYRLQQPPRGYQWVGVGGDYVLAAIATGVIAQIIVGSQ"
FT   sig_peptide     57699..57779
FT                   /locus_tag="Vapar_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            complement(58150..58410)
FT                   /locus_tag="Vapar_0060"
FT   CDS_pept        complement(58150..58410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aav:Aave_1088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16723"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW25"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16723.1"
FT                   /translation="MASTPQQQQKTRAALKAADAAERRERLRRALPATVELLQSRQADR
FT                   IDDSDIEAYVSLNWLEWHGGGLRLTITGRNVCAQSLPTVVA"
FT   gene            complement(58525..59469)
FT                   /locus_tag="Vapar_0061"
FT   CDS_pept        complement(58525..59469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0061"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: pna:Pnap_0071 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16724"
FT                   /db_xref="GOA:C5CW26"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037423"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW26"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS16724.1"
FT                   /translation="MNFQQLRSVREAVRCGFNLTEVAHTLHTSQPGVSRQIRELEEELG
FT                   IELFVRAGKRLTGLTEPGGHVLPIIERMLLESSNLRHAGQEFVAQQSGLLSVAATHSQA
FT                   RYAMPVAVQEFRAQFPNVKLHLHQGSPKQIAQMLIDGEADVGIATEALGDYPQLVALPC
FT                   YRWTHSVIVPPGHALLDAPLTLEALTRHPLITYDTGFTGRSRIDEAFAQRGLAPNIVLA
FT                   AMDADVIKTYVQLGMGVGIVAGVAYETERDTQLRALDAGRLFGINMTKLAVRRGNYLRK
FT                   YVYAFIESFAPTLTRAVVEKALGDEAKGSHYEI"
FT   gene            59665..60267
FT                   /locus_tag="Vapar_0062"
FT   CDS_pept        59665..60267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0062"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: pol:Bpro_0119
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16725"
FT                   /db_xref="GOA:C5CW27"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW27"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS16725.1"
FT                   /translation="MDAKTQKSELTRAAIVGAAMDLALAEGLEAITLQAVASRLALSKS
FT                   GVFSRVGSREALQKAVIEEYGRRFLADVFVPAMQKPKGLARLDDIVGRWIARTRDIEAE
FT                   TGCIYMAGAFEYDDREGELRDLLFGEITRWRAALRRTVLQAVETGELRADTDPAQLVSE
FT                   LNGLIMGLLHDARFLRDPQAADRATQTWQRLLSSYRA"
FT   gene            60346..60459
FT                   /locus_tag="Vapar_0063"
FT   CDS_pept        60346..60459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16726"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16726.1"
FT                   /translation="MLIIALCLAVYVGAIGADATRDALRSLPRSNEDWVWY"
FT   sig_peptide     60346..60396
FT                   /locus_tag="Vapar_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.638) with cleavage site probability 0.409 at
FT                   residue 17"
FT   gene            60477..61394
FT                   /locus_tag="Vapar_0064"
FT   CDS_pept        60477..61394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16727"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW29"
FT                   /inference="similar to AA sequence:KEGG:Bpro_0118"
FT                   /protein_id="ACS16727.1"
FT                   /translation="MTSTTTSAATHAAQSNYYRPGRLMRALRFGLTASQRLWPALGVRA
FT                   AYRVFGTPLPPKWLYRGQGPGAAWRREAWAFEDAGLGLYHLAAQDFGAESAPVVLLVHG
FT                   WGGHAGQMLALAQALADAGLRPVLLELPAHGRSAGTMSNSPQFARAIAYVVARLAADGH
FT                   ALRAVAAHSLGANGLALAAAQGLQALRLVLLAPPASPREYTRYFAHTFGLSEATRLAMQ
FT                   RRFEAREGVLMAQLEPAAVGPRIAQPTLIVHDHDDRVNRFADAEAYRDAIKGARLVATQ
FT                   GLGHRRILKEEDVVRQVVRFVAQP"
FT   gene            complement(61452..61730)
FT                   /locus_tag="Vapar_0065"
FT   CDS_pept        complement(61452..61730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0065"
FT                   /product="cell division topological specificity factor
FT                   MinE"
FT                   /note="TIGRFAM: cell division topological specificity
FT                   factor MinE; PFAM: Septum formation topological specificity
FT                   factor MinE; KEGG: dia:Dtpsy_0086 cell division topological
FT                   specificity factor MinE"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16728"
FT                   /db_xref="GOA:C5CW30"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CW30"
FT                   /inference="protein motif:TFAM:TIGR01215"
FT                   /protein_id="ACS16728.1"
FT                   /translation="MSFFSFLLGEKKKTASVAKERLQIILAHERSSLSGKKRPDYLPDL
FT                   QRELMAVISKYVKINADDIKVHLEKQDDLEVLDIKIELPDPAPSPAR"
FT   gene            complement(61734..62549)
FT                   /locus_tag="Vapar_0066"
FT   CDS_pept        complement(61734..62549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0066"
FT                   /product="septum site-determining protein MinD"
FT                   /note="TIGRFAM: septum site-determining protein MinD; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; KEGG: aav:Aave_0125
FT                   septum site-determining protein MinD"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16729"
FT                   /db_xref="GOA:C5CW31"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW31"
FT                   /inference="protein motif:TFAM:TIGR01968"
FT                   /protein_id="ACS16729.1"
FT                   /translation="MAKIVVVTSGKGGVGKTTTSASFASGLALAGKKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIQGEANLSQALIKDKQCDNLFVLAASQTRDKEALTQEGVEK
FT                   VLADLAAMDFDYIVCDSPAGIETGAMMAMHFADEALVVTNPEVSSVRDSDRILGMLSSK
FT                   TKRAKEGGDPIKEHLLITRYNPNRVAGGQMLSLEDIQDILRIKLIGVIPESESVLQASN
FT                   QGVPAIHDKDTDVAKAYSDVVARFLGEDRPMRFVDAEKPGFFKRIFGGK"
FT   gene            complement(62605..63378)
FT                   /locus_tag="Vapar_0067"
FT   CDS_pept        complement(62605..63378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0067"
FT                   /product="septum site-determining protein MinC"
FT                   /note="TIGRFAM: septum site-determining protein MinC; PFAM:
FT                   Septum formation inhibitor MinC; Septum formation inhibitor
FT                   MinC domain protein; KEGG: aav:Aave_0124 septum
FT                   site-determining protein MinC"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16730"
FT                   /db_xref="GOA:C5CW32"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW32"
FT                   /inference="protein motif:TFAM:TIGR01222"
FT                   /protein_id="ACS16730.1"
FT                   /translation="MADVSAARTKAVFEFKSATLPLIAVILKTADLAVLAEALDAQLAD
FT                   SPDFFEQEPVVIDLSQLQPDEESGEESPALDFAALRGLLARHQTQPIAVRGGNNAQNAA
FT                   ARAAGLSLTAMPVAPAPRSPAPPAASPAPASEAPQIVREVPVPANGTLLIDKPLRSGQQ
FT                   VYARGGDVVVTAVVSFGAEVIADGNVHVYAPLRGKAIAGARGNTEARIFSTCMEAQLVA
FT                   IAGIYRTNEVPLPDPVLGKPAQIRLDGKKLVIDPI"
FT   gene            complement(63500..64786)
FT                   /locus_tag="Vapar_0068"
FT   CDS_pept        complement(63500..64786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0068"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: dia:Dtpsy_0068
FT                   uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16731"
FT                   /db_xref="GOA:C5CW33"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW33"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ACS16731.1"
FT                   /translation="MSNLFSWREVAATEGRVVAPDERLPWLQTGAMGVQHVIAMFGATV
FT                   LAPILMGFNPNIAILMSGIGTLIFFLVTGGKVPSYLGSSFAFIGVVIAASGYAGKGPNA
FT                   NIAVALGGIVACGVVYILIGALVQAIGTGWIERFMPPVVTGAVVAVIGLNLAGVPIKNM
FT                   AASNFDSWMQAVTFLCVGLVAVFTRGMLQRLLILVGLILATAVYALLTNLLGMGKPVDL
FT                   SGIANAAWFGMPTFTAPVFTTNAMLLIAPVAIILVAENLGHLKAVTAMTGRNLDPYIGR
FT                   AFIGDGIATVVSGASGGTGVTTYAENIGVMAATRIYSTAVFVVAALIALVLGFSPKFGA
FT                   LIQAIPLPVMGGVSIVVFGLIAIAGAKIWVDNKVDFSQNKNLIVAAITLIIGTGDFTLK
FT                   FGDFALGGIGTATFGAIILYALLGRSRNA"
FT   gene            complement(64882..65304)
FT                   /locus_tag="Vapar_0069"
FT   CDS_pept        complement(64882..65304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0069"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rfr:Rfer_0061 phenylacetic acid degradation-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16732"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW34"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACS16732.1"
FT                   /translation="MRIWKKDISVEELTRNHIGTAVSTLGMEFLEVGDDFIRARVPVDE
FT                   RTRQPYGILHGGVSVVLAETLGSCGAHYSAPEGDRAVGLDINANHIRSATSGWVTGTAR
FT                   PVHRGRTTQVWQIDMTNDAGELTCVSRITMAVLPPR"
FT   gene            65388..66728
FT                   /locus_tag="Vapar_0070"
FT   CDS_pept        65388..66728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16733"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW35"
FT                   /inference="similar to AA sequence:KEGG:Pnap_0074"
FT                   /protein_id="ACS16733.1"
FT                   /translation="MKRPLRRWLIGIAAVLLLGTGALLWVASTHLPSDEEVAARIAEGF
FT                   EKRFGVGLKIGGAHWALWPSPVLVLSDLATEQPRPVTLRRITVQLKLRELLRRVVAIDE
FT                   VEIESLVLPRESVRAIRGGSPKPKEDGRIVALPAPWTLAPVPLEKLRWRDLVWIDRRNM
FT                   ALAYDGEITFDAGWRPRQARIERAGASPPARLRLDRAAGQDRWRTRIDIGGGTANGVAW
FT                   FETLPPNDLLRVSAELEPRQVDIEGMLQAFGRRSAVAGKASGQSMLVAEAEEVGALLRS
FT                   LRTRTTFSVQPATLTRLDLAKAVTTAGISRGGTTPLDELTGVLDTQGTDDGVVMRYTGL
FT                   KARSGVLTASGRLRLFNRKLDGEIAVDLIDGVVGMPLKIGGTMSEPEVSLTGGALAGAA
FT                   VGTAVLPGVGTALGARAGQQLEKLFGAEEPVKKKPAPAARKGARASP"
FT   sig_peptide     65388..65468
FT                   /locus_tag="Vapar_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.717 at
FT                   residue 27"
FT   gene            complement(66743..68560)
FT                   /locus_tag="Vapar_0071"
FT   CDS_pept        complement(66743..68560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0071"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   dar:Daro_3240 feruloyl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16734"
FT                   /db_xref="GOA:C5CW36"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW36"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACS16734.1"
FT                   /translation="MNDDHFLLDPSQIAPPRTVRIDFDDGSFALRSPMALKPYARCIGE
FT                   WLERWARETPEALAFAERDDSGEGWRKLDYRALRQAVGAVAQALLDLKLPADKPIVILS
FT                   DNAIDHAVLMLAAMHIGRTACSLSSAYSRMAKDPSRLHGMLQALQPALIYASDAKVYGG
FT                   ALAGCGVEAPAVFSRNADAHAGALPFAQLLQASETPAVMQAYEAILPDTHAKYLLTSGS
FT                   TGKPKVVINTHRMLCANQQMMAQTWRFLEYEKPVLVDWLPWSHTFGGNHNLHMVLAHGG
FT                   ALYIDEGRPAPGLIEKTVRNLREVKPTLLFNVPRGFDMLLPFLEADDALAREVLSRLRL
FT                   AFYAAAALAPSSWQRLEAVAQRVRPERPLWLTTSWGATETSPAITSAHWKLDGAGCIGA
FT                   PLPGLELKFVPNGQKLEMRVKGVSVFPGYRHAPRETAEAFDDEGYYRIGDAGFLANPAE
FT                   PSQGVIFNGRVAEDFKLSSGTWVSVGTLRVKLVSMLAPHVQDVVLTGHDRDEIGMLVFA
FT                   SPQAASLAPQALQARIAEVLRTLRSEGAGSSKCPTRALVLAEPPSLDAGEITDKGYINQ
FT                   RAVLTRRAAEVARLHAGAHHDLQVIRLRD"
FT   gene            complement(68562..69503)
FT                   /locus_tag="Vapar_0072"
FT   CDS_pept        complement(68562..69503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0072"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; KEGG:
FT                   bxe:Bxe_C0922 putative 3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16735"
FT                   /db_xref="GOA:C5CW37"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW37"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACS16735.1"
FT                   /translation="MEPTPQRVAVVATGVIGASWAAYFLARGLDVEATDPSLDAEARLH
FT                   AAVAAHWPTLERFGLATSASPGRLRFHARLEDAVAQADFVQESGPERLDFKTGLFRRMD
FT                   EAAPAHAILASSSSGLAISAVQAECKHPERVVLGHPFNPPHLIPLVEVVGGERTSAQAI
FT                   ERAMAFYAAIGKRPIHVKREVKGHIANRLQAALWREAFHLVDEGVASVADIDTAIAHGP
FT                   GLRWAVMGPFMNLHLSGGAGGIEHVLAHLGGPIEDWWKDLGAPSMTEELKQKVAEGVAA
FT                   ELGARRVAELEVARDMLLLDLIRAKADTGRLD"
FT   gene            complement(69514..70506)
FT                   /locus_tag="Vapar_0073"
FT   CDS_pept        complement(69514..70506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pna:Pnap_0604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16736"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW38"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACS16736.1"
FT                   /translation="MDTRRHFLHTLGAATALGALSPLAALAQALEQVKIYYGFPAGSAG
FT                   DSVARRVGEKLAGSAYCRNAAVVENKPGAGGRIALETLRSASADGSVLALSPFSCTSIY
FT                   PHIYSKLSYDPAKDFAPVSIAAVMHHGLAVGPLVPPEVRTVKDFLAWAKANPNQASYGS
FT                   PAAGSTPHFIGALLGLNHGVDLKHVPYRGSIPGVTDVVGGQIAAMVTPSGDFIPNHKAG
FT                   KLRLLATSGKARSPFSPEVPTFAEQGFAELTTEEWFGFYAPARTPASVVATANAAINAA
FT                   IKEKVVTDSLAVVGLIAQGSTAEEMARSQRAEAERWGPLVRKIGFTADS"
FT   sig_peptide     complement(70423..70506)
FT                   /locus_tag="Vapar_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.906 at
FT                   residue 28"
FT   gene            complement(70530..71456)
FT                   /locus_tag="Vapar_0074"
FT   CDS_pept        complement(70530..71456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0074"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bxe:Bxe_C0921 3-keto-5-aminohexanoate cleavage enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16737"
FT                   /db_xref="GOA:C5CW39"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW39"
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /protein_id="ACS16737.1"
FT                   /translation="MSSSKRKVIVTIAPTGGMAHKSQNPHLPTQPDEIAADVLRCWNAG
FT                   ASVAAIHARRPDDGATCSADVYRDINSRIRNAGCDIVINNSTGGGVHGDMVKPLAGDRW
FT                   EIAWKERIKGMDAGAEMCTLDATTLNLSFEGRQILMDTPITRGRELAAGMKARGIKPEW
FT                   EVFSPTHILQDTTTLIEEGHDDEPYFINLVMNVHRNFQNAMPYSPRFLQMMVDTLPRGS
FT                   IFGVSGIGPSQLEANVAALLLGGHARVGLEDNLYFRHGELATNVQLTERIVRVIHELDM
FT                   DVATPAEARQMMGLPRRGGPRPEFAPR"
FT   gene            71588..72298
FT                   /locus_tag="Vapar_0075"
FT   CDS_pept        71588..72298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0075"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: cyclic
FT                   nucleotide-binding; KEGG: bja:bll5961 transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16738"
FT                   /db_xref="GOA:C5CW40"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW40"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACS16738.1"
FT                   /translation="MATTKPAFKAASLTIPQLLQRSAWYPLLDEAARERVLDEIREVDV
FT                   AAGAALCRRGDTPLHWYGTLEGLLKWSITSSDGRSVTFGGLSVGSWFGEGTLLRGAPRS
FT                   ADVIALRSSRVAQLPLETFEWLHRTQRGFDHFLLQQLNERLHWFMGNYAAHRLLDADGQ
FT                   VARALAGLFHPWLYPGSELHLQTSQEEIANLSGVSRQRCNAALNRLKEAGFLRIEYGGI
FT                   TVIDLEGLRRFISE"
FT   gene            complement(72342..74144)
FT                   /locus_tag="Vapar_0076"
FT   CDS_pept        complement(72342..74144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0076"
FT                   /product="putative flavoprotein involved in K+ transport"
FT                   /note="KEGG: lch:Lcho_0089 putative flavoprotein involved
FT                   in K+ transport"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16739"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW41"
FT                   /inference="similar to AA sequence:KEGG:Lcho_0089"
FT                   /protein_id="ACS16739.1"
FT                   /translation="MTDPTTGPNRAAATWLADFAAALARGDADAAVSLFEADSYWRDLV
FT                   AFTWNIRTQEGADAIRAMLQARLADTQPAAFALEGEATEADGVVDAWFTFETRVARGRG
FT                   HLRLRGGKAWTLLTTMTELKGFEEKTGENRIKGAEHGVHKGRKNWLEKRRDEEAALGYT
FT                   EQPEVVIIGGGQGGIALGARLRRLGVPTIIVERNAKAGDSWRKRYKSLCLHDPVWYDHL
FT                   PYMPFPDDWPVFAPKDKIGDWLEMYTKIMELNYWSSTHARKARFDEAAQRWEVTVEREG
FT                   KPVVLRPRQLVFALGVSGYPNVPKIAGAENFKGDQHHSSQHPGPEAYAGKKCVVLGSNN
FT                   SAHDICAALWEHGADVTMVQRSSTHIAPSQSLMELALGGLYSEQAVKNGIDHHKGDLIF
FT                   ASVPYRIMHTFHIPVYEEMKKRDADLYARLEKAGFLLDFGVDGSGLFMKYLRRGSGYYI
FT                   DVGASELVANGSIHLKSGVNIERVNERSVTLTDGTELPADLLVYATGYGSMNGWLADLI
FT                   SPEIADKVGKCWGLGSGTPKDPGPWEGELRNMWKPTQVEHLWFHGGNLHQSRHYSQFLA
FT                   LQLKARMEGIDTPVYERAPSYHTR"
FT   gene            complement(74348..76294)
FT                   /locus_tag="Vapar_0077"
FT   CDS_pept        complement(74348..76294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0077"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   SMART: AAA ATPase; KEGG: mpt:Mpe_A1612 acetoin catabolism
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16740"
FT                   /db_xref="GOA:C5CW42"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW42"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACS16740.1"
FT                   /translation="MTSLQSRHIDNVYSIATGTALADPAASLVHKSWARCVREHGLDPT
FT                   KPSPARILPAQEVRAHQQQLEHFLRAARAGMEDIYRRVADLGYMVLLTDAEGITVDYIG
FT                   NPAWDDQLRRAGLYLGADWNEAHAGTCGVGTCLIERQPMTCHQTEHFDATHIALTCTTA
FT                   PLFDHSGRLTAILDVSALRSPEARESQHLVRHLVSIYARMIEDADFLRSFRGHWILRLG
FT                   TAYGLVDVAGELMLAFDEGGTVVGANSGARQALAENPLGREVSQLLHIPMDAIWRLGNG
FT                   GASAMPFAHTVLLPGGGEYHASLLAPRVRRAAAPAPDIARPSDRLPPLARIAGDDPAMQ
FT                   QLLAQAQRLVDRGIHVLVEGETGSGKEVLARAMHGASRRAAMPFVAVNCAAIPDSLIES
FT                   ELFGYTPGSFTGGRAKGMKGLIAQADRGTLFLDEIGDMPMALQTRLLRVLSEGEVLPLG
FT                   AESPQRVDLAVVAATHRNLSALVAAGRFREDLYYRLCGAVLKLPPLRARGDRRYLIEAM
FT                   FNEEAAAMRPGARLSDAALQRLLAHAWPGNLRELRNVLRLALALCADGTVGAQDLQLPA
FT                   PSDSAAAAAVPSAPASAEAGAGDGGLEGADELRALLQRHRWHVARAAAELGVCRATVYR
FT                   HMKRHGIAPPQRM"
FT   gene            complement(76439..76660)
FT                   /locus_tag="Vapar_0078"
FT   CDS_pept        complement(76439..76660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0078"
FT                   /product="4-oxalocrotonate tautomerase family enzyme"
FT                   /note="TIGRFAM: 4-oxalocrotonate tautomerase family enzyme;
FT                   PFAM: 4-oxalocrotonate tautomerase; KEGG: pfo:Pfl01_0300
FT                   4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16741"
FT                   /db_xref="GOA:C5CW43"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR018191"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW43"
FT                   /inference="protein motif:TFAM:TIGR00013"
FT                   /protein_id="ACS16741.1"
FT                   /translation="MPFVNLKITRDGVTREQKTQVIAEFTETLERVLKKPPEWTHIVIE
FT                   EIDTDDWGFAGLTTTEYRKRLADRAKPA"
FT   gene            complement(76671..77411)
FT                   /locus_tag="Vapar_0079"
FT   CDS_pept        complement(76671..77411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0079"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: ppu:PP_2503
FT                   3-oxoacyl-(acyl-carrier-protein) reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16742"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW44"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS16742.1"
FT                   /translation="MQDNTSPTVVITGASSGIGLGLAQAYLERGFNVVANARTEERLAA
FT                   AAKQLGNPARLLGVAGDIGRRDTAQQLVERAVERFGQVDVLINNAGIFNAKPFVEYTED
FT                   DLEQMVATNLKGFVYASQAAAKHMVARRQGHIVNITASIALQPNQQVPAALPVLIKGGI
FT                   NAATRALALELAPHNVKVNAVAPGIVDTPLYTPEQHGFLNGLAPAGRIATVREIADAVL
FT                   YLTSADFTTGVVLPVDGGMSSGKW"
FT   gene            77523..78434
FT                   /locus_tag="Vapar_0080"
FT   CDS_pept        77523..78434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0080"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ppu:PP_2502 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16743"
FT                   /db_xref="GOA:C5CW45"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW45"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS16743.1"
FT                   /translation="MQRQFGDILLGSIELFCLAAETGGFTSAALAAGVTPAAVSRSISR
FT                   LEKRLGLRLFVRTTRSVRLTDAGRSYFAQCRQALAQLAEAEREVMGQQALPSGMLRISV
FT                   PTTYGHHRILPLLPAFRERFPDIRLHVHLSNRNIDFVEEGYDMAVRVRAQPDSTLIARH
FT                   LEDADLVVVATRKYLRRAGTPRTLDDLAAHECIQFELPSSGRRISWLFKENGKDREVFA
FT                   DGAYSCSDDVLGGVTLAKSSAGLFQTYRFVVEKELADGSLVEVLKPFAGCSRPYTLLYP
FT                   DGRHVPLRMRVFIDFLMAQRGA"
FT   gene            complement(78447..80357)
FT                   /locus_tag="Vapar_0081"
FT   CDS_pept        complement(78447..80357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0081"
FT                   /product="Tannase and feruloyl esterase"
FT                   /note="PFAM: Tannase and feruloyl esterase; KEGG:
FT                   bcm:Bcenmc03_6136 feruloyl esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16744"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW46"
FT                   /inference="protein motif:PFAM:PF07519"
FT                   /protein_id="ACS16744.1"
FT                   /translation="MPRPQRRTRTASRTAIAARLAAACLGIGTLATLAACGGSGSSGAS
FT                   LPFLPVVPPPSTPGTSSALACDESLKTAFKPDANTTVTVVKQFKQGDDLNLDGKASGTV
FT                   AASDVCMVKLNVGPGHAGPADAPSTSPGIGIEVWLPAAAKWNNRLRVLGGGGFVGDAGI
FT                   SSRTQIGGAGAAAIAAGQGSVSAVTDAGHASKLPVPAVDGSFAMNPDGTVNTTLWTDFA
FT                   SRGIHEMAVKAKALASGFYQRDAQYAYWDGCSTGGRQGHMQAQVNPGDFDGILAGNSAI
FT                   NWTTFITSELYPQIVMQRDLGGTPLAAEQLALVSSAAVSACDSTLTGQHEGFISDPAAC
FT                   KYDPVQDKAVLCIGSGGTNATAACLSTVQAQAVNKIWYGQTRDGSAPAPASDIGYGATL
FT                   APGQLWYGLTRGTSLNSPGAPGFSLADSTAGTPHPFPIAAHQVALNLQDPTIATPDFVN
FT                   ATGNGANNWKGLSYAQLANASDRGKALQSAFAGINADNPDLARFRDRGAKLLTYHGLAD
FT                   QLIASSGTANYYERVAKTMGGIEATQKFYRYLEIPAMGHCVGVGSVNGLAGVSPAANPP
FT                   LPAPDQLFSALTDWVEKGIAPDNLVLQNADKSLARPLCTYPKKVAYTGGDVKAAASFAC
FT                   R"
FT   sig_peptide     complement(80223..80357)
FT                   /locus_tag="Vapar_0081"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.544 at
FT                   residue 45"
FT   gene            complement(80466..81344)
FT                   /locus_tag="Vapar_0082"
FT   CDS_pept        complement(80466..81344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0082"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: msl:Msil_1853 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16745"
FT                   /db_xref="GOA:C5CW47"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW47"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS16745.1"
FT                   /translation="MAREISLLDLSGKPVRFDGRMLMNAAATPWQGFALEVRAMHGDGE
FT                   NPACYNPHPLLAFCMRGHVKSAMTTGRRTSHVESRPGSVCIFDQGYEVDRVTWSGQCDE
FT                   VIALEIRPETLRSLMPESDGELHLQTHLSTTDATLTSLAIAMRDEVERGCTSGRMHAQG
FT                   LSMALVSYLQSRYGGARNAKRAPGRLSQADLRRVYDWVMQHLGEDFGIDELAAELNMSA
FT                   VHFTRLFRASTGSTPYRYVMEQRVRHALTLLEGRLSLAEIAHTVGFSSQAHFTQVFKQL
FT                   VGTTPARARLG"
FT   gene            complement(81372..82073)
FT                   /locus_tag="Vapar_0083"
FT   CDS_pept        complement(81372..82073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0083"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dac:Daci_0081 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16746"
FT                   /db_xref="GOA:C5CW48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW48"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS16746.1"
FT                   /translation="MLVVRDLNTYYGNSHILRGVHAGIPAATSVGLLGRNGMGKTTLIR
FT                   TVMGYVRPASGEVQVDGRTVTGWPPEKMARLGIGYVPEGRGIFPNLSVRENLVMSERAG
FT                   IDGRRAWTFDRVMATFPRLAERLSHGGQQLSGGEQQMLSIGRALMTNPRLLILDEATEG
FT                   LAPLIVAEIWRVISEIRATGIATLIVDRDYRKVLAHTDLAVVMEKGQIVRHGASADLLS
FT                   EPKALEDLLGV"
FT   gene            complement(82075..82821)
FT                   /locus_tag="Vapar_0084"
FT   CDS_pept        complement(82075..82821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0084"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dac:Daci_0080 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16747"
FT                   /db_xref="GOA:C5CW49"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW49"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS16747.1"
FT                   /translation="MTALLSVEGLTRRFGGLTAVNAITLDLHVGEVHAVIGTNGAGKST
FT                   LINMLSGEIEASEGRIALDGVDITRRAQWRRARAGVGRSYQRTTIFPEFSVHENCRLAA
FT                   QAATARPWTVWQSSGRCAASNAAADAALEAAGLSNEALRIAGTLSHGAQRQLEVAMCLA
FT                   TRPRVLLLDEPLAGMGAEETDRMLTLLARLKATHAILLVEHDMDAVFRIADRITVMVNG
FT                   TVIATGDPRSIRENPEVRTAYLGEDH"
FT   gene            complement(82961..83935)
FT                   /locus_tag="Vapar_0085"
FT   CDS_pept        complement(82961..83935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0085"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dac:Daci_0079 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16748"
FT                   /db_xref="GOA:C5CW50"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW50"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS16748.1"
FT                   /translation="MMQVHTSSMRRGAFLVPVACAIAIGVLGPLMGNYVSDFVVKVMIL
FT                   SIFALSLELLVGMTGLVSLGHAAFYGIGAYVTVLASGSEGGNLALLLPLAMGAAALYAL
FT                   FVGALSLRTRGVYFIMVTLAFAQMAFFVFHDTKVGGGSDGIYMYVRPAIGKLDMENRMV
FT                   LFYIVLASLVFTYGLLALVRRSRFGAALAGIRVNEQRMRAAGFPVYGYKLAAFVLAGAL
FT                   AGLAGFLLASRDGVVNPELMAWHNSGEVLLMVILGGLGHLRGAVIGAIAFTLLKEIFST
FT                   HAVMGPLADHWQLTLGIAIIVFVAWLPKGLIGLAKRLSPKGAA"
FT   gene            complement(83932..84804)
FT                   /locus_tag="Vapar_0086"
FT   CDS_pept        complement(83932..84804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0086"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dac:Daci_0078 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16749"
FT                   /db_xref="GOA:C5CW51"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW51"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS16749.1"
FT                   /translation="MDFGTFLVQCLNSVQYGLLLFLVASGLTLIFGIMGVINLAHGSFY
FT                   MIGAYMAFALSPLFGDQFLLMLVAGVVLAAIFGYLLEWAFFSYLYQRDHLQQVLMTYGL
FT                   ILVFEELRSILVGNDVHGVKVPAWLDGSFALGNVMSYPWYRLFASAACIVLAVALYWVV
FT                   NRTRLGMMIRAGASNRDMVRGLGIDVKRLYRIVFAAGVALAALAGMIAAPMSSVYPNMG
FT                   ASVLIICFVLVVIGGIGSITGALVASLLVGFVDTFGKVFFADLSGIGIYLLMAIVLIWR
FT                   PEGLMGRRP"
FT   gene            complement(84960..86144)
FT                   /locus_tag="Vapar_0087"
FT   CDS_pept        complement(84960..86144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0087"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rfr:Rfer_0214 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16750"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW52"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACS16750.1"
FT                   /translation="MTPFTPVRTARLALTAIAFAALASAAGAQGSAKLKVGLMLPYSGT
FT                   YTALGVAIENGFKLYVDEHGGKLAGREIEYFKVDDESDPAKATDNVNKLIKRDNVDVIV
FT                   GTVHSGVAMAMAKAAKESGTVLIVPNAGADAVTGPMCAPNIFRSSFSNWQPAFAMGEVA
FT                   AKQQGKKKAMTITWKYAAGDESVNGFKEGFEKNGGKVDKQLTLPFPNVEFQALLTEIAA
FT                   AKPDAVYAFFAGGGAVKFVKDYQAAGLNKTIPLYGPGFLTDGTLDAQGEAAQGMLTTLH
FT                   YADGLNTARDNAFRVGYAKAFKLQPDVYAVQGYDAAQMLGVGLAATKGDIGKKAEFTAA
FT                   IEKAKIDSPRGTFTMSKSHNPVQDIYLRKVEGKENKLVSIAIKGLTDPARGCRM"
FT   sig_peptide     complement(86058..86144)
FT                   /locus_tag="Vapar_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.626 at
FT                   residue 29"
FT   gene            complement(86141..86944)
FT                   /locus_tag="Vapar_0088"
FT   CDS_pept        complement(86141..86944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0088"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: lch:Lcho_3654
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16751"
FT                   /db_xref="GOA:C5CW53"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW53"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACS16751.1"
FT                   /translation="MTPDFATINWRGRPVHIECQWIAPERTDAPLIVFLHEGLGSIAMW
FT                   KDFPAQVCNAANARGLVFSRPGYGRSTPRADDEIWDVDFMHRQAHEVLPALFTALKLDD
FT                   EKPWLFGHSDGGSISLLYASRFADRVSGLIVLAPHIFVEDVTVANIEQARTAYLSTDLP
FT                   AKLGRYHDSADSAFWGWNRIWLHPPFREWNIEAELDTIRCPVLAIQGTGDEYGTLAQIH
FT                   GIAARVGGCELLEIPECGHSPHRDQPDRVIVAATSFITKNRRQTP"
FT   gene            complement(87084..88631)
FT                   /locus_tag="Vapar_0089"
FT   CDS_pept        complement(87084..88631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0089"
FT                   /product="benzoate-CoA ligase family"
FT                   /note="TIGRFAM: benzoate-CoA ligase family; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: vei:Veis_0730
FT                   benzoate-CoA ligase family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16752"
FT                   /db_xref="GOA:C5CW54"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011957"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW54"
FT                   /inference="protein motif:TFAM:TIGR02262"
FT                   /protein_id="ACS16752.1"
FT                   /translation="MTLPHRFNFAEHLFALNRGRAERTAYIDDRGTLAYGQLEDRARRL
FT                   AAALKAAGVRREERVLLLMLDSSDWPVSFLGCLYAGVVPVAVNTLLTPADYAYMLDHSR
FT                   AQAALVSGALLPTLQEAMALGPHEVHTLIVSQPTGALPEGAQEFEAALAAAAPMAAPAP
FT                   TASDDPGFWLYSSGSTGKPKGTVHTHANLWWTAELYGKPILGLTENDVCFSAAKMYFAY
FT                   GLGNALTFPLSVGATVVLMAERPTPDATFRRWVEHKPTVFFGAPTGFAGMLASPKLPAR
FT                   EAVALRMCSSAGEALPGEIAQRFKAHFGCEIIDGIGSTEMLHIFISNRPGDVRYGTTGR
FT                   PVEGYEVELRGEDGRPVPDGEVGDLYIRGPSAALMYWCNREKSRETFQGGWTKSGDKYT
FT                   RDADGYYTYAGRSDDMLKVSGIYVSPFEVEATLMQHPAVLEAAVIGKEDADGLTKTKAF
FT                   VVLKDGQSVSDEELKAFVKERLAPYKYPRFLEFVQELPKTATGKIQRFRLRERERQA"
FT   gene            complement(88660..90210)
FT                   /locus_tag="Vapar_0090"
FT   CDS_pept        complement(88660..90210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0090"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: lch:Lcho_3656
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16753"
FT                   /db_xref="GOA:C5CW55"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW55"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACS16753.1"
FT                   /translation="MTELLPNYVAGRWQGGSGAGTPLFDPVLGTELVRVDATGLDLPAA
FT                   FAFARDEGGHALRALTYRQRAGLLGAIVKVLQANRDAYYEIATANSGTVKNDSAVDIDG
FT                   AIFTLGQYAKWGDALGDVRALRDGEAVKLGKEPVFQSQHLQLPTHGVALFINAFNFPSW
FT                   GLWEKAAPALLSGVPVIVKPATATAWLTQRMVKDVVDAGVLPAGALSVVCGSSAGLMDA
FT                   LQPFDVVSFTGSAETAAVIRSHPAVAQRSVRVNIEADSLNSALLLPGAAAGSEAFNLLV
FT                   REVVREMTVKAGQKCTAIRRILVPAELYDAAAQAIGAKLKGVTVGNPRNESVRMGSLVS
FT                   RAQMNAVSEGLEALSAQATVLYDGRNTPLIDAEPSVAACIGPVLLGARDADAAQRVHDV
FT                   EVFGPVATLLPYRDLAHGIALAHRGQGSLVTSLYGSDDAALAQAALAVAPSHGRVHVIT
FT                   PEVAQAHTGHGNVMPMSLHGGPGRAGGGAELGGLRALDFYHRRSAVQASPGVLAALGL"
FT   gene            complement(90207..90680)
FT                   /locus_tag="Vapar_0091"
FT   CDS_pept        complement(90207..90680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B1916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16754"
FT                   /db_xref="InterPro:IPR032345"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW56"
FT                   /inference="similar to AA sequence:KEGG:H16_B1916"
FT                   /protein_id="ACS16754.1"
FT                   /translation="MSSKEAFHQLIAGLAAEIAGRPLDAQLDQWLNATHGAGSARFEAL
FT                   RQACIGGVAEGWLCEREGGGIRYGRVFKAEDALQRFSVDVVDMQDIAGPHHTHPNGEID
FT                   LIMPLEGSPGATFDGRPAGWCVYGPGTAHRPTVANGRALVLYLLPEGQIKFTP"
FT   gene            90881..91831
FT                   /locus_tag="Vapar_0092"
FT   CDS_pept        90881..91831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0092"
FT                   /product="transcriptional regulator, XRE family with
FT                   shikimate kinase activity"
FT                   /EC_number="2.7.1.71"
FT                   /note="KEGG: vei:Veis_0731 anaerobic benzoate catabolism
FT                   transcriptional regulator; PFAM: shikimate kinase;
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16755"
FT                   /db_xref="GOA:C5CW57"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW57"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ACS16755.1"
FT                   /translation="MNEHVDAVLAPAPEEGQRAGNPAAPAGEAKNPLLAALGERVRNLR
FT                   AQRGLTRKAVAIAADVSERHLANLEYGIGNASILVLQQVAGALHCSLAELVGDVTTSSP
FT                   EWLLIRELLENRSEADLRRVRVAVGELLGTASVDPARHRRIALVGLRGAGKSTLGQMLA
FT                   DDLDVPFVELSRDIEKLAGCSVREIHDLYGTNAYRRYERRALEEAIQIYGEVVIATPGG
FT                   IVSDPATFNELLAHCTTVWLQAAPEEHMGRVAAQGDTRPMAASKEAMEDLRRILNGRAA
FT                   FYSKADLSVDTSGKTLAQSFQALRTVARQAIGTGA"
FT   gene            91961..93637
FT                   /locus_tag="Vapar_0093"
FT   CDS_pept        91961..93637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0093"
FT                   /product="benzoyl-CoA-dihydrodiol lyase"
FT                   /note="TIGRFAM: benzoyl-CoA-dihydrodiol lyase; PFAM:
FT                   Enoyl-CoA hydratase/isomerase; KEGG: dac:Daci_0074
FT                   enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16756"
FT                   /db_xref="GOA:C5CW58"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR017633"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW58"
FT                   /inference="protein motif:TFAM:TIGR03222"
FT                   /protein_id="ACS16756.1"
FT                   /translation="MTETTTLQAPLRVDYRIEPAQYRHWKLSFEGPVARLVLDIAEDGG
FT                   IRPGYKLKLNSYDLGVDIELNDALNRVRFEHPEVRSVIVTSGKDRIFCSGANIFMLGVS
FT                   SHAWKVNFCKFTNETRNGIEDSSKHSGLKFIAAVNGACAGGGYELALACDEILLVDDRS
FT                   SSVSLPEVPLLGVLPGTGGLTRVTDKRHVRHDLADIFCTSVEGVRGQRAVDWRLVDAVA
FT                   KPAQFAAAVQERAAQLAAASDRPASGKGVALTRLERTDSADGIAYSNVDVKIDRSKRTA
FT                   TITVKAPTGTQPADIAAIEAAGAAWWPLAVCRELDDAILNLRTNELDIGTWLLKTEGDA
FT                   AAVLASDALMLAHKDHWLVRETIGALRRTLARLDVSSRSLFALVEAGSCFAGTLAELAF
FT                   AADRSYMLALPDDAARAPKLVLNEFNFGFFPMVNDQSRLQRRFYEEAAPLDAARAAAGK
FT                   PLDADEALKLGLVTAAPDDIDWDDEIRIAVEERAAMSPDALTGLEANLRFASKENMATR
FT                   IFGRLTAWQNWIFNRPNAVGEKGALKVYGTGQKAGFDLNRV"
FT   gene            93679..95106
FT                   /locus_tag="Vapar_0094"
FT   CDS_pept        93679..95106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0094"
FT                   /product="benzoyl-CoA oxygenase, B subunit"
FT                   /note="TIGRFAM: benzoyl-CoA oxygenase, B subunit; KEGG:
FT                   vei:Veis_0733 benzoyl-CoA oxygenase component B"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16757"
FT                   /db_xref="GOA:C5CW59"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR017635"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW59"
FT                   /inference="protein motif:TFAM:TIGR03225"
FT                   /protein_id="ACS16757.1"
FT                   /translation="MSTINYSEKIPNNVNLGEDRTLQRALEGWQPNFINWWDDVGPEGS
FT                   TNHEVYLRTAVSVDPQGWAQFGHVKMRDYRWGIFLNPGDANREIHFGDHKGEKAWQDVP
FT                   GEHRANLRRIIVTQGDTEPASVEQQRHLGLTAPSMYDLRNLFQINVEEGRHLWAMVYLL
FT                   HKHFGRDGREEAEALLQRTSGDQDNPRILGAFNEKTPDWLAFFMFTYFTDRDGKFQLAA
FT                   LAESAFDPLARTTKFMLTEEAHHMFVGESGVSRVLARTAQVMNELKTDDAQKVRAAGAI
FT                   DLGTIQRYLNFHYSVTIDLFGADQSSNAAIFYSSGLKGRYEEGKRGDDHVLKGQTYKVL
FT                   EVKDGQLVEKDVPMLNALNEVLRDDFIKDSVAGVGRWNKVLEKAGIPTRLTVPHKAFNR
FT                   QIGALAGIKMSPEGRVVNEVEWAAKRNEWLPSAEDFAFVASLMGRVVEPGKFAGWISPP
FT                   VMGINRQPVDFEYVRFG"
FT   gene            95235..96521
FT                   /locus_tag="Vapar_0095"
FT   CDS_pept        95235..96521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0095"
FT                   /product="benzoyl-CoA oxygenase/reductase, BoxA protein"
FT                   /note="TIGRFAM: benzoyl-CoA oxygenase/reductase, BoxA
FT                   protein; PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: vei:Veis_0734 oxidoreductase
FT                   FAD/NAD(P)-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16758"
FT                   /db_xref="GOA:C5CW60"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR015701"
FT                   /db_xref="InterPro:IPR017634"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW60"
FT                   /inference="protein motif:TFAM:TIGR03224"
FT                   /protein_id="ACS16758.1"
FT                   /translation="MDMAVEAGVIKQHLIDPEICIRCNTCEATCPVNAITHDDNNYVVR
FT                   ADICNGCMACISPCPTGSIDNWRTMPLVRAYTIEEQLSWESLPAELTPEELEAAGVSAS
FT                   EAGDEAAPAAAPASSQTAVDAIEPVFNSAQYGATVPPWSAAHAYTNLFAPKSPTTATVV
FT                   GNFNCTEAGFDSETHHIVLDFGVVPFPVLEGQSIGIVPPGVDAIGKRHHARQYSVASPR
FT                   NGERPGYNNVSLTVKRVTEDHQGDPVRGVCSNYVCDLKVGDTVQVVGPFGSSFLMPNHP
FT                   RSHIVMICTGTGSAPMRAMTEWRRRLRKSGKFEGGKLMLFFGARTQQELPYFGPLQSLP
FT                   KDFIDINLAFSRTPGQPRRYVQDLMRERAADLAALLKDGASHFYVCGLKSMEEGVVLAL
FT                   RDVAKEAGLDWDTVGAALKREGRLHLETY"
FT   gene            96532..96975
FT                   /locus_tag="Vapar_0096"
FT   CDS_pept        96532..96975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0096"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   rfr:Rfer_0225 MaoC-like dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16759"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW61"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACS16759.1"
FT                   /translation="MKFADFHPGQVIEAGPYVVSEAELIGFAQAYDPQWFHTDAVAAAD
FT                   SAFGGLIASGWHTCSIAMRLVVDAALRGSESFASPGLEHVRWPHPVRPGDALRLVADVI
FT                   EARRSEKRPTLGILRWRWRLFNQRELMVLDVEVTSLFRLEASH"
FT   gene            complement(97027..97566)
FT                   /locus_tag="Vapar_0097"
FT   CDS_pept        complement(97027..97566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0097"
FT                   /product="putative outer membrane adhesin like protein"
FT                   /note="KEGG: mgm:Mmc1_2179 putative outer membrane adhesin
FT                   like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16760"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW62"
FT                   /inference="similar to AA sequence:KEGG:Mmc1_2179"
FT                   /protein_id="ACS16760.1"
FT                   /translation="MKQQQHKSLFVGALLAGLLAMSGFAQAQSVGVGVGVNADVNTSGS
FT                   ATAPQRQGAAGAGARTEGSAGGSAATNAGVQPVEVPGKAAGGLGNTLGGVVGGATGAVG
FT                   GATNAVGGATSAVGGATNAATGAAGNVTGATNVVGDTVGGVTGAAGSAGGALKAPAVGA
FT                   KASGKAKGSGAVDVKK"
FT   sig_peptide     complement(97483..97566)
FT                   /locus_tag="Vapar_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 28"
FT   gene            97818..98279
FT                   /locus_tag="Vapar_0098"
FT   CDS_pept        97818..98279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0098"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="PFAM: protein of unknown function UPF0074; KEGG:
FT                   swi:Swit_2165 BadM/Rrf2 family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16761"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW63"
FT                   /inference="protein motif:PFAM:PF02082"
FT                   /protein_id="ACS16761.1"
FT                   /translation="MKRDSKLSGVLHALLHMAEMEGPVTSESLAMAMQTHPVVVRRVMA
FT                   GLREAGFVSSAKGHGGGWVLSCPLDAVTLGDIHQAVGSPALLAMGNRTESPGCIVEQAV
FT                   NAALDGACREAEALLLERFNSITLADLSRDFHRRMTGGGFTRKDIEHAL"
FT   gene            98269..99177
FT                   /locus_tag="Vapar_0099"
FT   CDS_pept        98269..99177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0099"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: mex:Mext_4049 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16762"
FT                   /db_xref="GOA:C5CW64"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW64"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACS16762.1"
FT                   /translation="MHYDALVVGGSFAGLSAALQLARARKTVCIVDAGAPRNRFAAASH
FT                   GFFGQDGTPPLKMIADARAKVLAYPNASFVEGRVAEARADGAGGFAVSLEGGGAPLTAS
FT                   RIVLAFGVEDGFPEIEGVRERWGRSVLHCPYCHGYEVSGRRLGILIERPHAPEHAILFA
FT                   EWGSATLFLNGNNTVDDETRARLQARGVAIEPGRIAALEGPSPTELSGVRFADGRRVSL
FT                   DAMFLVPRTRLSSPLAEQLGCAIDEGGFGPLIRTDAMKMTTVPGVFAAGDAAMMFHNAT
FT                   MASADGVMAGISLHRASVFGH"
FT   gene            99232..99307
FT                   /locus_tag="Vapar_R0001"
FT                   /note="tRNA-Gly1"
FT   tRNA            99232..99307
FT                   /locus_tag="Vapar_R0001"
FT                   /product="tRNA-Gly"
FT   gene            complement(99370..100695)
FT                   /locus_tag="Vapar_0100"
FT   CDS_pept        complement(99370..100695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0100"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="KEGG: bpy:Bphyt_2380 fumarylacetoacetase; TIGRFAM:
FT                   fumarylacetoacetase; PFAM: Domain of unknown function
FT                   DUF1969; fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16763"
FT                   /db_xref="GOA:C5CW65"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW65"
FT                   /inference="protein motif:TFAM:TIGR01266"
FT                   /protein_id="ACS16763.1"
FT                   /translation="MNAALNHTHDTNARSWVAAANTEGTDFPIQNLPYAVFRRTGSPQP
FT                   FRGGVAIGDQVLDMAALSARQLLDGLALDAARAAALPALNDFFALGGTAWRALRHAVFA
FT                   LLRDDAPAATAKLVRECLVPQAEVEYTLPARIGDYTDFYTSIDHALNISRLMNPEGDVT
FT                   PNFRWIPTAYHGRVSTIGISGQRFHRPMGQTMAPGAKAPTFHACARLDYELELGIWIGE
FT                   GNAAGEPIPLERAEEHIFGICLLNDWSARDIQFWEMAPLGPFLAKNFATTISPWIVTME
FT                   ALAPYRQAWTRPADEPQPLAYLESRGNREGGAIDIRLEVWLESERARSEGSGPSRLSRT
FT                   SFRHQYWSVAQMVAHHTVGGCSLNPGDLFGSGTISGPGPGEAGAIIELTRAAQDPVTLA
FT                   NGEQRGFLEDGDAVLLRGWCEKPGHARIGFGESRGTVLPAKG"
FT   gene            complement(100715..101521)
FT                   /locus_tag="Vapar_0101"
FT   CDS_pept        complement(100715..101521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0101"
FT                   /product="cyclase family protein"
FT                   /note="PFAM: cyclase family protein; KEGG: vei:Veis_0387
FT                   cyclase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16764"
FT                   /db_xref="GOA:C5CW66"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW66"
FT                   /inference="protein motif:PFAM:PF04199"
FT                   /protein_id="ACS16764.1"
FT                   /translation="MPRKFVDLSIFLENDVLSDPPAFAPKIQYFTHEQTYEQIEPFFPG
FT                   LKKEDLPDGEGWAVELVQLSTHNGTHLDAPYHFHSTMDKALGEKKPAIAIHEVPLEWCF
FT                   QPGVKLDFRHFADGYVVTAGDVEAELKRIGHTLSPLEIVVVNTRAGSRYGHNDYVSAGA
FT                   GMGYEATMYLLERGVRLTGTDAWSWDAPFVHTAKKYGETHDASLIWEGHKAGRDIGYCH
FT                   IEKLHNLEALPPTGFFISCFPHKIRGASAGWTRAVAIFDDALMASA"
FT   gene            complement(101561..102352)
FT                   /locus_tag="Vapar_0102"
FT   CDS_pept        complement(101561..102352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0102"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vei:Veis_0386
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16765"
FT                   /db_xref="GOA:C5CW67"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW67"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS16765.1"
FT                   /translation="MNGNRRVGILVNRLGSLAVLLALIALWWMASNAGWVSRVFLPTPQ
FT                   ATFASLLEGLNLRGPNSNGELLAFTQATVGRMLQGWLLASLFGVLLGAAIGVSPAVRAW
FT                   VQPTLEFIRPLPASALLPLAISIFGLNPGMVLFVVAFGAMWPVLLATVHGFAAVEPRLA
FT                   EVARCLQMSRAAFVWKMGLPNAMPDILAGMRLALTIALIVAVVGEMIASQSGLGQAILL
FT                   AARAFRASDLFAGIVLLGLIGFASNALLAFAEKRLLRWQQP"
FT   sig_peptide     complement(102251..102352)
FT                   /locus_tag="Vapar_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.975 at
FT                   residue 34"
FT   gene            complement(102349..103119)
FT                   /locus_tag="Vapar_0103"
FT   CDS_pept        complement(102349..103119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0103"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vei:Veis_0385
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16766"
FT                   /db_xref="GOA:C5CW68"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW68"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS16766.1"
FT                   /translation="MTEHRLLRWLRPWVFPALLVGAFEWYARRAAALGSDALAPPSAAA
FT                   RAFMGAALDGSLWQATGFTLGTAALGLLLGAVLGIALGLVLGLSRRAAQLGSLSIEVLR
FT                   PVPSVALIPLAMLTFGFGVRMELAIVAFATFWPLLVLVQSAVQQIEPRLLEVSRVLGLS
FT                   ARERAFKIVLPAIAARLFVALRLGVAVALVVAVTVEIAANPNGMGYAMMIAQQSFDPAL
FT                   MLAWLGWIGVVGFAVNAGMVLLQRVVARRMGVLP"
FT   gene            complement(103112..103894)
FT                   /locus_tag="Vapar_0104"
FT   CDS_pept        complement(103112..103894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0104"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vei:Veis_0384 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16767"
FT                   /db_xref="GOA:C5CW69"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW69"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS16767.1"
FT                   /translation="MSTAADFLRFDGVAIRLGGREILSPTSFDVARGEFVCIVGPSGCG
FT                   KTTLLRAASGLVAASAGEVRRKGVKMSEPSREVAFVFQDYGRALLPWRTVEGNVSLALE
FT                   AAGVPAAERAPRIAEVLGKVGLAKHAQKFPVQLSGGMQQRAQIARCLAQKPELMMMDEP
FT                   FGALDALTRQSLQDELARLVRDDGLTVLFVTHDLEEAIYLGDRVIALQANPGPGRPSLA
FT                   RMIDVKIPRPRDQLTTKEHPEYLQLRRELFAFIEQGHD"
FT   gene            complement(103891..104835)
FT                   /locus_tag="Vapar_0105"
FT   CDS_pept        complement(103891..104835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0105"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   vei:Veis_0383 NlpA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16768"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW70"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACS16768.1"
FT                   /translation="MMKRRTLLSALAAASAAAALPSRAQSNPKIVFGYTAVSDFASVFV
FT                   AAEEGYFKKRNLDVELKFIPLNSTIPAALQSDSLQIGGPTPSVFLQAVDGGLDLVLVAG
FT                   GGLTSKTITGFGLVARAGSGIKGPQDCVGKKIGVPGLGAFLHVTFRAWLKESGVDYRKV
FT                   NFVEASFPQHADLLRGGSVDAVVSADPFMSRITESGAGYVASYYSTFLPENNQTIVHAA
FT                   KREWVLKNPGAARAFRESLVEAAAFMQQPKNDAKVRAAIGKYIKLPPEVLAKIQISPPG
FT                   ATVSEKQLGYWVGLMKDQDMLKTSIDVAKLIAK"
FT   sig_peptide     complement(104761..104835)
FT                   /locus_tag="Vapar_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 25"
FT   gene            complement(104832..105560)
FT                   /locus_tag="Vapar_0106"
FT   CDS_pept        complement(104832..105560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0106"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: vei:Veis_0382
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16769"
FT                   /db_xref="GOA:C5CW71"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041586"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW71"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS16769.1"
FT                   /translation="MNTRTPPARRSAHRAPAAAAEAARPDRRHAILLAAEKLFAQHGYH
FT                   AVTIRQIAEEAGVPLALVGYYFGPKHELFHAIFEHWSHSIEERLAGLKAVDNDPDDART
FT                   LPRIIEAFTGPVLALRASAEGEYYALLVARELYHATEEADRVLRGYFDPLAEAYIDALH
FT                   VALPHATRGQAAWGYQFSLGALLHHLNDSRIERLSRGENRRSDPAVAPMLVNFIVGGLR
FT                   AALPRPKAPQKKTTPRRQKT"
FT   gene            105660..107675
FT                   /locus_tag="Vapar_0107"
FT   CDS_pept        105660..107675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0107"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: pol:Bpro_0120
FT                   acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16770"
FT                   /db_xref="GOA:C5CW72"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW72"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ACS16770.1"
FT                   /translation="MPAPNIPQIRLYQDWLREQRGLSFDTYDALWRWSVTDLDAFWQSI
FT                   WDYMGIVSPTPHTAVLADDRMPGATWFPGAEVNYAREVLRHADAAHAAGLPAIVSDNEL
FT                   GEVREMPWPELRRQVASVALTLKSLGVQRGDRVAAYLPNVPETMVAFLACSSIGAVWSV
FT                   CAPDMGTAAVVDRFRQIEPKLLIAADGVHYGAKPIDRSAVVQELRDALPSVQKLLLLRT
FT                   PHAAQQLAADADWQAASARRDAEVAAFEPEWLPFDHPIWIVYSSGTTGLPKPIVHGQGG
FT                   IIMTMYACGLHNDIGASYGANNFDERFHWYSSTGWVMWNCQLAGLAFGATIVIYDGHPA
FT                   GSKEKPDWAVLWRFVAKHRITFFGAGAAYFTNCMKAGVVAAECGDLSRVRALGSTGSPL
FT                   SEEVQRWGTAQLLAAGASSVWWCNISGGTDFCGAFVGGNRELPEVPGQMQCRQIGHAVE
FT                   AWNEDGKPVIGEVGELVCTRPIPSMPLYFWGDEGNARYLSSYFDTYPGVWRHGDWIRIG
FT                   EDGGCIIYGRSDATINRLGLRMGTSEIYSAVEALPEVLDSMVVDLEYLGRESYMPLFVV
FT                   LRPGVALDDAMRGKINHAIKTSLSPRFLPNDIFQVAEIPRTLSGKKQELPIKKLLLGQP
FT                   LQKVVNPEAMANPGSLGWYVEFAARRAAASQGISSS"
FT   gene            complement(107654..109600)
FT                   /locus_tag="Vapar_0108"
FT   CDS_pept        complement(107654..109600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0108"
FT                   /product="adenylate/guanylate cyclase with integral
FT                   membrane sensor"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   adenylyl cyclase class-3/4/guanylyl cyclase; KEGG:
FT                   sfu:Sfum_2802 adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16771"
FT                   /db_xref="GOA:C5CW73"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW73"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACS16771.1"
FT                   /translation="MNKKNSSGSAGGAGKPPLAFFEFSAAVARLSRRFRVDVSTIVSAV
FT                   ALTQSLLLATLGYWGSQRLVAKIGASAHAANHYRTEDNMLAVLAKTESAVGALAGAPSL
FT                   GAAGEHAQRTAELLWTLLQQAPELDSLYVADDTGQMLMALRYPVPAIRRIARGAGTGEL
FT                   AIETWQYKLPPAPEIDAQQRFATQRIESFRSGYDPRLQRWYQQARQMQRPVWTAPYAFA
FT                   ATQELGVSYALPSKRRAAEGGPRLLVVGGDVSLGRLSQFVRLFASDGRGDGALLDAGDQ
FT                   VLARSDQPGVLRQPEPPTGVLGALHAQMLENRTPDGAGGAAFSFEHEGRGYLAQASRIP
FT                   SAGWQLVSWVPEDFVLGALRRAVLWWLLLGLALLAAALFVSLQLSRLVTSPVEKLAQIA
FT                   RRIGLLELDDLPREPSRVLEIQNLDRALDESARSLRAFSKFVPVDVISQLVAEGQALAP
FT                   SGSPRRMTVMFTDIEGFTRISESMEANVLVRMLTEYFNLATRVLARYGGVVDKFMGDGI
FT                   MVLWGAPADLKDAEYRACLAALQLHIETSALNRRWRADGLPEFRTRVGIHTGVAIAGVL
FT                   GSNDRLSYTALGDVVNVASRIEGINKQLGTHTLISEVTCAGLKGRLQTRRIDERVALRG
FT                   RQTRMVLYELLMP"
FT   gene            complement(109790..110503)
FT                   /locus_tag="Vapar_0109"
FT   CDS_pept        complement(109790..110503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO2589 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16772"
FT                   /db_xref="GOA:C5CW74"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR018655"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW74"
FT                   /inference="similar to AA sequence:KEGG:BRADO2589"
FT                   /protein_id="ACS16772.1"
FT                   /translation="MPTSPAHIVRALDWPRIETELATRGCATTGVLFSPKECAALAALY
FT                   DEPGHFRSRVVMQRHGFGQGEYQYFGNPLPAPVAAWRSALYERLAPLANAWAAAMGQPA
FT                   DYPADHAAYLARCHAAGQLRPTPLLLRYVEGDYNCLHQDLYGDLQFPMQLTVLLSRPGE
FT                   DFTGGEFVLTEQRPRMQSRAEVVALAQGEAVVFAVNQRPVAGTRGSYRVTMRHGVSRVR
FT                   AGRRHTLGIIFHDAR"
FT   gene            complement(110587..111351)
FT                   /locus_tag="Vapar_0110"
FT   CDS_pept        complement(110587..111351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0110"
FT                   /product="2-oxopent-4-enoate hydratase"
FT                   /note="KEGG: reh:H16_B0884 2-oxopent-4-enoate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16773"
FT                   /db_xref="GOA:C5CW75"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW75"
FT                   /inference="similar to AA sequence:KEGG:H16_B0884"
FT                   /protein_id="ACS16773.1"
FT                   /translation="MSAAAGGLAPASAAHALHLARREGRRVPSALLQTASRAEAYAIQD
FT                   ATLAAIGPVGGWKVGARAPGQEPTCAPLPAEGLLPGGVRLQGPAWRLRGIEAEVGFQLG
FT                   ADLPPRAAPYTLADVAGAVESVLPVIEVVETRLADWFGAHANALLADLLSHGALVLGQR
FT                   QPFAPAWFDLQRAEAALHFDGQTVAHTVGEHPSPDAGALLVWLANHCAARGAGLKAGQI
FT                   VTSGSCTGMLFASAGTAVRVEIGELAPVALSF"
FT   sig_peptide     complement(111301..111351)
FT                   /locus_tag="Vapar_0110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.608) with cleavage site probability 0.536 at
FT                   residue 17"
FT   gene            complement(111348..112727)
FT                   /locus_tag="Vapar_0111"
FT   CDS_pept        complement(111348..112727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0111"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: reh:H16_B0883 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16774"
FT                   /db_xref="GOA:C5CW76"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW76"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACS16774.1"
FT                   /translation="MKALWQLTAAQLAEGFGAGAFTPEQALAACLARTAEVNPRLNALV
FT                   VLDAEGAAEAAAQSTARWRSGRALGALDGVPATIKDNLQVRGLPTHWGSRALAGFVAER
FT                   DELPVARLREAGAVIFGKTNVPEFTMQGYTANPVFGPTGNPWNPALTPGGSSGGAVALV
FT                   AAGGCPIALGTDGGGSIRRPASHTNLVGLKPSRGRVRRGNGLPPIFLDFEVVGPMARCV
FT                   DDVAAVMRAIAPRAAADAPHKAKAARILYLPRFADHPVDPRIARLVDAAAEKLAALGHE
FT                   VTTLPRFELAEAVNQRWPLLAQVGLAWLVDHPRELWPRPFDPALFGPAMQANTGTGRAA
FT                   SARELFELLFEAERLRSELAGLFEQHDFLLTPATAALPWPAADTHPPRIDGREVGPRGH
FT                   AVFAGFVNALGLPAIALPCGFAEGLPVGLQLVAREGGDDALLALARDFERAHPWQRFPA
FT                   L"
FT   gene            complement(112753..114045)
FT                   /locus_tag="Vapar_0112"
FT   CDS_pept        complement(112753..114045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0112"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: pol:Bpro_0558 TRAP
FT                   dicarboxylate transporter-DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16775"
FT                   /db_xref="GOA:C5CW77"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW77"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ACS16775.1"
FT                   /translation="MNLFVIGLAFLAMLGMMLVGMPIAVSMALVGIVGGIAAYGAPFMD
FT                   SIAPVVWGVQNENLLTSVPLFVLLGELLLRSGIADRMYIALSAWLGRLPGGLLHTNIGS
FT                   CALFAATSGSSVATAATVGTVALPSLHRRGYSMRASLGSLAAGGTLGILIPPSVNMIVY
FT                   GSLTNNSIGKLFIAGIIPGLLLTGFFMLWIAGSSLASGNAMREPKVPLKARIRALVHLV
FT                   PPAVVFGIVMGSLYFGIATAAESAALGVIAALGFVLHSGKLSWELMRNCFVSTARVSGM
FT                   ILLIVVAAFVLNLTVSLTGVAEAMTKWVSGLGLSATGLILALMLFYLVLGMFMDVLSMQ
FT                   VATIPITYPIATALGVDPIWFGIFIVLMCELGLITPPVGMNLFVVHGIRPDRGGIEDAI
FT                   YGALPYALIMILFTLLLLAVPQLVTWLPGHM"
FT   sig_peptide     complement(113959..114045)
FT                   /locus_tag="Vapar_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.670 at
FT                   residue 29"
FT   gene            complement(114042..114701)
FT                   /locus_tag="Vapar_0113"
FT   CDS_pept        complement(114042..114701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0113"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: pol:Bpro_0557
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16776"
FT                   /db_xref="GOA:C5CW78"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW78"
FT                   /inference="protein motif:PFAM:PF04290"
FT                   /protein_id="ACS16776.1"
FT                   /translation="MSERPQPTAASPEEAPAAPRHASFKTRVETVLATVFGAIFLGLSV
FT                   IVTVETAARKLFNISLQGADELGGYALAVGSTIAFSLALMGRNHIRVDVFHEKFPARVQ
FT                   ALLNWISAVSLAALAVFIGWVAFKVIGDTMAYRSTAQTPWATPLIIPQGVWYAGLVVFA
FT                   LVACGLALRATQLLLRGDIAALNTDFHPKSAKEELKEELDDLAVRQAPQPGEGGRP"
FT   gene            complement(114713..115795)
FT                   /locus_tag="Vapar_0114"
FT   CDS_pept        complement(114713..115795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0114"
FT                   /product="TRAP dicarboxylate transporter-DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: pol:Bpro_0556 TRAP dicarboxylate transporter-DctP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16777"
FT                   /db_xref="GOA:C5CW79"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW79"
FT                   /inference="protein motif:PFAM:PF03480"
FT                   /protein_id="ACS16777.1"
FT                   /translation="MPLRPLAKPSFPRPFAAACLLALATVLALPAAQAQERIKLKAIGQ
FT                   PLATGLIQKNKEQPFFENFAARTGLPIDVDYKPIDTLGIKDTEQLRVMKAGLFDIVSLR
FT                   VSQNSRDEPTILGLDLVGAAPDFATGRKVAKAYFDTVDARLQQQFNVKLLGVWPFGPQI
FT                   LFCKKPIASLADIKGMKVRVYDQNLAKFIELVGATPVPVSFADTHQSLSLGVVDCAITG
FT                   PSSANSAGWPEVTTHQLAIGFQMALNGYGMTMKSWNALKPDQQAKLKAAFDGLTDEVWK
FT                   YSEELFRDALNCNAGRDPCTTGKKFKLVDVPVTPADLELVRGAVGKVSLPVWAEVCDKS
FT                   NPGCSKGWQATVAPVLGLNK"
FT   sig_peptide     complement(115691..115795)
FT                   /locus_tag="Vapar_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 35"
FT   gene            complement(115971..116810)
FT                   /locus_tag="Vapar_0115"
FT   CDS_pept        complement(115971..116810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0115"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Transcriptional regulator IclR; regulatory
FT                   protein IclR; SMART: regulatory protein IclR; KEGG:
FT                   reh:H16_B0879 transcriptional regulator, IclR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16778"
FT                   /db_xref="GOA:C5CW80"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW80"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ACS16778.1"
FT                   /translation="MTDSSSPRSSSSSKAAGKVMRIDRDGDGTVQSLTRAMQLLELLAD
FT                   DDEGYRLVDIAARSGLSSSTAHRLLTTLEQRQFVQFDRETSLWYVGVRCFSVGAAFGRR
FT                   RRIAHLALPVMRRLRDSSGESINLGIADLGDIVFVTQVESRELMRAIGKPGFRAPLHGT
FT                   AMGQAILAAMAEDDVLQYLRTYGLPKLTPNTIARASRLHETLGEVRRAGYAVDDEQNAV
FT                   GLRCIAAAIRDEHGQPFGAISLVGPTQRIKAADFAQLGATVRGAADEITAAYGGRLK"
FT   gene            complement(116995..117399)
FT                   /locus_tag="Vapar_0116"
FT   CDS_pept        complement(116995..117399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0116"
FT                   /product="membrane protein of unknown function"
FT                   /note="PFAM: membrane protein of unknown function; KEGG:
FT                   rfr:Rfer_2723 membrane protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16779"
FT                   /db_xref="GOA:C5CW81"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW81"
FT                   /inference="protein motif:PFAM:PF04020"
FT                   /protein_id="ACS16779.1"
FT                   /translation="MLNNLAPFLVHWAITALSLWVASLIFRGIKFESTSALVISALLLG
FT                   LANAVVKPLLIVLTLPLTLLTLGLFLLVINALMIMLVAALVRGFKLSGFWTAFFASIFI
FT                   SLLSIAIDSLVSSGDPATTIQMPTGSGKWL"
FT   gene            complement(117462..118370)
FT                   /locus_tag="Vapar_0117"
FT   CDS_pept        complement(117462..118370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0117"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rfr:Rfer_4071 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16780"
FT                   /db_xref="GOA:C5CW82"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW82"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS16780.1"
FT                   /translation="MRRKIPPLQTLVCFDAAARHESYTRAAQELALTQSAVSRQIGTLE
FT                   AFLGVALFRRTRHGVALTASGAAYARQITKRLEAMERDTLDAMAHQGEGGSLSLAAVPT
FT                   FATRWLMPRLKGFAALQPDVVVHIETRTRPFLFADAEFDAALYAGTPAQVENWAGTRAL
FT                   MLMHEDVVPVCSPSLLLRGKAVAPAAIAQMPLLQQSTRPDGWRQWFDAQQVDAPNARGG
FT                   PRYELFSILAAAASHGLGVALMPTMLVADELARGELVVACARPLSGERNYYLVTPERAD
FT                   QRPLLKFFSDWLLAEAQRSAV"
FT   gene            118547..119746
FT                   /locus_tag="Vapar_0118"
FT   CDS_pept        118547..119746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0118"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: aav:Aave_1982
FT                   acyl-CoA dehydrogenase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16781"
FT                   /db_xref="GOA:C5CW83"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW83"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS16781.1"
FT                   /translation="MAAKAQFHWDDPLLLDQQLTDEERMIRDAANAYCQERLAPRVIEG
FT                   FRSGETDPAIFREMGALGLLGPTIPEQYGGPGLNYVAYGLIAREVERVDSGYRSMASVQ
FT                   SSLVMVPINEFGTEAQKQKFLPKLATGEWIGCFGLTEPDHGSDPGSMVTRAKKVPGGYS
FT                   LSGAKMWISNSPIADVFVVWAKEVSESGTVGPIRGFVLEKGTKGLSAPAIHGKVGLRAS
FT                   ITGEIVMDGVFCPEENAFPEVQGLKGPFTCLNSARYGISWGALGAAEDCWHRARQYTLD
FT                   RKQFGRPLAANQLIQKKLADMQTEITLGLQGSLRLGRMKDEGTASVEITSIMKRNNCGK
FT                   ALDIARLARDMMGGNGISDEFGVARHLVNLEVVNTYEGTHDIHALILGRAITGIAAFAN
FT                   "
FT   gene            119758..120999
FT                   /locus_tag="Vapar_0119"
FT   CDS_pept        119758..120999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0119"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: vei:Veis_1735 formyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16782"
FT                   /db_xref="GOA:C5CW84"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW84"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACS16782.1"
FT                   /translation="MTATKPAALDGIKVLDLSRVLAGPWCTQILADLGADVVKIERPGV
FT                   GDDTRTWGPPFIKDADGNDTDQASYFTACNRNKRSVTVDMATPDGQALLKQMAAQADIV
FT                   VENFKTGGLKQYGLDHESLRAANPRLIYCSVTGFGHDGPYAERAGYDLMIQAMTGMMSI
FT                   TGRPDGEPGGGPLRVGVALTDLFTGVYASTAILAALQVRGRTGEGQHIDMALLDVGMAI
FT                   LANQASAFLNTGKAPQRQGNTHPSLAPYQDFPTQDGSMLLAIGNNGQFARFCEAAGHAE
FT                   WAADARFATNTLRVKHRGVLIPMMEELTRTRSTADWVALLEDKAVPCGPINDIAQAFDD
FT                   AQVKSRGLAVTLPRDAGDGIASITGVASPLRLTATPPVLRHAPPALGQHTREVLAEFGI
FT                   DGARFDALRAAGVV"
FT   gene            121015..121452
FT                   /locus_tag="Vapar_0120"
FT   CDS_pept        121015..121452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0120"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: pol:Bpro_0144
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16783"
FT                   /db_xref="GOA:C5CW85"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW85"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS16783.1"
FT                   /translation="MTDPIHSPPFSVLRIDHVVLRVKDAERAIAFYRDVLGCAVERRRD
FT                   NLGLVHLRAGTNLIDLVTPDGPLGKQGGALAGKEGRNVDHLCLRIEPFDEAAIRALMAR
FT                   HGVPVHGEVQNNFGAEGNGPSIYITDPDGNSVELKGPAGNS"
FT   gene            complement(121449..121907)
FT                   /locus_tag="Vapar_0121"
FT   CDS_pept        complement(121449..121907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16784"
FT                   /db_xref="GOA:C5CW86"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW86"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A3337"
FT                   /protein_id="ACS16784.1"
FT                   /translation="MSYAFLLFIHLLAAAFWVGGMATLHFAVRPAAVATLEPPLRLRTM
FT                   AAVLRRFFVGVDAAVTLLFVTGVAMILLAGGFRAVHWRIEAMMGIAIVMAGIYVYIRAS
FT                   VFKALRRAVEESAWPVAAGRLDMVRKLVSLNLALGVAVFGVAILGRAS"
FT   sig_peptide     complement(121806..121907)
FT                   /locus_tag="Vapar_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.806) with cleavage site probability 0.422 at
FT                   residue 34"
FT   gene            122006..122836
FT                   /locus_tag="Vapar_0122"
FT   CDS_pept        122006..122836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_4222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16785"
FT                   /db_xref="GOA:C5CW87"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW87"
FT                   /inference="similar to AA sequence:KEGG:Daci_4222"
FT                   /protein_id="ACS16785.1"
FT                   /translation="MTRTVAQKRAEFRALHEQGCFAIPNPWDKGSARYLQGLGFKALAT
FT                   TSSGHAWSQGLADGGQSRDTMLAHLRDIVGATDLPVNADFENGFAADVEGVAESVRLAV
FT                   ETGVAGLSIEDSTGDAANPLFEIGVAVERLRAARRAIDAAGGDTLLVGRAENFFVGRPD
FT                   LDDAIARLKAYAEAGADCLYAPGIRTREQIAAVVAAVAPKPVNLLIGWASELGMQDIAA
FT                   LGVRRVSVGGALARAAWGGFDRAARALAEKGRFDGFEGAASGADLDGFFGRFSE"
FT   gene            122853..123431
FT                   /locus_tag="Vapar_0123"
FT   CDS_pept        122853..123431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0123"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   reh:H16_B1845 uracil-dna glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16786"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW88"
FT                   /inference="protein motif:PFAM:PF03167"
FT                   /protein_id="ACS16786.1"
FT                   /translation="MDALLAEIRGCTACAAQLPLGPRPVVQASASARLLIVGQAPSLTV
FT                   HATGLPWDDKSGEQLRRWLGIEREVFYDAARIAIMPMGYCYPGRGSSGDLPPRRECAEL
FT                   WHARLLAQMSRVELTLLIGQYAQRHFLGAARKAGVTETVAAFAEFAPRFIPLPHPSPRN
FT                   TGWFKHHPWFESEVLPVLRERVRQALAQP"
FT   gene            complement(123428..125101)
FT                   /locus_tag="Vapar_0124"
FT   CDS_pept        complement(123428..125101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0124"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; KEGG: smt:Smal_2334
FT                   amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16787"
FT                   /db_xref="GOA:C5CW89"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW89"
FT                   /inference="protein motif:PFAM:PF07969"
FT                   /protein_id="ACS16787.1"
FT                   /translation="MRTLLMAAGAAALLLRPPAAQAQPADLIVTNAKIATLDAAATTAQ
FT                   ALAVRDGRIVAVGNAAQVRALSGPITRTVDAGGRTVVPGLIDSHMHAVRAALSYSTEVN
FT                   WIGAGSIGEAMERIRAAAARARPGGWLIVAGGWTEQQFVERRRPTAAELQEAAPNHPVY
FT                   VQLFYEAVVMTPKALEALGVPAGTLPAGMKPAADGAPGWMTGDIVGISALFDKLPKPTY
FT                   DDNLAGTRAFFRELNRLGVTGLVDPGGFSIAPSQYAALFELWREKALTLRVAYSVFAQK
FT                   PGAELQEFRELTQMLPMGFGDDMLKFNGLGERVTLAMYNNNFPDAAAKEKFYELIKWAA
FT                   MRRLAVTIHWQENGSVDHLLGLYEKLNAEVPIKELRWSIAHLDDASPETLARMKALGIG
FT                   WTMQDAMYFQGDRALATRGEAARRMPPIGSALRTGVNVGAGTDAHRVASYNPFVALQWM
FT                   LDGRTVSGKAMRGADETPTREQALRLYTVGSAWFSFDEARRGTLEVGKLADFAILDQDF
FT                   FSVPLERIGKTVSLMTVVGGRVVYAARPFDGAGTSVAAAP"
FT   sig_peptide     complement(125033..125101)
FT                   /locus_tag="Vapar_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 23"
FT   gene            complement(125104..126099)
FT                   /locus_tag="Vapar_0125"
FT   CDS_pept        complement(125104..126099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0125"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   vei:Veis_0621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16788"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW90"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACS16788.1"
FT                   /translation="MKKTFDTWSRRQALTLAAALAAIGTLGAAHAQNPWPGTQPIKLVV
FT                   PFTAGSGTDIVARLVAEKLGPALGTSVVVDNKPGAGGTLGAAITAKAPADGYTLLVHSA
FT                   GHLVNPWIYKGLSYDTIKDFTGITPMASLPNVLVTGPSHFANVRDLVAKAKANPGGLNY
FT                   GSAGNGSATHMNAEVFRLAAGLDAQHVPFRGTPEAMTEVMAGRVDWFFAPMVSALPLIK
FT                   SGKLQALAVGTAKRSPALPEAPTTVEAGVPGSEYLFWVGLFAPAKTPQPVVDRLQAEVA
FT                   KIMASPELKERLDKLGAEPFTMPSAQFNKFIADETTKAQQVVKAASIKVD"
FT   sig_peptide     complement(126004..126099)
FT                   /locus_tag="Vapar_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 32"
FT   gene            complement(126154..126516)
FT                   /locus_tag="Vapar_0126"
FT   CDS_pept        complement(126154..126516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0126"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   rme:Rmet_1908 cupin 2, conserved barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16789"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW91"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACS16789.1"
FT                   /translation="MHVTRFSEAPHYEAPNHFDMRCLRLQGKEAGPSTQMWMGMSQILP
FT                   GGRTGLDGSPMEKLYLVLEGQLHVVGELDGAHQEEVLGPYDSCRFAPGEKRQLENRSNR
FT                   PVLVALVMPNSVPPAA"
FT   gene            complement(126542..127540)
FT                   /locus_tag="Vapar_0127"
FT   CDS_pept        complement(126542..127540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0127"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   reh:H16_B1796 NADPH:quinone reductase Zn-dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16790"
FT                   /db_xref="GOA:C5CW92"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW92"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACS16790.1"
FT                   /translation="MSTDTPPTSRALRVNEKAANLEALQLQAAPQPEPTAPPGYAVVQV
FT                   AAAAVNPSDVKAALGLMPQAVWPRTPGRDFAGTVVSGPSEWIGREVYGSGGDIGITRDG
FT                   SHARYLVLPEAALRAKPQGISMDEAGAVGVPFVTAYEGFRRCGMPQAGQTVLVLGANGK
FT                   VGQAAVQLASQAGARVIAVQRRAGPFEGFACGPVDVIDARHHADVGAQVRELTGGRGAN
FT                   IVYNTVGSAYFEAANKAMAKGATQIFIATHERAVPFDIFAFYRGMHTFVGIDSLAMDCV
FT                   ASTAQLDAMREGFERGTLKPFPVARHFALDEAMDAYRLVLSGSTDRVVLRP"
FT   gene            complement(127913..128803)
FT                   /locus_tag="Vapar_0128"
FT   CDS_pept        complement(127913..128803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0128"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   reu:Reut_B5853 3-keto-5-aminohexanoate cleavage enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16791"
FT                   /db_xref="GOA:C5CW93"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW93"
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /protein_id="ACS16791.1"
FT                   /translation="MSTAKTLITCAVTGNLVKPEQTPHLPITPVRIADECLAAAEAGAA
FT                   QVHIHVRHPETGKPSMEVELYREVVDRIRRGNRELVINLTTGPGGRFIPSEDDPKIAAP
FT                   GTTLLPPEKRVEHIALIRPDVCSLDLNTMNSGPDVVMNTPKNVRRMARVIREAGVKPEL
FT                   EIFDSGDINLALDLIADGTLDGPAMWTFVLGVKYGFAPTPETLLYARNMLPRGAFWSAF
FT                   GIGRMEFPIVAQAWLLGGHVRVGMEDNIYLEKGVLAESNAQLVAKARDILLSLGGEIAN
FT                   PREARAMLGLPGGGS"
FT   gene            complement(128800..129564)
FT                   /locus_tag="Vapar_0129"
FT   CDS_pept        complement(128800..129564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0129"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: reu:Reut_B5854 NAD-dependent
FT                   epimerase/dehydratase:short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16792"
FT                   /db_xref="GOA:C5CW94"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW94"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS16792.1"
FT                   /translation="MSFDPVSRLDGKVAVITGGLGAIGYATAVRLATLGATCVLLHRKG
FT                   DDAAARAAALPSASGQRHAAIRADIVDTPSLEAAAAEVKAAHGRCDILVNSAGHTQPVP
FT                   AGDLDALTDELIDDIVRANFRGVFATIRAFAPMLKDSGDGLVANISSIAGFTGVGSNLA
FT                   YVAAKAGLDVVGDALAKALAPAVRVVSVSPGAVESGFVPGRGAEFASKMASTTPLGRIG
FT                   KPDDVAAAVEALATTMRFVTGTRIVVDGGRHL"
FT   gene            complement(129585..130487)
FT                   /locus_tag="Vapar_0130"
FT   CDS_pept        complement(129585..130487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0130"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; Catechol
FT                   dioxygenase domain protein; KEGG: cti:RALTA_B1412
FT                   hydroxyquinol 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16793"
FT                   /db_xref="GOA:C5CW95"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW95"
FT                   /inference="protein motif:PFAM:PF00775"
FT                   /protein_id="ACS16793.1"
FT                   /translation="MQTIAQTSDETPMNIATSPDSVLGFALQAMERTPDARLRTVMNAL
FT                   TRHLHAFVREVKLSEEEFEQALEFIVAIGQATGEKKNEVVLAADILGISTVVALQNNQD
FT                   PHGESPAALLGPFWRANSPACALGDSIARSGTPGLPLAVAGTVRNARGEPIAGATVDVW
FT                   QASPIGLYENQDPAQEDMNLRGRFTTDAQGRFHFRSVRPAGYPVPTDGPCGVLLRAQQR
FT                   HPNRPAHLHFMVSKPGHKVLVTQVFADDDQNLKSDPTFGVTQRLIGCFALAPDGQSATL
FT                   QYDFQLEPGEMKFPRPPIP"
FT   gene            130599..131630
FT                   /locus_tag="Vapar_0131"
FT   CDS_pept        130599..131630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0131"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: reh:H16_B1792
FT                   transcriptional regulator, LacI-family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16794"
FT                   /db_xref="GOA:C5CW96"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW96"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS16794.1"
FT                   /translation="MSTTPPSSPVTIRDVARAAGVHVSTVSRALSPEKRSLISDEVLRV
FT                   VEEAAQRLGYRPNRAASALRTGRTHTIGVLVPDITNAVFPPILQGIEASAAARGYFVFV
FT                   TNVVDPALARPVLERMLAQRVDGVILATATRDDPLVDFVAKAGMTAVLVNRADETGRLP
FT                   AVVSDDRLAMKLAVDHLVGLGHKRIAHLAGPQNIPTGVGRRLGLEQALRDHRMKPLRVV
FT                   ECESYSREAGAAAMRQMLEAGPAPQAVVCCNDLVALGAYDALREAGLRVPKDISVTGHN
FT                   DMPLVDMVDPPLTTIRLPHRELGWRAAEMLFEEIDGRAMSASTVVLRPELVVRKSTGAP
FT                   SVR"
FT   gene            complement(131631..133316)
FT                   /locus_tag="Vapar_0132"
FT   CDS_pept        complement(131631..133316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpi:Rpic_3961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16795"
FT                   /db_xref="UniProtKB/TrEMBL:C5CW97"
FT                   /inference="similar to AA sequence:KEGG:Rpic_3961"
FT                   /protein_id="ACS16795.1"
FT                   /translation="MPQTAAPTPLSIELTSPQSVNGQRAAFQSLWLLARMKHAHDAEGG
FT                   LVRLADLRGEVSDASTLRMVVSRAFRDFKAWHIEVGWGEDTQREPRFLNAERRSQGPFW
FT                   LPPAEAKRVRMLVGGRAATAAEVASFLGLRSRKARAGAPGSAPPDAVHLQDAAFWKQLV
FT                   AAQQAARQGRLMAPVAGGGAAGSPAKSPPSALESIRLAGTLAATDFQRALVTLNEAMLW
FT                   RRLGDNEQARRRLQALKKQRLAHHVAGNDYLGAMECIVSAWCAYTARDLPLAQSLLGGM
FT                   ANDAARSLVLRHHPDVRFEWCNLWALVCRSRALGLSADDKPAAAALAEESLQRFGEALA
FT                   AAFESHSFDAAQHVAANMGMAAWLFDRVGLSDLPALAHDGHADTTRRAVQWIAFSEWLC
FT                   GHTDGQGRSAWNAIYLMRIARGHCRPEPQPTLAQFRAQEPLDPAAISQLAGPLADAFDT
FT                   AHWPARWVGVAQARLADHQAGRRRYPGLQHCSLLFEHAWYAAHAGDLKAAEQSLGSLRE
FT                   ALPQLVPSDRAYFTESWNDTLPAELVLEARPPRRPAARKKTLPR"
FT   gene            complement(133345..133536)
FT                   /locus_tag="Vapar_0133"
FT   CDS_pept        complement(133345..133536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0133"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   mpt:Mpe_A1048 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16796"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:C5CWZ2"
FT                   /inference="protein motif:PFAM:PF06568"
FT                   /protein_id="ACS16796.1"
FT                   /translation="MTAPTHSPFHQRLMHALRSWRRRAAERRRAHADARHLAGMSEHEL
FT                   RDLGIGRSEVAGLLDRHR"
FT   gene            133627..134517
FT                   /locus_tag="Vapar_0134"
FT   CDS_pept        133627..134517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0134"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mpt:Mpe_A1047 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16797"
FT                   /db_xref="GOA:C5CWZ3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CWZ3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS16797.1"
FT                   /translation="MRQLNLDQLRTLIAIADLGTFSAAAKALHLAQPTVSLHISELESR
FT                   LDAQLVVRGNRRVTPTAAGAALVERGRKLLRDTDDAVEAVKRQAEGRTGRVRLGTSTGV
FT                   VVDLLPQVLEALGARHAGIDVEVSILGSYEAMARLAAGTLDIGLVAMPQPPLRELVVTP
FT                   WCDQAMMAFVPQRWKAPRRVTPAWLAAQPLIFNDATTHMYRLSMEWFAAAGFAPRARIE
FT                   LNYDAAIRSLVAAGYGAALLPLQQTTDAALNERMQILPITPRLTRRLGIAHRQRALLDG
FT                   ATQSVLQVLTAFRQV"
FT   gene            complement(134520..135554)
FT                   /locus_tag="Vapar_0135"
FT   CDS_pept        complement(134520..135554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0135"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: vei:Veis_4905 acylamide
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16798"
FT                   /db_xref="GOA:C5CWZ4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR023719"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CWZ4"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACS16798.1"
FT                   /translation="MRHGDISSSNDCVGVAVVNYKMPRLHTKAEVLDNARKIGEMLVGM
FT                   KKGLPGMDLVIFPEYSTHGIMYDTKEMYDTASAIPGEETAIFADACRRANVWGVFSLTG
FT                   ERHEAHPDKAPYNTLILMNNQGEIVQKYRKIMPWVPIEGWYPGDCTYVSDGPKGMKMSL
FT                   IICDDGNYPEIWRDCAMRGAELIIRCQGYMYPAKEQQILVSKAMAFMNNTYVAVANAAG
FT                   FDGVYSYFGHSAIIGFDGRTLGECGEEEMGINYAELSMGLIRDARRNGQSQNHLFKLMH
FT                   RGYTGVIHSGDGDKGVAACPFDFYKQWINDPEGAREQVESFTRSTIGTAECPIEGLPNE
FT                   AARS"
FT   gene            complement(135719..136219)
FT                   /locus_tag="Vapar_0136"
FT   CDS_pept        complement(135719..136219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0136"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_4043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16799"
FT                   /db_xref="UniProtKB/TrEMBL:C5CWZ5"
FT                   /inference="similar to AA sequence:KEGG:Rfer_4043"
FT                   /protein_id="ACS16799.1"
FT                   /translation="MTEATDSTDSDTLPLQEPRLWRDGQWTARVIKNEEDDGWAVEMTR
FT                   HGDPEPALVGPWTMGRDKKNPKPLDGPAFSTLVKTAAEVIRRHEQQLHATLNKSVTVTA
FT                   RNDQRVRVALAIVPDEDSPSATLTAYDDADDSELASVNVSPAFRLTASSAAAWIESDYA
FT                   RPR"
FT   gene            complement(136286..137224)
FT                   /locus_tag="Vapar_0137"
FT   CDS_pept        complement(136286..137224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0137"
FT                   /product="Glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="PFAM: Glutaminase, core; KEGG: sme:SMc00486
FT                   glutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16800"
FT                   /db_xref="GOA:C5CWZ6"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/TrEMBL:C5CWZ6"
FT                   /inference="protein motif:PRIAM:3.5.1.2"
FT                   /protein_id="ACS16800.1"
FT                   /translation="MKDADFQPVLDDIVTTLRPLLGTAGTVASYIPALACIDARQLGIA
FT                   LRTCNGAEAFAGDAETPFSIQSVSKLFTLTLAMQRMGDALWERIGREPSGNPFNSLVQL
FT                   ENEQGKPRNPFINAGAIAVADRLVSQALQAGGSAKADILALMGSLCGEPIAFDDEVARS
FT                   EAATGFRNIALANFMKSFGKIDNDVAVVLDTYFHQCALRMSCRQLARAAAFLCRDGAHP
FT                   IDGQAEVTGERQTRRINALMLTCGTYDAAGDVAFSIGLPCKSGVGGGIVAVVPDRLTLC
FT                   VWSPALDATGNSLLGMKALELFVARTGLSVF"
FT   gene            complement(137221..138120)
FT                   /locus_tag="Vapar_0138"
FT   CDS_pept        complement(137221..138120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0138"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: pol:Bpro_0122 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16801"
FT                   /db_xref="GOA:C5CWZ7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C5CWZ7"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS16801.1"
FT                   /translation="MIQRKTHLDSLAIGLLIACCAFWGLQQILIKTTVAEVPPLWQASV
FT                   RMAGAVALLWLWCLWRRVPLFERDGTLPGGLLVGLLFAGEFACIYLGLQHTSASRLTVF
FT                   LYTAPFWVSLLLPRWVPAERLRGLQWLGLGIAFAAVLFAFSEGFGHSSSGQLLGDAMAI
FT                   VGGMLWGLTTLALRTTRLATASAEKALFYQVAVTAAVCPLLSLALGESWGFSYSAWAWT
FT                   SIGLQTVIGAFASYLTWMWLLRHYPATQMSSFSFLTPLFALVFGVVLLGEPLTLQLMLA
FT                   LAGVGLGIVMVNRRKARA"
FT   gene            complement(138143..138625)
FT                   /locus_tag="Vapar_0139"
FT   CDS_pept        complement(138143..138625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0139"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; KEGG: cvi:CV_3234
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16802"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="UniProtKB/TrEMBL:C5CWZ8"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ACS16802.1"
FT                   /translation="MCMSLLLVAQNVAAQEPAAPLKQNWFDDPFFQVSAGLPACAMPEG
FT                   PFYTAEERRAQTHSRLERGTSCWLAGQCTDSNAYRYDKPLAPKVRAALSAVPGVQKASV
FT                   WVMIQRRWVYLQGCVPSAAVARKLERAARAVPDVETVVTDLMVGTRGKPPYPVAGR"
FT   gene            complement(138643..139152)
FT                   /locus_tag="Vapar_0140"
FT   CDS_pept        complement(138643..139152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0140"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: pna:Pnap_0092 flavin reductase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16803"
FT                   /db_xref="GOA:C5CWZ9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C5CWZ9"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACS16803.1"
FT                   /translation="MTTSRRAKPPTFSPAEFREALGMFATGVTIVTARSAEGALVGLTA
FT                   NSFNSVSLAPPLVLWSLARAAGSMPALSTGSHYAINILAANQKGLAERFATKNIDRWAD
FT                   VAFTEGLGGAPVLAGAAASFECFNRSRYDEGDHVIFVGEVERCTHNAGASPLLFHGGRF
FT                   YTEHPL"
FT   sig_peptide     complement(139045..139152)
FT                   /locus_tag="Vapar_0140"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.624) with cleavage site probability 0.385 at
FT                   residue 36"
FT   gene            complement(139259..140488)
FT                   /locus_tag="Vapar_0141"
FT   CDS_pept        complement(139259..140488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0141"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   psa:PST_4050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16804"
FT                   /db_xref="GOA:C5CX00"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX00"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ACS16804.1"
FT                   /translation="MLNGLWLGFFGVAMLAALGRWLVGGDAAVFAAIVESLFAMARLAV
FT                   EVMVLLFGTLTLWLGFLRIAEAAGLVGWLARLLGPLFRRLMPGVPAGHPALGLITMNFA
FT                   ANALGLDNAATPIGLKAMRELQRLNPDPVTATNAQILFLVLNASSLTLLPVTIFMYRAQ
FT                   QGASDPTMVFLPILLATSASTLVGLLAVAVAQRLRLWDPVVLAYLVPAALLLGGFMALL
FT                   GTLSAAAIASLSSLMGNLVLFGVIIVFLLAGAVRRIKVYECFIEGAKEGFDIAKNLLPY
FT                   LVAMLCAVGVLRASGALDFVLGGLRWLVSAGGWDARFVDAMPTALVKPFSGSAARAMLI
FT                   ETMKSQGVDSFPALVAATIQGSTETTFYVLAVYFGAVGIQRARHAVSCALAAELAGVVA
FT                   AIAVCYWFFG"
FT   sig_peptide     complement(140429..140488)
FT                   /locus_tag="Vapar_0141"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.737) with cleavage site probability 0.593 at
FT                   residue 20"
FT   gene            140567..142150
FT                   /locus_tag="Vapar_0142"
FT   CDS_pept        140567..142150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0142"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; SMART:
FT                   phospholipase D/Transphosphatidylase; KEGG: rpi:Rpic_4172
FT                   phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16805"
FT                   /db_xref="GOA:C5CX01"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX01"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ACS16805.1"
FT                   /translation="MAASSPIRRLAALVWAAVALAWLAGCAGLPPPQPRAPAMAITDVA
FT                   DTALGQLARQRAPQESESLSGFRLLPEAAFAFDARISLARHAEKSLDVQYYLIQNDDVG
FT                   LLLLRELREAAARGVRVRLLVDDLYTAGEDEVFSALSAFPNVEVRLFNPLPSRADSFAL
FT                   RLLFSLGDFGRINHRMHNKLLVADNSFAVSGGRNIANEYFMRGTAANFIDMDVLSCGPV
FT                   VRRMSEGFDRYWNSEHAWPIERIVPQRMAAEEAHKRFDALAAAALPDVRIRPRDVLDHS
FT                   PVGEQLATGKLELQWATSTLFVDDPAKITRTSEAAYEGSVTAGALGVINSAKREVKIGS
FT                   PYFIPGARGMAMMKQAIERGGRITVVTNSLGATDEPLAYAGYERYRADMLKIGVTIYEI
FT                   APRLTGRSGRFGDFGQSISRLHAKLAVIDGERFFVGSMNLDRRSAAVNTEMGLVIDSPA
FT                   LVADYERLMSGERVSLGYRLRLAPGGRRVQWLEYDDAGGDIVHEDEPGEFLWLRFKNWL
FT                   LLPIVGEELL"
FT   sig_peptide     140567..140650
FT                   /locus_tag="Vapar_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.603 at
FT                   residue 28"
FT   gene            complement(142169..142975)
FT                   /locus_tag="Vapar_0143"
FT   CDS_pept        complement(142169..142975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0143"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: aav:Aave_0135
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16806"
FT                   /db_xref="GOA:C5CX02"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX02"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACS16806.1"
FT                   /translation="MKLQLLSDLHLESHPRFHAEPVPGADMLVLAGDIGSYQEGSRLTD
FT                   PDFGLGRFSPRNGWPVPVMYVPGNHEYDNTDFDQTHERLRALCQELGILWLERETLVID
FT                   GIRFVGTTLWADFDALVAPTDGLADALKKRGKAMRAADFYLEKAATVRHGQPFMAGAMR
FT                   EQALACQAWLEQALAEPFDGTTVAITHFAPSLASADPRYGLTPGTAGFCNSLDALLPRA
FT                   RLWLHGHLHCPFDYVKDGCRVVANPLGYKGKGEQEGFRPELLIEVP"
FT   gene            143099..143272
FT                   /locus_tag="Vapar_0144"
FT   CDS_pept        143099..143272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16807"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16807.1"
FT                   /translation="MFSLIAQVARFFRSSAASAPASPAAALMESADVRAGRGAHHAQEL
FT                   RAAASAWLSVIR"
FT   sig_peptide     143099..143179
FT                   /locus_tag="Vapar_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.820) with cleavage site probability 0.356 at
FT                   residue 27"
FT   gene            complement(143283..144263)
FT                   /locus_tag="Vapar_0145"
FT   CDS_pept        complement(143283..144263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0145"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: pol:Bpro_0158 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16808"
FT                   /db_xref="GOA:C5CX04"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX04"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS16808.1"
FT                   /translation="MDVNFRTLDLNLLRVFDEVMAERNLTRAARNLSITQPAVSNALRR
FT                   LREVLGDELVRRSGAGVEPTPRALALWPTVRDALRQLQHTLAPGEFDASTADTTFLLAM
FT                   ADATAAELIPGLVQIVEKEAPAISLRVLPLTTRDPRRMLEQEEVDMAIGYFPAVIASLA
FT                   ARGQSGVGVAFETQRLYLGQYVCVMRRGHPLANAPLTLDDYCAARHLLVSFSGRPYGFI
FT                   DQTLGALGRERRIVVTVNQFFTAGRVVANSDLLTVLPRHFVTVTGIDEQLVLRDLPFDQ
FT                   PMVHVDAIWHRRAQHGHAHEWLRTALLRSAAAAFADSVLGQKVPG"
FT   gene            144371..144919
FT                   /locus_tag="Vapar_0146"
FT   CDS_pept        144371..144919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16809"
FT                   /db_xref="GOA:C5CX05"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX05"
FT                   /inference="similar to AA sequence:KEGG:Bpro_0159"
FT                   /protein_id="ACS16809.1"
FT                   /translation="MTSFVHVDQPTVHPGVQRAEILFGQLKAARAGANGSRPLIALLIV
FT                   AVAAAVMVVADKLVSNWDEGALLAAWAVLCAAAFGIAALFAGSLRAPLARVGAAWNAAA
FT                   QRRASARADARFLETARNDPRVMQELQAATWREQSEGKVSVATAAKVDALTRVAARSSE
FT                   ARMPTLYEAMRRMNSSRYY"
FT   gene            complement(145019..146881)
FT                   /locus_tag="Vapar_0147"
FT   CDS_pept        complement(145019..146881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0147"
FT                   /product="Phosphoenolpyruvate carboxykinase (GTP)"
FT                   /EC_number="4.1.1.32"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   pol:Bpro_0160 phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16810"
FT                   /db_xref="GOA:C5CX06"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX06"
FT                   /inference="protein motif:PRIAM:4.1.1.32"
FT                   /protein_id="ACS16810.1"
FT                   /translation="MNAPTMQGLAIQAPSYVKNAKLIAWVADMAALCKPEAIHWCDGSK
FT                   EEYDRLCQQLVDAGTFKKLNPAKRPNSFLAVSDPSDVARVEDRTFICSEKKENAGPTNN
FT                   WMAPAEMRATLQPLFDGCMKGRTMYVVPFSMGPLGSPIAHIGIELSDSPYVAVNMRIMT
FT                   RMGKAVYEVLGADGEFVPCVHTVGAPLEAGQKDVAWPCNKTKYIVHYPETREIWSYGSG
FT                   YGGNALLGKKCFALRIASNMGRDEGWLAEHMLILGVTNPQGKKYHVAAAFPSACGKTNF
FT                   SMLVPPAGFEGWKVTTIGDDIAWIKPGKDGRLYAINPEAGYFGVAPGTNMLTNPNCMDS
FT                   LDHDVIFTNVALTDDGDVWWEGMEQDTGSLPAHLIDWQGKDWTPQIAKETGAKAAHPNS
FT                   RFTVAATNNPALDDAWDDPKGVAIDAFIFGGRRSTTVPLVTEARNWVEGVYMAATMGSE
FT                   TTAAAAGQQGVVRRDPFAMLPFTGYNMSDYFQHWLDLGKKLEASGAKLPKIYTTNWFRK
FT                   GADGKFAWPGYGENMRVLKWMIDRVEGTAKGTEHITGVSPRYEDLNWNGLEFSAEQFAT
FT                   VTSMDKAAWQAELKLHAELFQQLAHHLPKELPETKAAIEQRLAA"
FT   gene            complement(147027..147179)
FT                   /locus_tag="Vapar_0148"
FT   CDS_pept        complement(147027..147179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0148"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_0140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16811"
FT                   /db_xref="GOA:C5CX07"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX07"
FT                   /inference="similar to AA sequence:KEGG:Aave_0140"
FT                   /protein_id="ACS16811.1"
FT                   /translation="MSNPTPVEPGHAAAVEKDAVESIVHLMPLVLPLAGGVLMLLLASI
FT                   AVYLA"
FT   gene            complement(147268..148497)
FT                   /locus_tag="Vapar_0149"
FT   CDS_pept        complement(147268..148497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0149"
FT                   /product="threonine dehydratase"
FT                   /note="TIGRFAM: threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   amino acid-binding ACT domain protein; KEGG: pna:Pnap_0111
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16812"
FT                   /db_xref="GOA:C5CX08"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005789"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX08"
FT                   /inference="protein motif:TFAM:TIGR01127"
FT                   /protein_id="ACS16812.1"
FT                   /translation="MPAMVGIEEIRRAAARLEGQVLNTPCVESRTLSEIVGAQVYLKFE
FT                   NLQFTSSFKERGACNKLVDLLEADTRDGQEATRGVVAMSAGNHAQGVAYHAQRLGLRAL
FT                   IVMPRFTPGVKIERTRGFGAEVVLHGDTLDAARAHALELAEREGLTFVHPYDDEAIIAG
FT                   QGTVALEMLDAVPDLDTLVVSVGGGGLIAGMAIAARERKPGIEIVGVQTTRFPGMVNAV
FT                   KGTQHLQGKSTIAEGIAVGTPGVLTREIIAQHVDDLLLVDEGDIEQGVLMLLEIEKTLV
FT                   EGAGAAGLAALIRHPARFKGKRVGLVLSGGNIDPLLLAAIIERGMVRAGRLARVRVSAR
FT                   DVPGSLAQITATVAEAGANVDEVHHQRAFTMLAAQNVDIELVLQTRGRAHLASVLGALH
FT                   DAGFEAEEQH"
FT   gene            148605..150932
FT                   /locus_tag="Vapar_0150"
FT   CDS_pept        148605..150932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0150"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase; KEGG: pna:Pnap_0112 ATPase central
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16813"
FT                   /db_xref="GOA:C5CX09"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX09"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACS16813.1"
FT                   /translation="MVKRAGVDVVAAAVRGQALPSPGLKGAPVLELMCSHFVLTLAAKQ
FT                   GPRFNVRRDINGLLSLTGRHLVWPAAVLQRLREFLGRRCAGNEAWKGVENFDGRTLLER
FT                   HGVWRGPYEEGTLFFYLDEYAKDYPKDLLSVLAVTRDWLTHALRKQSTLVEKNIDALAG
FT                   LLQLNKAERALLLYGTLARYQRDLRSLLVEFKVNNAPEAYAAIADIAGVNATEVGEALR
FT                   AGSRLERIGLVENLISEHNITDLADLMKVSEKLPPVLMREYRDHNELMAVFTRPSAKSA
FT                   LTTHDFSFVEEDAQMLVTLLRAAVARKEPGVNVLLYGPPGTGKTELAKVVAQAAGLELF
FT                   EVEYADRDGNSLSGRDRYRSLQIAQVFLKGSAQAALLFDEVEDVFPPISTEAAQFMARA
FT                   EQIPAPTSGSVSGKAWVNQILEANPVPTLWVTNRIEQIDPAFRRRFAYHLELKSPPPGA
FT                   REQLVKKTLEGIVVSEAFTAKLAERKGLTPAQIRTAVRFAGLAQTEDGASMEALIERQL
FT                   KNADLALGTLDTGPGERRSVTTYDLDMLNVETRFEIPRIVAAIKARGHGTLCFYGAPGT
FT                   GKTALAEHIAKAIGRPLIIKQASDLMSKYVGETEQNMAAMFKEAEAEKAVLLLDEADSF
FT                   LQDRRGAQRTYEVTEVNEMLQGMERFNGVFICTTNLLDRLDQAALRRFTFKIKFMPLTA
FT                   PQRERMFVTEALAGDAALLTAGIKARLAQLQQLCPGDFAAVKRQTDILAVEFSAAEFLD
FT                   QLEAEHRIKPEVRESRGIGFMQ"
FT   gene            151015..152607
FT                   /locus_tag="Vapar_0151"
FT   CDS_pept        151015..152607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0151"
FT                   /product="peptidase S41"
FT                   /note="PFAM: peptidase S41; SMART: PDZ/DHR/GLGF domain
FT                   protein; KEGG: afw:Anae109_2977 peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16814"
FT                   /db_xref="GOA:C5CX10"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041613"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX10"
FT                   /inference="protein motif:PFAM:PF03572"
FT                   /protein_id="ACS16814.1"
FT                   /translation="MSLGNGHARARPRFTASAAAAFALAGIVCALAGCGGGGGGGGGGG
FT                   GFPIVAPPGTTPPPASGGDDDAIVASSTVAGLCAAPRPGTNPETGIAYPDKPGTLTDEK
FT                   RWVRGWIDETYLWYGEVPTTLKAADYATPVAYFSVLKTPLLTASGRAKDRFHYVYDTER
FT                   YRQLSENGVAPGYGMEFAFVRNSRPRDLRIAFTEPGSPAATAGIARGAKVLEVDGVDVV
FT                   NGTNTAVINRGIAPTAIGESHSFKLQEGSATRTVTLAAASITRTPVQNVKSIDTGSGRV
FT                   GYLLFNDHITTSESQLISAFNQFRQDGVQDLVLDMRYNGGGQLNIANRLASMVSSSATT
FT                   SGKVFERLSFNDKNPFHLTPAQTIYPFYGTSRTGATLPRLGLSQVTVLVGPDTCSASES
FT                   VVNGLRGIDVKVNLVGGATCGKPYGFSPQDNCGTSYFAIQFQGVNAKNFGDYGDGFAPD
FT                   CTVADDFDHPLGDPAEARLAAALAMRSGGACPVSAKSGAGLEKSGTAGEQPYLLDRTPL
FT                   REMRLLETAPSPG"
FT   sig_peptide     151015..151113
FT                   /locus_tag="Vapar_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.549 at
FT                   residue 33"
FT   gene            152751..153929
FT                   /locus_tag="Vapar_0152"
FT   CDS_pept        152751..153929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0152"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: bpy:Bphyt_4926 inosine/uridine-preferring
FT                   nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16815"
FT                   /db_xref="GOA:C5CX11"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX11"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ACS16815.1"
FT                   /translation="MTIRIQRRRWMAAALLATALSACGGGGNSGIGLAPGFGAAPPPAQ
FT                   KIIIDSDYNTMSDDGQLGVMAAQLQAQGKVQVMGISVVSGNQWLRQGVADALKSVERLG
FT                   VGERIGIYAGANYAFNHDYATIEAEMAAGSGGDGYLGAWSSPEPKTDADLKPSPDGFAT
FT                   HTVLQPRSAVDFIVDTVKANPNEITILAIGPLTNIALAVKQNPEIVPLIKKIIYMGGAV
FT                   DVPGNTTKFAEFNWWFDPEAAQFVVRLPIPQVVVPLDVTDTVFLTKPIYDRIAHPATPT
FT                   AVTEVFRQLNGYGFSGTNGFENNPAYTQNIWDTLTLAYLIDPAYATETVERYVDVVAKP
FT                   GAADNGRSIGYASQPAGPALQKMTVVKKFDNARFFELYVDLLTRPVPIALRP"
FT   sig_peptide     152751..152825
FT                   /locus_tag="Vapar_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.638 at
FT                   residue 25"
FT   gene            complement(153937..155838)
FT                   /locus_tag="Vapar_0153"
FT   CDS_pept        complement(153937..155838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0153"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: ajs:Ajs_0084 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase RecQ; ATP-dependent DNA
FT                   helicase, RecQ family; PFAM: HRDC domain protein; helicase
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicase; helicase domain protein; HRDC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16816"
FT                   /db_xref="GOA:C5CX12"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX12"
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /protein_id="ACS16816.1"
FT                   /translation="MSSLAPLPLDAPGSSSAPADILHEVFGYSQFRGPQQDIVEHVVAG
FT                   GDALVLMPTGGGKSLCYQIPAIARQRAGRGVSVVVSPLIALMHDQVGALHEAGVNAAFL
FT                   NSTLDWEQTQDVERRMLRGEITLLYAAPERVNTPRFLSQLDSLKERGKLSLFAIDEAHC
FT                   VSQWGHDFRPEYRALTVLHERYPGVPRIALTATADALTRADIVERLQLEEARQFVSSFD
FT                   RPNIRYTIVEKKDATTQLLRFIEREHEGDAGVVYCQSRKRVEDVAVMLKGAGINALPYH
FT                   AGLDAAVRQKHQDRFLREEGVVMVATIAFGMGIDKPDVRFVGHLDMPKNIEGYYQETGR
FT                   AGRDGAPADAWMAYGLQDVVNQRRMIDESPAGEEFKQVMRGKLDALLSLAEASDCRRVR
FT                   LLGYFGEKSTPCGNCDNCLNPPQVWDGTDAARKLLSTIYRVQQLSGISFGAGHIMDILR
FT                   GKETEKVKQFGHERISTFGIGAEFSEVQLRGVLRQLIATGALAVDAEAFNTLKLTEGSR
FT                   AVLKGEANVTLRESVSSPAARGGKPRREKAARGAPSPAAAALDADGQKRFEALKAWRAE
FT                   VAREHNLPAYVIFHDATLAAIAERAPATLEDLQGISGIGTKKLEAYGAEVLRVCSAF"
FT   gene            156128..157099
FT                   /locus_tag="Vapar_0154"
FT   CDS_pept        156128..157099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0154"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="KEGG: pol:Bpro_1047 extracellular solute-binding
FT                   protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16817"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX13"
FT                   /inference="similar to AA sequence:KEGG:Bpro_1047"
FT                   /protein_id="ACS16817.1"
FT                   /translation="MVVKTVVVKVASLLAAGACAAGMAQTAAAQETRIALGMSGWTGFA
FT                   PLSLADKAGIFKKNGLDVELKMIPQKDRHLALASGAIQCAATTVETHVAWNANGVPIVQ
FT                   IFQMDKSYGADGLAVRNDVKGFADLKGKTIGVSAPGTAPYFGLAWMLNKNGMTLKDVKL
FT                   VSLEPQPAAQAFVAGQNDAAMTYEPYLSTVRANPTAGKILATTLDYPMVMDTVGCAPTW
FT                   LKANAKAAQALAQSYFEALDMIKADPAKANELMGSAVKQTGEQFAKSSAYLRWQDKAAN
FT                   QKFFAGELTGFMKEAAPILLEAGVIRKAPEDYTAMFDASFVK"
FT   sig_peptide     156128..156217
FT                   /locus_tag="Vapar_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.869 at
FT                   residue 30"
FT   gene            157080..157958
FT                   /locus_tag="Vapar_0155"
FT   CDS_pept        157080..157958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0155"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pol:Bpro_1046
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16818"
FT                   /db_xref="GOA:C5CX14"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX14"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS16818.1"
FT                   /translation="MQASSSKALPQVAPRAAAPASAATPQAAVPARRRSLAPLEPVSGR
FT                   ARVLLGLGFFVAFVLVWSVATLGGFVPPTFLASPVTMLKEGWMLFAEFGFIGDVGMTVW
FT                   RVFGGFLLAAVLAVPLGIAMGTWKAVEAFFEPFVSFCRYLPASAFIPLLILWAGLGEMQ
FT                   KLLVIFIGSFFQIVLMVAVTVGGARRDLVEAAYTLGAKSRGIVARVLIPGAAPGIAETL
FT                   RLVLGWAWTYVIVAELIGSSSGIGHMITDSQALLNTGQIIFGIIVIGVIGLVSDFAFKA
FT                   LNRRMFAWAAL"
FT   sig_peptide     157080..157148
FT                   /locus_tag="Vapar_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.837) with cleavage site probability 0.699 at
FT                   residue 23"
FT   gene            157958..158740
FT                   /locus_tag="Vapar_0156"
FT   CDS_pept        157958..158740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0156"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_1045 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16819"
FT                   /db_xref="GOA:C5CX15"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX15"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS16819.1"
FT                   /translation="MNDQLSIQGVSRVFTGANGQRTQALLPIDFEVRENDFVTILGPSG
FT                   CGKSTLLRIVAGLDFPTTGQVLLDGERIEGPGADRGVVFQSYTLFPWLTVAQNIRFGLR
FT                   ERGMSEADQKERSEFFIAKVGLRGFEHHFPKQLSGGMQQRTAIARALANDPKMLLLDEP
FT                   FGALDNQTRVLMQELLLGIWESARKTVLFVTHDIDEAIFMANRVAVFSARPGRIKTEIA
FT                   VDFPHPRSYTIKTSPEFMEIKARLTEEIRAESMAAAEH"
FT   gene            158760..159497
FT                   /locus_tag="Vapar_0157"
FT   CDS_pept        158760..159497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0157"
FT                   /product="transcriptional regulator, histidine utilization
FT                   repressor, GntR family"
FT                   /note="KEGG: aav:Aave_2966 histidine utilization repressor;
FT                   TIGRFAM: histidine utilization repressor; PFAM: UbiC
FT                   transcription regulator-associated domain protein;
FT                   regulatory protein GntR HTH; SMART: regulatory protein GntR
FT                   HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16820"
FT                   /db_xref="GOA:C5CX16"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR010248"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX16"
FT                   /inference="protein motif:TFAM:TIGR02018"
FT                   /protein_id="ACS16820.1"
FT                   /translation="MKRDLPSLALYAQVKDHISRKIQDGTWPAGHRLPSESELVAQFGI
FT                   SRMTVNRALRELMEQGRIVRVAGVGSFVAENKPQSTLLQIANIASEIRQRGHDYRCEML
FT                   AVERLAASPDVAAWLDMRAGTSVFHSVCLHLENDTPVQLEERYVNPLVVPDFLEQDFAA
FT                   VPPSEYLVRHVPFDQIEHVVDAVLPTAEQAARLAMEPTDPCLLLTRRTWTRNTPVTWVR
FT                   CLHPASRYSLGSRFKADGNPSFG"
FT   gene            159557..161110
FT                   /locus_tag="Vapar_0158"
FT   CDS_pept        159557..161110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0158"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: pol:Bpro_1043 histidine ammonia-lyase;
FT                   TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16821"
FT                   /db_xref="GOA:C5CX17"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX17"
FT                   /inference="protein motif:TFAM:TIGR01225"
FT                   /protein_id="ACS16821.1"
FT                   /translation="MPTSKHTATPLILTPGKVDLAMLRRIQAGGVRLALDPSVQEGMAR
FT                   AEAAVRHIVENDQVVYGINTGFGKLASTRIGNDHLAELQRNLVLSHSVGTGEPLAAPVV
FT                   RMVLATKAVSLARGHSGVRPALAEALLALFNAGVMPRIPCKGSVGASGDLAPLAHMACV
FT                   LIGEGEATTADGAVVSGAEAMRLVGLEPFVLGPKEGLALLNGTQVSTALALAGLFGAED
FT                   VFASALMSGALSLEAIQGSIKPFDARIHAARGQPGQIAVAGAVRTLLEGSEIVPSHADC
FT                   GRVQDPYSVRCIPQVMGACLDNLAHAARVLVIEANAASDNPLVFTDTGEVISGGNFHAE
FT                   PVAFAADIIALAVSEVGAIAERRIALLLDTGLSGLPPFLVRDGGLNSGFMIAQVTAAAL
FT                   ASENKSLAHPASVDSLPTSANQEDHVSMATFAARRLGDMVNNTAVVVGIEAMAAAQGIE
FT                   LKRGLKSSPLVEAEFAAIRQKVAFLERDRYLAPDIEAMRQWALKAELPAALLNILPSHA
FT                   "
FT   gene            161135..162853
FT                   /locus_tag="Vapar_0159"
FT   CDS_pept        161135..162853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0159"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: pol:Bpro_1042 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16822"
FT                   /db_xref="GOA:C5CX18"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX18"
FT                   /inference="protein motif:TFAM:TIGR01228"
FT                   /protein_id="ACS16822.1"
FT                   /translation="MNAPEKLPLQNTDPRHDPTRVIRAPRGSTLNCKSWLTEAPYRMLQ
FT                   NNLDAEVAERPQDLVVYGGIGRAARNWACYDQILASLKELNDDETLLIQSGKPVGVFKT
FT                   HENAPRVLLANSNLVPKWANWEHFNELDRQGLFMYGQMTAGSWIYIGSQGIVQGTFETF
FT                   VEAGRQHYNNSLAGKWILTAGLGGMGGAQPLAATLAGAVSLNIECQQTSIDFRLRTRYV
FT                   DKQARDIDHALELIQQHCDAKEAVSIALLGNAADILPELVKRAKAGGIKPDLVTDQTSA
FT                   HDLINGYLPSGWSVAQWQAAMKDVSQHDALKKAAAKSCAVHVQAMLDFQAMGIPTVDYG
FT                   NNIRQVAFDEGVQNAFDFPGFVPAYIRPLFCEGKGPFRWVALSGDPEDIYKTDAKIKEL
FT                   FPENTHTHRWLDMARERIAFQGLPARICWLGLGERHIAGLAFNEMVKNGELKAPIVIGR
FT                   DHLDTGSVASPNRETEAMKDGTDAVSDWPLLNALLNTAGGATWVSLHHGGGVGMGYSQH
FT                   SGVVIVCDGTEAAAKRIERVLWNDPATGVMRHADAGYDIAVATAKKQGLNLPMVR"
FT   gene            162998..163732
FT                   /locus_tag="Vapar_0160"
FT   CDS_pept        162998..163732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0160"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; regulatory protein ArsR; Helix-turn-helix
FT                   type 11 domain protein; SMART: regulatory protein IclR;
FT                   KEGG: pol:Bpro_1041 transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16823"
FT                   /db_xref="GOA:C5CX19"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX19"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACS16823.1"
FT                   /translation="MTSMPEASAHNDRALRVLSVLAQSKSAMSAAELAEATGLVKSTLY
FT                   RQIAVLRRWGFVMETDGRYSPGPVSVQLASGFDGNSDLVMAARADMRALAQQSHESVAL
FT                   VTLVNDRVVCLEMIDSEQSLRCSFDRGRSVPARDGASAKCLLAHLPADQRDALLDSLGD
FT                   DPGRRAERAAELDAIREAGHAVTHGEVDAGVWGASAPVLGPGRRLRGAITLMAPLTRAG
FT                   GMEAAWAALTVVTAARISRALQ"
FT   gene            163786..164526
FT                   /locus_tag="Vapar_0161"
FT   CDS_pept        163786..164526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0161"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3;
FT                   ionotropic glutamate receptor; KEGG: pol:Bpro_1040
FT                   extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16824"
FT                   /db_xref="GOA:C5CX20"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX20"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS16824.1"
FT                   /translation="MNTRRTLVAAALSSLAFFGFAATAQAQGEPLRVATDATFPPMEFV
FT                   ENGKRTGFDVELVEAIGKTLGRKIEWIDIDFKGLVPGLISKRFDMAVSAIYITDERRKV
FT                   VDFTVPYYAGGLVVMVKDGNTAIKAPADINGKKVSVQVGTKSVAYTKEKFPQVQLMEVE
FT                   KNQEMFNLVDIGRADAAVTGKPAAYQYVRTRGGLKVLPEQITTEEYGMAIRKDTPELTK
FT                   AVNGAIEKLKADGTYAQIVAKWFK"
FT   sig_peptide     163786..163866
FT                   /locus_tag="Vapar_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.948 at
FT                   residue 27"
FT   gene            164637..165305
FT                   /locus_tag="Vapar_0162"
FT   CDS_pept        164637..165305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0162"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: pol:Bpro_1039 amino
FT                   acid ABC transporter, permease protein, 3-TM region,
FT                   His/Glu/Gln/Arg/opine"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16825"
FT                   /db_xref="GOA:C5CX21"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX21"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS16825.1"
FT                   /translation="MDFDFSPVWQGWPDLLRGALVTVEITACALALGCVLGLLVGIGRL
FT                   NPKRRWLYGACTAYVAAIRGTPLLVQLFILFFGLPHFGILLPAFLCGVLGLGVYSGAYV
FT                   SEIVRGAIQSIDKGQTMAAQSLGMTPGTAMREIVLPQAVVRMIPPLGNEFIALIKNSAL
FT                   VSLLTIHDVMHEGQKIISVSYRSLEVYLAIALVYFVLTGTMTLVLRHFEQKLRQGGLMR
FT                   "
FT   gene            165302..165871
FT                   /locus_tag="Vapar_0163"
FT   CDS_pept        165302..165871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0163"
FT                   /product="protein of unknown function DUF886"
FT                   /note="PFAM: protein of unknown function DUF886; KEGG:
FT                   pol:Bpro_1036 protein of unknown function DUF886"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16826"
FT                   /db_xref="InterPro:IPR010282"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX22"
FT                   /inference="protein motif:PFAM:PF05962"
FT                   /protein_id="ACS16826.1"
FT                   /translation="MSVQRFSRSSLPAMPWKNGGGTTQEIASWPQGAGLDGFGWRASIA
FT                   TIAAAGPFSTFAGVDRSIMLLEGDGVRLFTHDGRIEHRLDVPHRPFAFSGDDAIDCALL
FT                   GGASNDFNIMTRHGQWRADVQVLDHASAVEAAPHGVLLALGGAWRLNGEPCREGEGLYW
FT                   TDSAQAWQAEPVQEGARLAAIRIVPA"
FT   gene            165895..167145
FT                   /locus_tag="Vapar_0164"
FT   CDS_pept        165895..167145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0164"
FT                   /product="imidazolonepropionase"
FT                   /EC_number="3.5.2.7"
FT                   /note="KEGG: pol:Bpro_1035 imidazolonepropionase; TIGRFAM:
FT                   imidazolonepropionase; PFAM: amidohydrolase; Amidohydrolase
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16827"
FT                   /db_xref="GOA:C5CX23"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX23"
FT                   /inference="protein motif:TFAM:TIGR01224"
FT                   /protein_id="ACS16827.1"
FT                   /translation="MTSASTFPSADGLWTGLRLAPGAAPGTALDADTEAAIAVAEGTVR
FT                   WVGARSALPAEFAGLPPHDGGGALVTPGLVDCHTHLVYGGQRANEFAMRLAGASYEEVA
FT                   KAGGGIVSSVRATREADEDALFAQAAPRLEQLLADGVCAIEIKSGYGLALEHERKQLRV
FT                   ARRLGEAYGVTVRTTFLGAHALPPEYAGRSGDYIDLVCNEMLPALAAEGLVDAVDVFCE
FT                   RIAFTLAETEQVFQAAKALGLPVKLHAEQLSDMGGAALAAHYGALSCDHIEHLSAQGIE
FT                   AMRQSGTVAVLLPGAYYTLRDTQLPPIEALRAAGVPMAVSTDHNPGTSPALSLLLMMNM
FT                   ACTLFRLTVPEALAGVTVHAARALGLQKTHGVIAKGMPANFVLWNLRDAAELAYWFGQR
FT                   PVRTVVRQGRIAVGAAQ"
FT   gene            167142..168551
FT                   /locus_tag="Vapar_0165"
FT   CDS_pept        167142..168551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0165"
FT                   /product="formiminoglutamate deiminase"
FT                   /note="TIGRFAM: formiminoglutamate deiminase; PFAM:
FT                   amidohydrolase; KEGG: pol:Bpro_1034 N-formimino-L-glutamate
FT                   deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16828"
FT                   /db_xref="GOA:C5CX24"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR010252"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX24"
FT                   /inference="protein motif:TFAM:TIGR02022"
FT                   /protein_id="ACS16828.1"
FT                   /translation="MNTLFAADALLPVGWAKNVLLSWNEAGQLTQVQSAAPPAAGAQVA
FT                   KGPVIPGMPNLHSHAFQRAFAGLTEYRAQQQDSFWSWRTLMYRFAARLGPQQMEAIATW
FT                   LYAEMLEAGYTSVCEFQYVHHDADGRPYADDATLSLALLRAAKKAGIGFTLLPVLYQAS
FT                   GFGGLPPNEGQRRFIRSTDSMLRLLDTLKPACDAQGAPGPQGGPSARLGLAPHSLRAVP
FT                   PDALREAVAGLEAIDPGAPIHIHIAEQTKEVDDCVAWSGQRPVAWLLDHAPVDARWCLV
FT                   HATHMDAAEYERAAKSGAVAGLCPTTEANLGDGIFDFSAWRHHGGAWGLGSDSHATVNA
FT                   AEELLMLEYSQRLAWRQRNVGASAAQPHVATALTLEAVRGGAQASGRAIGGLAAGQQAD
FT                   FVVLDAAQLALQGLPAPDMLSSHVFASHRTSAIDTVWVAGQPRVAAGRHALHAEAAAAF
FT                   VAARSQLLLEN"
FT   gene            168558..169373
FT                   /locus_tag="Vapar_0166"
FT   CDS_pept        168558..169373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0166"
FT                   /product="N-formylglutamate amidohydrolase"
FT                   /note="TIGRFAM: N-formylglutamate amidohydrolase; PFAM:
FT                   N-formylglutamate amidohydrolase; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16829"
FT                   /db_xref="GOA:C5CX25"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR010247"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX25"
FT                   /inference="protein motif:TFAM:TIGR02017"
FT                   /protein_id="ACS16829.1"
FT                   /translation="MSFTTTEPAFRFRQGTRPLLISMPHVGTYVPPALAARLTGEARQV
FT                   PDTDWHLERLYDFADELGASVLVATHSRYVVDLNRPPDGASLYPGQSVTGLCPVDTFDD
FT                   TPVYASADDLPNDAEIAARRDAIWQPYHRQLQAELDRLKAAHGTIALWDAHSIRSVLPR
FT                   FFEGKLPDLNLGTGKGSSCDPALAATLLSIAESATGYTGVLNGRFTGGYITRQYGNPAA
FT                   GVHAVQLEMTQSSYMQEKLPFDYLPEVAAGVQPHVRRMIEAVLEFVERR"
FT   gene            169422..170468
FT                   /locus_tag="Vapar_0167"
FT   CDS_pept        169422..170468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0167"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   pna:Pnap_0115 homocysteine S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16830"
FT                   /db_xref="GOA:C5CX26"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX26"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ACS16830.1"
FT                   /translation="MKPVIYTRGQALAGILEKRIAILDGAMGTMIQRFKLTEEQYRGER
FT                   FKDFERDVKGNNELLSLTRPDVIRDIHEGYLAAGADLIETNTFGATTIAQEDYRMAHLA
FT                   REMNLESAKLARAACDKFSTPDKPRFVAGALGPTPKTASISPDVNDPGARNVDFEQLRA
FT                   AYYEQTEALVEGGADVILVETIFDTLNAKAALFAVDEYFDNSGQRLPLIISGTVTDASG
FT                   RILSGQTVTAFWHSVRHAQPLAIGLNCALGAALMRPYIQELAKVAGDTFISCYPNAGLP
FT                   NPMSETGFDETPDVTSRLLHEFAAEGLVNIVGGCCGTTPDHIAAIGKAVAPMTGRLLNN
FT                   NGFYREAA"
FT   gene            170553..171347
FT                   /locus_tag="Vapar_0168"
FT   CDS_pept        170553..171347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0168"
FT                   /product="SH3 type 3 domain protein"
FT                   /note="PFAM: SH3 type 3 domain protein; protein of unknown
FT                   function DUF1058; KEGG: bpy:Bphyt_2633 SH3 type 3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16831"
FT                   /db_xref="GOA:C5CX27"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX27"
FT                   /inference="protein motif:PFAM:PF08239"
FT                   /protein_id="ACS16831.1"
FT                   /translation="MNNKLSMRWIGIGAVALALPMAAAAQQAFTRGAVNLRAGPSGDYP
FT                   LVARLGPGQPLDVIGCTGGYSWCDVVLPDGGRGWVWARSLDYAYQERRVPLASYAAVIG
FT                   VPVVTFVIGSYWADYYRDRPWYGERRWWGGRPPPPPMPGWRPPPPVRPAWQPRPWPGPG
FT                   FKPAPGPGFHPQPGPGYRPPRPGPGYRPPADPGIKPPRPQPAFRPGPPPGQPQMHPGGG
FT                   RPGAGGGGGGRPHGGGEGGGRGGGHGHGGGGGGKGGGHGHRD"
FT   sig_peptide     170553..170630
FT                   /locus_tag="Vapar_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.786 at
FT                   residue 26"
FT   gene            complement(171348..172277)
FT                   /locus_tag="Vapar_0169"
FT   CDS_pept        complement(171348..172277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0169"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: dia:Dtpsy_0155 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16832"
FT                   /db_xref="GOA:C5CX28"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX28"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACS16832.1"
FT                   /translation="MAFSSDNVEVFLAVIDHGSFSAAARALRKVPSAVSMAIANLEAEL
FT                   ALPLFDRSGREPQPTAAARSLEPQARLLAAQLKQLQVQALALTQGLENRLTLAIAPELL
FT                   AAPWSGPLAALAEEYPLLQVEVLAAPQADALALLHSGRAQLALVFERPSLDGREGFQEV
FT                   GSDTMVAVMAPGHPVLLAAAGERLREEHLTNTRQIVVAGRDLATSDPRFVFARHVWRTD
FT                   NALAALSLITAGLGWGWLPRNFARPHVAAGALVEIPFENLSNGLDLWVDVVWSRERPLG
FT                   LGAQRFVALIARDRQAAAGISAADDPRG"
FT   gene            172376..172837
FT                   /locus_tag="Vapar_0170"
FT   CDS_pept        172376..172837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0170"
FT                   /product="transmembrane pair domain protein"
FT                   /note="PFAM: transmembrane pair domain protein; KEGG:
FT                   vei:Veis_1694 transmembrane pair domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16833"
FT                   /db_xref="GOA:C5CX29"
FT                   /db_xref="InterPro:IPR007896"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX29"
FT                   /inference="protein motif:PFAM:PF05232"
FT                   /protein_id="ACS16833.1"
FT                   /translation="MQGFQRRVVYISLYEGIAIVAASAGLALMTDAGLGHSGVLAVAAS
FT                   VIAVIWNLVFNALFERWESRQAVRGRSVRRRVAHAVGFEGGLIAVLVPLFAWGLGVTLW
FT                   QALVMDLGLVVFFLIYTFVFNWGFDRVFGLPASAAPAKTGPAAAAGQGA"
FT   gene            173020..175770
FT                   /locus_tag="Vapar_0171"
FT   CDS_pept        173020..175770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0171"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="KEGG: aav:Aave_0214 methionine synthase
FT                   (B12-dependent); TIGRFAM: methionine synthase; PFAM:
FT                   dihydropteroate synthase DHPS; Methionine synthase
FT                   B12-binding module cap domain protein; cobalamin
FT                   B12-binding domain protein; Vitamin B12 dependent
FT                   methionine synthase activation region"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16834"
FT                   /db_xref="GOA:C5CX30"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX30"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ACS16834.1"
FT                   /translation="MSEEVSTPRVPPMKLSGLEPVAIDAGSLFVNIGERTNVTGSKAFA
FT                   RMILNGQFEDALAVARQQVENGAQVIDINMDEAMLDSKAAMVRFLNLIASEPDIARVPV
FT                   MVDSSKWEVIEAGLRCIQGKGIVNSISMKEGVDKFKHEAKLVRRYGAAAVVMAFDEKGQ
FT                   ADTYQRKIEICERAYRILVDEVGFPPEDIIFDPNIFAIATGIEEHDNYAVDFINAVRWI
FT                   KENLPGAKVSGGVSNVSFSFRGNDPVREAIHTVFLYHAIQAGMDMGIVNAGMVGVYDDL
FT                   EPTLRERVEDVVLNRRPDAGERLVEVAETAKSGAKDDSKKLEWRGTPEHPVHVNQRLSH
FT                   AMVHGITDFIVEDTEEAYQQILAKGGRPLHVIEGPLMDGMNIVGDLFGQGKMFLPQVVK
FT                   SARVMKSAVAHLIPYIEEEKRQDEAAGRDVRTKGKIIIATVKGDVHDIGKNIVTVVLQC
FT                   NNFEVVNMGVMVPCHEILAKAKVEGADIVGLSGLITPSLEEMQYVAGEMQKDDHFRIRK
FT                   IPLLIGGATTSRVHTAVKIAPHYEGPVVYVPDASRSVSVAQSLLSDQATAYIDEINADY
FT                   EKVRTQHANKKQVPLWPLAKARANKTPVDWSGYTPPVPKFIGRRLFKNFDLTELAKYID
FT                   WGPFFQTWDLAGPFPAILKDEVVGTEAVRVYADGQRMLKRLIEGRWLSASGVVGFWPAN
FT                   TVNDDDIELYTDETRSEVALTWYGMRQQTEKQVIDGVMRPSRCLADFVAPKDSGLADYV
FT                   GVFAVTAGLGVEKKEKYFIDDLDDYSAIMLKALADRLAEAFAESLHHRARTDLWGYAPE
FT                   EGLSNEDMIAEKYRGIRPAPGYPACPDHSVKRPMFDLLGCADIGMTLTESLAMMPAASV
FT                   SGFYLSHPESTYFNVGKIGHDQLQDQAARRRTSESELERLLAPNL"
FT   gene            175823..177631
FT                   /locus_tag="Vapar_0172"
FT   CDS_pept        175823..177631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cja:CJA_0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16835"
FT                   /db_xref="GOA:C5CX31"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16835.1"
FT                   /translation="MFAAAHYAALAVFVLGCWGFGRALLARLAPPPRRDAGLEAAMAAA
FT                   LGVGLFICAFQLLAIFGAFKPGATVALIAAGVLAAALQLRPWWREARALHVAGAPAAPW
FT                   SRAERIAAIALALVALPALVAPLAPPAAFDELMYHLPYARLVAQQGSLGIHEWLRYPWF
FT                   PYNYNLLYAAALQLGDDVLPHFLNALAGVISAVMVYRLGIQHANRLTACIGAAIWIGIG
FT                   DYSNALIDMGVALFVLSACVALWWWRESEPLPGGTRWLGLAAFCLGVAAGSKYQALTFL
FT                   PLVALFVVWRERRPKAWALALLCFLVPCVYWYARNAIMTGDPFNPIGARVFGFTDWIPA
FT                   DYVQQVADVRDHAARPNALIWAVFLAPFSLLWKRSAALRAAGWFCFYSVAVWLLTSRYP
FT                   RYLTASFPLLALMAAIGWQVLFGGIAAGVRRVFGAKGGPVEAAPAAAAPAGRLALAGDW
FT                   IVVLLLAALAAVSLRQTAGKVAMISPTPETREAFLRQHVPGYAAMDYLRQHADGRVYQI
FT                   ALNEAIYYGPNPIWGDTLGPWRYRDFLLLLPGDMARKLAAKGFTAIVMPTSMVPTLATR
FT                   PGFDEHFALLYEKDGGRVYRILSTAP"
FT   gene            177628..178605
FT                   /locus_tag="Vapar_0173"
FT   CDS_pept        177628..178605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0173"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   ajs:Ajs_0549 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16836"
FT                   /db_xref="GOA:C5CX32"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX32"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACS16836.1"
FT                   /translation="MTDDNPSAAARAPIRIAAVIPCYNEALSIAQVVAQFRAALPEAEI
FT                   HVFDNNSTDDTAAIARASGATVTHVAAPGKGNVVRRMFADVEADVYVTVDGDATYDVAS
FT                   APRLVDALVERNLDMVVGCRVDDGQNALTYRAGHRFGNRLLTGAVAQLFGGGLTDMLSG
FT                   YRVFSRRYAKSFPALSQGFEIETELTVHALELRMPHAEFDTAYSTRPEGSHSKLSTYRD
FT                   GWRILKTICKLFISERPLQFFSILAAVLAAGAIALAIPLLLTYLHTGLVPRLPTAVLAT
FT                   GAMLAAMLSMVCGVVMHAIRLARREAKRLRYLAIPGVGQFRRKP"
FT   gene            178602..179009
FT                   /locus_tag="Vapar_0174"
FT   CDS_pept        178602..179009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0174"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: bph:Bphy_0865 GtrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16837"
FT                   /db_xref="GOA:C5CX33"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX33"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ACS16837.1"
FT                   /translation="MKAGREFLAFAVVGVIGLVVDVAVLYLAAPLLGWYGARVLSFLAA
FT                   ATTTWALNRRYTFAARRALGAATPIVREYLGYLATMLGGAVVNYGAYVLVLHWLEGPWV
FT                   PALGVAAGSCAGMAVNFLAARHLVFKPRRSP"
FT   gene            complement(179022..180221)
FT                   /locus_tag="Vapar_0175"
FT   CDS_pept        complement(179022..180221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0175"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: amidohydrolase; KEGG: pol:Bpro_4072 enamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16838"
FT                   /db_xref="GOA:C5CX34"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX34"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACS16838.1"
FT                   /translation="MAEIAAGAKSGKVVIKNIGLLLSGDIDKPILDADTIVVNDGLIVA
FT                   VGKEKDCDLDGAQTVIDAKKTCVAPGLIDSHVHPVFGDWTPRQGQIGWIDSTMHGGVTT
FT                   MISAGEVHLPGRPKDIVGLKALAITAQRAFDNFRPGGVKVLAGAPVIEKGMVESDFKEL
FT                   AEAGVGLLGEVGLGSVKAGYEAKEMVAWARKYGIQSTIHTGGPSIPGSGLIDKDVVLEA
FT                   DADIIGHINGGHTSLPEAHVCELCEKSSRAIEIVHNGNEKVAIAAAKAALELKCPHRVI
FT                   LGTDGPAGSGVQPLGILRMVAMLSSIANIPAELVFCFATGNTAKIRKLNCGLVEVGRDA
FT                   DFVFMDRAQHSPAPGLLESVQLGDIPGVGMVMIDGIVRCGRSRNTPPATEIPVVLPAAH
FT                   "
FT   gene            complement(180226..181017)
FT                   /locus_tag="Vapar_0176"
FT   CDS_pept        complement(180226..181017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0176"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: vei:Veis_0851
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16839"
FT                   /db_xref="GOA:C5CX35"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX35"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS16839.1"
FT                   /translation="MADSRTAAKPQRRTGVREAAAQATRDSILKSATKVFAKYGYDGGS
FT                   VEKISKAAKSYDRMIYYYFGSKEGLFIAVLEGIYKRMDDAEAAIALDASRPVEALTEVI
FT                   RFVLGYYRKNPEFVTLLNTENLHKGRHISKSLRAREYSSRAVAIIAEILASGAAQGLFR
FT                   RDLNARDIYLLIASTGYFYTSNRHTLTAFLGEPLESPEAITHWEDFVIETVLRTVRADD
FT                   IQEQENNSPPHDEEKMTPIAHVRSRPPKGAQASLGAARREA"
FT   gene            complement(181035..181808)
FT                   /locus_tag="Vapar_0177"
FT   CDS_pept        complement(181035..181808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0177"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   pna:Pnap_2736 ferredoxin--NADP(+) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16840"
FT                   /db_xref="GOA:C5CX36"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX36"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACS16840.1"
FT                   /translation="MSAFSEERVLSVHHWTDRLFTFTTTRDPALRFSNGHFTMIGLKVN
FT                   NKPLLRAYSIVSPNYEEHLEFLSIKVEEGPLTSKLQHIQVGDTIIVGRKPTGTLLIDYT
FT                   LPGKRLYLFGTGTGLAPFMSIIRDPDTYEKFEQVILVHGVRQVDELAYHDLVTDHLPKH
FT                   EFLGEMVEKQLLYYPTVTREEFRNQGRITDLIETNKLTDDLGLPPINPMEDRVMLCGSP
FT                   GLLVDLKHILEKRGFKEGNTSTPGDFVVERAFAEK"
FT   gene            182133..183749
FT                   /locus_tag="Vapar_0178"
FT   CDS_pept        182133..183749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0178"
FT                   /product="6-hydroxynicotinate reductase"
FT                   /note="KEGG: pol:Bpro_4068 6-hydroxynicotinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16841"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX37"
FT                   /inference="similar to AA sequence:KEGG:Bpro_4068"
FT                   /protein_id="ACS16841.1"
FT                   /translation="MTEHTKTDGLPGMDMPVAFEAGSGAFGKAPPRNEKMSSAKVECNA
FT                   CPVLCQISDGRTGACDRYANKEGVLVRVDPVLLLRREIASETPVLVPFDRPAAEKSEGS
FT                   VPDWDGDLLHADEVFVTGVGSSTTYPDYKPAPFIVASKAQGVDMVTVVTEGIFSYCSFK
FT                   VKIDTDRFLGSEQANVRYRGEVVGHVTTAEYGSQMLSLGGVHHLTGGSKKEGRMTAELM
FT                   QLLGNKKAVECTIDGGSTLVIQAGKAPIVNGVEEQRMRVGCGSAAVGIFARQFAGVADE
FT                   VVVVDDHITGVLTEHQAGRCLDMAPSGIQMLGRKSTPGRYFQVANPGNGWGGTDIADPL
FT                   SIIEGWEEGVARPGLRLLMTSTTGEHAQWYVLDEALKPVEQPMPPEVRRIVERIGENCE
FT                   PSLCTVLFLGGAGGSLRAGVTENPVLLTRAIKRALVNVTCGGAPAYVWPGGGITVMADV
FT                   MRMPDNSFGTVPTPAIVAPIEFSMRRDDYLALGGHMEHIFPLEQALARGAWQEDGAPLA
FT                   RQWVVIDEANPWPLGHPPMLG"
FT   gene            183917..184834
FT                   /locus_tag="Vapar_0179"
FT   CDS_pept        183917..184834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0179"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: pol:Bpro_4067
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16842"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR007183"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX38"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ACS16842.1"
FT                   /translation="MTAQRTALDASRWHFNHGPIDIVAEAHGDPYAVAAAHDAAWARFG
FT                   HVLDELVRELPLLRLSVTDSMRPRGVVGARMWDACAAFSPMFITPMAAVAGSVAQELIA
FT                   FYDRPGIERAWINNGGDIALHLAPGQSARVGVYADLARFDWRKHVEGESGILTTDGQFE
FT                   ISAAQPVRGVATSGWRGRSFSLGIADSVTVLAATAAEADAAATVIANAVDVDDAAIRRR
FT                   PASECKDDSDLGEMLVTVDVPPLSPAQVKSALDTGAVCAKVLQKEGLAWAALLVCQGQW
FT                   RLVEPLCSKSLASAPADAVGSVFA"
FT   gene            184856..185497
FT                   /locus_tag="Vapar_0180"
FT   CDS_pept        184856..185497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0180"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   pol:Bpro_4066 protein of unknown function DUF1185"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16843"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX39"
FT                   /inference="protein motif:PFAM:PF06684"
FT                   /protein_id="ACS16843.1"
FT                   /translation="MIDIRRVFTHVEHIHHEFGPRAATPLVRGAIGAVLANPFAGRYEP
FT                   DILPMMALLDPVGVDMAHRLHAAMDVPLEQIATYGKGAIVGAAGELEHGALWHVPGGYA
FT                   MRELLGWKGDRAAYTAGKAEEKTGQPGNALSIVPSTKKVGPPGAALDVPLTNINASYVR
FT                   GQFDAIEVRVPGAPAADEIVFILAMSTGYRVHARVGGLLAKDISKWDGLR"
FT   gene            185535..186119
FT                   /locus_tag="Vapar_0181"
FT   CDS_pept        185535..186119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0181"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   pol:Bpro_4065 protein of unknown function DUF1185"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16844"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX40"
FT                   /inference="protein motif:PFAM:PF06684"
FT                   /protein_id="ACS16844.1"
FT                   /translation="MTANIRKLVVQVDETRKEMGRDISPPTRRAVAIAVIDNPYAGRFS
FT                   ENLDELIAIGEELGALLGQKAVKALGIEPGQAQSYGKAAIVGENGELEHAAAILHPKLG
FT                   APLRVAVEKGAALVPSAKKRGTLGTAIDVPLGHKDAAFVRSHFDAVEARVSDAPRANEI
FT                   VVAVAVTDSGRPLPRIGGLQASEIKGEDGLR"
FT   gene            186193..187398
FT                   /locus_tag="Vapar_0182"
FT   CDS_pept        186193..187398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0182"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pol:Bpro_4064 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16845"
FT                   /db_xref="GOA:C5CX41"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX41"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACS16845.1"
FT                   /translation="MNPLRHVFSAAAVATLATALVPAHAQGVIKIGEVNSYKAQPAFLE
FT                   PYKKGMELAVEEINAKGGVNGRKVELITRDDNANPGDAVRVAEELVAREKIDVLTGTFL
FT                   SNTGLAVADFAKQKKIFFLAGEPLTDKMTWQGGNEYTFRLRPGTYMQAAMLVPEAAKLK
FT                   KKRWAVVYPNYEYGQSAVAAFKTLLKAAQPDVEFVAEQAPPLGKVDAGAVVQALADAKP
FT                   DAVFNVLFGADLSKFVREGNTRGLFKDRTVVSVLTGEPEYLDPLKDETPNGWIVTGYPW
FT                   YGIQTPEHKAFFLAYHAKYKDYPRLGSVVGYSMIKSVAAGIDKAKSTETPKLVAAFKGL
FT                   QVDTPFGKISYRAEDHQSTMGAFVGKTKNENGKGVMVDYTYFDGAKFQPSAADVKKSRA
FT                   AD"
FT   sig_peptide     186193..186270
FT                   /locus_tag="Vapar_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 26"
FT   gene            187423..189351
FT                   /locus_tag="Vapar_0183"
FT   CDS_pept        187423..189351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0183"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   pol:Bpro_4063 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16846"
FT                   /db_xref="GOA:C5CX42"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX42"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS16846.1"
FT                   /translation="MSLSSLLLQFLTGLSSASSLFLVGAGLSLIFGVTRIVNFAHGSFF
FT                   MVGIYLAYTLVDKLGTLGFWPAVLIAALAVGVIGALIEMVLLRRIYKSPELFQLLATFA
FT                   LVLVIKDAVLYVWGPDELLGPRAPGLSGSVDILGRQFPTYDLFLIVVGPVVLGLMWLLL
FT                   TRTRWGTLVRAATQDREMVSALGVNQAWLFTAVFALGATLAALGGALQLPREPATLAMD
FT                   LNTIGAAFVVVVVGGMGSIPGAYVAALLLSEIKAVCIWLGVVEIFGYSVSFSKLTLVVD
FT                   FIVMAIVLVWRPWGLLGRPQAPSRYVGMQEEPLRRASKGYLWLVAALGVALMAMPLLTA
FT                   DSPYTTVLMIDLLIAALFAASLHFIMGPAGMHSFGHAAYFGLGAYGAALLVRTSGMPME
FT                   IALIVAPLVAAIGAFVYGWFAVRLSGVYLAMLTLAFAQITWAVVYQWDSFTGGSNGLTG
FT                   VWPSEWLSDKRTYYWLTLVLVAAGILMLRRVLFSPFGYALRAGRDSVLRADAIGIDVKR
FT                   MQWTAFVIAGAAAGLAGALYAFSKGSISPESLSVDKSVDGLVMVLLGGIQTLAGPVVGA
FT                   VTFSWLHDTVARNTDYWRATLGAIILLLVLLFPQGIAGFAKQLSERLLRGRRRRSEVDV
FT                   ALTERRT"
FT   sig_peptide     187423..187497
FT                   /locus_tag="Vapar_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.731 at
FT                   residue 25"
FT   gene            189348..190085
FT                   /locus_tag="Vapar_0184"
FT   CDS_pept        189348..190085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16847"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX43"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16847.1"
FT                   /translation="MRGGCLSFFGGSFFGGGRVSPRRATYFSLLRQRNVGKRKATLLSA
FT                   SLRFAAGNLRCSITAGVRRTRSTAFRSNSCGPDPASICAPRRIQKGWERAAFASLGPKT
FT                   NSQYQQPNPIPTTTARSAAVAWWPSEAKARLVSNPLCMRRGAECFADQGSPLFERSEFG
FT                   RDPAKREHRRLPRSVAKGSQTVGSPFFCLRFFGEAKKSRSPAGARPGLGKQTISTDQKI
FT                   GSDGKAASPHPNPLPEGEGVSQK"
FT   gene            190082..190888
FT                   /locus_tag="Vapar_0185"
FT   CDS_pept        190082..190888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0185"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_4062 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16848"
FT                   /db_xref="GOA:C5CX44"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX44"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS16848.1"
FT                   /translation="MTLLKVDNLGKSFGGVKAVDGISFELEAGELLALIGPNGAGKSTT
FT                   FNMVNGQLKADQGSIVFDGHELVGQKPREIWRKGVGRTFQIAETFASLTVAENVQMAML
FT                   SHDGKLFSMWRRAADHKRDEALALLDQVGMKAQADRPCSELAYGDVKRVELAIAMANAP
FT                   KLLLMDEPTAGMAPKERNSLMALTKELVVQRGLAVLFTEHSMDVVFAYADRMIVLARGR
FT                   LIAQGKPLEIRDHPKVQEVYFGSGKTFEKIAEKAAEVNAAVGAATA"
FT   gene            190885..191619
FT                   /locus_tag="Vapar_0186"
FT   CDS_pept        190885..191619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0186"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_4061 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16849"
FT                   /db_xref="GOA:C5CX45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX45"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS16849.1"
FT                   /translation="MSTHETLLKANSLCAWYGAAQILYDVDLEVQRGEVVALMGRNGAG
FT                   KSTTLKTLIGMLAKRKGSVSFLGHDISKSEPHHAAKLGLGFVPEDRRVFTDLTVMENLE
FT                   VGKQPPRRWADGSEAPLWTPERLFKLFPNLGEMPDRPGGRMSGGEQQMLTVARTLMGNP
FT                   YLVLLDEPSEGVAPVIVEQMANMILELKAQGVSILLSEQNMHFAELVSDRAYVLEKGQI
FT                   RYHATMAELAANEEVRRAYLSV"
FT   gene            191673..192395
FT                   /locus_tag="Vapar_0187"
FT   CDS_pept        191673..192395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0187"
FT                   /product="Nicotinamidase"
FT                   /EC_number="3.5.1.19"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: vei:Veis_0861
FT                   nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16850"
FT                   /db_xref="GOA:C5CX46"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX46"
FT                   /inference="protein motif:PRIAM:3.5.1.19"
FT                   /protein_id="ACS16850.1"
FT                   /translation="MHDSHRRSLLKSTAALGLLGAAGTLFAAPKLKPNDKSALIVIDVQ
FT                   NCFVDGGTLPVKGGAEVVPVINKLADSFENIVVTQDWHTQGHASFASAHAGQKPFSSIK
FT                   LSYGNQVLWPDHCVQGTDDAALHKDLKLPTAQVIVRKGFHKGVDSYSAFEEADRKTATG
FT                   LGGYLKQRGIKTVYVAGLATDFCVAWTALDARKAGFEVYVIEDATRAIDLNGSLAAAWK
FT                   QMAAKGVKRIQSADIQAA"
FT   sig_peptide     191673..191756
FT                   /locus_tag="Vapar_0187"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            192461..193621
FT                   /locus_tag="Vapar_0188"
FT   CDS_pept        192461..193621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0188"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   pol:Bpro_4060 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16851"
FT                   /db_xref="GOA:C5CX47"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX47"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACS16851.1"
FT                   /translation="MTIPISRRALVAGGAALALGPGLLRSARADNGVTDGLIRIGQSAV
FT                   FSGPAKDFGIDYRAGIKLYFERANKSGGINGRKLELVSYDDAYDPARTAANTAKLIDED
FT                   KVFALAGFVATGNLAAAMPLAEKAGVPMFAPLVGTTSFRTKVNRLLFHVRAGYDLELRK
FT                   IISHLSTLSLASIAVVYQDSAFGKSNLATCEQLAADYKVQVVKTLPLAIAAEDAKQVVA
FT                   SLAEAKPGAVLMIMAGRMVEVFMRDYRANGGAAPLYTLSVGITDAAGSAKRLEGKLAGL
FT                   VTASIVPPPQAVRVPIVADYQRDRAEFGEKIDSYTTLEGYIASRVMVEGLRRAGKALTR
FT                   DSFIAGLEGIGNARFGDFPVEYSAKNHNGSTFVDLEMYTRDGQLRR"
FT   sig_peptide     192461..192550
FT                   /locus_tag="Vapar_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.861 at
FT                   residue 30"
FT   gene            193599..194102
FT                   /locus_tag="Vapar_0189"
FT   CDS_pept        193599..194102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0189"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: ppf:Pput_1890 2Fe-2S iron-sulfur cluster binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16852"
FT                   /db_xref="GOA:C5CX48"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX48"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ACS16852.1"
FT                   /translation="MTASCGAEPPLYLQVNGRACSIEGVPHAATLLHLLRNDLGLNGPK
FT                   YGCGLGQCGACTVHVDGVAARACVIPAHGVAGRAITTLEGLGTRGRWHPVQAAFEDAQA
FT                   AQCGYCLSGMVMQAAALLARDPQASEARIRSELSGNLCRCGTHIEILDAVQRAAVRMQE
FT                   VERP"
FT   gene            194236..197997
FT                   /locus_tag="Vapar_0190"
FT   CDS_pept        194236..197997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0190"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: pol:Bpro_4058 isoquinoline
FT                   1-oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16853"
FT                   /db_xref="GOA:C5CX49"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX49"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ACS16853.1"
FT                   /translation="MTRRADLPRTRADFLSADGVLLVVRETPPAPAPANGQPTAVAGNP
FT                   IEGDEILLAVWDDGSASALNGHVDLGTGIQTALAQIVAEELELGMPCVRMMLGDTARAP
FT                   NQGATIASASIQIHAQPLRMAAAQARAWLLARAAERLGVAAEALQVRNGVVRVAEAPDR
FT                   RINYADLVAGQRTVLRLDPAAVPKDPADYRIVGTRQARVDIPAKLAGDLVFVHDMRVPG
FT                   MLHGRVVRPPYAGADHGEFIGNTLESVDESSIAHIPGIRAVVVIRDFVGIAAEREEHAE
FT                   QALRELRVRWKPWPGMPDLSNLAQALRDNPSTQRLLVDEGDVDGAIAAAAQPMHRTYVW
FT                   PYQMHASIGPSCALAEWLPEDGSGMQLRCWAGSQNPHVLRADLAKLMGLDDVQVDVIRM
FT                   EAAGCYGRNGADDAAADAALLARAVGAPVRVQLTREQEHAWEPKGAAQLMEVDGGLMAD
FT                   GRIAAYDFETSYPSNGAPTLALLLTRTIEPVAQAFEMGDRTARPPYSVDNLRVKVNDMA
FT                   PIVRASWLRGVSALPSSFAHESYIDELATAAGVDPVQFRLRHLDDTRAVELVQATAQKA
FT                   GWRMRTGPEENADGGLGEGGDILFGQGFAYARYIHSKWPGFGAAWAAWVADVEVNRRTG
FT                   EVHVRRVVVGHDAGLLVNPAGVEHQVHGNVIQTTSRALKEEVQFAPQQGAEAAAAGAQL
FT                   LTGVRPSGVVASREWGSYPIINFRDVPVIEVMHMPRPGEPSLGAGESSSVPGTAAIANA
FT                   IFDATGVRFREPPFTPEKVLAALNRGLLPPLPGEGGGGGERRSKGDAAVPPSQPSPGRG
FT                   RSNAPWPRRKSVWATGTALFIGGLGLIAGLLGWRSAIAPVSLSAPVYSEATIERGRVLA
FT                   ALGDCAVCHTAPGGAPNAGGRAMQTPFGTLYTTNLTPDADTGLGRWSFSAFQRAMREGV
FT                   SRDGHHLYPAFPYTAFAKTSDDDLQALYAYFMSMPAVRAETPKAELKFPFSMRPLMAGW
FT                   NALFHDPAPLQPVATQSAEWNRGAYLVNGLGHCGACHTPRNVLGAEQGGSAFLSGAMVD
FT                   GWEAPALTQLSKSAVPWDADALYRYLRNGHSPRHGIAGGPMAEVVRELAQVPDADVRAM
FT                   ATYLASFNPAPAADPQAVAQQVVDNAARTQGRLLGPAQRMFDSACASCHHDGDGPTLLG
FT                   VNTPLALNGNLTSARPDNLLRTILDGVREPASQGIGFMPAFRDALDDRQIAELAGYMRA
FT                   RFAPQEPAWKNLPAEVARVRAARGHGAE"
FT   gene            198109..199296
FT                   /locus_tag="Vapar_0191"
FT   CDS_pept        198109..199296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0191"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   pol:Bpro_0733 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16854"
FT                   /db_xref="GOA:C5CX50"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX50"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACS16854.1"
FT                   /translation="MPLNLSTAASLPRDAERATLVGRIWQPGVGPVLVAVHEGGLHDLS
FT                   RLAPTMSDLLEAKEPPADAVRRALRSGQAPRVAALDEAIANSDATARDEAKPWLLAPCD
FT                   LQAIKASGVTFVESLLERVIEEQARGDASRAEATRAALSGVLGDNLAGIVPGSAEAAKV
FT                   KEVLISQGAWSQYLEVGIGPDAEIFTKAPVLSAVGMGADVGIHAASVWNNPEPEVVLAV
FT                   NSRGETLGAALGNDVNLRDFEGRSALLLGKAKDNNASCAIGPFIRLFDAHFGIDDVRRI
FT                   TVALEVKGPEGFTLEGSSSLARISRDPLDLVSQAIGAHHDYPDGFMLFLGTMFAPTQDR
FT                   HGPGQGFTHVVGDRVSIAAPELGALVNRVVHSDQAPRWTFGLSALMRNLAARGLL"
FT   gene            199429..200520
FT                   /locus_tag="Vapar_0192"
FT   CDS_pept        199429..200520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0192"
FT                   /product="type VI secretion-associated protein, ImpA
FT                   family"
FT                   /note="TIGRFAM: type VI secretion-associated protein, ImpA
FT                   family; PFAM: ImpA domain protein; KEGG: bbr:BB0799
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16855"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX51"
FT                   /inference="protein motif:TFAM:TIGR03363"
FT                   /protein_id="ACS16855.1"
FT                   /translation="MGLPPSEIELLQSPVEGPLPCGEDLEYDPDFMALQQAATGKREQQ
FT                   FGSTIIPAEPPDWARVERIAKQLCQRTLDVRVLVLLTLAWTESRGLPGYVDGLRVVDGI
FT                   LQKFWNDVHPRVVDGDFEDPLPRMNALAALAEAEGLGRSVRDARLLEDAGASMSLRQVE
FT                   ALLDSSKADQIDYPGGIGRLREVARRAQEKAAPAVVALHAALELLRRIRETSERALGQS
FT                   WAPDFSRLERSLRTVVQLLPEQAQPEPAEASQAAAQGHGSAPAAPSAQGAAALGHGASG
FT                   ARAASIKDIEISTRDDVQVLLEKACQYMERTEPSHPAPMLIRRAQRLLDLNFFQIIEEL
FT                   VPEGLQKIESLAGRSLSGGSAAE"
FT   gene            200601..201170
FT                   /locus_tag="Vapar_0193"
FT   CDS_pept        200601..201170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0193"
FT                   /product="type VI secretion protein, VC_A0107 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0107 family;
FT                   PFAM: conserved hypothetical protein; KEGG: bpt:Bpet4117
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16856"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX52"
FT                   /inference="protein motif:TFAM:TIGR03358"
FT                   /protein_id="ACS16856.1"
FT                   /translation="MADNRVRNSGQKFIARNRAPRVQIEYDVEIYGSERKIQLPFVMGV
FT                   IADLAGKQVDPMPDLAERDFMAVDIDNFDDRMKAIKPRVAFQVPNTLTGEGQMNVDITF
FT                   DSMDDFSPARIARQVGALQHLLEARTELSNLLSYMDGKNGAEQLIAQALQNPELLKSLA
FT                   SAPNPAVAKAIEAANEKSGNPGTPSE"
FT   gene            201189..202697
FT                   /locus_tag="Vapar_0194"
FT   CDS_pept        201189..202697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0194"
FT                   /product="type VI secretion protein, EvpB/VC_A0108 family"
FT                   /note="TIGRFAM: type VI secretion protein, EvpB/VC_A0108
FT                   family; PFAM: protein of unknown function DUF877; KEGG:
FT                   spe:Spro_3004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16857"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX53"
FT                   /inference="protein motif:TFAM:TIGR03355"
FT                   /protein_id="ACS16857.1"
FT                   /translation="MSTAPKQTARGQAATIEALEPNEFSDLLQREFKPKTDQAREAVQS
FT                   AVKTLAVQALESTVTISNDAYRTVQAIITEIDRKLSEQINQILHHEDFQQLEGAWRGLH
FT                   YLVNNTETDEQLKIRVMCASKREVARSLKRHKGIGWDQSPLFKKIYEAEYGQFGGEPFG
FT                   ALIGDFHFDHSPPDVEMLGEMAKIAAAAHCPFIAGASPTVMQMDSWQELSNPRDLTKIF
FT                   QNTEHTAWRSLRESEDARYIGLAMPRFLARLPYGARTNPVDEFEFEEETDSALHNRYTW
FT                   ANSAYAMGVNINRSFKQFGWCTSIRGVESGGAVENLPTHTFPTDDGGVDMKCPTEIAIS
FT                   DRREAELAKNGFMPLVHRKNSDFAAFIGAQSLQQPAEYYDADATANANLAARLPYLFAC
FT                   CRFAHYLKCIVRDKIGSFREREDMERWLNDWIMNYVDGSPGTSSQDTKAMKPLAAAEVQ
FT                   VEAIEDNPGYYAAKFFLRPHYQLEGLTVSLRLVSKLPSNKKDSS"
FT   gene            202747..203229
FT                   /locus_tag="Vapar_0195"
FT   CDS_pept        202747..203229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0195"
FT                   /product="protein of unknown function DUF796"
FT                   /note="PFAM: protein of unknown function DUF796; KEGG:
FT                   bpa:BPP0716 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16858"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX54"
FT                   /inference="protein motif:PFAM:PF05638"
FT                   /protein_id="ACS16858.1"
FT                   /translation="MAVDMFMRVEGANGESKDSNHKDWTDIKSFAWGATQPGNMVSGGG
FT                   GGVGKASFNDLQVLARIDKAAPSVMKNCASGKHLSKVEVSVCKAGGSQIEYTRVTLEEV
FT                   LVTSVQYSAEQGGDAVLVQFAFQAAKVKQQYWEQTDKGGKGAETVLAWNIKENREA"
FT   gene            203343..204209
FT                   /locus_tag="Vapar_0196"
FT   CDS_pept        203343..204209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0196"
FT                   /product="virulence protein SciE type"
FT                   /note="PFAM: virulence protein SciE type; KEGG:
FT                   bpt:Bpet4114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16859"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX55"
FT                   /inference="protein motif:PFAM:PF07024"
FT                   /protein_id="ACS16859.1"
FT                   /translation="MGDGFAVLGERSVAEHTEWVQRQIRASPQNAGLRLALGHFLALRG
FT                   DWQRAEDQLKLAAKIDPSFAPASATCAMALAAERHRTEFWSGGRAPAVVAGEAGWVAAL
FT                   IAAAALPPERDAEAAELREAARQDAPALQGTLSCVDRSDSRAVQAIDGEPVQSIEFAWL
FT                   CDGDARMGAALELLTPSGYAWLPLPAVRRLKFSRPQHLVDLLWAPAEIVLHDGRGLNGL
FT                   VPVRYPGALEALDDETTLGRRTDWLPLAGEDQYAGVGQRTLISEAGDHSLLDIRLVEFA
FT                   PAESAAQ"
FT   gene            204239..204766
FT                   /locus_tag="Vapar_0197"
FT   CDS_pept        204239..204766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0197"
FT                   /product="type VI secretion system lysozyme-related
FT                   protein"
FT                   /note="TIGRFAM: type VI secretion system lysozyme-related
FT                   protein; PFAM: GPW/gp25 family protein; KEGG: bbr:BB0804
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16860"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX56"
FT                   /inference="protein motif:TFAM:TIGR03357"
FT                   /protein_id="ACS16860.1"
FT                   /translation="MEADGDQQESVARDRLQPVLLDRLTDKQPQSRQERAGAFLMSGKL
FT                   LRDSVLRDLQWLLNTTNFGADHTINAMPRARRSVVNYGVRGWAGGRMSEVDFADVEAAI
FT                   RAAIIDFEPRIMKDSIDVRCVTDATDLEHHNLLALEIRGTLWSVPYPIEFILRSELDLE
FT                   SGHMVLRPTGGL"
FT   gene            204767..206638
FT                   /locus_tag="Vapar_0198"
FT   CDS_pept        204767..206638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0198"
FT                   /product="type VI secretion protein, VC_A0110 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0110 family;
FT                   PFAM: protein of unknown function DUF879; KEGG:
FT                   bpt:Bpet4112 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16861"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX57"
FT                   /inference="protein motif:TFAM:TIGR03359"
FT                   /protein_id="ACS16861.1"
FT                   /translation="MDARLLDYYNRELTYMHELGAEFAQRYPKIAGRLGMRGIEVSDPY
FT                   VERLLEGFSFLTARIQLKMDAEFPRFSQRLLEVVYPNFLAPLPAMAVVQIDGNLNEGSL
FT                   KAGYELPRHTIMRGRMIKGEQTACEFRTGHEVTLWPIRIADASIGPVPAEIAHAMPAVA
FT                   QRARSAITIKLEAVGGTTFAEMPIERLEFFLSGAELHALRVLELAVHHSIGTVCRSGPG
FT                   SKARIVPLGDEAIRHEGFDPEQALLPYDARSFQGYRLLHEYFAFPDRYLFFSVKNLRAA
FT                   ASAMGGTTMEIVILLDRADADLERLVDAKHFSLFCTPIINLVPRRSDRIPVGPGQHEHH
FT                   AVIDRTRPRDFEIFTVERVTGHMASGSEEREFRPFLGSFAADDGDFGAYFSLRREPRLV
FT                   SDRARAQGTRTSYTGSEVYVSLVDQHDAPFPHSLRHITIDALCTNRDLPLLLPTGLESD
FT                   FSLRVSAPVRGIRILRGPSRPYPALAEGALTWRLISHLGLNYLSLTDVDATQGAAALRE
FT                   MLDLYGNLADPAVRRQIQGVRSMALAPVFRRLPEPGPIVFGRGVEIALKIDEVAFSGAS
FT                   PYLFGAVLEQFFSRHVSLNAFTEFALSSLQRGEIARWTPRIGRRPAV"
FT   gene            206635..207801
FT                   /locus_tag="Vapar_0199"
FT   CDS_pept        206635..207801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0199"
FT                   /product="type VI secretion protein, VC_A0111 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0111 family;
FT                   PFAM: protein of unknown function DUF1305; KEGG:
FT                   bpt:Bpet4110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16862"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX58"
FT                   /inference="protein motif:TFAM:TIGR03347"
FT                   /protein_id="ACS16862.1"
FT                   /translation="MSMRTTAELADDSQQAPPAAIEHAAPEHAAAPARRGAAEADPVLW
FT                   AGLVDQPFEHDLFMLLRRLDAHGSHPLLGRAPRPLDEPLRLGQEPSMAFAPSNVSGVDV
FT                   DGDGPPRISIYGFGLFGPNGPLPLHLTEYARERKRHHSDNTLSAFADLFHHRLILLFYR
FT                   AWADAQSVNSLDRPDGHRFVDYVASLMNMGQPGLKARDRIADHARTFMAGHLVRQTRNP
FT                   EGLIQILRLYFDVPVRVEEFVSDWVMLDEREISRIGTSGRNQKLGAGATVGLAVRDAQG
FT                   KFRLELGPLSQREFRDFLPGSKRLQQVVDWVRQYVGIEFAWELRLVLKKQEALGMQLGS
FT                   DQRLGWGSWLGTRLSPTDAGDMLFQPEALYSRSASAASAAAEASSMAL"
FT   gene            207798..210524
FT                   /locus_tag="Vapar_0200"
FT   CDS_pept        207798..210524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0200"
FT                   /product="type VI secretion ATPase, ClpV1 family"
FT                   /note="KEGG: bpt:Bpet4107 putative ATPase with chaperone
FT                   activity; TIGRFAM: type VI secretion ATPase, ClpV1 family;
FT                   PFAM: ATPase AAA-2 domain protein; AAA ATPase central
FT                   domain protein; ATPase associated with various cellular
FT                   activities AAA_5; Clp domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16863"
FT                   /db_xref="GOA:C5CX59"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX59"
FT                   /inference="protein motif:TFAM:TIGR03345"
FT                   /protein_id="ACS16863.1"
FT                   /translation="MTDIRRVSLFSKLNPMLYKALETATAFAKLRGNAYVELVHWLHQI
FT                   LQLQDSDLLRIVKRAGLNLDAVEQDLVRALDRLPHGATSISDISEHVDNAVERAWVYAS
FT                   LRFEATSIRGAYLLAGIVKTPGLRQVLSGISREFDKIVPDVLVAQLPAWTEGSPEDDFD
FT                   AAAAPGQAAPAESHQGDGAAAGGSALAKYASDLTAKARAGELDPVYGRDDEIRQIIDIL
FT                   MRRRQNNPLLTGEAGVGKTAVVEGLASRLAAGDVPPSLKDVSLWVLDPTLLQAGAGVKG
FT                   EFEQRLRQVIDEVEKSPKPIVLFVDEVHTLVGAGGTAGTGDAANLLKPALARGRLRTIG
FT                   ATTWSEYKKYIEKDPALTRRFQTIQVHEPTESKAVVMLRGISAELEKHHGVLILDAALE
FT                   AAVSLSHRYIPARQLPDKAVSLLDTACARVALSQHALPAAIEDLHRRIEVLGIESGIAG
FT                   REAAIGVGEHQRVEDIAAQVAVAQAELDLLEQRRAEESVLVERIVALRKLLSPDAVPVR
FT                   AEAKEEEGDEAEAPVEAEPAPPEPERTPEEIRAELDQAQDKLVQLQGESPLILAAVDAQ
FT                   AVATVVADWTGIPIGRMVRDDAQSVLRLGEILSARVVAQPDALETISRRIRTARARLDN
FT                   PNKPVGVFLLCGPSGVGKTETALALSEALYGGEQNLVTINMSEFQESHTVSTLKGAPPG
FT                   YVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEIFFQVFDKGWMEDGEGRHIDFRN
FT                   TVIIMTSNVGTDLVMQLCEDPTLRPDPEPLAAALREPLLKVFAPALLGRLVVVPYYPLQ
FT                   ADALHRIIRLQLDRIATRLDANHGIALDYDNSAVELVARRCTAIESGGRMIDAILTHTI
FT                   LPRLSEEVIGATVSARKLAGVRLSAAGDDFRYEFSEA"
FT   gene            210545..212878
FT                   /locus_tag="Vapar_0201"
FT   CDS_pept        210545..212878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0201"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; Rhs element Vgr protein; PFAM: Rhs element Vgr
FT                   protein; KEGG: bbr:BB0793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16864"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX60"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ACS16864.1"
FT                   /translation="MARVVRAHTPLGEDQLQFRSMHGTEGLSQLFEFEVDLLSPSASID
FT                   MKAVLGKPMALEIQTAGTPRFLNGQVVRFSMIGREGGTSRHTVYRASVRPWLWYLTRSS
FT                   DNKIFQNKTVVEVLEDVFGDYNFAFEKKLTGTYRQWEHCVQYNETDFAFVSRLMELEGI
FT                   YYYFKHDKNQHTLVLTDDVTMHEPMSGYETINYFAADRDVTEDMEVIDNWQVTAEIRSG
FT                   SYAVDDYNFTTPGADLSGARSMPQPYDHSGYEMYEWLGEYTNPGEGEHYARVRLEEAQS
FT                   MAERSVGHATVRGMAPGYTFSMQNSPRSDDNREYLIVSVNYMLREGGYATGAAPGEYSF
FT                   NFVVQPTSLPFRAPRITQIPRTTGPQTAVVVGPEGEEIWTDQYGRVKVQFRWDRSGRRN
FT                   ENCSCFVRVSHVIAGDGFGAVFTPRIGQEVVIDFVDGRADRPLVVGRVYNPRQMPPFNL
FT                   PGEQTKSGFVTRSTPGGSPETANSLVFEDKMGAEYVALHAERDLNVSVEKNETHDTGGT
FT                   RTTVIVGHESATYKAGEERHITEGAVETIDGGETRTVTGGATETVSGGETRTISDGATE
FT                   TISGGETRTVSGGFTETISGGATETISGGVNSTITGGVTQTITGGVNETISGGLTFMVN
FT                   GGVTSNVLGNHTHVVTGGSTTTTTGPTINNAPDIVDNSDRRTINAGDNTVNAAKEGWWR
FT                   NTDNHGTLEHTGVNVAAVDVNGVKLQFSGVNGQFNGVFINLSVTSIIDAKFKYKLNPVG
FT                   ISTVGLSLKTGYIAVAFKSLFMKA"
FT   gene            213018..213347
FT                   /locus_tag="Vapar_0202"
FT   CDS_pept        213018..213347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0202"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpa:BPP0708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16865"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX61"
FT                   /inference="similar to AA sequence:KEGG:BPP0708"
FT                   /protein_id="ACS16865.1"
FT                   /translation="MAEEKTWQALRGQGVRAQGVVVGISRQANRLTKNGNYGNNEVAAT
FT                   DLLLAYEDAAGNRHEVTVATFIELGLLANFSVGKKIDVIYARDAPDRVAIDRERTPLEI
FT                   PSSAY"
FT   gene            213347..216007
FT                   /locus_tag="Vapar_0203"
FT   CDS_pept        213347..216007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0203"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: bbr:BB0795
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16866"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX62"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ACS16866.1"
FT                   /translation="MKTIKPLRLSILTRPYLRNGAQYLAMTAIAMTNLKGQQQQLVPEP
FT                   EIWKTLTDELGGDTVFDLGMPKDNAEFIVSGFAHTAHQPDKSRCAVSVQVGARKKTLLV
FT                   FGDRFWIDGRATAPQPFDAIRLDWRKAFGGPGFAENPLGIGHDDDIVEGLKVRRVPNIE
FT                   HANGLLWRPGQVPAPAGFGPIDVARPSRMRKMGRDYDEHWKQNLYPGFARDMDWGYFNA
FT                   ASEDQWLALGERGLAGASYEILNMHPEDPVQRGRLPDWQARGFIVREAKNRQLASGIFD
FT                   EVSLRLTTAWFFPHREQVALVYHGSIGIEEDDASDISHVMAAMEEGGSERPLASYRDVL
FT                   IQRCDPENGALYALRDDQLLPPNSIGQWLENSQEEDRDADPLTRNMKVRAERAQAKLAE
FT                   AFKASGGDPAKFALPPPPITTPPKLHEIPAYVQKMKAMVQEQREKLAKGREAIGKAADA
FT                   NAVQSRKLGFDTSTFLAKAEAAKGKGPPRFDPRPFVDGISGVSAAVGAPPAPPESLAEL
FT                   RRVTAEAKRGLLASYRSMAQYQDAADAMPPDESDRARAEIERVLAGSRDFSDMDLTGAD
FT                   LSNMDLHGTRWHRALLEGVDFSNSRLDDADFSEAVLARARLHRTSMRRAIFDRANMALA
FT                   RCEDADFSGARFMKMVLDKMVAKGCNFSDATMEELNFMTVHLERCSFERAAISYAHVLE
FT                   KSVMHGVRFDHARIHKMSWIDCDVNELSFAHAELDSCGWVNTDGAGRLDFSAAHLTTTC
FT                   FVGESSLRKVCFRGAMLRDCSLRGIALDEADFANARIENSDFSGASMHRTNLEGADAKG
FT                   AMFVRSDLTRASLLDADLSGAILQKAVLVSTDLRRANLFRADLSQCLIDDRTLFDGAYV
FT                   EQVKTVPLRKKEKVE"
FT   gene            216004..217080
FT                   /locus_tag="Vapar_0204"
FT   CDS_pept        216004..217080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0204"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   spe:Spro_4190 pentapeptide repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16867"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX63"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ACS16867.1"
FT                   /translation="MTPASVQAMIHGGETIARKQLQALDFRGMDLTGAIFLETDLSDAD
FT                   LSGAKLDASIFKQCKLAGARLDAAHVDRCAFEHCDATGIRMVGATLDGAAFYQCGLAGA
FT                   KLDDANAGVASFANCTLDRASFVNVLSEALVFSETSLDATDFSTTLLHKTVFYRADLRS
FT                   AIFRGSRFDKAVFSEAKLSGQRFNAQKFLLCQFIDAELDGCDFDESMLVQCNFKGAKLE
FT                   GASLNRVHAPQCLFPSAKLDGVGCRGAHFNQSIWVEVQARGADFSDAKLEQCIFQRASC
FT                   SHAVFARADLTYADFSHADLRGADLRGARFLRTKVHRAQQGGTRYGDRGGLLLNDPDLF
FT                   AAEEFSARRLARPGAYPS"
FT   gene            217178..217798
FT                   /locus_tag="Vapar_0205"
FT   CDS_pept        217178..217798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet4111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16868"
FT                   /db_xref="InterPro:IPR021927"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX64"
FT                   /inference="similar to AA sequence:KEGG:Bpet4111"
FT                   /protein_id="ACS16868.1"
FT                   /translation="MVNTIGIVTGVLPGGIYSVQTERRQLLRCARAASCLLRPAVGDTV
FT                   LVTGPDATRLYLTAVAEQADASASRIDVAGDMTLASERGAVTVESSTHIAMRGEQGLSL
FT                   DAPHLRINAEDADCRVDRLQYQGQEAVTTVLSIRVIGRVYEAVMDRLVHLSKTAFRMTE
FT                   DVEHLRAGRIDYEAAETARLHGKNTVVTAKEIVKVDAKQIHMG"
FT   gene            217824..218210
FT                   /locus_tag="Vapar_0206"
FT   CDS_pept        217824..218210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spe:Spro_4188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16869"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX65"
FT                   /inference="similar to AA sequence:KEGG:Spro_4188"
FT                   /protein_id="ACS16869.1"
FT                   /translation="MFANCQMMGMDLAFPDVCKTPPAIPIPYPDFALGPTAIPNAYNIL
FT                   YMCTPAHNMATVTPLTNGDNAGVAMGVVSQTVMGQSRHLTGAFTVLLKGTPATRMTSLT
FT                   LQNSTNMVGMRIVPSQFKVLMLAA"
FT   gene            complement(218230..219039)
FT                   /locus_tag="Vapar_0207"
FT   CDS_pept        complement(218230..219039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0207"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="SMART: protein phosphatase 2C domain protein; KEGG:
FT                   esa:ESA_03927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16870"
FT                   /db_xref="GOA:C5CX66"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX66"
FT                   /inference="protein motif:SMART:SM00331"
FT                   /protein_id="ACS16870.1"
FT                   /translation="MLETTPRAFAVPISTSQFSCVGERSGNQDAIGYHLDEYSACFVVS
FT                   DGVGGNAGGELAARIAVDTALNTFVDNPSVAQHDILQAVKAANDAILAKQRELADQSRM
FT                   SATIVSLFVDRTSGQACWAHVGDSRLYWFRRGALMQRTEDHSLSERSGEAALGNGANGG
FT                   ERLVKTNLLYRALGARATAETTVSTPQRLADGDAFLLCTDGLWQLISQQVMERSLQLAD
FT                   SAEEWLALLRRAAEAKADESRDNYSALAVWVGFPQQVTLAGTARPAA"
FT   gene            complement(219032..220969)
FT                   /locus_tag="Vapar_0208"
FT   CDS_pept        complement(219032..220969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0208"
FT                   /product="FHA domain containing protein"
FT                   /note="TIGRFAM: type VI secretion system FHA domain
FT                   protein; PFAM: Forkhead-associated protein; KEGG:
FT                   spe:Spro_3006 FHA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16871"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX67"
FT                   /inference="protein motif:TFAM:TIGR03354"
FT                   /protein_id="ACS16871.1"
FT                   /translation="MRWTVIEHAGKPVAAGPSALLAAPGGTIGRSPDNHLVLPDEQRQI
FT                   SRLQATVRFDDSGAAVLRNMSAVLPIGVNERTLQHEQEAPIAEGDRVTIGSYVLVAGSG
FT                   QRTAPVEPAAPLMAAAPPPAAPVHSALPASTMAPAPMDSLLPAAPVSDVFSDLFGAGAL
FT                   PIGETQPVTVAMPPPTVPAPPPAQVLAAAPVPAASPSPAPSPASAQASTQASASQIPSA
FT                   ADWDAILANAPRREASASEPMPDPMAHEPFELPSQARRNPVDPLAELNPRAEDSMSDVA
FT                   LKRGMDPLSFFAADNDAPSPLSDPRPTALTHEDPLSDVHPAIDLLARPAAAPQGYSHSN
FT                   HARELAAQFRPPNPVPFDPPAAKPAEPRVSAQVEPPPSAPPPPPPPPPPPPPPPPPPPP
FT                   APVPVAAPRVENVAPPAPQQPKPVAAPSPVAATPVPVAAPPSAPASSDELFRAFLEGAG
FT                   VPDVAGQQPLDAEAMRRLGRLMRAFTDGTIELLSSRAMLKREVRAEITMIVDEENNPFK
FT                   ILPNGRAVLMQMFGARMPGFLSPEAAVHDALGDLQSHQLGMVAGMRAALLTVLKRFDPA
FT                   ALNTATPHDGGLGEKLLPGGREARLWRQLQKLHAETTAAVEDDFQAVFGRAFQQAYDKE
FT                   MERLKEARRA"
FT   gene            complement(221013..221417)
FT                   /locus_tag="Vapar_0209"
FT   CDS_pept        complement(221013..221417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16872"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX68"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_B1596"
FT                   /protein_id="ACS16872.1"
FT                   /translation="MKSCLPALAFTLVLVAGCTTTPPPEPPQPERLSQQVARSTLERAQ
FT                   QAYDEGDYAKAITTLKSGGVSVFDAAEPATRLEAMKLEAFSYCVANQVPECRAQFRKLI
FT                   DAFPNFDLTVAERKHPVWGPAFEAAKRMKR"
FT   sig_peptide     complement(221355..221417)
FT                   /locus_tag="Vapar_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.646) with cleavage site probability 0.398 at
FT                   residue 21"
FT   gene            221594..222064
FT                   /locus_tag="Vapar_0210"
FT   CDS_pept        221594..222064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0210"
FT                   /product="type VI secretion lipoprotein, VC_A0113 family"
FT                   /note="TIGRFAM: type VI secretion lipoprotein, VC_A0113
FT                   family; KEGG: bpt:Bpet4105 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16873"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX69"
FT                   /inference="protein motif:TFAM:TIGR03352"
FT                   /protein_id="ACS16873.1"
FT                   /translation="MLGGLSGCASTAKSLPTPYAVTIKIDDGVNPDGRGQPAPILVKVF
FT                   ELKSSGNFETADYFALQDRDRETLAAELVNADQAIMRSGEERVFKREAGLDSRAIGIIA
FT                   GYRKLEAARWRIVLPLKEPKQTNLYKVWQFSPSEQNVRIAIRKSGIELLPSR"
FT   gene            222227..223603
FT                   /locus_tag="Vapar_0211"
FT   CDS_pept        222227..223603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0211"
FT                   /product="type VI secretion protein, VC_A0114 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0114 family;
FT                   PFAM: protein of unknown function DUF876; KEGG:
FT                   bpt:Bpet4104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16874"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX70"
FT                   /inference="protein motif:TFAM:TIGR03353"
FT                   /protein_id="ACS16874.1"
FT                   /translation="MTVRNPGAGKQGALPQALANRVVWSEGMYLRPQHFQQLERYVEQY
FT                   VTRRTAGLQGAYWGWLSLDIDRDAHALGRVSLLGGAGVLPDGTPFSFGAEDAPLPYEVP
FT                   SDLTDELIVLALPLRRTGSEEVIFADDEGSAARFGVIEREVADGNSVALGPAVLQLAKP
FT                   RLRLARASSLTAEWQAIGAVRVIERRTDHKLVIDANYIPPVLDASAHPMLRSMVAELHG
FT                   LLTQRSEALASRLSQPGRGGVSEVSDFLLLELVNRYLATTWHAQHAVQVHPEELFIDWF
FT                   KLACHLATHTSPTRRPVVWPKYDHDNLNETIRPLMEELRRSLSAVLEQSAIAIELEERS
FT                   HGVRVGRMPDPVLVRNAGFVLAVHANLPADAIQQRFPTQVKIGSVERIRDLVQLQLPGV
FT                   TVRPLPVAPRQIPYNAGYHYFELDKSGDMWRQLEKSGGVAMHLAGDFPGLAMEFWAIRP
FT                   "
FT   gene            223612..224994
FT                   /locus_tag="Vapar_0212"
FT   CDS_pept        223612..224994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0212"
FT                   /product="type IV / VI secretion system protein, DotU
FT                   family"
FT                   /note="TIGRFAM: type IV / VI secretion system protein, DotU
FT                   family; type VI secretion system OmpA/MotB family protein;
FT                   PFAM: OmpA/MotB domain protein; KEGG: bps:BPSS2105
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16875"
FT                   /db_xref="GOA:C5CX71"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX71"
FT                   /inference="protein motif:TFAM:TIGR03349"
FT                   /protein_id="ACS16875.1"
FT                   /translation="MNGVNDMAVGPGGFVPPNPGGGANNNGGNGDAAGMPPASRGAGQQ
FT                   QPQSFTAWHDARRPHAGDTALAGNNPLVAAANPLLDLIPQIRATGHHDAPAQLREHLVD
FT                   EVRRFETRAQQSGIAPEVIIGARYCLCTAVDEAAALTPWGGSIWSSQSLLVMFHNETWG
FT                   GEKFFQLLSRLVQNPQQHLQLIELIYFCLAMGFEGRFRVIDNGRTQLETLKQRLLQIIR
FT                   QTRGEIAVPLSPHWQDASAPVRRTRNWVPLWAVGAVAAVLLVLVFGVLTFSLAGRSDGA
FT                   FAAVNAVRLPQTQRAVAVAPAPQPRLQRFLEPEIRDGLLTVRDEADRSVVVLRGDGLFA
FT                   SGSDRVLDRYAPVLARVADALNSVEGNVLVSGFSDDQPIRSVRFPSNWQLSQARADAVK
FT                   KMIATRVTRPERLRAEGRGDADPLVPNDSPANRARNRRVEVTLLVAPVAAGAAPAPQGG
FT                   TR"
FT   gene            224994..228629
FT                   /locus_tag="Vapar_0213"
FT   CDS_pept        224994..228629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0213"
FT                   /product="type VI secretion protein IcmF"
FT                   /note="TIGRFAM: type VI secretion protein IcmF; PFAM: ImcF
FT                   domain protein; protein of unknown function DUF1215; KEGG:
FT                   bpt:Bpet4102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16876"
FT                   /db_xref="GOA:C5CX72"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX72"
FT                   /inference="protein motif:TFAM:TIGR03348"
FT                   /protein_id="ACS16876.1"
FT                   /translation="MLRAIFRFLVSRDLWVFLGLLAVAFLIWIIGPVIAVGRYRPFESE
FT                   FVRIVVIALMFAIWIARVLYRKWRERRLNAQLLNQLRTPSPKEKAAKPEDAPEIKELQS
FT                   GFTDATSILKNMRFGADAGGKPAGRFALFDRQYLYQLPWYIFIGAPGSGKTTALVNSDL
FT                   DFPLADQLGKAAVRGIGGTRNCDWWFTNEAVLIDTAGRYTTHESNRETDEGEWKGFLDL
FT                   LKKFRPRQPINGAILTISIADLPLADDAQRARHAMALRKRLLELRNGLGINFPVYVLVT
FT                   KTDLLAGFNEYFGALGRAERSQVWGFTFPIDANPADPAKADLRERFHQEYKLLHQRLDE
FT                   RLPELLAAEPDQLRRAQAYLLPQQFASFEDILGTFLADVFNPSKFEVAPMLRGVYFTSG
FT                   TQEGTAFDRVMGAIKRYLQVNAPPAPPPGPGKSYFLKELLQQVIFRDAGVAGTNLRWYR
FT                   RKRAIDLAGYGLIGVLLVVVLGACVNSWRNNRDYVAEVDTNAKAFNKAAARGELPTVVD
FT                   SNSDIASSLPVLDRLRDLPKSSHFDIGDPPMGYRFGLYQGEKLQAATDGVYQRALEGVL
FT                   LPQAAQRVEQALREASKTDAEYSYEALKAYLMLYDAERYDADFLQAWLLTDVDRKIGAG
FT                   LTREQRTNLESHLKALFAERVVTSPFAKDDRLVTETRNRLAGVPLAQRAYARLRRILLQ
FT                   TSPPNAFSIAEAAGAESALVIKRTSGKPLTDGIPTLFTYRGYWDIFDKRMAETTLALEQ
FT                   EDRWVLQIRAPGMADITSRELLLREVRRLYLTDYIRVWDDYLLDVRLADSRSLLQSIQM
FT                   TRVLSTSESPMSRLIRGAARETDLLRNHDEATRSLLDQAQNRVASTRERIEQLIGQPDG
FT                   SQRRNTVPDRPESLVDNHFAPLRRMVTAPKAGGQAPIDATAALINELYTFLTATDTALR
FT                   SGNIPPSSDAVTKVQAEAGRLPVPFQGMLNDLSATASSKAAAVTRQNIGQNAAATIGQF
FT                   CSQAIAGRYPFSRGSNRDVAAGDFAQLFAPGGMMDDFFQKNLASQVDTSVNPWAFKKGV
FT                   DGSSPGRSAYLDSFQKAQAIRDVFFSGMAGGRTPSFTIDIRPEDMDAAISQFTLDIDGQ
FT                   TVRYAHGPQAPSTVKWPGPRNSNQVRLQVTTASGTPAGGIVTEGPWALHRLFDKASISS
FT                   GSAPESFNATFDLQGKKVVLAVTANSVYNPLRLHQMNGFSCPGKS"
FT   sig_peptide     224994..225101
FT                   /locus_tag="Vapar_0213"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.916 at
FT                   residue 36"
FT   gene            228631..229356
FT                   /locus_tag="Vapar_0214"
FT   CDS_pept        228631..229356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0214"
FT                   /product="type VI secretion-associated protein, BMA_A0400
FT                   family"
FT                   /note="TIGRFAM: type VI secretion-associated protein,
FT                   BMA_A0400 family; KEGG: bpt:Bpet4101 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16877"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX73"
FT                   /inference="protein motif:TFAM:TIGR03373"
FT                   /protein_id="ACS16877.1"
FT                   /translation="MNSGIPSPRVWVPDDEQIGWYGKLPAAGDFLYRRVPRELQAWWDR
FT                   WMQNGLGTFKRWPDAMTRHYVVAPVWNFAIPATQGVDAVQFGCLAPSCDRVGRYYPVCV
FT                   TLQVAASSYRPSMLEGSAAWYWQCGTALLQAIRHSVAPDQFDRQVLAAAHGGFQTASGG
FT                   SDDILSILGPAAGGAGATGAQQRLGWPELPLCFDAFGSTSYWWTNQADGSPLRTAAHGG
FT                   GLNTPLFSKLFSQGHVPWA"
FT   gene            229388..231559
FT                   /locus_tag="Vapar_0215"
FT   CDS_pept        229388..231559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0215"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: tyrosine protein kinase; SMART:
FT                   serine/threonine protein kinase; tyrosine protein kinase;
FT                   KEGG: bur:Bcep18194_B1590 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16878"
FT                   /db_xref="GOA:C5CX74"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX74"
FT                   /inference="protein motif:PFAM:PF07714"
FT                   /protein_id="ACS16878.1"
FT                   /translation="MTTNASNDNSNGSASMQADPQERPHPLDAGHRLDEFELLEVIGEG
FT                   GFGIVYRAYDHSLQREVAIKEYMPSMLARRVGDDSVHVRSDRLTATFQAGLRSFINEAR
FT                   TLAQFSHPALVRVHRFWEANSTAYMAIQLYRGRTLRRLAEEEPKKISEAWLLSMLGPLL
FT                   GALETLHRSQCFHRDIAPDNIFIQQDDLPVLLDFGAARKSIADLVDEVAVMVKSGYSPI
FT                   EQYADDNTLLQGAWTDLYALGAVLYRAVTGHPPPSAVVRSVQDAYVPLSSLGRSDLSPA
FT                   FCAAVDHTLAVHSKDRTQTVAAFAAELGLAKLGDTYVSGLAAPMAVIAPPPPSKAAPAV
FT                   APVPQQAPAASAAPQASAPAAAAAAQATASASAVRPGAAASEPVEPKPKPQPASKAEPP
FT                   SSSPKPAAPREAAAAPVRPPSAAGKPQPQPAPTGKKSSRPPWGLVGVLLIALVAVGSWI
FT                   GLHLTSGRQETSTAMVPVPPPSGPMSATSPPPAAMPPGEGAAGGSSSAPAGENVAAAPG
FT                   TPPPAAAASAPAGPLTPLTNVPVGAAPAAAPATPDPAATPPGATPTPVPPPEAAMATAE
FT                   AEDWNLAQAENTREGYEAYLRRYRRGPHARDARNAIAELNRLAQAVPAAPGTAPTNPVP
FT                   TVIAGGPTPPTAPPAAPPGMGRVVLNIRPWGQVFVDGAERGVSPPLKSLSLRPGIYNIE
FT                   VRNGDLDVYRQRVTVQDSKSAPVVSHEFK"
FT   gene            complement(231588..233141)
FT                   /locus_tag="Vapar_0216"
FT   CDS_pept        complement(231588..233141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0216"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: aav:Aave_0231 Mg chelatase, subunit ChlI;
FT                   TIGRFAM: Mg chelatase, subunit ChlI; PFAM: magnesium
FT                   chelatase ChlI subunit; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16879"
FT                   /db_xref="GOA:C5CX75"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX75"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ACS16879.1"
FT                   /translation="MSLSLVQSRALLGLEAASVTVEVHLANGLPSFTLVGLAETEVKEA
FT                   RERVRSAIQNAGLEFPNNKKIVVNLAPADLPKDSGRFDLPIALGILAASGQIQPALLAG
FT                   HEFAGELSLSGELRPVRGALAMALALHTRGIATRLVLPAASAQEAALVPGSEVYGARHL
FT                   LDVVQRFMPEGAALPQGEEQQQQQPATDGWARVHAAAAAPAPLYADLADVKGHAGAKRA
FT                   LEIAAAGGHSLLMVGEPGSGKSMLAQRFAGLLPPMSVDEALESAAVASLAGSFSAARWM
FT                   NRPTSAPHHTSSAVALVGGGSPPRPGEISQAHHGVLFLDEFPEFARSALEALREPLETG
FT                   TITIARAARRAEFPARFQLVAAMNPCPCGYLGSTLKACRCTPDQISRYQAKLSGPLLDR
FT                   IDLHIEVPAVSAQQLIDAPPGESTASIRARVVAAREFALQRQGGPNQALQAGAIDKHAA
FT                   LDDAARKFVYNAAAKLGWSARSTHRALKVARTVADLAGAESVGVVHVAEAVQYRRALRN
FT                   "
FT   gene            233359..234183
FT                   /locus_tag="Vapar_0217"
FT   CDS_pept        233359..234183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dia:Dtpsy_0180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16880"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX76"
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0180"
FT                   /protein_id="ACS16880.1"
FT                   /translation="MMHRKFAQAMAVAALAALPMLASAQLTGNVALTSNYKFRGQDQDM
FT                   IGKNDYAKTKGFKPAIQGGFDYAFGETGFYVGNWNSSVNWLKGNSIESDIYGGYKFKAG
FT                   PFDMDVGALTYIYPGNSAGNTTELYGAGTWADEAIGSFTLKYSHTVSKDYFGYAGNKAG
FT                   SGLKGTNTGYLNLAYSKEIVPKLTLKAAVGYTHMSSDIRSLGYKSYVDYNVGVSYDFGS
FT                   GLALAGSIQGANKKSSYLAVSNPGVDLGFGTFGQTTYSPNKARFIVTLSKTL"
FT   sig_peptide     233359..233433
FT                   /locus_tag="Vapar_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 25"
FT   gene            234254..234592
FT                   /locus_tag="Vapar_0218"
FT   CDS_pept        234254..234592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0218"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   pol:Bpro_0183 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16881"
FT                   /db_xref="GOA:C5CX77"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX77"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ACS16881.1"
FT                   /translation="MKLVTAIIKPFKLDEVREALSAIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKIEAAVSDDLVDRVIEAVEGAARTGKIGDGKIFVYNLEQVVRIRT
FT                   GETGREAL"
FT   gene            234849..236147
FT                   /locus_tag="Vapar_0219"
FT   CDS_pept        234849..236147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0219"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: mpt:Mpe_A0172 putative
FT                   ammonium transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16882"
FT                   /db_xref="GOA:C5CX78"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX78"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ACS16882.1"
FT                   /translation="MMLSTLLVIMMTVPGLALFYGGLVRSKNMLSVLMQVMVTFSMIVV
FT                   LWLIYGYSLAFTEGNAFFGGFDRLFMKGIFDPATGVFAPGATFSKGVYIPELLFAAFQA
FT                   TFAGITCCLIVGAFAERAKFSAVLLFMVIWFTFSYAPLAHMVWFWMGPDAYTAANVVDA
FT                   QNAKAGLIWQWGALDFAGGTVVHINAAVAGLVGAFVIGKRVGYGKEAFTPHSLTLTMVG
FT                   ASLLWVGWFGFNAGSALEAGTSAVLAFMNTFTATAAAVLAWCIGEALMRGKASMLGAAS
FT                   GAVAGLVAITPAAGNVGLMGAIIIGFIAGFACLWGVNGLKKLLGADDSLDVFGVHGVGG
FT                   IVGALLTGVFNTQALGGPGLVGDWVTASVVSNGIGAQVWIQLKGVLLTIVWSGVVSFIA
FT                   YKIADLTIGLRVSEEEEREGLDISSHGETAYNR"
FT   gene            236419..237354
FT                   /locus_tag="Vapar_0220"
FT   CDS_pept        236419..237354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0220"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: pna:Pnap_0122 SMP-30/gluconolaconase/LRE
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16883"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX79"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ACS16883.1"
FT                   /translation="MWTSIDNSLCELGESPFWHPRERALYWLDIPGRAVLRTRGDIGTD
FT                   SAKVERWALSTEPGCMAPARNGGLVIALRDGIYRAREWGGELVAIARVDHDVRTMRFND
FT                   GKCDALGRFWSGSINEAKDRANAALYCLDARPGSGVAPALTQMANQVTTANGLAFSPDA
FT                   RTLYWADTPAHQVRAWNWDAAANTLSQPRVFHQFDAKPEGWTPDSLALRYEGRPDGATV
FT                   DAQGHYWVAMFEGAQLLRLAPSGEIVAAVPVPAQCPTMPCFGGDDLKTLFVTTARKGRP
FT                   AAEIERLPASGTVISMRVDTPGLPVSFFEN"
FT   gene            237698..238579
FT                   /locus_tag="Vapar_0221"
FT   CDS_pept        237698..238579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0221"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: lch:Lcho_3308 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16884"
FT                   /db_xref="GOA:C5CX80"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX80"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS16884.1"
FT                   /translation="MALQHIPPIQCLLTFEAVARLRHAGRAADELCVTASAVSHRIRQL
FT                   EAHVGFKLFGRGDFSLTADGAAYLANVRTGLAALQATPLGNAATRATRLRIAVTPTFSR
FT                   VFLMPRLELFRNIYPDIELVLQVSIPLLDVTAEQADLEVRYGSGAYADCEHRLLLEEEV
FT                   VPACSPSYLNEFGPFDGFCTAAEIASARLIRSPLEPWGTWFASCGLDQPEPHVGSQFND
FT                   LGLVYDAAASGFGVALVRQKMGAAWFESGRLVPLSDRPVPSPHRHTICWQPGTLDRWEC
FT                   AAFADWLAQSLR"
FT   gene            238713..240221
FT                   /locus_tag="Vapar_0222"
FT   CDS_pept        238713..240221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0222"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   aav:Aave_0645 FAD linked oxidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16885"
FT                   /db_xref="GOA:C5CX81"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX81"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACS16885.1"
FT                   /translation="MNAPLTAAQHDSLLQKKTDRQSQIVRALQAHLPAHALIWHAEDTT
FT                   PYECDGLTAYRQRPLVVALPETEAQVAAVLKTCHPLGVPVVARGAGTGLSGGAMPHALG
FT                   VTLSLAKFNRILKIDPVSRTAVVQCGVRNLAISEAAAPFNLYYAPDPSSQIACTIGGNV
FT                   AENSGGVHCLKYGLTLHNVLRVRGFTAEGEPIEFGGEALDAPGLDLLALVIGSEGMLAV
FT                   TTEVTVKLVPKPQVARCIMASFDDVRKAGDAVAAVIAAGIIPAGLEMMDKPMTAAVEDF
FT                   VHAGYDLDAAAILLCESDGTAEEVEEEIGRMTAVLRSCGATAIAVSSSEEERMKFWSGR
FT                   KNAFPASGRISPDYMCLDSTIPRKRLADILLAIQQMEKKYGLRCCNVFHAGDGNLHPLV
FT                   LFDANDPDELHRCELFGADILETSVAMGGTVSGEHGVGVEKLNSMCVQFTAAENEQMFG
FT                   VKRAFDPAGLLNPGKVIPTLQRCAEYGKQVVRGGRLPHPELPRF"
FT   gene            240251..241357
FT                   /locus_tag="Vapar_0223"
FT   CDS_pept        240251..241357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0223"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   dac:Daci_0304 FAD linked oxidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16886"
FT                   /db_xref="GOA:C5CX82"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX82"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ACS16886.1"
FT                   /translation="MEPALRQIAERIRAAAADATPLRIRGGGTKDFYGEALQGDVLDTT
FT                   ALAGITSYEPSELVVTVRAGTPLAELEAALAEEGQCLPFEPPHFASNSTVGGMVAAGLS
FT                   GPARASVGAVRDYVLGATLVNGRGDILSFGGQVMKNVAGYDVSRVLAGSLGTLGVIAEV
FT                   SLKVLPVAPAEATLEFACSQADALRLLNEWGGRPLPLNASCWFEQAGAGVLQLRLRGAV
FT                   AAVEAACAHLGGERRDNAQAAAHWQALRDQQLPWFGTGVNALWRLSVPQTASALAWDGD
FT                   GAAPLVEWHGGQRWYQAPPAQAARIREAAHAAGGHATLFRMPAGQAADSRVPRFDALSA
FT                   PVARIHQALMHEFDPHRIFDRARLLAGA"
FT   gene            241381..242613
FT                   /locus_tag="Vapar_0224"
FT   CDS_pept        241381..242613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0224"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: dia:Dtpsy_0186
FT                   protein of unknown function DUF224 cysteine-rich region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16887"
FT                   /db_xref="GOA:C5CX83"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX83"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACS16887.1"
FT                   /translation="MQTELAPEFRGTDEGREAEAILRKCVHCGFCTATCPTYQLLGDEL
FT                   DGPRGRIYLIKQVLEGKAPTRSTQLHLDRCLTCRNCESTCPSGVQYGHLVDIGRKIVDE
FT                   KVPRPAMESATRWLLKEGLPSPLFGPAMKLGQSVRGLLPDSLKAKVPARQEAGAWPTAT
FT                   HARKVMMLAGCVQPSMMPNINSATARVLDAAGIQAVVAPEAGCCGAVRFHLNDQEGGKA
FT                   QMRANIDAWWPMVERNEVEAIVMNASGCGVTVREYGHILQHDPAYAAKAARISELTRDL
FT                   SELLPDLVPVLKARVHAPQGVAAYHPPCTLQHGQKLRGGVETHLRALGFDVRVAMNESH
FT                   LCCGSAGTYSVLQPELAYPLRDRKLGHLAQLQPSVIASANIGCITHLQSGSQQTPVRHW
FT                   VELLDAALAAA"
FT   gene            242703..243137
FT                   /locus_tag="Vapar_0225"
FT   CDS_pept        242703..243137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_2835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16888"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX84"
FT                   /inference="similar to AA sequence:KEGG:Aave_2835"
FT                   /protein_id="ACS16888.1"
FT                   /translation="MSSVQAASTVPKKHLRRALLALACAAGAVGAQAQSAMPQWKGEGA
FT                   VRYVCGGIGSDESTAMRAAMKDHPLALLFARSDGAYLADVQVDIRGADGAPSLALRASG
FT                   PVCLVDLPAGRYTIDAAMAGSAKSQAVTVGSGSKTVDFRF"
FT   sig_peptide     242703..242804
FT                   /locus_tag="Vapar_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.901 at
FT                   residue 34"
FT   gene            complement(243150..243641)
FT                   /locus_tag="Vapar_0226"
FT   CDS_pept        complement(243150..243641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0226"
FT                   /product="Peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /note="PFAM: glutathione peroxidase; KEGG: pna:Pnap_0128
FT                   glutathione peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16889"
FT                   /db_xref="GOA:C5CX85"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX85"
FT                   /inference="protein motif:PRIAM:1.11.1.15"
FT                   /protein_id="ACS16889.1"
FT                   /translation="MTTSIYDFEANRIDGKKVKLSDFRGKVLLIVNTASQCGFTPQFAG
FT                   LEQLHEKYASQGLVVLGFPSNQFGSQDPGTNEEIGAFCTTNYGVSFPMMEKIDVNGGNA
FT                   APLYQWLTKEKPGLLGSTAIKWNFTKFLVGRDGRVRKRYAPLDTPASIAREIEAALAAG
FT                   "
FT   gene            complement(243655..244545)
FT                   /locus_tag="Vapar_0227"
FT   CDS_pept        complement(243655..244545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0227"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rfr:Rfer_0486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16890"
FT                   /db_xref="GOA:C5CX86"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX86"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS16890.1"
FT                   /translation="MPALALIFNAFVWGVSWFPFRHIESHGLHPVWTTCIIYVAISLAM
FT                   GFFRRHAWRGFAAYPMLVLLGLAAGFTNLGFNWAVTQGDVVRVVLLFYLMPLWSVLLGW
FT                   AVLGERPTGGALARVALALTGVAVVLKTPGVEWPVPSSLPDWLGLAAGFSFAVTNIVLR
FT                   HLRDAPGESRALAMFCGCAAVAGIAAAAGTLLGDFGSPLAAEPGWIGWAALLGTGFVLA
FT                   NICLQYGAARLAASATAVIMLSEVLFASVSSVALGAAQMDPRILAGGALIVLAAVWSAF
FT                   ARTPAQGDDRLSSPT"
FT   gene            complement(244661..245965)
FT                   /locus_tag="Vapar_0228"
FT   CDS_pept        complement(244661..245965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0228"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_0192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16891"
FT                   /db_xref="GOA:C5CX87"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX87"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS16891.1"
FT                   /translation="MKRGFYTIMSAQFFSSLADNAIFVVAVELMRSTGAAEWQRAALVP
FT                   IFAVFYVVLAPLVGAFADALPKGRVMFISNAIKVVGCLMMLFGSHPLLSYSIVGLGAAA
FT                   YSPAKYGILTELLPASQLVKANGWIEGLTIASILLGIVLGGSLVGHAVSSRLLSFDMPL
FT                   IDTGVDSPAEAAISVLIFVYMLAAWFNTRIPHTGVEMRPLRANPAHGLARNMFSLLPDF
FT                   WHCNARLWRDKLGQISLATTTLFWGAGANLKYIVLAWAALALDYNTTQATALTGVVTIG
FT                   MAVGAIVASMRMRLDMATRVIPMGIAMGLLVISMNLIGNVWIAVPFLILLGGLGGFLVV
FT                   PMNALLQHRGHNLMGAGRSIAVQNFNEQACILLLGGFYSACTGLGLSAFAAIGAFGGVV
FT                   AGCMWLIQRWHHHNLRKYPEEVEHLLAIARSDKHH"
FT   sig_peptide     complement(245909..245965)
FT                   /locus_tag="Vapar_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.681) with cleavage site probability 0.645 at
FT                   residue 19"
FT   gene            246138..247238
FT                   /locus_tag="Vapar_0229"
FT   CDS_pept        246138..247238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0229"
FT                   /product="alanine racemase"
FT                   /EC_number="5.1.1.1"
FT                   /note="KEGG: pol:Bpro_0193 alanine racemase; TIGRFAM:
FT                   alanine racemase; PFAM: alanine racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16892"
FT                   /db_xref="GOA:C5CX88"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CX88"
FT                   /inference="protein motif:TFAM:TIGR00492"
FT                   /protein_id="ACS16892.1"
FT                   /translation="MPRPILATVHTAALRHNLDRARRAAVDARVWAVVKANAYGHGIER
FT                   VYEGLRGADGFALLDLAEAERVRALGWRGPVLLLEGVFDARDLELCSRLDLWHTVHCDE
FT                   QIDMLAAHKTLKPQRVFLKMNSGMNRLGFAPERFGSAWTRLNALPQVDEISLMTHFSDA
FT                   DGARGIAHQLEVFERATHDLLGERSIANSAATLRHARQTRGDWVRPGIVLYGSAPDFPE
FT                   HDAAHWQLQPTMTLSTKLIGIQTLKAGDTIGYGSNFTAEGPLTIGVAAVGYADGYPRHC
FT                   NTGTPVLVNGVRTRMVGRVSMDMITVDLTPVPEAKFGTEVTLWGRSAVSGAVLPIDEVA
FT                   QAAGTVGYELMCAVAPRVPFAPADGE"
FT   gene            247235..247969
FT                   /locus_tag="Vapar_0230"
FT   CDS_pept        247235..247969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0230"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_0132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16893"
FT                   /db_xref="GOA:C5CX89"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX89"
FT                   /inference="similar to AA sequence:KEGG:Pnap_0132"
FT                   /protein_id="ACS16893.1"
FT                   /translation="MKVLSNWRSVRLWETQLERELHRNYSLRTHGILIGSFTLLLMWGV
FT                   SALQMHVLDVQSLALRYLLTLGVGYLGYLGVLRWWARRLVENRAGFNVDAGDVVDAGDL
FT                   AFDAAGSPAGGTGGSALSDAASGALEVAGAADEGAVIVVPVVAVFLICVAMVLGAGSLV
FT                   LLYFSWDALLAVAVEVAFSYVSARAAVRVAREGWLMAAVRLTWKPLLGAVVCAVALGAV
FT                   LDHFMPQVNSLPEAVRVLLKKH"
FT   gene            complement(247971..248867)
FT                   /locus_tag="Vapar_0231"
FT   CDS_pept        complement(247971..248867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0231"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rfr:Rfer_3620 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16894"
FT                   /db_xref="GOA:C5CX90"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX90"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS16894.1"
FT                   /translation="MVTFLRVAELGSFSAAADLLGMTPSAASRQVKRLEKEIGAQLIQR
FT                   TTRQLRLTEPGVEALARCRELVLAAQGAMDVAQRFSKKPSGLVRISAPKAFARRVLHPH
FT                   ILDFLQRHPEVDVQLIVEDRDIDPIREGVDLVVRLTTKPPEGLVARQLMPVAHILCASP
FT                   RYLAQGAAIAHPRDLLAHSCLSLGEHERDNHWCFRKGDEDEAEVVVRGRYVSNHSEVRL
FT                   EAALAGLGVACVPAFMAQQALKDGSVMRVLADWEFQGNYHGHAYILYPPSRFTVPKCRV
FT                   LIDHLLDALATQRGRRK"
FT   gene            248998..249954
FT                   /locus_tag="Vapar_0232"
FT   CDS_pept        248998..249954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0232"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rfr:Rfer_3621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16895"
FT                   /db_xref="GOA:C5CX91"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX91"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS16895.1"
FT                   /translation="MDSKQVLGTASGAWGERRWAGVGAAEVMLLAVAAVWGGSYAVAKQ
FT                   ATQQLPVLEFIALRFGLTFVVLLPALRPLFDAQWRQGLAVGGLLGANLLAIFVCETFGV
FT                   SLTAASNAAFLISLCVALTPFVEWWLLGRRPEPRMFWAAGLSAVGAAMLSATSPASISV
FT                   GWGDGLMVIAAFLRAVMVCMTRRFAGRHSMPALTLTAVQSGMMALGAMALSLVASKGAW
FT                   HMPPATASFWWGMAYLVLLCTVFAFFAQNHAASHSSPSRVSLLMGSEPVFGALIAVYGF
FT                   GETVGAWGWAGGLLIVMAAWWVTMPQSTAPRAHSVNL"
FT   gene            250019..250837
FT                   /locus_tag="Vapar_0233"
FT   CDS_pept        250019..250837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0233"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smt:Smal_0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16896"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16896.1"
FT                   /translation="MNLKKRPPAAFACGIALAIGGFSAHAVEPEASTTPFATSAADAPA
FT                   TPPPSPVALGAQEAAAPQTRLRFTRGVYKPGIERLRVVRREDTGNRIAGQVALNVVTTL
FT                   IAGGLSIGAQGFSKDDLGGVTLEELKDDPLAVNPAITELNDALSKVATDIYRKRAEAAY
FT                   ATALTDGSTPEEIEEARKVQKEADTPLNSGPWHLVYENLTGSDELFRLKFGAELGRAGF
FT                   MRPPFACLYQSEPVAWTQWKADNWQRLREERAKAVTSCTETLAATPEKRW"
FT   sig_peptide     250019..250099
FT                   /locus_tag="Vapar_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(250853..251830)
FT                   /locus_tag="Vapar_0234"
FT   CDS_pept        complement(250853..251830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0234"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: pol:Bpro_0197 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: Ketopantoate
FT                   reductase ApbA/PanE domain protein; NADP oxidoreductase
FT                   coenzyme F420-dependent; NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16897"
FT                   /db_xref="GOA:C5CX93"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX93"
FT                   /inference="protein motif:TFAM:TIGR00745"
FT                   /protein_id="ACS16897.1"
FT                   /translation="MKICIYGAGAIGGWIGASLAQAGERLNVVARGTTLEALRQDGLSL
FT                   MRGDVRTRVPVNAVAHPEALGTQDLVVIAVKAPALAGVAERIGPLIGPDTLVLVAMNGV
FT                   PWWFLEGGFGGAITGHRLAAVDPDGAIARAIPSRNVIGCVVHASCSLDAPGVVRHHFGN
FT                   GLIVGEPSGEATPRAQKLVALLQRAGLDATLSPQIQKDVWFKLWGNMTVNPISALTGVT
FT                   TDLIMGDDYVRGFISAVMLEAKEIGHRIGIEITQSPEDRHAVTMKLGAFKTSMLQDVEA
FT                   GRSVELDALVTVVRELGELTAVATPFTDALLGLARLKMRKLGLY"
FT   sig_peptide     complement(251762..251830)
FT                   /locus_tag="Vapar_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.882 at
FT                   residue 23"
FT   gene            complement(251832..252629)
FT                   /locus_tag="Vapar_0235"
FT   CDS_pept        complement(251832..252629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0235"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: bxe:Bxe_B1223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16898"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX94"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ACS16898.1"
FT                   /translation="MNTTLATRVPPSAPVHPSIHPDERAAREQLAACYRVFAMLGWTEM
FT                   IYNHITVRLPDSVTGGEKQFLINPFGLHYSEVTASNLVKIDLQGKVLDGSAWPVNPAGF
FT                   TVHAAIHDGLPGAHCVMHTHTTAGVAVACLQGGLQQTNFYTAQLHGMVAYHDFEGITIH
FT                   ADEGPRLLRSIGDRNAVILRNHGLLAWGQTLPQTFAILWTLQRACEIQMATFSMGAAIP
FT                   VSEEIAQRCTRDALQFSPEHGAGQDVFDALVRQVDRIDASYKN"
FT   gene            complement(252650..253639)
FT                   /locus_tag="Vapar_0236"
FT   CDS_pept        complement(252650..253639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   dac:Daci_2451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16899"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX95"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACS16899.1"
FT                   /translation="MTFTRRQLLQTTGASALLASLGQRAFAQASLETATIVTGFAAGGT
FT                   SDTTCRRLAQKLSPEYAKAAVVENRTGAGGQIAVSYVKGRPADGATILQTPTSILTIYP
FT                   HIYKKLPYDPMVDLTPVSIACIFDFGFAVGPAVPASVKTVPEFLAWAKANPAGANFGSP
FT                   AAGSTPHFIGALLGKKGGVELKHAAYRGTQPAMLDLLGSNISAVSGPIGDITQHLASGK
FT                   VRILGVSGAKRSRFAPDVPTFGEQGIKDMAHSEWFAFFLPAKASPELVAKLNTAMKNAL
FT                   AQKDVIDGLGTFGLEAMSSTPGELTELLKKDTAKWAPIVKEVGFTAEG"
FT   sig_peptide     complement(253556..253639)
FT                   /locus_tag="Vapar_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.901 at
FT                   residue 28"
FT   gene            complement(253671..255407)
FT                   /locus_tag="Vapar_0237"
FT   CDS_pept        complement(253671..255407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0237"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: dac:Daci_2450 dihydroxy-acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16900"
FT                   /db_xref="GOA:C5CX96"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX96"
FT                   /inference="protein motif:PRIAM:4.2.1.9"
FT                   /protein_id="ACS16900.1"
FT                   /translation="MTTPTDPNSKRFRSATIREGTIRATTRSFLHALGQDDEDIARPHI
FT                   GVFHTGGEMSPCNLNLREQAQHAKIGIYAGGGTPHECPVVSVSDGLTMAHSGMRFSLIS
FT                   RELIADSVEASTRGHQWDGIFAIGACDKNLPGLMMGMVRCNVPSVFVHGGSALPGQMPG
FT                   PDGRDLNVVDTYETIGKVLAGTATHDELDAMSRACLPTAGACAGQFTANTMGMVSEALG
FT                   LAPMGSSMVPAVFSERAPLMRRAAKNLMKAVMGDSPLPRDIVTRKALENACAVVSATGG
FT                   STNAALHLPAIAHEAGIKFHLDDVAEVFARTPLIADLRPGGQYLARDVFYIGGAGVILR
FT                   TLMEQGFVHGDALSFTGRTLAEELADAAAPDGRVVRAPGNPITRDGGLAVLKGNLCPDG
FT                   ALLKTAGLQTLVHRGPARVFDSEEQAQAAVQNRRYEAGDVIVIRNEGPKGSPGMREMLG
FT                   ITALLYGQGMGDKVALLTDGRFSGATRGLCIGYAGPEAADGGPIAALQDGDMVAIDARP
FT                   GARTISVELAAEEIALRLSRRQVNAGVAHRGLLEKYALTVRPAHQGAVTHSGAVTWLRD
FT                   ES"
FT   gene            complement(255450..255923)
FT                   /locus_tag="Vapar_0238"
FT   CDS_pept        complement(255450..255923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0238"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   bcj:BCAM2778 putative exported cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16901"
FT                   /db_xref="GOA:C5CX97"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX97"
FT                   /inference="protein motif:PFAM:PF07366"
FT                   /protein_id="ACS16901.1"
FT                   /translation="MQRATLAALSAAATLFLAACAPMGTGKPQAATAQQEANRQAVLAF
FT                   YEKGLNQKDADAALQYVGNRYVQHNPTAADGPEGFRKFIAFLREKFPKSHSDIKRSFVD
FT                   GDFVILHVNAVREPGTRGSAIVDIFKLENGKIVEHWDVVQPVPETAANSNGMF"
FT   sig_peptide     complement(255831..255923)
FT                   /locus_tag="Vapar_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.962 at
FT                   residue 31"
FT   gene            complement(255962..256783)
FT                   /locus_tag="Vapar_0239"
FT   CDS_pept        complement(255962..256783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0239"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /EC_number="4.1.3.39"
FT                   /note="KEGG: rfr:Rfer_0941 2-dehydro-3-deoxyglucarate
FT                   aldolase; TIGRFAM: 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase; PFAM: HpcH/HpaI aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16902"
FT                   /db_xref="GOA:C5CX98"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX98"
FT                   /inference="protein motif:TFAM:TIGR02311"
FT                   /protein_id="ACS16902.1"
FT                   /translation="MQTPLNTFKQAMQAGEQKIGLWVGMADGYVAEILAGTGFDWLLVD
FT                   GEHAPNDVRSVLAQLQGISSAWSAQPEPERSHPVVRVPVGDVTLLKQFLDIGAQTILVP
FT                   MVDTAEQAARMVQGMRYPPEGIRGMGSALARASRWQAYPRYLHEANAQTCLLVQAETVE
FT                   AMKNLDAIAATPGVDGVFIGPADLSASMGFVGQPNHPEVQAMIADAIARIRKAGKAPGI
FT                   LSTTEEQARKWLAAGAQFVAVGVDTILLTAAARQLSSRYKSAASAVTPSGY"
FT   gene            complement(256794..257597)
FT                   /locus_tag="Vapar_0240"
FT   CDS_pept        complement(256794..257597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0240"
FT                   /product="2-oxo-hepta-3-ene-1,7-dioic acid hydratase"
FT                   /EC_number="4.2.1.80"
FT                   /note="KEGG: bav:BAV1262 2-oxo-hept-3-ene-1,7-dioate
FT                   hydratase; TIGRFAM: 2-oxo-hepta-3-ene-1,7-dioic acid
FT                   hydratase; PFAM: fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16903"
FT                   /db_xref="GOA:C5CX99"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012690"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C5CX99"
FT                   /inference="protein motif:TFAM:TIGR02312"
FT                   /protein_id="ACS16903.1"
FT                   /translation="MLTADTIASLAAELHESEKSRVQVEHFSKRFPEMTIEDGYAISRA
FT                   WVKQKIAEGRVPRGHKIGLTSRAMQQSSQIDEPDYGTLLDDMFFEQGGDIPFKRFIAPR
FT                   IEVELAFVLGRKLQGPNVTIFDVLAATDYVVPAIEIIDARIEQFDRHTKAPRKVFDTIA
FT                   DNAANAGIVMGGRPVKPDAVDLRWVSALLYKNGVIEESGVAAAVLNHPATGVAWLANKL
FT                   APWDECLEAGEVVLGGSFTRPTTALPGDTFHADYGPLGSIAFRLI"
FT   gene            complement(257602..258006)
FT                   /locus_tag="Vapar_0241"
FT   CDS_pept        complement(257602..258006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0241"
FT                   /product="5-carboxymethyl-2-hydroxymuconate isomerase"
FT                   /note="PFAM: 5-carboxymethyl-2-hydroxymuconate isomerase;
FT                   KEGG: dac:Daci_0102 5-carboxymethyl-2-hydroxymuconate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16904"
FT                   /db_xref="GOA:C5CXA0"
FT                   /db_xref="InterPro:IPR004220"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXA0"
FT                   /inference="protein motif:PFAM:PF02962"
FT                   /protein_id="ACS16904.1"
FT                   /translation="MPHVVIQYTANLEAEADMGGLCRSLAAVLVAQKDGAGRKLFPTGG
FT                   TRVLAYPAVHYAVADDADDYAFVYINVRIAAGRNEEDRKKAGDALLDGAKKHFAPIFDK
FT                   RHIGITLQIDESPGQVYDGKHSNLHPLFNK"
FT   gene            complement(258018..258893)
FT                   /locus_tag="Vapar_0242"
FT   CDS_pept        complement(258018..258893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0242"
FT                   /product="3,4-dihydroxyphenylacetate 2,3-dioxygenase"
FT                   /EC_number="1.13.11.15"
FT                   /note="KEGG: bpy:Bphyt_5827 3,4-dihydroxyphenylacetate
FT                   2,3-dioxygenase; TIGRFAM: 3,4-dihydroxyphenylacetate
FT                   2,3-dioxygenase; PFAM: Extradiol ring-cleavage dioxygenase
FT                   class III protein subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16905"
FT                   /db_xref="GOA:C5CXA1"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR011984"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXA1"
FT                   /inference="protein motif:TFAM:TIGR02298"
FT                   /protein_id="ACS16905.1"
FT                   /translation="MGTLALAAKITHVPSMYLSEFPGPNFGCRDAAINGHKEIDRRCRA
FT                   LGVDTIVVFDVHWQVNSEYHINCGPKFGGTYTSNELPHFIKNMPYAYPGNPALGHLIAD
FT                   VANEMGVKSRAHSDTTLELEYGTLVPMRYMNADQHYKVISISGWCDWHDLTESGRFGLA
FT                   VRRAIEERYEGTVAVFASGSLSHHFADNGRAPEFMHKVYDPFLEQVDRRVVELWEAGDW
FT                   KTFVGMLPMYADKCWGEGDMHDTAMLLGLLGWDRYAAPVEVVTPYFGSSGTGQINAIFP
FT                   VTPLPAETTT"
FT   gene            complement(258896..260356)
FT                   /locus_tag="Vapar_0243"
FT   CDS_pept        complement(258896..260356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0243"
FT                   /product="5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase"
FT                   /EC_number="1.2.1.8"
FT                   /note="KEGG: bbr:BB0736 5-carboxymethyl-2-hydroxymuconate
FT                   semialdehyde dehydrogenase; TIGRFAM:
FT                   5-carboxymethyl-2-hydroxymuconate semialdehyde
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16906"
FT                   /db_xref="GOA:C5CXA2"
FT                   /db_xref="InterPro:IPR011985"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXA2"
FT                   /inference="protein motif:TFAM:TIGR02299"
FT                   /protein_id="ACS16906.1"
FT                   /translation="MRVDHLIAGKAVAGSEYFETVNPATQEVLAEVASGGEAEVNAAVA
FT                   AAKEAFPKWAGLPAPERAKLVRKLGDLIAQHVPEIAQTETNDCGQVIAQTGKQLIPRAA
FT                   DNFYYFAEMCTRVDGHTYPTPTHLNYTLFHPVGVCALISPWNVPFMTATWKVAPCLAFG
FT                   NTAVLKMSELSPLTAARLGELALEAGIPPGVLNLVHGYGKEAGEPLVAHPDVRAISFTG
FT                   STATGNRIVKSAGLKKFSMELGGKSPFVIFEDADLDRALDAAVFMIFSNNGERCTAGSR
FT                   ILVQQSIYADFAAKFAERARRIAVGDPLDEKTIVGPMISQAHLAKVRSYIELGPKEGAT
FT                   LLCGGLDAPANLPERVQRGNYVMPTVFADVDNRMKIAQDEIFGPVACLIPFRDESHAIA
FT                   LANDIPYGLSSYVWTENIGRAHRVAAAVEAGMCFVNSQNVRDLRQPFGGTKASGTGREG
FT                   GTWSYEVFCEPKNVAVSMGSHHIPHWGA"
FT   gene            complement(260353..261126)
FT                   /locus_tag="Vapar_0244"
FT   CDS_pept        complement(260353..261126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0244"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase,HpaG2 subunit"
FT                   /EC_number="5.3.3.10"
FT                   /note="KEGG: rpi:Rpic_1959 4-hydroxyphenylacetate
FT                   degradation bifunctional isomerase/decarboxylase,HpaG2
FT                   subunit; TIGRFAM: 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase,HpaG2 subunit; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16907"
FT                   /db_xref="GOA:C5CXA3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR012684"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXA3"
FT                   /inference="protein motif:TFAM:TIGR02303"
FT                   /protein_id="ACS16907.1"
FT                   /translation="MKHARVIFEGREHTGTAHEFNGQADAAVRLDDGRIVPQEQLTWLP
FT                   PLAPTPRPRTILALGLNYADHAKELEFKAPEEPLVFVKGQSTLIGHRQHTHRPAGVQFM
FT                   HYECELAIVVGKTAKRVKRADAYDFIGGYTVANDYAIRDYLENWYRPNLRVKNRDTCTP
FT                   LGPWFVDAADVPDPMALALKTTVNGTVTQQGSTRDMIFDAPFLIEYFSRFMTLSPGDLI
FT                   LTGTPDGVVDCRPGDVVVTEIERIGALVNTIQGKT"
FT   gene            complement(261123..261761)
FT                   /locus_tag="Vapar_0245"
FT   CDS_pept        complement(261123..261761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0245"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rpi:Rpic_1960 4-hydroxyphenylacetate degradation
FT                   bifunctional isomerase/decarboxylase, HpaG1 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16908"
FT                   /db_xref="GOA:C5CXA4"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXA4"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACS16908.1"
FT                   /translation="MSPSSPFLPAGTVYGTLLNFRAEMQALAPQMTEPPYKAPPKAPVL
FT                   YVKTANTWSPHGSAIAVPASVPEVEIGASIGMVIGAEGDVEGFVLMNDLSIPHASFFRP
FT                   PVKFKCVDGFLGVGPALRDAQEVADPAGFRAEVRINGTLKQSIDFSQLVRPAQQLLADV
FT                   GEFMTLAHGDVLMLGCDAGRPLARAGDRIEISAPGFESLCNTLVQEAAA"
FT   gene            complement(261758..262192)
FT                   /locus_tag="Vapar_0246"
FT   CDS_pept        complement(261758..262192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0246"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: bmj:BMULJ_04131 MarR family transcriptional
FT                   regulator; TIGRFAM: homoprotocatechuate degradation operon
FT                   regulator, HpaR; PFAM: regulatory protein MarR; SMART:
FT                   regulatory protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16909"
FT                   /db_xref="GOA:C5CXA5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR012712"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXA5"
FT                   /inference="protein motif:TFAM:TIGR02337"
FT                   /protein_id="ACS16909.1"
FT                   /translation="MASTFTHRNLPRLLLQAREAVMAHTRPSLREHALSDQQWRVLRVL
FT                   GEHGAVETGRVAREAFILGPSLTGVLARMERDDLITRSRDPEDQRRTVVEATAHGMKLV
FT                   KKLSSSIESHYQWLEQSLGKTKLTQLYGLLDELIALEQPE"
FT   gene            complement(262373..262765)
FT                   /locus_tag="Vapar_0247"
FT   CDS_pept        complement(262373..262765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16910"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXA6"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B1284"
FT                   /protein_id="ACS16910.1"
FT                   /translation="MEADPDGAFFERSLDGGATSFYLIIRPRPYLTARDRELIDQGIFS
FT                   LEELHPEVLRLGRTPSPQTPWLYEVESFKVGREHHDDQEVFNDHATDYRSEVFDNLSTL
FT                   LEHCQKEFGVAASDFRKRDATHYPKF"
FT   gene            complement(262832..267136)
FT                   /locus_tag="Vapar_0248"
FT   CDS_pept        complement(262832..267136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0248"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: RHS protein; YD
FT                   repeat-containing protein; KEGG: xop:PXO_05538 rhs repeat
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16911"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXA7"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACS16911.1"
FT                   /translation="MFFAAKHFDPQLGIDAHTYLAPPGVWPTLHIGIVMDPFDYLPTIQ
FT                   VSPDNPIVKGMAAVDGAMQAGLDTIGQGTAAPEVPAPPGAPAGGGEMPASIPFPLGATV
FT                   EVAGVRRANAGTGGVDFHVLVGAPMPVIKAPGGPQFEDELFMGSRIVLADGEPFSRIGV
FT                   PVLACNIVGLVPPFRKKKAVKPLRLSLMLPTTFNVAIPPQVFVGGPPTISWGAMVQRGL
FT                   FKALGRAYTRIARRVFKNMPPGFLKCQVLRAEPVDIRDGSVSVTHEDFSIPGRLPLSWT
FT                   RVYASRDHALPGHCGHGWQTPADVRLMAEADGLLSLQGPEEFALFPALPQAEGQQVLDV
FT                   VDGARLMRQGTALVVRFKSGLRYHFEDALSPEGALQAAPLPIARIEDACGNHWRFVRRG
FT                   RDLVRIAESGVDGLPGRSIEVQSRGGYIESMALRDPATGQEHPLVRYRHADGDLLAASD
FT                   ALGAAREFAYLQHRMARHTDRTGLSFHYAYDEQWRVVHAWGDGGLHDYRFAYSAALRQT
FT                   EVTNSLGHLTVVKFDEAGLPLAEIDPLDGVTTFEYDDVGRTVAVTAPGGLRTGFTYDAR
FT                   GNLLGVRHPDGSIVGCEYDSDDQLLAVIDPLGHRWEHASDARGLPSSQTDPLGAVTRFE
FT                   HDDRGQLVRHVNARGAVTQLRYDRYGLPAQMIDALTHVTRFDYDALGRLRTQVNALGQR
FT                   SRYHCDAKGRLQRITQHDGAQLTCAYDAEDRLVRYADENGAITELTYSGTGLIARRVQP
FT                   DGHAVRYDYDSEEQLVAVVNPRGERHELTRDPLGRIVEEIDYWGQCRRFHYDASGRLLR
FT                   SIDPMGRTISFHTDAMGRITHKTWPEISGGAPAGAEDFRYDAAGRLVEARNAHSHFKHR
FT                   FDALGHLVEEQQGSFRIERAYDAAGNSVERKTSAGNRVAVRYDLLNRPAEIAINDEPPI
FT                   TIERNALGQATAEHLSEHVVRTLRYNDQGLVAAQAVAKDGAPLFDTRFDYDAAGNLTRR
FT                   TDSQQGNDLYTHDPMGRILSHVDPMGRVRHYLSDPAGDRLRTNVRIVAMAQTASGQQQP
FT                   EHWTREGEHEGWHYVFDRAGNLTSRTQTRAPNQPALHLAWDTNQRLTQSRWERGPHHGE
FT                   VTTYGYDPLGRRVFKRNTTHTTWFFWDGDALLGEACQENALVPKTKKSPVTSLLERRKQ
FT                   EDALRQLHAKTREFVLKPGTFEPLALIDKEMPPSSVDTSEDTARVLHYHNDPDGRPLRM
FT                   TTRDGQIVWAVRYDVWGGIARKDCELLAQPIRCQGQQEDAETGLFYNRHRYFDPIIGAY
FT                   VSADPIGLRGGVNPYAYGCSNPYFWIDPLGLAASCERHLRSIDEQLQQGRRARIDVASK
FT                   DDAIELLLAYTTGPAGRRGAFRNTTDQPLPEGKKSESGSDWLPGGRGAYQREGTYHWDA
FT                   ADPNAKAGDHALEGNHLQIHNFDGKIIRIFFP"
FT   gene            complement(267179..268762)
FT                   /locus_tag="Vapar_0249"
FT   CDS_pept        complement(267179..268762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xoo:XOO1635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16912"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXA8"
FT                   /inference="similar to AA sequence:KEGG:XOO1635"
FT                   /protein_id="ACS16912.1"
FT                   /translation="MSTRNPVEKRMAQLHDLWWERTDDPALRAIVLRAPPDSQRMLEAF
FT                   FTLQMVDSEYSTPDLFLRLDTAFETGFRYSRELRQQLIDTYRHNRPQLVKQGVSASWDE
FT                   EGQPGWDSAAGFVQAGCSLARHLRCQRMSVVLQPASVSDADCFERWFDAAMQTPMPPQE
FT                   AGLLRLVLVDDSDSRAWQPLVERHAGAMRVVDAPLDILEAAREIAAQSGGGSSGAALFR
FT                   QLYADMLSLLRLGDAAGVQAAGERALRLATRNGWADQRAVLDMMVGGAWLQARDFGASI
FT                   TRYRRARDSAAEAAQAGNPMGATLFMQGWMAEGGAWAAAGDMKQAAYAFEEAAEAARRV
FT                   PHAMFAVEGHRAAAQAWRSAGERDRAWASALAGVREARTMADADRPRSTVPQLLHDMLV
FT                   MQDPRRCERIAHCATRYERDARAALAEADLAGHRLGERPPRPAIDAIEARLAQHYEQAF
FT                   QTLLREREKWVQGSEDVFRTVIALGRQWLDPAWSGLPHVSHPLDQGVDEWREPPAFARL
FT                   PDPQPFVEAA"
FT   gene            complement(268770..271154)
FT                   /locus_tag="Vapar_0250"
FT   CDS_pept        complement(268770..271154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0250"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; Rhs element Vgr protein; PFAM: Rhs element Vgr
FT                   protein; Gp5 domain protein; KEGG: bxe:Bxe_A4429 rhs
FT                   element Vgr protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16913"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXA9"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ACS16913.1"
FT                   /translation="MSAFNRGRKLAATSSAMPTLAGMDALEPMRVEGEESLSRPYSYTI
FT                   TLTTPESPDIDARSAANVKLKPLIGEEFSVHILLDGRPGGAGQERHISGLVTRARFLRL
FT                   ENRRALYEVVIEPWLSLAQRTRDYRIFQKNSVLDTVGEVLGAYGFALSVRATGSYPARE
FT                   FVVQYGETDYDFASRLLHEWGLYYYFEHGEAGHTMVIVDDMQSHRPFPAGGYEQVPFGA
FT                   MQASSNEEHCHRFRLSEGLQSGKWVTGDFDFTRPKADLTQARAMPRRTQHSTREVFAWP
FT                   GNYAVESEGEQLARARMEEAGAPGQVASGAGNLRGVAAGHRFTLAGHPQDGANADYLVT
FT                   AARLLLQEAGDATGQEEFQCNVEFEVIPASNIFRPTPDAAKPRTAGPQTAVVTGPAGRE
FT                   IWTDQYGRVKLSFHWNRYCTRDESSSCWVRVSSPWAGTNFGGMQIPRIGQEVVVDFEYG
FT                   DPDRPIITGRVYNADNMPPWELPANATQSGLLSRSSEGGTSENANALRFEDKKGEEQLW
FT                   LHAEKDQLIEVENDEVHTVGRDRTKTVDHDETSRIKNDRTETVDRNETITVHGQRAETV
FT                   DGNETVTVKSNRSHSVTGTETLTVTGDQTHTAKANRTASVTGNQSTSVTGADSLAVTQA
FT                   RSVTVQDSDTWNVALGQTTTIGQAYQVCAKSHTGTYNDAMTLNVPAGPASATSQGDFSL
FT                   TSSAANIYGTAALNVGLFAQGGDFSAVASTNVGVSAEGGTLDTYSSGAMTHASPTSVVL
FT                   NVEGTTVEVTPGRIVLRAGSANLMLDDAGVTVNGTKIFLNC"
FT   sig_peptide     complement(271089..271154)
FT                   /locus_tag="Vapar_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.764) with cleavage site probability 0.659 at
FT                   residue 22"
FT   gene            271235..272623
FT                   /locus_tag="Vapar_0251"
FT   CDS_pept        271235..272623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0251"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_0200 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16914"
FT                   /db_xref="GOA:C5CXB0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXB0"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ACS16914.1"
FT                   /translation="MAKEKTLFVCSECGGTSPKWLGKCPSCGAWNTLIEQVAGGSGPAN
FT                   NRFGTQYAALAGVSELATLSEIEATDVARTPTGLDELDRVLGGGIVSGGVTLIGGDPGI
FT                   GKSTLLLQAVDALQRAGQNALYVTGEESGAQVALRSRRLGLDHSQVQVLAEIQLEKIIA
FT                   TLDATRPAIAVIDSIQTVYSDQLTSAPGSVAQVRECAAHLTRFAKTSGTAVVLVGHVTK
FT                   EGALAGPRVLEHMVDTVLYFEGDTHSSFRLVRAIKNRFGAVNEIGVFAMTERGLKGVAN
FT                   PSAIFLSQHAEPVPGSVVLVTLEGTRPMLVEIQALVDNGGPSPRRLSVGLDRDRLAMLL
FT                   AVLHRHAGVACMDQDVFVNAVGGVRISEPAADLAVMLAITSSLRGKPLPRGFIAFGEVG
FT                   LAGEVRPAPRGQERLREAAKLGFSVAVVPKANAPRKGTKEIEGLTIHAVERIEEAMDVV
FT                   RRLD"
FT   gene            272860..273303
FT                   /locus_tag="Vapar_0252"
FT   CDS_pept        272860..273303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16915"
FT                   /db_xref="GOA:C5CXB1"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXB1"
FT                   /inference="similar to AA sequence:KEGG:Bpro_0202"
FT                   /protein_id="ACS16915.1"
FT                   /translation="MRPMNFQKIWVPVGGIVLLGLAWRSYGWAGVALTGGAIVMFLLLH
FT                   FNRAMQVLKRAADRPVGYVASAVMLNAKLKPGVTLMHVIAMTRALGELRSPKDEQPELY
FT                   RWTDTGGSYVDAVFNGGKLQSWTLTRPEAAPDDAPSSEEDKAG"
FT   sig_peptide     272860..272949
FT                   /locus_tag="Vapar_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.783) with cleavage site probability 0.730 at
FT                   residue 30"
FT   gene            complement(273331..274338)
FT                   /locus_tag="Vapar_0253"
FT   CDS_pept        complement(273331..274338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0253"
FT                   /product="putative exonuclease RdgC"
FT                   /note="PFAM: putative exonuclease RdgC; KEGG: rfr:Rfer_0012
FT                   recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16916"
FT                   /db_xref="GOA:C5CXB2"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXB2"
FT                   /inference="protein motif:PFAM:PF04381"
FT                   /protein_id="ACS16916.1"
FT                   /translation="MSVFKNVIVYRIEPAWSQTLAEAEEALAKARFEPCGPSQEKSAGW
FT                   VEPRGEANGPLVESIDGQWLVEYMIESKAVPGSVVRRKLDERCAQIEAATGRKPGKKEK
FT                   KELKEDITLELLPMAFTRSARVAVWIDKAEHRLVINSGNASRADEVVTSLVKSLDGFAV
FT                   ALINTQVEPAAAMANWLLTQEPPAGFTIDRECELKASDDSKAVVRYAKHPLDIEEVQKH
FT                   ITDGKRPTRLALTWDDRVSFELTHGMLIRKIVFLEGTGDGAAGGKKEDNFDADVAIATG
FT                   ELGQLVPALLDALGGEAAFSGAPADAAAAPKAAAAAPTTTTPADAEAEEEDAPF"
FT   gene            274470..275423
FT                   /locus_tag="Vapar_0254"
FT   CDS_pept        274470..275423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0254"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: pol:Bpro_0203
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16917"
FT                   /db_xref="GOA:C5CXB3"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXB3"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ACS16917.1"
FT                   /translation="MSSIPPSLDDRDGKIWMDGELVDWRDAKIHVLSHTLHYGCGAFEG
FT                   VRAYKTADGSTAIFRLAEHTERLFNSAKILRMKIPFTQEQLNEAQKQVVRENKLESCYL
FT                   RPLIWIGSEKLGVSPKGNRIHAMVAAWSWGAYLGEEGMKRGIRVKTSSFTRHHVNITMT
FT                   QAKTVSNYTNSILANMEALDDGYDEALLLDASGFVSEGAGENIFVVKGGVVYTPDLSAG
FT                   ALNGITRNTILHVCKDLGLELVQKRITRDEVYIADEAFFTGTAAEVTPIRELDRIEIGN
FT                   RGDGGSRGPITEKIQAAFFDIVNGKNPKYAHWLTKV"
FT   gene            275432..275641
FT                   /locus_tag="Vapar_0255"
FT   CDS_pept        275432..275641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_0265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16918"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXB4"
FT                   /inference="similar to AA sequence:KEGG:Aave_0265"
FT                   /protein_id="ACS16918.1"
FT                   /translation="MPTNAVVELLARELNHQGGVFCPSPKADMKLWDTHPKVYLDVART
FT                   GEAKCPYCGTVYRLKAGETVSSRH"
FT   gene            275638..276054
FT                   /locus_tag="Vapar_0256"
FT   CDS_pept        275638..276054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0256"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16919"
FT                   /db_xref="GOA:C5CXB5"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXB5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS16919.1"
FT                   /translation="MTVRGLLGRFGAAYLLLLLILGLALNMFGVQANAGVNTAALLGAV
FT                   MWVCLAFGKKNGRYLARNEKTRAVLGMIAIDLAIQAAVSVAAAMVAGASVLQLGPMLLV
FT                   LLFVGVLHAAVIYFFVGMAGRQFAAAEARRSSSR"
FT   sig_peptide     275638..275742
FT                   /locus_tag="Vapar_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.718 at
FT                   residue 35"
FT   gene            complement(276055..277314)
FT                   /locus_tag="Vapar_0257"
FT   CDS_pept        complement(276055..277314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0257"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: har:HEAR0457
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16920"
FT                   /db_xref="GOA:C5CXB6"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXB6"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ACS16920.1"
FT                   /translation="MQRSHIVRPAAMFWGLVVFMPVGLTYLSALLLLATMLLAGGLRER
FT                   SARLRANPLWWPLVAYLAWTFIVLAIGPHYPETGSNLFHGLRIGLTILMAMALTREEAV
FT                   WALRGFLLIAALNILLVVAYYAIGFPIWSPLRAVVMEVGNKSISNALLFSVVASTAAVW
FT                   GIAQIAAHRPLRAIPAFVLMLGLGLVVALPLTSRTSVLALLLVIPVVCIHQWRSHLKML
FT                   VSALVLGAVVLAAALYQLPQLQHKVETGVEEIEKAQAGEIFKGSWVIRYYMYRDTGLMI
FT                   ADRPLTGWGIGGWTDQWHKRGPALFADSNMPHNDFLWVGAQGGLPALLSLLAIMAGAVW
FT                   QAWKRPDIAGRYALAATLIALIASSVNSAVRDAQIGLALLWIAMVYLRLAQEPRETQPW
FT                   QGLWPTRRIAAALEVPPQSR"
FT   gene            complement(277457..278653)
FT                   /locus_tag="Vapar_0258"
FT   CDS_pept        complement(277457..278653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0258"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   aav:Aave_0274 integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16921"
FT                   /db_xref="GOA:C5CXB7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CXB7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS16921.1"
FT                   /translation="MLRSLYSRHLYVRIWLAVVGGVVILTLMANWIVREAAQAERERLA
FT                   PVPRNVVVLDAQDTPIGTGKALRVPGQGLEFDVTLSDGKALTLRVAPRDRPPGGGFAPW
FT                   RTPFGLGWMIALVGIAVALGVYPIVRRLTQRLEALQRGVQRWGEGDLSVRVTEEGQDEV
FT                   ADLSKRFNASAERIEQLVRSHKSLLANASHELRSPLTRIRMGLELMGERPSPKAREEIS
FT                   RNIGELDQLIDEILLASRLDASEADLGTIEAVDLTGLAAEECSQVNAELDLVEGTDNAG
FT                   LTVPGVSRLLRRAIRNLLENARRYGAGEIRVELGSANGFATVRVTDRGPGVPPALRERI
FT                   FEPFYRLPGASERNGGVGLGLALVKSIAERHGGSVRCEDGPGGGASFVIRLPASAPAN"
FT   sig_peptide     complement(278564..278653)
FT                   /locus_tag="Vapar_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.647) with cleavage site probability 0.607 at
FT                   residue 30"
FT   gene            complement(278661..279383)
FT                   /locus_tag="Vapar_0259"
FT   CDS_pept        complement(278661..279383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0259"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: rfr:Rfer_0510 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16922"
FT                   /db_xref="GOA:C5CY18"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY18"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS16922.1"
FT                   /translation="MKRMSTPQLLMIEDDARLAQMVGEYLTQSGFLFTHAGDGASGLEQ
FT                   LQQHAPDLVILDLMLPDTDGLEICRRIRSLPPPASKVSVLMLTAKGDPMDRIIGLEIGA
FT                   DDYLPKPFEPRELLARIRAVLRRRSENNADTEASTVMRFGTLEIDRNARTVSVGGALAD
FT                   LTSYQFDLLVAMAERAGRVLTRDQIMEAVRGRELEAFDRSIDVHMGRIRAAIEVDAKNP
FT                   KRILTVRGVGYVFAKQQD"
FT   gene            complement(279380..281086)
FT                   /locus_tag="Vapar_0260"
FT   CDS_pept        complement(279380..281086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0260"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: har:HEAR2878
FT                   halogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16923"
FT                   /db_xref="GOA:C5CY19"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY19"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACS16923.1"
FT                   /translation="MTGTAQRCDAVIMGGGLAGLTLALQLKQRFQDIDVLVLERRTHPV
FT                   PHAAHKVGESSVEIGAHYFDTVLGLKPHMDGAQLRKFGFRFFFSEGRRDIDQVTEIGAS
FT                   RYLAVPSYQIDRGIFENYLAEEAVRRGVRFDDAALVRRVELAPDAEAPHRLEWTRGSET
FT                   HSAEARWLVDACGRAGLLKRKLGLAEANAHDVNAVWFRIGERIAIDEWSDDAAWRGRCD
FT                   PQARWLSTNHLVGAGYWAWLIPLASGSHSVGIVADPKLHPLDTIDTFDKAMRWFATYQP
FT                   RLYDALDSKRHLLQDFAFLKHFSHGCRQVFSGRRWALTGEAGLFLDPFYSPGSDFIAIS
FT                   NTYIADLVAHDRAGRPVEARAQLYDQIYHSFYESTLALYQDQYPLFGDPEVLPVKVIWD
FT                   YAYYWGVLSQIFFQQRLTDLVLLGSLKDELQHCQRLNLAVQQLLRSWSAASARRNAPVM
FT                   LDQAAMPWFAELNRSLKDPRLGDAAFRARIRASAAQLRQLAGEILARARADNADLGDCA
FT                   LPSLLEENIAALPAGAQAGAMLFAALPNDSRTRRLPNFTERSSPVAPRARP"
FT   gene            complement(281093..281941)
FT                   /locus_tag="Vapar_0261"
FT   CDS_pept        complement(281093..281941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xca:xccb100_4191 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16924"
FT                   /db_xref="GOA:C5CY20"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY20"
FT                   /inference="similar to AA sequence:KEGG:xccb100_4191"
FT                   /protein_id="ACS16924.1"
FT                   /translation="MTTSMSVPTPPTLYIEGPAFWTPTLPGWDAARAAFRGEGGLADPP
FT                   AKRPSPQVLAPAERRRAPDTVALALEVAAASMAGSGRNAADVPCVFVSAHGDLSINDYM
FT                   CSTLATDPTVLSPTRFHNSVHNAAVGYWTIGTGCMAASNSVSAYENSFAAGLLEAAVQC
FT                   AADQSPVLLVGYDTPTVGPLTSVTDSQGLLAVALVIAPERTARSVAALDWSVDGSGGGG
FT                   NPPAPLSEAAKTLAHINPMAHALGLFEALARLDGDGPPPPIGLPLSSTLSLRLQLRPIR
FT                   D"
FT   gene            complement(282054..283256)
FT                   /locus_tag="Vapar_0262"
FT   CDS_pept        complement(282054..283256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0262"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: xcb:XC_4087
FT                   3-oxoacyl-(acyl carrier protein) synthase I"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16925"
FT                   /db_xref="GOA:C5CY21"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY21"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ACS16925.1"
FT                   /translation="MPPRISPLQISAFTATSAVGVGKEPLAEALEHSRSGLRANDFGDA
FT                   PLPTWIGRVDGLEDIRLPEALASWDCRNNRLAWLGLHADGFPEAVAAARARYGPSRIAL
FT                   ILGTSTSSIGETELAYTQLDADGRFPTDQRRPAVHTPHSLAMFVQQVLGLSGPSETIST
FT                   ACSSSAKVFASAERLIRLGLADAAVVGGVDTLCGSVLFGFNSLELVSSEPCRPFDASRK
FT                   GISLGEAAGFALVERVQDDAAAPLRLLGYGEASDAHHMSTPHPEGLGAERALDEALARA
FT                   GLAPEAIDYINMHGTASQKNDEVEGALVARRFPATTHASSTKGFMGHTLGAAGIVESVI
FT                   SLLAIERGLMPGTVNTSQLDAGFGPQIRLAPAHGEVRYALTNSFGFGGNNCSLVFGKAK
FT                   A"
FT   gene            complement(283388..284776)
FT                   /locus_tag="Vapar_0263"
FT   CDS_pept        complement(283388..284776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0263"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dia:Dtpsy_0214 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16926"
FT                   /db_xref="GOA:C5CY22"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY22"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS16926.1"
FT                   /translation="MDNPEFMSAQPAETSTAPSLPWRDALKVYLEPATLRMLALGFSAG
FT                   LPLLLVLGTLSFRLREAGIDRTTIGYLSWVGLAYGFKWVWAPLVDRLPLPPLTTLLGRR
FT                   RGWLLLAQGMVVAGLVGMALNDPRQGLAPLIWCALLVAFGSATQDIALDAFRIESAETR
FT                   KQAALAAAYQTGYRLAMIWAGAGVLWVAAWAEVAPAAAAATGAAAYQNGAWKTAYLVMA
FT                   ASMAVGVLTVLLSPEPVRRVLPKPKNAAEWLQSVLIEPFADFIRRYKWQAALILSLIAI
FT                   YRISDVVMGIMANPFYVDMGFTKDEVATVSKIYGVVMTLAGAFVGGVLSMRLGVMRVLM
FT                   LGAVLSAASNLLFAWLASRGHDLTALIAVVSADNLAGGIASAAFIAYLSSLTNISYSAT
FT                   QYALFSSLMLLLPKFIAGYSGAFVDAHGYAQFFTGTALLGLPVLLLVALAARITTTKAP
FT                   AGRQ"
FT   gene            284835..285701
FT                   /locus_tag="Vapar_0264"
FT   CDS_pept        284835..285701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0264"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: aav:Aave_0280
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16927"
FT                   /db_xref="GOA:C5CY23"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY23"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACS16927.1"
FT                   /translation="MCTRCELLAVSSAASSAPRASAWQPRRAFLLAAGAALAGPALAQV
FT                   NVGNASVARNLVPADRIEAAGVQQYGQLLEQARAKRALAGDGNAQLQRLRTIANRLIPF
FT                   ATPWNARAREWKWEVNLIGSKQINAFCMPGGKIAFFTGILEQLKLSDDEVAMVMGHEMA
FT                   HALREHARARMAKSAGTGAALSIGAQLLGLGQMGDLAARAGTQLLTLKFSRSDETEADL
FT                   VGLELAARAGYDPQASVSLWKKMAAASKNQGGLGFLSTHPSGPDRIQKLEANLPKVEGL
FT                   YREAKRS"
FT   sig_peptide     284835..284903
FT                   /locus_tag="Vapar_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.578 at
FT                   residue 23"
FT   gene            285894..287603
FT                   /locus_tag="Vapar_0265"
FT   CDS_pept        285894..287603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0265"
FT                   /product="allophanate hydrolase"
FT                   /note="TIGRFAM: allophanate hydrolase; PFAM: Amidase; KEGG:
FT                   vei:Veis_0832 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16928"
FT                   /db_xref="GOA:C5CY24"
FT                   /db_xref="InterPro:IPR014085"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY24"
FT                   /inference="protein motif:TFAM:TIGR02713"
FT                   /protein_id="ACS16928.1"
FT                   /translation="MMVHEENGSAAAAWIARFPRPVPGADAGPLAGLRFAVKDNIDVAG
FT                   VPTTAACPAFDRRPAEHSAVVRKLLDAGASLLGKTNLDQFACGLNGTRSPYGEVPNAFD
FT                   ARYVSGGSSSGSAYVVAAGEADFALGTDTAGSGRVPAGLNNIVGLKPSRGLLSAFGVVP
FT                   AAQSADCVSIFARSVGLAVDVLLAAAGPDARDPYSRALALRSHPFPPAFRFGVPDTLSF
FT                   FGDAAAEQAFRDAQLRLAELGGTAVEIPYAPLAEAAALLYESALVAERYAAVRGFFDAR
FT                   GSQVIEPVRGILESGRGYSAADVFEAQTRLRAIAQQVEPMWRGIDLLLVPTAPTHYTRE
FT                   QMRADPVVLNRNLGAYTNFVNLLDYAAISVPSALRADGLPFGITLIGPCGSDLALAELG
FT                   QRYHHATGLPQGATGLPLPEPRPIPGLGASPVQAMPIAVVGAHLSGMPLNGQLTERGAT
FT                   LLRATTTSPHYRLHALPGTVPPKPGLQRSTAGGAAIALEVWSVPVAEIGSFLALIPPPL
FT                   GLGSVELADGSWVHGFICEGHALAGAEDVSHHGGWRAYIASRAAASSQAIPT"
FT   gene            287621..288625
FT                   /locus_tag="Vapar_0266"
FT   CDS_pept        287621..288625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0266"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   vei:Veis_0833 ABC transporter, substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16929"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY25"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACS16929.1"
FT                   /translation="MCIPEKSSAAASRRQLLQAGAAGLAVLAAPAIVRAQAAPKIRIGF
FT                   WPVAAGLPFFAAVDRGYFKEAGLDVEPLKFAGAQQVMEGMLAGRCDGSSNGTGSANLAI
FT                   GEIAQPGLFKIFCTNPSNARFVLDEFIVAKDSPTKTMAELAGKKIASGPGIQNVTLCKT
FT                   MLERAGATGATVSELPIGQHVAALVAGQVDACYTLEPTGTVGRMNGTTRVIEAGVVAKY
FT                   ILGDPMAPWHGGAASLTSEFIKKNPDAARKYIAAYARGVELVRSKPDDARQHMKGYTAI
FT                   EGSLTAEVPLASYMLYNEFKPSDVAYFQKFYDLFTEKGIFEKKVPVDGLLYKA"
FT   sig_peptide     287621..287734
FT                   /locus_tag="Vapar_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.587 at
FT                   residue 38"
FT   gene            288628..289458
FT                   /locus_tag="Vapar_0267"
FT   CDS_pept        288628..289458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0267"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vei:Veis_0834
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16930"
FT                   /db_xref="GOA:C5CY26"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY26"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS16930.1"
FT                   /translation="MADASTTTATPWTPPADGTAASAPKPPLRDRLLPFIGPLALFIVW
FT                   DLAVRLGFIKPILLPTPADTVAALITGLAGGPLLTDFAMTVWRTLQAFAIAAVVGVPLG
FT                   VLLGSNEKAYRSVEFLIDFFRSTPSSALIPLFLLIFGVSDVNKVAIAAFGALLIVVFNS
FT                   AYGVINARKQRVMAARVMGASRWQIFKDVLVWESLQPSFVGLRSAVSMALVIVIVAEMF
FT                   IGSDTGLGHRIIDAQQVLNVKSMYAAILAAGALGYALNILFLIAERRIVHWSGR"
FT   gene            289455..290288
FT                   /locus_tag="Vapar_0268"
FT   CDS_pept        289455..290288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0268"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vei:Veis_0835 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16931"
FT                   /db_xref="GOA:C5CY27"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY27"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS16931.1"
FT                   /translation="MKATPDIVVNGPVYADVPRPVFKPGPAGTHITIRGLTKYFAGWPL
FT                   YENFDLDIPKHRIVSVFGPNGCGKSTLINMIAGLIPIDAGEILFDGKQRKDTKIGYVFQ
FT                   NYREAMFPWMRTIDNIAYPLKLEGRSKAEVDRRMEELVASFDVKFDLKRFPYELSGGQQ
FT                   QTASIMRALAPKPEVLFLDEPFSALDFEMTLFIREKLQEVFMQTGTTMLLVSHDLEEAV
FT                   YLADEVLLLTKRPTRVAEILRYGDARPRTVETLSTESFVATKKLSLDIFQREVRR"
FT   gene            290285..290665
FT                   /locus_tag="Vapar_0269"
FT   CDS_pept        290285..290665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bav:BAV2587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16932"
FT                   /db_xref="InterPro:IPR024507"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY28"
FT                   /inference="similar to AA sequence:KEGG:BAV2587"
FT                   /protein_id="ACS16932.1"
FT                   /translation="MTPEINIPEVLAEVTDVFARYEQALMANQPAVLDELFWNSPHTLR
FT                   YGFSENHYGHTGISAFRASLPVQSPPRELLRTVITTYGRDFATANCEFRREGATAVGRQ
FT                   SQTWLRTADGWRVVAAHVSLLG"
FT   gene            290714..291832
FT                   /locus_tag="Vapar_0270"
FT   CDS_pept        290714..291832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0270"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG:
FT                   mpt:Mpe_A0769 bmp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16933"
FT                   /db_xref="GOA:C5CY29"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY29"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ACS16933.1"
FT                   /translation="MTSQINRRDSLKSLAALGAAGTLGGWSALAGAQAKPLTVGVIYVG
FT                   ARDDYGYNQAHAMAAAEIKKLPGIKVVEEENVPETAAVQKTMAGMISQDGAKLLFPTSF
FT                   GYFDPHILAVAPKNPDVRFSHCGGLWTEGKHPKNAGSFFGYIDECQFLNGVIAAHMTKS
FT                   NKIAFVAAKPIPQVLRNINAFTLGARSVKPNITCSVIFTGDWSMAVKEAEATNSLADQG
FT                   CDVFTMHVDGPKVVVETAAKRGKMVCGYHASQAKLAPNAYLTGAEWNWLTAYKTAIEAA
FT                   QAGKPHPNFLRGGLKEGYVKMSAYGPMVPDAAKKQADEIKAKMVAGSFDIFKDGIKDNK
FT                   GAVVVPAGKVLKQTDLELEKMNYLVEGVIGQA"
FT   sig_peptide     290714..290806
FT                   /locus_tag="Vapar_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.374 at
FT                   residue 31"
FT   gene            291858..292919
FT                   /locus_tag="Vapar_0271"
FT   CDS_pept        291858..292919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0271"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   mpt:Mpe_A0768 ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16934"
FT                   /db_xref="GOA:C5CY30"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY30"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS16934.1"
FT                   /translation="MRQALKEFALPVFAIAAALLLFGVLAAFAGVDPLEVWATLFKGAF
FT                   GDWFSWQNTLQRAAPLMLTALCVALPARAGLIVIGGEGALVLGGLACAALAHAVPLPGN
FT                   VLGTAIVCIAGALAGALWIVLAGWLRQYRGINETISSLLLAYIAIGIFKHLVEGPLRDP
FT                   ASLNKPSTHALADGLLIGGIGGSDVHWGLVIGVVACLALGWWLRATASGFSVRVVGGNP
FT                   RTAQLVGLPATRLILGACALGGASAGLAGAVEVAAVHTNANASLIAGYGYAGILVSFIA
FT                   RHNPVAIVPVAILFGGFGAAGSLLQRRLGLPDASVLVLQGMAFVLILASEGLRMVDWNA
FT                   FRARVPRGGGALR"
FT   sig_peptide     291858..291947
FT                   /locus_tag="Vapar_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 30"
FT   gene            292916..293839
FT                   /locus_tag="Vapar_0272"
FT   CDS_pept        292916..293839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0272"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   mpt:Mpe_A0767 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16935"
FT                   /db_xref="GOA:C5CY31"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY31"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS16935.1"
FT                   /translation="MSADQWIALAAGIVGGALRVGAPFLFVSLGECLTEKSGRINLGLE
FT                   GVLVLSAMAAFGGAYLTDSAWLGVLIGALAGAALALLHGLLCSLDRVNDVATGIALMLL
FT                   GTGLAFYLGKPLIQPQAPQIPAIPLGFWSDNTVVRSALQLNALVPIGVALAVLLWWGFA
FT                   RTRAGLLVRMAGDSAQAARALGYSVSGLRIAATTAGGFIAGLGGASLTLFYPGSWNEGI
FT                   SSGQGLIAVALVIFARWSPLRCVGAALLFGGAGAIGPALQSIGIGWGYHLFNTVPYVLT
FT                   LVILVFTCRPGTAAAGAPGELSSTRS"
FT   gene            293845..294549
FT                   /locus_tag="Vapar_0273"
FT   CDS_pept        293845..294549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0273"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: mpt:Mpe_A0766
FT                   isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16936"
FT                   /db_xref="GOA:C5CY32"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY32"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACS16936.1"
FT                   /translation="MANTASPRHVAAEPYGWPYNGALRPGNTALIVIDMQTDFCGTGGY
FT                   VDVMGYDLSLVQAPIQPIARTLAALRPLGFHIIHTREGHRPDLSDLPANKRWRSRQIGA
FT                   NGVGIGDDGPCGRILVRGEPGWEIIPELAPLPGEVVIDKPGKGSFYATDLELILRTRGI
FT                   ENLILAGITTDVCVHTTMRDANDRGFECLLLSDCTAATDHGNHLAALKMITMQGGVFGA
FT                   HATSQALLAALD"
FT   gene            294557..296155
FT                   /locus_tag="Vapar_0274"
FT   CDS_pept        294557..296155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0274"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mpt:Mpe_A0765 ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16937"
FT                   /db_xref="GOA:C5CY33"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY33"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS16937.1"
FT                   /translation="MADPTPHAIGALPAGHGALALDTCELTKRFGAFTAMDRVTMHVEP
FT                   GTVHALLGENGAGKSTLVKCVAGFQRAEEGSILIDGREQDIANPIVARALGIGMVYQHF
FT                   TLAPGMTVAENLLLAGGKTPALIDWKAKRAELRDFLAATPFSLDLDARPSELAAGEKQK
FT                   LELLKQLYLKPRLLILDEPTSVLTPQEADEVLGHVREFAKSGLCTVLIITHKFREVMAY
FT                   ADGVTVLRRGKAVHHCRVADTNPAQLAQAMMGGEDASAPVPASSPVARKPVPDAAPVAL
FT                   RVEGLEAQGDRGTLALHGLSLAVRAGEILGVAGVSGNGQRELVEALVGQRARLAGKVSV
FT                   MGQPYSARRAENRSLKVRSLPEEPLRNACVGDLSVAENMALRDFDRPPLSRGGVLDFPF
FT                   WRHRAREWIAEYGVKTQGEGAPIRSLSGGNVQRAVLARELAGDINVLIAANPVFGLDFA
FT                   AVAEIHERIVQVREKGGAVLLISEDLDELLELADRIVVMSEGRIVFETSAAGAERHVIG
FT                   AHMGGGHHEPSKAAA"
FT   gene            296436..297107
FT                   /locus_tag="Vapar_0275"
FT   CDS_pept        296436..297107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0275"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bxe:Bxe_B1373
FT                   isochorismatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16938"
FT                   /db_xref="GOA:C5CY34"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY34"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACS16938.1"
FT                   /translation="MRIETANPFPYDFELKNTALVLIDMQRDFIEPGGFGETLGNDVSL
FT                   LEAIVPATKAALQAWREAGGLVVHTREAHKADLSDCPPAKRNRGNPSLRIGDQGPMGRI
FT                   LVAGEPGNQIIDALAPVDGEMVIDKPGKGAFHATGLHELLQARGITHLLFGGVTTEVCV
FT                   QTSMREANDRGYDSLLLEDCTESYFPAFKAATLDMVRAQGAIVGWTAPSSALRAVLGQG
FT                   Q"
FT   gene            297104..297868
FT                   /locus_tag="Vapar_0276"
FT   CDS_pept        297104..297868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0276"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   vei:Veis_0841 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16939"
FT                   /db_xref="GOA:C5CY35"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY35"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACS16939.1"
FT                   /translation="MTATTIPHVPTARPRSASPAPASDATVFRTRADEVYAQLKRDVAD
FT                   FILVPGDRFTENEISDRLGVSRTPVRQALFRLQQEGFVEVLFRSGWRVLPFDFDQFEQL
FT                   YDLRMVLETTAVHRLCEADRRVDRSLLDALAEIWLVPAAQRSSDTAQVAQWDEAFHCAL
FT                   VAAAGNAEMARVHRDVTDRIRIIRRLDFTQQPRIDATYEEHAKILKAVRANRGEQAAML
FT                   LRAHIETSQAEVRKITLHQVHLARHAGKAAPR"
FT   gene            complement(297883..298686)
FT                   /locus_tag="Vapar_0277"
FT   CDS_pept        complement(297883..298686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0277"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: ajs:Ajs_0233 exodeoxyribonuclease III Xth;
FT                   TIGRFAM: exodeoxyribonuclease III Xth; exodeoxyribonuclease
FT                   III; PFAM: Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16940"
FT                   /db_xref="GOA:C5CY36"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY36"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ACS16940.1"
FT                   /translation="MFKLTSLNLNGLRSAATKGVADWVAELAPDCICMQEIRVQASDIE
FT                   GRFEEMAGLKGHFHFAEKKGYAGTAIYTRHAPSAVVVGWGDAEFDAEGRYLELRFDTPR
FT                   RKLSIISCYFPSGSSGEERQEAKFRFLKGFFPHLTALKKEREFILCGDINIAHKEIDLK
FT                   NWRGNQKNSGFLPEERAWMTRLLDAGADGAGLVDVYRLLKPDTTGEAYTWWSNRGQAYA
FT                   NNVGWRLDYHLATPALGALARSEQIYKTIKFSDHAPITVDYDFTL"
FT   gene            298699..299382
FT                   /locus_tag="Vapar_0278"
FT   CDS_pept        298699..299382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0278"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: aav:Aave_0289 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16941"
FT                   /db_xref="GOA:C5CY37"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY37"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ACS16941.1"
FT                   /translation="MAVDGVQGSAVAQDFVQFALDAGVLRFGEFKTKAGRMSPYFFNSG
FT                   LFDDGAKIARLAGFYADRLIESGVEFDMIFGPAYKGIPLGATVAAELARRGRNHPFAYN
FT                   RKEAKAHGEGGNLVGAPLKGRVLIVDDVMSAGTAVRESIAAIEAAGATPHAVAIALDRQ
FT                   EKATENGVDVDHSAVQYVRNQLGLQVVAIATLDDLLNYLSGSAAADLGVHRERVLAYRA
FT                   RYGAN"
FT   gene            299393..300079
FT                   /locus_tag="Vapar_0279"
FT   CDS_pept        299393..300079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3927 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16942"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY38"
FT                   /inference="similar to AA sequence:KEGG:Rfer_3927"
FT                   /protein_id="ACS16942.1"
FT                   /translation="MPIHKPGLAARPFAAPWVLLLPMALWAGAVPAQPAPAPAAGIYSC
FT                   TDARGRTLTADRPIAECVDREQRELSPSGTTRRRIEPTYTARELAEREDRAREAALQAA
FT                   RLTDERRRERALLVRYPNAEVHDRERAEALVQIDAVIQAAKKRLAELAEDRHKIDEELE
FT                   FYKHDVSKAPGAVRRKLEDNAQSVAVQNRFIGEQEDEKKRVNARFDEERTRLKQLWSPQ
FT                   NGGIKR"
FT   sig_peptide     299393..299476
FT                   /locus_tag="Vapar_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.895) with cleavage site probability 0.882 at
FT                   residue 28"
FT   gene            complement(300083..301513)
FT                   /locus_tag="Vapar_0280"
FT   CDS_pept        complement(300083..301513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0280"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB region; GatB/Yqey domain protein; GatB
FT                   central domain protein; KEGG: dac:Daci_0351
FT                   glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16943"
FT                   /db_xref="GOA:C5CY39"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CY39"
FT                   /inference="protein motif:TFAM:TIGR00133"
FT                   /protein_id="ACS16943.1"
FT                   /translation="MRGYEVIIGFETHAQLSTASKIFSRASTAFGAEPNTQACAVDLAL
FT                   PGTLPVMNKGAVERAIKLGLALGSHIAPRSVFARKNYFYPDLPKGYQISQYEIPVVQGG
FT                   AVSFFLGEEKKTVRLVRAHLEEDAGKSLHENFIGQSGIDLNRAGTPLLEIVTEPDMRST
FT                   AEAVAYARELHKIVTWIGICDGNMQEGSFRCDANVSVRKPGEKLGTRREIKNLNSFKFM
FT                   QQAIDYEINSQINELEDGRKIEQATVLFDPDTGETRTMRTKEDAADYRYFPDPDLPPLA
FT                   IEAEWIERVRATMPELPRAMAERYVRDHGMSEYDAAQLTQSPALARYFDDAVKAGATPK
FT                   LASNWITGEMARRLNAQEIGIEAAPVTAQQLAQLVGRIADGTLPNNAARQVFDALWTGE
FT                   GSDVDAIIEARDLKPMSDTGALDRILDEVIAKNAKNVEEYRGGKEKALNGLVGQVMKAS
FT                   GGKANPAQVTELLKAKLG"
FT   gene            complement(301575..303062)
FT                   /locus_tag="Vapar_0281"
FT   CDS_pept        complement(301575..303062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0281"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: aav:Aave_0292
FT                   aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16944"
FT                   /db_xref="GOA:C5CY40"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY40"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ACS16944.1"
FT                   /translation="MSGELHQMGVADLAKALAERKVSAVEASQVFLGRMKAHESLGTFV
FT                   DVNEDVTLAQARAADALIAKGNAPALAGVPIAHKDIFVTTDFATTAGSKMLAGYRSPFD
FT                   ATVVRRLAEAGAVTLGKLSCDEFAMGSANENVAVPAVGHDKAVPVQNPWNRERIPGGSS
FT                   GASAAAVAARLAPAATGTDTGGSIRQPASFCGITGIKPTYGRASRYGMVAFASSLDQAG
FT                   PMARSAEDCALLLSAFCGPDLDRDSTSLDKPAEDFGRSLGDSLEGLRIGVPKEFFGEGV
FT                   APGVRAAIDAALVQYEKLGAKRVEVSLPLTELSIPVYYILAAAEASSNLSRFDGVKFGH
FT                   RAKQYKDLAEMYERTRAEGFGDEVKRRIMIGTYVLSHGYYDAYYLQAQKVRRMIADDFQ
FT                   QAFRQCDLIAGPAAPTTAWKIGEHGGDPVADYLADIFTLPASLAGLPGMSVPAGFDAGM
FT                   PVGLQLIGNYFGEAKLLNAAHRFQQATDWHMRTPEGF"
FT   gene            complement(303059..303358)
FT                   /locus_tag="Vapar_0282"
FT   CDS_pept        complement(303059..303358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0282"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; KEGG: aav:Aave_0293
FT                   aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16945"
FT                   /db_xref="GOA:C5CY41"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CY41"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ACS16945.1"
FT                   /translation="MSLSASDIARIASLARLQLASDESERMLSQINGFFDLVERMRSVD
FT                   TAGVEPLAHPVAAVEDITLRLRDDVASEPDNREANQKSAPAVEAGLFLVPKVIE"
FT   gene            303574..304617
FT                   /locus_tag="Vapar_0283"
FT   CDS_pept        303574..304617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0283"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: aav:Aave_0294 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16946"
FT                   /db_xref="GOA:C5CY42"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY42"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ACS16946.1"
FT                   /translation="MFGAFRRYFSTDLAIDLGTANTLIFARNKGIVLDEPSVVAIRHEG
FT                   GPHGKKVIQAVGREAKAMLGKVPGNIEAIRPMKDGVIADFVITEQMIKQFIKMVHPRTL
FT                   LTPSPRIIICVPCGSTQVERRAIKDAAEAAGATSVYLIEEPMAAAIGAGLPVSEASGSM
FT                   VVDIGGGTTEVGVISLGGMVYKGSVRVGGDRFDEAIINYIRRNYGMLIGEPTAEVIKKN
FT                   IGSAFPGSEVKEMEVKGRNLSEGVPRSFTISSNEVLEALTDPLNNIVSAVKNALEQTPP
FT                   ELGADIAERGMMLTGGGALLRDLDRLLAEETGLPVLVAEDPLTCVVRGCGIALERMDRL
FT                   GSIFTSE"
FT   gene            304703..305683
FT                   /locus_tag="Vapar_0284"
FT   CDS_pept        304703..305683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0284"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: pol:Bpro_0223 rod
FT                   shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16947"
FT                   /db_xref="GOA:C5CY43"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY43"
FT                   /inference="protein motif:TFAM:TIGR00219"
FT                   /protein_id="ACS16947.1"
FT                   /translation="MPLGTLDRTAPPLFNQGQSALSKLIFFGALSLFLMVADARFHLVQ
FT                   PLRAAVGAVLYPVQWLALKPVQMMMGGSRYFEDLQTAQRNEDEARKALMLQAERASQAD
FT                   TLAQDNARLRALLELRQTTQAPGRAAEVLYDAADPYTRKIVIDQGLTQGVAPGSPVIDA
FT                   HGVLGQVTQVQPFTSEVTLVIDRDLSIPVQNTRTGVRSVAFGDASAHGGGLELRFMAAN
FT                   ADLQEGDLLSTSGVDGVYPPGLPVAKIERIERRADSAFARIYCVPLARVTAARYVLVLA
FT                   PTGAPSAPPAPAPAAAVRKKPEAKPAAKADKATDKADKKAAERAR"
FT   gene            305680..306201
FT                   /locus_tag="Vapar_0285"
FT   CDS_pept        305680..306201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0285"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD; KEGG: pol:Bpro_0224
FT                   putative rod shape-determining MreD transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16948"
FT                   /db_xref="GOA:C5CY44"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY44"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ACS16948.1"
FT                   /translation="MIKRPGQQQLLLPVSPLFMWASLVVALLINMIPIGRAAWMPDLLA
FT                   LAIVFWGVHQPMRVGIGAAFVFGLCMDVHQSSMLGQHALSYTTLGFFAITIHRRLLWYP
FT                   VASQALQVLPLFALSQLIEVITRLVGGGVFPGWSVLVSPAIEAALWPLATALLLAPQLR
FT                   TPDPDENRPL"
FT   gene            306258..308225
FT                   /locus_tag="Vapar_0286"
FT   CDS_pept        306258..308225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0286"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: aav:Aave_0297 peptidoglycan
FT                   glycosyltransferase; TIGRFAM: penicillin-binding protein 2;
FT                   PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16949"
FT                   /db_xref="GOA:C5CY45"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY45"
FT                   /inference="protein motif:TFAM:TIGR03423"
FT                   /protein_id="ACS16949.1"
FT                   /translation="MTEIRNVAADLARFKRRVVVIGLAVLFAFSLLCARLVYLQVVRHE
FT                   DLAEQAESNRTAIVPVVPNRGLILDRNGIVLASNYSAYTLEITPSKVGDVEETIESLTQ
FT                   VLEISPRDRRRFKRLREDSRSFDSIPIRTRLSDEEVARFAAQRYRFPGVEIKARLFRNY
FT                   PHAELASHVLGYIGRINQREKTAMEDWDEEDQANYKGTDYIGKLGIEQSYEKTLHGQTG
FT                   VEQMETSAGGRAVRRLASHPATPGNTVMLSLDIKLQKLVEDMFGDRRGALVAIDPKSGE
FT                   VLAFVSKPTFDPNLFVEGIDTESWQALTESLDKPLLNRALRGTYPPGSTYKPFMALAAL
FT                   QTGKRGPNVVVNDPGYFNFGGHRFGSPEGNIGGVDMRRSIQLSSNIYYYSLANEMGVDL
FT                   IHDFMKPLGFGQITGIDLGGEVRGVLPSTEWKRNAYKRPEQKKWYAGETISLGIGQGYN
FT                   AFTMLQLAQATSIVADGGRKHKPHLVLATRNTVSGQVVPLPQPPAENLGYSAANVAVVR
FT                   EGLTSVVTSGTARGVFAGAGYQAAGKTGTAQAVTQAQNTKYNARALEEHQRDHALFMAF
FT                   APVNDPKIALAVIVENAGWGAGAAAPIARRVFDYWLMDQYPSEADMAAIKVGKATAPIG
FT                   KPRVASEVAWPAASAAATAP"
FT   gene            complement(308268..309542)
FT                   /locus_tag="Vapar_0287"
FT   CDS_pept        complement(308268..309542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0287"
FT                   /product="fumarylacetoacetase"
FT                   /EC_number="3.7.1.2"
FT                   /note="KEGG: aav:Aave_0256 fumarylacetoacetate hydrolase;
FT                   TIGRFAM: fumarylacetoacetase; PFAM: fumarylacetoacetate
FT                   (FAA) hydrolase; Domain of unknown function DUF1969"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16950"
FT                   /db_xref="GOA:C5CY46"
FT                   /db_xref="InterPro:IPR005959"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR015377"
FT                   /db_xref="InterPro:IPR036462"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY46"
FT                   /inference="protein motif:TFAM:TIGR01266"
FT                   /protein_id="ACS16950.1"
FT                   /translation="MSTTALNATHDPKLRSWVASANQAGCDFPIQNLPFGRFRTAGSSE
FT                   AFRIGVAIGDQVLDLKAAGLVDSDDMNALMNASVKERQALRAAISAGLAEGSSQQAAWA
FT                   KALLPQAKAEMTVPCRIGDYTDFYTGIHHATTIGKLFRPDQPLMPNYKWVPIGYHGRAS
FT                   SIGVSGQVFKRPQGQTKAPDAAEPGFGPSKRLDYELELGFFVGRGNALGEPIAIAEAED
FT                   HLFGVALLNDWSARDIQAWEYQPLGPFLSKNFASTLSPWIVTMEALAPFRARFERPAGD
FT                   PQPLAYLDAPSNRESGALDITLEVLLQTAKMRAEGLAPARLTRGNTTEAAYWTAAQLVA
FT                   HHTVNGCNLQPGDLLGSGTLSGPQPDEAGSLIELTQGGKQPITLPNGEKRTFLEDGDTL
FT                   VIRGYCERAGAVRIGLGEVSGTVVA"
FT   gene            complement(309568..310545)
FT                   /locus_tag="Vapar_0288"
FT   CDS_pept        complement(309568..310545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0288"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   reu:Reut_A2507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16951"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY47"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACS16951.1"
FT                   /translation="MKNAFGITRRAAAIALLAAPLLAAHAAEFPSKPIRFIVPYTPGGT
FT                   TDLVARTVGQQISQKLGQPVLIDNRGGAGGNIGMDAVAKAAPDGYTIGFGAISTNALNP
FT                   HIYKSMAFDPRRDFTAISLLGTSTIVLEVPASSPIRSVSDLVAAAKKNPGLPYATAGAG
FT                   TSMNLAGVMFAQMTGTELVHVAYKGSGPAITDMLGNNIGLMFDNLPASLPHIQAGKLRA
FT                   LAVAGPARSPSLPDVPTMAEAGLKGYALDPWFGVYGPANLPAPIVKALNEAFVEALAMP
FT                   EVKAKLQQAGFSPRGSTAQELATLTQTEYQRLGDVARKAGMTAD"
FT   sig_peptide     complement(310465..310545)
FT                   /locus_tag="Vapar_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            complement(310542..311855)
FT                   /locus_tag="Vapar_0289"
FT   CDS_pept        complement(310542..311855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0289"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /note="KEGG: pol:Bpro_2997 homogentisate 1,2-dioxygenase;
FT                   TIGRFAM: homogentisate 1,2-dioxygenase; PFAM: homogentisate
FT                   12-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16952"
FT                   /db_xref="GOA:C5CY48"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY48"
FT                   /inference="protein motif:TFAM:TIGR01015"
FT                   /protein_id="ACS16952.1"
FT                   /translation="MTNPTAHTERRYQSGFGNEYASEAVAGALPQGRNNPQRAPFDLYT
FT                   ELLSGTAFTAPRHENRRSWLYRRQPSVVSGRYQPYAQAHWTTGADREIALPPEPLRWHP
FT                   MPLEGGAAAADFIDGMHTIAANGDAESQVGIGSLMYLAGRSMDQRAFVNADGEMLVVPQ
FT                   QGRLVITTELGVLDVKPGEIALLPRGMAFKVALPDGLSRGYVCENYGAHFRLPELGPIG
FT                   SNGLANARDFQAPVAAFEDDGGAYELVKKFGGRFWKAPARQSPFNVVAWHGNLAPVKYD
FT                   TANFMVIGSISFDHPDPSIFTVLTSPSDTPGTANCDFVIFPPRWMVMENTFRPPWFHRN
FT                   LMSEFMGLVLGEYDAKPGGFKPGGASLHNCMVPHGPDEEAFDKATHADLKPHKLDNTLA
FT                   FMFESRYRFIPTDFALKSPALDTDYADCWAGLKDQFKP"
FT   gene            complement(311897..312091)
FT                   /locus_tag="Vapar_0290"
FT   CDS_pept        complement(311897..312091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16953"
FT                   /db_xref="InterPro:IPR021233"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY49"
FT                   /inference="similar to AA sequence:KEGG:Bpro_4536"
FT                   /protein_id="ACS16953.1"
FT                   /translation="MQQQLITAPNLEAPDDFYEALIEAHQGLSTEESHAFNARLVLVLA
FT                   NHIGSLAVLREAFEAARGS"
FT   gene            complement(312100..313737)
FT                   /locus_tag="Vapar_0291"
FT   CDS_pept        complement(312100..313737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0291"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: pol:Bpro_4535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16954"
FT                   /db_xref="GOA:C5CY50"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY50"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACS16954.1"
FT                   /translation="MIDYQSLRFDYRRHADQDASKPARHPVVIVGAGPVGLTLAIDLAL
FT                   RQVPVVLLDNDNTLSSGSRAICFAKRTLEVFDRLGCGDRMVDKGVSWHVGKVFFHGEQV
FT                   YRFDLLPEPGHERPAFINLQQYYVEGYLVERAATLPLIDLRWNHKVTGIEPRDDGALLT
FT                   IETPEGNYQLAADYVGACDGSRSNLRQLMGLEAKGRTFRDRFLIADITMDAQLPTERRF
FT                   WFDPPFHPGQSVLLHKQADGMWRVDFQLGWDADPVEERKPENIMPRVRALLDSIGFDGV
FT                   QFQIGWASVYTFACQRMERFRHGRVLFAGDSAHGVSPFGARGANSGVQDADNLAWKLAA
FT                   VLHGEAPDALLDSYASEREYAADENIRHSTRATDFITPKSEVSRLFRDAVLELTKRHAF
FT                   ARTLVNSGRLSLPAVLRDSPLNTPDTDVFAGAMVPGAAAADAPIVRADGSSGWLLRECH
FT                   VAQFTALLFGKDEAAERSLQALKACDLPLHVVRVEGATPAGELAVQRYDVQPGTVYLLR
FT                   PDQHVCARWRQPTAENIRAAIGRALAKA"
FT   gene            complement(313876..314835)
FT                   /locus_tag="Vapar_0292"
FT   CDS_pept        complement(313876..314835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0292"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pol:Bpro_4534 beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16955"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY51"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACS16955.1"
FT                   /translation="MSQAKKFASQADMEEKKITFSQISEHAWAYTAEGDPNTGIVIGDD
FT                   CVLVADTQATPAMAADVVRRIREVTDKPIKYVVLTHYHAVRVLGAAGYGAEHILASQDT
FT                   RDLIVERGEADKASEIGRFPRLFQNVETVPPGLTWPTMTFTGKMTLWLGKLEVQLIQLG
FT                   RGHTKGDTVVWLPGERTLLSGDLVEFGATPYAGDAYFQDWPQTLDNIAALKPAALVPGR
FT                   GAALTTPAEVAEGLAGTRNFISDVYASVQEGVKAGRDLNTVYKDTYAKLKPKYSQWVIF
FT                   DHCMPFDVSRAYDEASGHADPRVWTAERDIEMWKALEG"
FT   gene            314980..315843
FT                   /locus_tag="Vapar_0293"
FT   CDS_pept        314980..315843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0293"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   lch:Lcho_4298 IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16956"
FT                   /db_xref="GOA:C5CY52"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY52"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACS16956.1"
FT                   /translation="MAANDNDRAAQRGIQSIEVGGQLLRALVHHGRPMALKDLAREADM
FT                   TAAKAHPYMVSFGRLGLIEQDRASGHYLLGPLALQLGLISLQQADPVHIATPLIAEVAQ
FT                   RIGHTVALAVWGARGATIVRTAESPSPVHVNMRHGTVFSLTNTASGRVFAAYLQADAVR
FT                   QLLDAERQRQKQRKAGEEPPVAGMPPQPPLPSWSEFERQLQEVRAHGISRSEGEVIEGV
FT                   SAMAAPVFDHTGAIVLSVTAIGPAAIFDTAWDGEIARALKACAGTVSARLGATSGGRKA
FT                   SAPLDP"
FT   gene            315840..316589
FT                   /locus_tag="Vapar_0294"
FT   CDS_pept        315840..316589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0294"
FT                   /product="Silent information regulator protein Sir2"
FT                   /note="PFAM: Silent information regulator protein Sir2;
FT                   KEGG: aeh:Mlg_2040 silent information regulator protein
FT                   Sir2"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16957"
FT                   /db_xref="GOA:C5CY53"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY53"
FT                   /inference="protein motif:PFAM:PF02146"
FT                   /protein_id="ACS16957.1"
FT                   /translation="MSSLGTASSSTSPVESAIALLGAARRIAVLSGAGLSKASGISTYR
FT                   DADGLWMNQNALQFSHAEDLQRDPRRFTRFWARRLSTVEAAQPNPGHAALALLQRLRPA
FT                   TRLVTQNVDGLLSIAGGLDVLELHGSLRRWRCDHCGNRRGPWPFHRCMRCASRARPDVV
FT                   MFGEMLNPGVLHDAQVAAQESDVFMVVGSTAVVYPAAELPQLAMSRGARLITLNMEPLP
FT                   QLDAAAAVVLRGAAEVLLPRLLAGIGG"
FT   gene            complement(316600..316821)
FT                   /locus_tag="Vapar_0295"
FT   CDS_pept        complement(316600..316821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: har:HEAR0765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16958"
FT                   /db_xref="GOA:C5CY54"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY54"
FT                   /inference="similar to AA sequence:KEGG:HEAR0765"
FT                   /protein_id="ACS16958.1"
FT                   /translation="MNATRIIGILLIVAGIAGLGLGGFSFTKETHQAKLGPLEFSVKEK
FT                   QQVNFPAWASVAAIVVGGALVLLGGKKG"
FT   sig_peptide     complement(316738..316821)
FT                   /locus_tag="Vapar_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.949 at
FT                   residue 28"
FT   gene            complement(316865..317548)
FT                   /locus_tag="Vapar_0296"
FT   CDS_pept        complement(316865..317548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0296"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   pol:Bpro_0233 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16959"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY55"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ACS16959.1"
FT                   /translation="MMTMMKKNAVLRLPPRLAACAGLALLLLAGCSALPDKPARATLYD
FT                   FGPGPAASAPAANPPAAALPTLALAEIESNTRLDSTQILYRLGYADANELRPYGQSRWS
FT                   LAPAQLLRQRLRDALAERRTVLGPEESATIARAEGKVPDTLRISLDEFSHYFESASSSA
FT                   GLVRLRATLIRGTTGGDRVLGQRSFTVRRPAPSADAPGGVKALAAATDAAVAEVVQWVD
FT                   QLPRQ"
FT   sig_peptide     complement(317447..317548)
FT                   /locus_tag="Vapar_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.856 at
FT                   residue 34"
FT   gene            complement(317554..318525)
FT                   /locus_tag="Vapar_0297"
FT   CDS_pept        complement(317554..318525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0297"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: dia:Dtpsy_0246 mammalian cell entry related domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16960"
FT                   /db_xref="GOA:C5CY56"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY56"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ACS16960.1"
FT                   /translation="MENKAHAIAAGAFVLGLIAVLVGLVVWFTRDSTVRNTYELSTRDP
FT                   VSGLQPQAMVRYRGIAVGKVTSIDFDPKTKGNVRVRITVDQRVPLTTSSFATLSYQGVT
FT                   GLAFIALDDKGESNVALAPNNEDPPRIPLKPSMLAQLQDRGEAIVNQVDEATKRANQLL
FT                   SDDNQKRAADALENIAAASASANTLLKQLDNTVKTGLNPALAALPNTLSSVKTAAGDVS
FT                   RVANNFNTTVGRLNAPDGPIERLSEGTKALAQSVDSFNAATLPRVNRVADDTSRAVRRL
FT                   GRAADSINDNPQSLLFGNGGTAAGPGEPGFSAPPSTHSLARP"
FT   gene            complement(318540..319358)
FT                   /locus_tag="Vapar_0298"
FT   CDS_pept        complement(318540..319358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0298"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_0231 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16961"
FT                   /db_xref="GOA:C5CY57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY57"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS16961.1"
FT                   /translation="MNDSSVVVDIRKLWTVFKSADGEVVVHRDLELRIERGEVLSLVGG
FT                   SGTGKTVLLRQILGLEKPTKGTVEVLGQAPGELSAKGAANVGMLFQHGALFSAFSVLEN
FT                   IAFPLRELKLLPDELIRNAALVKLQMVGLEPRHANMSPADLSGGMIKRVALARALIMDP
FT                   PLLLLDEPTAGLDPEASDSFCDLLRGLHRELGLTVVMVTHDLDTLFDLSTRIAVLADHK
FT                   VIVSGSAREVIAYPHPFIHEYFLGGRGQRALEALHDKPANAAPAPAGAAR"
FT   gene            complement(319355..320521)
FT                   /locus_tag="Vapar_0299"
FT   CDS_pept        complement(319355..320521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0299"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   dia:Dtpsy_0244 protein of unknown function DUF140"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16962"
FT                   /db_xref="GOA:C5CY58"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY58"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ACS16962.1"
FT                   /translation="MSLATPPADAPAADSVLPRIDEREQDGRSWTVASGRWTTLAMSSR
FT                   SAWQALSKDLAGAPPADGRAWDLRPIEQLDHIGAQLLWDHWRHRWPATLELSPQHKAVL
FT                   DQVAQFTVGTPEEPPPTLAERLRHFSHTGARGLEVARDFVGLIGQLALDACTLLRAPHR
FT                   GPWRDFSGHLYQFGATALHITALVGLLIGVVLAYLISQQLRQYGAEAFVVNILGLSLIR
FT                   ELGPVLAAVLIAGRSGSAITAQIGVMRVTEELDAMRVMGIPHGFRLVMPRVMALAIAMP
FT                   LISLWTSMAALLGGMLAADAALDISPAYFLSALPRAVPISNLWLALAKSAVFGILIALI
FT                   GCYFGMKVKPNTESLGRGTTSSVVTSITAVILVDALFAVLFKGVGFRA"
FT   gene            complement(320670..321575)
FT                   /locus_tag="Vapar_0300"
FT   CDS_pept        complement(320670..321575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0300"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: pna:Pnap_0181 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16963"
FT                   /db_xref="GOA:C5CY59"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY59"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS16963.1"
FT                   /translation="MTAAALDLQILRAFVLAAREGNVSRAAERLHLTQPAVSLQLKRLA
FT                   EETGLQLFTRTPHGLALTADGAALLPQAERVLAAVGDLQQAARNLQGTVRGALRIGTIL
FT                   DPEFTRLGVFLRELVESAPQIETELRHGMSGTVLAQVLRGELDVGFHLDADGGDAATPA
FT                   PLAARTLTRFTYRVVAPAGWGPQVLGRDWKALAALPWLATPPESAHHQLLEKVFGPLGL
FT                   SPRRVALVDQEASMLDLLKSGVGLSLLRDSIAIRESQSHGLVMADRVQLDCALRFVSLA
FT                   ARRNEPVIASAWNALARAWN"
FT   gene            321714..323342
FT                   /locus_tag="Vapar_0301"
FT   CDS_pept        321714..323342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0301"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: pna:Pnap_0180
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16964"
FT                   /db_xref="GOA:C5CY60"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY60"
FT                   /inference="protein motif:PFAM:PF00732"
FT                   /protein_id="ACS16964.1"
FT                   /translation="MSDNTFDYIVIGGGTAGALMCNRLTRKSQQRTLLIEAGRKDDYHW
FT                   IHIPVGYLYCIGNPRTDWLYSTEPDAGLNGRVLRYPRGKTLGGCSSINGMIYMRGQSRD
FT                   YDQWAQLTGDDAWRWQNVLPDFKKHEDYYLGADELHGAGGEWRVEKQRLRWDILDAFAE
FT                   AAVQAGVPHSTDFNRGSNEGVGYFQVNQKNGWRWNTAKAFLRPVCYGRPNFEMWVNAHV
FT                   TKLIVETQPDGSRRCTGVQVWDGREMVIAHATREVVLCAGSIGSPQILQLSGIGPAELL
FT                   RQHGIEVVLDAPGVGANLQDHLQIRAVYKINGAPTLNVLASSMVGKAKIGLEYLMKRSG
FT                   PMSMAPSQLGAFTRSSPEHEWPNLEYHVQPLSLDAFGDPLHSFPAFTASVCNLNPTSRG
FT                   SVRIKSPRFQDAPAIAPNYLSTDEDRKVAADSLRVTRRIASQPALAKYKPEEWKPGVQY
FT                   QSDEDLARLAGDIATTIFHPVGTTKMGADGDPMAVLDSKLRVRGVQGLRVVDAGAMPTI
FT                   TSGNTNSPTLMMAEKAAGWILEANG"
FT   gene            complement(323662..324738)
FT                   /locus_tag="Vapar_0302"
FT   CDS_pept        complement(323662..324738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0302"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rfr:Rfer_0883 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16965"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY61"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS16965.1"
FT                   /translation="MSRFQKIFSFFSLRRTVLGAAAVAALAAGGAAGAQTKTLYIGMNG
FT                   GTMEKAYTQYVFPAFEKLYGAKVVVVPGTSSDILAKAQANKDRPQMHVMFLDDGIMVRA
FT                   IGMGLCQKQRPNPSLAEIYPAARFKDDMASGVSLGMTGLAYNAKMFKEKGWAPPTSWMD
FT                   LADPKYKGKVVFQSMSSSSFGLHGFLMFNRIQGGNDKNVEPGFKAWPTTIGPNVLEYIP
FT                   SSAKLSEMVQTGEAAIFPLTPTAVAALKTKGIPVEYAPPKEGAVVLMVGQCVIANNSEP
FT                   ELSQKLAEFLLSPLAQANVLQYGAQIPTNPKAPAVGDGVAQVADINKWMKTAVTIDWDS
FT                   INANRPAWNARWNKTIEK"
FT   sig_peptide     complement(324634..324738)
FT                   /locus_tag="Vapar_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.879 at
FT                   residue 35"
FT   gene            complement(324751..325881)
FT                   /locus_tag="Vapar_0303"
FT   CDS_pept        complement(324751..325881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0303"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rfr:Rfer_0884 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16966"
FT                   /db_xref="GOA:C5CY62"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY62"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACS16966.1"
FT                   /translation="MSGRRTLRTDVAIVGGGIVGASAALALRQMGIGVVLLERDLCGSR
FT                   SSGVNYGGVRRQGRPIDQLPLAQRAHRIWGRLRETIGTDGEYLRSGHFKIARSEADMAS
FT                   LERYRAQSSDFDLGLELISDARLRERCPWLGTRAVGGSLCAEDGQANPRLVSPAFALAA
FT                   QRAGAQVFERHKVDEVAHDGQAFMLRSGNALEVHAPALLNCAGAWAGSIATEFGEEVPL
FT                   QSGHPAMAVTEPLPFFMDWSLGVEGGGIYCRQVARGNLVLGGGGKGVALDADRARSDRD
FT                   AIASLSAQAVELLPALRHAHFIRTWSGTEGYLPDRQPVLGPSRTTPGLFHGFGFSGAGF
FT                   QIGPAAGEVLAELVRDGRSSTPIESFSIERFTPTPP"
FT   sig_peptide     complement(325801..325881)
FT                   /locus_tag="Vapar_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.824) with cleavage site probability 0.756 at
FT                   residue 27"
FT   gene            complement(325878..327296)
FT                   /locus_tag="Vapar_0304"
FT   CDS_pept        complement(325878..327296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0304"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: rfr:Rfer_0885 BFD-like
FT                   (2Fe-2S)-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16967"
FT                   /db_xref="GOA:C5CY63"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017224"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY63"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="ACS16967.1"
FT                   /translation="MTASSSAALQPVIVGAGPAGVRAAQALVAHGLRPVVIDEASRAGG
FT                   QIYRQPPASLAQRSAQALYGFEAGRADALHAAFDSLRERIDYRPDSLVWNAQGGRLDVL
FT                   HGPTRSTSSLSYGQLIVATGATDRVLPVPGWTLPGVYTLGGAQVALKFQGCAIGERVVF
FT                   MGTGPLLYLVAYQYAKAGAKVIAVLDTARLADQLAATPAMLRQPAVFAKGVYYVAWLRA
FT                   HGVALHGGVRPLRVLGDAQESRVAGVAWHDGREERTLACDAVGFGYALRSETQLADLLG
FT                   CRFDYAPLHRAHLPVRDAAGRSSVRGVYLAGDGAGIMGADAAEWAGERAALALLADNGV
FT                   AVDVARAAELERKLGKLAGFREGLERAFPVPRDWAAHAPDELVVCRCENITAGTLRQTV
FT                   AAAGADEMNRLKALSRVGMGRCQGRMCGAAAAEILAQATGLPLQQVGRLRGQAPIKPIP
FT                   IHLAAAPSAEGAGE"
FT   sig_peptide     complement(327225..327296)
FT                   /locus_tag="Vapar_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.815 at
FT                   residue 24"
FT   gene            complement(327293..327598)
FT                   /locus_tag="Vapar_0305"
FT   CDS_pept        complement(327293..327598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16968"
FT                   /db_xref="GOA:C5CY64"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY64"
FT                   /inference="similar to AA sequence:KEGG:Rfer_0886"
FT                   /protein_id="ACS16968.1"
FT                   /translation="MSLPKLQPLLHRLAETGRAAVPFTLDGQPASALVGDTVLTAVLTQ
FT                   AAQLRRNEFSGAPRAGFCMMGACQDCWIATEQGERLRACSTFIAPGMALVTGRSGA"
FT   gene            complement(327599..328393)
FT                   /locus_tag="Vapar_0306"
FT   CDS_pept        complement(327599..328393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0306"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rfr:Rfer_0887
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16969"
FT                   /db_xref="GOA:C5CY65"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY65"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS16969.1"
FT                   /translation="MTKNGPLALAFNALVITFMLAPLVVVCIVAFTPENTLTIPTTHFS
FT                   LRWFEAVFAHPDFMQSFWNSLWLALASATIATLLAVPAGMAITRYTFPGRDFLNGLFLS
FT                   PLIIPHLVLGVALLRLFALVGGTGSFGWLVMAHALIVTPYTLRLVVAALVGFDRSAEQA
FT                   ALSLGASQATVFRRITLPMILPGVTGGWLLSFINSFDEVTMSIFVTSPSTVTLPVRMYM
FT                   YATESIDPLMAAVSALMVAVTAIAMVVLDRVYGLDRVLVGRR"
FT   sig_peptide     complement(328313..328393)
FT                   /locus_tag="Vapar_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.657) with cleavage site probability 0.405 at
FT                   residue 27"
FT   gene            complement(328398..329249)
FT                   /locus_tag="Vapar_0307"
FT   CDS_pept        complement(328398..329249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0307"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rfr:Rfer_0888
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16970"
FT                   /db_xref="GOA:C5CY66"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY66"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS16970.1"
FT                   /translation="MKSKATPWWLSGPALLLFAALLVVPLALTAVLSFNVYDPATGPKA
FT                   GEFTLAHYAQVFTDSYYHGIFWRTFWISALVTLICVLVGAPEAYVLSRMRNPWRSVLLL
FT                   VVLAPLLVSVVVRAFGWSMLLGPEGAVNGLLRLVGIGPVKMLYTETAVIVALVHVMLPF
FT                   MVIPVWTSLQKLDAGVENAALSLRASPFTTLRRIVLPQVMPGILSGSLIVFGLAASSFA
FT                   IPGLLGGRRLKMVATVVYDEYLSELNWPLGAAVALTLLVANLIVMLSYNRLVEGRYKKA
FT                   LG"
FT   sig_peptide     complement(329160..329249)
FT                   /locus_tag="Vapar_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.743 at
FT                   residue 30"
FT   gene            complement(329246..330316)
FT                   /locus_tag="Vapar_0308"
FT   CDS_pept        complement(329246..330316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0308"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: rfr:Rfer_0889
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16971"
FT                   /db_xref="GOA:C5CY67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY67"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS16971.1"
FT                   /translation="MSFLRLTDLTKFYGATRAVSAMNLTVEKGEFVSLLGPSGCGKTTT
FT                   LQMIAGFEPVSSGRIELAGKDITHAKANTRGLGIVFQTYALFPHMTVADNVSFGLEMRK
FT                   MPKAERAERVKQALALVHLEAHAARYPRELSGGQRQRVALARALVIEPPVLLLDEPLSN
FT                   LDAKLREEMQFELRQIQRKVGTTTVMVTHDQSEAMSISDRVVVMEGGCATQIDHPHRVY
FT                   EHPSTRFISTFVGKANLLDGRVTASGARSCQVAVGALAVEVDDSGYKPGDAVLMSVRPE
FT                   KLQLVEAGRGRLDGQVLERFFLGSQWLYRLGTPAGDLMVLSPNDGRDALDEGHAAGIDW
FT                   PAHCTRLLPAGEAVAA"
FT   gene            330521..331381
FT                   /locus_tag="Vapar_0309"
FT   CDS_pept        330521..331381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0309"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   rfr:Rfer_0890 IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16972"
FT                   /db_xref="GOA:C5CY68"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY68"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACS16972.1"
FT                   /translation="METLSAASGGVPRVFSVIRALGAVQAEGGRVTQIARSVGLTQATT
FT                   HRLLQSLMAEGMVEQDERSKLYRLSIDFFALAASAGNPGDLRSICRPVLLRLCASLGDS
FT                   IFLLARSGFDAICLDRSEGPFPIRSFTGDIGGRIALGVGQGALAILAFLPEAEREEVIR
FT                   FNLSRVREYGVYDEVYLRTEIERVRQAGYAGRNTGLLEGMAGVAVPILDREGRAVAALS
FT                   VGTIADRLNADRMPTVVELLKREAAAIGPKINPFDATLRRPAQSLAGSPAGQRISLPEP
FT                   PGPAA"
FT   gene            331550..333088
FT                   /locus_tag="Vapar_0310"
FT   CDS_pept        331550..333088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0310"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: rfr:Rfer_0880
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16973"
FT                   /db_xref="GOA:C5CY69"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY69"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACS16973.1"
FT                   /translation="MPEAQAFLSVATEIAQLLQRLGVPGAAHTGGELTVRSPVTGEVVA
FT                   QVRQTTAAEAAAAIGQAHEAFKAWRSVPAPRRGELVRLLGEELRAAKADLGRLVTLEAG
FT                   KIPSEGAGEVQEMIDICDFAVGLSRQLYGLTLATERAEHRMMETWHPLGVCGVISAFNF
FT                   PVAVWSWNAALALVCGDSVVWKPSEKTPLTALAVHAIAQRALARFGDAPEGLLGLLLGQ
FT                   RDIGEVLVDDHRVPILSATGSTAMGRQVGPKLAARFARAILELGGNNAAIVTPSADLDL
FT                   TLRAIAFSAMGTAGQRCTTLRRLFVHDSVYDALVPKLAKVYGNVQVGDPREAGTLVGPL
FT                   IDRAAFDGMQKALGESREIGATVHGGQRVEGIGTKDAFYVRPALVELKSHDGPVLRETF
FT                   APILYVVRYSALDDAIEWHNAVGAGLSSSIFTLNVREAERFLSSAGSDCGIANVNIGPS
FT                   GAEIGGAFGGEKETGGGREAGSDSWKAYMRRATNTINYSTALPLAQGVTFEIND"
FT   gene            333183..334088
FT                   /locus_tag="Vapar_0311"
FT   CDS_pept        333183..334088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0311"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   dac:Daci_5673 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16974"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY70"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS16974.1"
FT                   /translation="MKMQLKTLAIAAALLALAFGAAAQQAPAGGTLDKIRSSGKAVLGV
FT                   REASPPMAYMLGANEKYVGYHVELCERVLKDIAPQAKLEYMAVTAQNTIPLVQNGTLDI
FT                   GCGPTTNNTARQQQVAFALTTYVSEVRMATRVDSGISSLDQLAGRTVSASTGTTAVQLL
FT                   RKRERAQNTTITTMLGKDHLESFLLMESGRADAFVLDDNLLAGIIANAKNPSAYRIVGD
FT                   ALGSEPIALLFRKDDAIFKAAVDDALRRLMKSGELEKIYTKWFVAPIPPKNTSLNLPMS
FT                   AALKQLIAEPNDKPLEAYAK"
FT   sig_peptide     333183..333254
FT                   /locus_tag="Vapar_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.862 at
FT                   residue 24"
FT   gene            334085..335326
FT                   /locus_tag="Vapar_0312"
FT   CDS_pept        334085..335326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0312"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   rfr:Rfer_0881 aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16975"
FT                   /db_xref="GOA:C5CY71"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY71"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACS16975.1"
FT                   /translation="MTSTVLDSALSASAFEPAQRVRAIGVSEILRITDHANALKRAGRP
FT                   VIVLGAGEPDFDTPEPIRAAASRAMERGDTRYTVLDGSPAMKAAVQLKFRRDNVLDFAL
FT                   DEISVGAGAKQVIFNALMASLNPGDEVILPAPYWTSYADIVQICGGVPVSVPCGETNGF
FT                   RLDAAQLEAAITPRTRWLFLNSPSNPCGAAYSAAQLAPLCEVLLRHPKVWVLADDIYEH
FT                   ILYDGHAFATPAAVEPRLRDRTLTVNGVSKAYAMTGWRVGYGAGPRALIAAMAVVQSQS
FT                   TSCPSSVSQAAAIEALTGPQQVVAERRNDFQARRDFVVAALNRAPGLHCRVPEGAFYTF
FT                   ASCAGVLGRRTRSGALLQTDSDFCSYLLQDFEVAVVPGSVFGLAPYFRISYATSMAQLE
FT                   EACARIAAACEALE"
FT   gene            335346..337019
FT                   /locus_tag="Vapar_0313"
FT   CDS_pept        335346..337019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0313"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: rfr:Rfer_0882 acetolactate synthase 2 catalytic
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16976"
FT                   /db_xref="GOA:C5CY72"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY72"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACS16976.1"
FT                   /translation="MTSPRTGGQILVDQLITHGVRQLFCVPGESFLAVLDALHDAAIDV
FT                   TVCRQEGGATMMAEAQGKLTGRPGVCFVTRGPGATNAAAGVHIAHQDSTPLLLFVGQVA
FT                   REALGREAFQELDYGAVFGTMAKWVVQIDDPARVPELVSRAFHVATSGRPGPVVIALPE
FT                   DMLTEAATVADAQPYAVVETHPGAAQIAELQQRLSQAERPVVILGGSRWSEAATQQFAA
FT                   FAEAFSLPVYCSFRRQMLLSAEHPCYAGDLGLGANPRMLERIRNADLVLLAGGRLSEVP
FT                   SQGYELLAIPQPKQALVHVHADADELGKLYRPAQGIHATPQAFAEAVSALRPAAPPAWQ
FT                   AGTKAAREDFLRWSDPAPIRIPGPLQMGEVMQHLREVLPADTIFCNGAGNFATWVHRFW
FT                   PFRAFASQLAPTSGSMGYGLPAGVGAKRLWPQREVVVFAGDGDFMMHGQEFATAVQYGL
FT                   PILVVLLDNAMYGTIRMHQEKHYPGRVSATQLKNPDFRGYAEVFGGHGERVASTEEFGP
FT                   ALARARASGKPAILHCLLDPEAITPASTLQSIRKAALAAG"
FT   gene            complement(337028..337327)
FT                   /locus_tag="Vapar_0314"
FT   CDS_pept        complement(337028..337327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16977"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY73"
FT                   /inference="similar to AA sequence:KEGG:Pnap_0179"
FT                   /protein_id="ACS16977.1"
FT                   /translation="MSMSESERIALAARLHVALRRKHGRVTDTEWMATNAEYATEIVRM
FT                   TRAHAVETKDEDLYLLATRLEQAMEPLARAARLAARAPDGHLPNPLPRYADGLG"
FT   gene            337737..338495
FT                   /locus_tag="Vapar_0315"
FT   CDS_pept        337737..338495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0315"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   pol:Bpro_0226 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16978"
FT                   /db_xref="GOA:C5CY74"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY74"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACS16978.1"
FT                   /translation="MEMLVVTGASLLAGFVDSIVGGGGLILVPALFAVFPGAPPATLLG
FT                   TNKSASIWGTAAAAAQFSQRVQMRWGALWPAALLGFAGSMLGAWGVTVFPGDFLRRALP
FT                   VVLLGVLLYTIARKDLGRNHVPRFSGRAETLAACAIGLSIGFYDGFFGPGAGSFLVFLF
FT                   VRWMGYDFLNASASAKIINTLTNAAALLLLALKGHVWWHYGLVMAVANVAGSLLGTRVA
FT                   LKHGAGFVRGVFIVVVSALILKTAYDAFLK"
FT   gene            338518..339861
FT                   /locus_tag="Vapar_0316"
FT   CDS_pept        338518..339861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0316"
FT                   /product="chromate transporter, chromate ion transporter
FT                   (CHR) family"
FT                   /note="TIGRFAM: chromate transporter, chromate ion
FT                   transporter (CHR) family; PFAM: Chromate transporter; KEGG:
FT                   mpt:Mpe_A2526 CHR transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16979"
FT                   /db_xref="GOA:C5CY75"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY75"
FT                   /inference="protein motif:TFAM:TIGR00937"
FT                   /protein_id="ACS16979.1"
FT                   /translation="MPPPEPVEPPAPIGFWQAFAYWLKLGFISFGGPAGQIALMHQELV
FT                   ERRRWISEKRFLHALNYCMLLPGPEAQQLATYIGWLMHRTWGGIAAGVLFVLPSLFILV
FT                   GLSWAYMAYGQVPAVAGLLYGVKPAVTAIVLFAAWRIGSRVLKNAWLWAIAVAAFVAIF
FT                   ALRLPFPLIVLAAGAIGYFGSRFAPAYFAAGGGHGSAASSAGPALIDDHTPTPQHALFG
FT                   WGRFARVLAVFFLLWLGALGALTALYGWHGALTQMAWFFTKAALLTFGGAYAVLPYVFQ
FT                   GAVDHYQWLSATQMIDGLALGETTPGPLIMVVSFVGFVGGWGQALFGPEAPFAAGAAAA
FT                   AVVTFFTFLPSFLFILLGGPFIESTHGNLKFTAPLTAITAAVVGVIVNLAVFFAYHVLW
FT                   PAGLSGPFEIASAVIGVLAALALFRFKAGVIPVVLASALTGMAWQLLH"
FT   gene            complement(339875..341386)
FT                   /locus_tag="Vapar_0317"
FT   CDS_pept        complement(339875..341386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0317"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: pna:Pnap_3237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16980"
FT                   /db_xref="GOA:C5CY76"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY76"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ACS16980.1"
FT                   /translation="MDLIHNLSIGFGVAFTFTNLLYCLLGCILGTLIGVLPGIGPVATI
FT                   AMLLPATYALPPVSALIMLAGIYYGAQYGGSTTAILVNLPGESSSVVTCIDGYQMARQG
FT                   RAGPALAAAGLGSFFAGCVGTLILAAFAPPLTELAFKFGPAEYFSLMTLGLIGAVVLAS
FT                   GSLLKAVAMIVLGLLLGIVGTDVNSGVARFSFDIPELTDGIGFVVIAMGVFGYGEIIGN
FT                   LSQPDDEREVFTHKVKGLWPTKEDFKRMTPAVLRGTALGSALGILPGGGALLAAFAAYA
FT                   LEKKIKMRPGEIAFGKGNIRGVASPESANNAGAQTSFIPLLTLGIPPNAVMALMVGAMT
FT                   IHNIQPGPQVMTSNPELFWGLIASMWIGNAMLIVLNLPLIGMWIKLLTVPYKFLFPAIV
FT                   LFCAIGVYSTNNNTFDVWMVAIFGFIGYLFLKLRTEPAPLLLGFILGPMMEENLRRALL
FT                   LSRGAWSVFVTRPLSAGLLVAAALLLGIVLLPSIKAKREEAFVEE"
FT   gene            complement(341399..341887)
FT                   /locus_tag="Vapar_0318"
FT   CDS_pept        complement(341399..341887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0318"
FT                   /product="protein of unknown function DUF1468"
FT                   /note="PFAM: protein of unknown function DUF1468; KEGG:
FT                   aav:Aave_1069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16981"
FT                   /db_xref="GOA:C5CY77"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY77"
FT                   /inference="protein motif:PFAM:PF07331"
FT                   /protein_id="ACS16981.1"
FT                   /translation="MRIKSQADFFSGVMFTAVGGAFGIGATTYNIGDGARMGPGYFPLM
FT                   LGILLAILGAFIMFQALVVETADGDKIGKWAWKPLAFVLGANLAFGVLLGGLPSIGLPA
FT                   MGMIVAIYALTIISSMAGEHFKLRDVLVLSTILAAGSYVAFIWALKLQIQVWPTFISG"
FT   gene            complement(342070..342483)
FT                   /locus_tag="Vapar_0319"
FT   CDS_pept        complement(342070..342483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0319"
FT                   /product="RNP-1 like RNA-binding protein"
FT                   /note="PFAM: RNP-1 like RNA-binding protein; SMART: RNP-1
FT                   like RNA-binding protein; KEGG: mpt:Mpe_A3805 RNA-binding
FT                   region RNP-1"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16982"
FT                   /db_xref="GOA:C5CY78"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY78"
FT                   /inference="protein motif:PFAM:PF00076"
FT                   /protein_id="ACS16982.1"
FT                   /translation="MGKKLYVGNLAYSVRDNDLEQAFGEFGSIVSAKVMMERDTGRSKG
FT                   FGFVEMGTDAEALAAVEAMNGHSLQGRALTVNEARPMEARPPRTGGGGGYGGGGGGGYG
FT                   GGGGGGGYGGGGGGRSGGGGGYGGGGGGGRGGY"
FT   gene            complement(342665..342898)
FT                   /locus_tag="Vapar_0320"
FT   CDS_pept        complement(342665..342898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16983"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY79"
FT                   /inference="similar to AA sequence:KEGG:Daro_1138"
FT                   /protein_id="ACS16983.1"
FT                   /translation="MKPEDLQRLVTLEMPFGKHKGTLIADLPGNYLNWFAREGFPSGEI
FT                   GRLLHLMHEIDHNGLSGLLQPLRNRPSGRDVS"
FT   gene            complement(342904..343278)
FT                   /locus_tag="Vapar_0321"
FT   CDS_pept        complement(342904..343278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0321"
FT                   /product="translation initiation factor SUI1"
FT                   /note="TIGRFAM: translation initiation factor SUI1; PFAM:
FT                   translation initiation factor SUI1; KEGG: pol:Bpro_2734
FT                   translation initiation factor 1 (eIF-1/SUI1)"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16984"
FT                   /db_xref="GOA:C5CY80"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY80"
FT                   /inference="protein motif:TFAM:TIGR01158"
FT                   /protein_id="ACS16984.1"
FT                   /translation="MATMKSNPASALVYSTEAGGRMCPDCRAPMAQCRCKQIKARAPAT
FT                   DGIVRVSHETKGRKGKGVTVVKGLALDAAALAALGKQLKTACGSGGTVKDGLIEIQGDH
FT                   RELVIAALSKQGHTVKRAGG"
FT   gene            343335..344609
FT                   /locus_tag="Vapar_0322"
FT   CDS_pept        343335..344609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0322"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; KEGG: pna:Pnap_2407 DEAD/DEAH box
FT                   helicase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16985"
FT                   /db_xref="GOA:C5CY81"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY81"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACS16985.1"
FT                   /translation="MPFDSLGLAPALVQAAAESGYAAPTAIQAAAIPAILQGRDVRGSA
FT                   QTGSGKTAAFSLPLLQRLAAEPAQAPRRVRALVLVPTRELAAQVGETLRSLAQHLPERL
FT                   KIAIAFGGVSINPQMMSLRGGADIMVATPGRLLDLVEHNALKLGAVSTLVLDEADRLFD
FT                   LGFAEELGRILALLPARRQNLLFSATFPPAIQALADGTLRDPAVIDVQGEPGTEPAIVQ
FT                   RVIEVDANRRTQLLRHLLKENEWDRVLVFVATQHAAQTVAEKLYKNGVYAVPFHGDIAQ
FT                   GTRTGILAQFKESRWDVVIATDLAARGIDIAQLPVVINYDLPRSPTDYIHRIGRTGRAG
FT                   ESGLAISFVSAATEAHFRLIEKRQGLSLPRERIEGFEPTEAPVPMADASGTGGIKGKRP
FT                   SKKDKLRAAAALAAAQHDAGEKKND"
FT   sig_peptide     343335..343403
FT                   /locus_tag="Vapar_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.701 at
FT                   residue 23"
FT   gene            complement(344634..345386)
FT                   /locus_tag="Vapar_0323"
FT   CDS_pept        complement(344634..345386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0323"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; SMART: band 7 protein; KEGG:
FT                   pol:Bpro_3547 SPFH domain, band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16986"
FT                   /db_xref="GOA:C5CY82"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY82"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACS16986.1"
FT                   /translation="MFTFGIGTVLLVLLVVLLFSAIWIFREYERGIVFTLGRFSRVAGP
FT                   GLVIVVPAIQQVVRVDLRTVVLEVPTQDVISRDNVSVKVSAVVYFRIVDAEKAIIEVRD
FT                   FFNATSQLAQTTLRSVLGKHQLDDMLAEREKLNLDVRESLDVQTASWGIKVSNVEIKQI
FT                   DLTESMVRAIARQAEAERERRAKVIHAEGELQASEKLFQAARVLAQEPQAIQLRYLETL
FT                   TVIGADKNTTIVFPLPVDLLASFLHKPA"
FT   sig_peptide     complement(345324..345386)
FT                   /locus_tag="Vapar_0323"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.689) with cleavage site probability 0.683 at
FT                   residue 21"
FT   gene            complement(345477..346637)
FT                   /locus_tag="Vapar_0324"
FT   CDS_pept        complement(345477..346637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0324"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: vei:Veis_1896
FT                   acyl-CoA dehydrogenase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16987"
FT                   /db_xref="GOA:C5CY83"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY83"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS16987.1"
FT                   /translation="MQYTHEHLEIQKTLRRFIDSEINPHVDEWEEAEIFPAHEVFRKLG
FT                   KLGMLGLNKPEAFGGAGLDYSYAMAMAEALGHVSCGGVPMAIGVQTDMCTPALARFGSD
FT                   ELRREFLAPAIAGETVGCIGVSEPGAGSDVAGLKSHARKDGADYLISGQKMWITNSLQA
FT                   DWMCMLVNTSDGPVHRNKSLVMVPMDSPGIEKAKKIRKIGMHSSDTGLIHFDNVRVPQR
FT                   YRIGEEGQGFVYQMQQFQEERLWAAASSLEPMEDCIAQTIEWAQQRQMFGATLADQQWV
FT                   QFKLAELKTEVEALRALAYRACDLHVQGQDVLELASMAKLKTGRLTRQVADTCLQFWGG
FT                   MGFTLENRVSRLYRDGRLGSIGGGADEVMLGILAKTMGIAKRPPRG"
FT   gene            complement(346652..347566)
FT                   /locus_tag="Vapar_0325"
FT   CDS_pept        complement(346652..347566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0325"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rfr:Rfer_3507 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16988"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY84"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS16988.1"
FT                   /translation="MNDSSRYRSVFSPGLFAGQVILVTGGGSGIGRCTAHELASLGAQV
FT                   VLAGRNADKLQQVQAEIADAGGKASIQAFDIRQEEAVRAAVADIVAAHGRIDGLVNNAG
FT                   GQYLTPLAAISAKGWEAVIHTNLTGGFLVARECFVQSMQAYGGAIVNIVADMWGSMPHM
FT                   GHSGAARAGMVSFTETAALEWAARGVRVNAVAPGYIASSGMDHYPPEAGEMLRAMRDTV
FT                   PAGRFGNEAETSAAIAFLLSPAASFISGSVLRVDGARPQVRMGWPMALPDAQVRQRAAV
FT                   RPFGGFHLAETPRVFRDGGEAND"
FT   gene            complement(347610..349559)
FT                   /locus_tag="Vapar_0326"
FT   CDS_pept        complement(347610..349559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0326"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; biotin carboxylase domain protein;
FT                   biotin/lipoyl attachment domain-containing protein;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   KEGG: rpc:RPC_3200 carbamoyl-phosphate synthase L chain,
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16989"
FT                   /db_xref="GOA:C5CY85"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY85"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ACS16989.1"
FT                   /translation="MSFGKILIANRGEIAVRVMRTARAMGCRTVAVYSSADADAEHVRQ
FT                   ADQSVCIGEPLPAQSYLDIAAIVEAARSSGAQAVHPGYGFLAENADFAQACRDAGLVFV
FT                   GPSPEAIRAMGDKAAAKRLMQAAGVPCIPGYQGEDQSAATLAAEAARIGWPVMIKATAG
FT                   GGGRGMRLAPSAESFAELLQSAQSEALHAFGDANVILELAIAAPRHIEIQVFADRHGNA
FT                   IHLGERDCSVQRRHQKLIEESPSPAVSEALRERMGATAVAATRAIGYEGAGTLEFLLDA
FT                   DGQYWFMEMNTRLQVEHPVTEAVTGLDLVELQLRVAAGEVLPLAQQDVRLRGHAIEVRL
FT                   CAEDPRQGFMPQSGTLAAWRPSPALRIEHALRDGAAVPPFYDSMIAKLVAHGPTREEAR
FT                   RRLVAGLQDTVALGLATNQRFLQRALTHPVFAGGSATTAFIAEHADALLAPDPAMARRT
FT                   AWLAALLLQLGERGWPSPLAHTLPNALRFSLDGQVHAARVTPRGAGCFDIALDAAAPVP
FT                   IELLSLTGDGALRFSCDGVSERALAVRESATRLWLHFHGQAFDLQDLTHAAVPRAEAAG
FT                   GDGLLRASMNGRVIALLVAEGEAVAAGQPIATLEAMKMEHVHCAPRAGRVAALHVAVGA
FT                   QVAARHVVAEIADA"
FT   gene            complement(349556..351166)
FT                   /locus_tag="Vapar_0327"
FT   CDS_pept        complement(349556..351166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0327"
FT                   /product="Methylcrotonoyl-CoA carboxylase"
FT                   /EC_number="6.4.1.4"
FT                   /note="PFAM: carboxyl transferase; KEGG: rpe:RPE_2254
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16990"
FT                   /db_xref="GOA:C5CY86"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY86"
FT                   /inference="protein motif:PRIAM:6.4.1.4"
FT                   /protein_id="ACS16990.1"
FT                   /translation="MPAIESRLNAASESFQAHRAGMLALLGQVRAHEARAAGASNASAE
FT                   RFARRGQLLPRERLALLLDTGAPFLPLASLAGLGHDNEDLAQSVPGGGVIAGIGRVAGV
FT                   RCMVSASDSGIDAGALQPMGLDKQLRVQEIALENKLPYVQLVESAGANLMQYRVQDFVR
FT                   GGGIFRNLARLSAAGLPVVTVTHGSSTAGGAYQTGLSDYIVMVRDRTRAFLAGPPLLKA
FT                   ATGEIATEEELGGAVMHTHISGLGDYLAEDDRDAIRIARAILGGIDWARDEQARKFAPP
FT                   LYAAEELLGIMPSDGRRPVDMREVIARLADGSEFLEFSAHYGSATLCGHMRLEGHAVGI
FT                   VTNNGPIDSDGATKATHFIQACCQSRTPIVYLQNITGYMVGRAHEEAGIIKHGAKMIQA
FT                   VTSATVPQVTLHCGASYGAGNYGMCGRGFAPRFCFSWPNARTAVMGGEQAAQTMAMVME
FT                   AGMARKGSVDRAKIDAMQRQIIERFDRQTSVFTTSALLLDDGVIDPRDTRAVLAEVLSV
FT                   CRDGDARVPQAMQFSVARP"
FT   gene            complement(351239..352009)
FT                   /locus_tag="Vapar_0328"
FT   CDS_pept        complement(351239..352009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0328"
FT                   /product="putative integral membrane sensor protein"
FT                   /note="PFAM: MHYT domain protein; KEGG: bbr:BB1820
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16991"
FT                   /db_xref="GOA:C5CY87"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY87"
FT                   /inference="protein motif:PFAM:PF03707"
FT                   /protein_id="ACS16991.1"
FT                   /translation="MTPLVVGQLLSPEYSLGLVALSFLISFAGSLVALICAGRMVGADG
FT                   KPNLAVVACAAVALGGIGIWSMHFIGMLAYRLPVGISYNVPLTVVSLVAAILISGIALY
FT                   MAGGRRKFSRAGWLAGSLLAGLGVCVMHYMGMFAMNMRASMDFDPTVVALSVAIAITAA
FT                   GAALWLAFNLRRLSHQIAAAAVMGVAVCTMHYVGMSAASMICIAAAPTDALAIGGNYMG
FT                   LSVFGTAGAVLIFIYWVITGSSLDAPTAQRARTS"
FT   gene            complement(352158..353819)
FT                   /locus_tag="Vapar_0329"
FT   CDS_pept        complement(352158..353819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0329"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: rpa:RPA4432 NHL repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16992"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY88"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ACS16992.1"
FT                   /translation="MPCRPFIRAAALIAILALLAACAGIAPTPSPPPTRPAAWSEPEVL
FT                   VAPSSFAGVHGLAIDQKGRLLAGSVLGNTLWEVDRSTGAAKILIDAPEGQADDIAVGPR
FT                   GELAWTNYLMGMLRYRESDGAPMRVLAKDLPGLNSLDFDRSSGKLYASQVFLGDALWEI
FT                   DRMGQKPPRLIKKDMGGFNGFEVGPDGMLYGPLWFKGQVVKIDPADGAMTVIAGGFKIP
FT                   AAANLDGKGNLWVVDARSGELVKVDLATGRKTVAKQLRPSLDNLAIAPDGTIYVSNMAN
FT                   NEVQSFDPATGVLRTLTSGKLATPAGLKIEGRTLWVADVFGFRQVDVRTGEVRDVFRMQ
FT                   RDPELDYPFAVGLSGTRFALTSWFTGTVQLVDRQTLRTVEIIHGLKAPFDAIPMADGSV
FT                   IYAEIATGSITRASGPHFADKQVLASGLGGPVQMIVGRDGALYVTEAAGKLTRIPLDAS
FT                   APLRAIAEGLALPEGVAETPWGSFIVAESAARRLVEIDPANGSRRTVAENLPIGLAAGP
FT                   GLPPPYVVTGVAVGSDGSIYMAADRNNAIYRIRPKN"
FT   sig_peptide     complement(353748..353819)
FT                   /locus_tag="Vapar_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.950 at
FT                   residue 24"
FT   gene            complement(353920..355143)
FT                   /locus_tag="Vapar_0330"
FT   CDS_pept        complement(353920..355143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0330"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   psa:PST_2930 predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16993"
FT                   /db_xref="GOA:C5CY89"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY89"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ACS16993.1"
FT                   /translation="MKRVALGLLCAAALLYALASALDGEHPAWGYAAAFAEAAMVGAIA
FT                   DWFAVVALFRHPLGLPIPHTAIIPSNKDRIGAKLAGFICNNFLGTGQVLAKLREFDAAG
FT                   RIADWLARPASGQKLGEWGVAATRYGLAAFDDERVRAFMGRAAAAGLQKIDLSRLMGQA
FT                   LDALTAGGRHQALLDDVLQQVAGLLEGEEVQAHITEAIAREIKTLRYVGLDQVAAKLAT
FT                   RKIVAAVARTIAELAAEPEHPMRRRFDHFVDDFVVRLKLDPEFQQRGEQIRAELIAHPA
FT                   LGDYLHGIWGELLAWLHDDLGRGDSTIRQRIAAMAGALGTRLQADDAIRRWINEQIEAA
FT                   APLAIERYREDIRRYIEERVADWNASEMTSELERHIGRDLQFIRINGTLVGGLVGLSIH
FT                   TATQLLRG"
FT   sig_peptide     complement(355084..355143)
FT                   /locus_tag="Vapar_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.708 at
FT                   residue 20"
FT   gene            complement(355175..356341)
FT                   /locus_tag="Vapar_0331"
FT   CDS_pept        complement(355175..356341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0331"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   aav:Aave_0769 acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16994"
FT                   /db_xref="GOA:C5CY90"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY90"
FT                   /inference="protein motif:TFAM:TIGR01892"
FT                   /protein_id="ACS16994.1"
FT                   /translation="MSPTLSPQSLALAQTLVRMNTVSENSNLQLIDLAQSHLAALGVKS
FT                   RITYNAERTKANLFATLGEGKPAGVIISGHTDTVPWDGQDWSVDPLSAAVQNERLYGRG
FT                   SADMKSFIAIALSNARRFLESDSPFAVHFAFSYEEEIGCFGVKELIADMRDAGIKPLAC
FT                   IVGEPTSMVPAIAHKGVYRYRCCVRGKEAHSSLTPKSVNAIEMAARVVGKVRDMAEGFE
FT                   RSEPRYEGFDVPFSTASVGQFHGGIADNVVPRDAEFRYEFRDLPTADAKKMQDEVVSYA
FT                   GSLEASMKKVAPDAGFRFETICEIPSFLGAATDPVTLLAQRLAGEDRTTLVAFGTEAGL
FT                   FKNAGIPTVVCGPGSIEQAHQPDEFVSLEQLARCELFMQRLAATPTIG"
FT   gene            356442..357629
FT                   /locus_tag="Vapar_0332"
FT   CDS_pept        356442..357629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0332"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: pol:Bpro_3128 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16995"
FT                   /db_xref="GOA:C5CY91"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY91"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACS16995.1"
FT                   /translation="MRTVHFALAATAVLGLAACSTTGPANKLLTLDGNPPLVIAHRGAS
FT                   GYLPEETLEAYARAIELGADVIEMDLVSTKDGVLIARHDPNLAISTDVAKHPRFASRKK
FT                   TIKVDGETQTGWFSNDFTLAEIKTLGGISTDPERPQEFNGKFKIPTFQEIIDFAKAKSK
FT                   ETGRTIAIYPETKNPTYFRELGLPLEDKVIAAINAAGWNSKTAPIYVQSFEPGSLKYMK
FT                   AKGLNTRLIQLIDGDSVDLKTGAVTFAVPSDRPYDWTKAGDKRNFDAMVTPAGLAEIKT
FT                   YADGIGPWKRYIVSIKGSIGADGKPLDVNKDGKINDADATSVSPTTLIADAHKAGLFVH
FT                   PFTFRNESRRLAADYNKDGRNEYAVYYKLGVDGVFTDFTDTAIAARADYLKSMGR"
FT   sig_peptide     356442..356525
FT                   /locus_tag="Vapar_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.526 at
FT                   residue 28"
FT   gene            357696..358901
FT                   /locus_tag="Vapar_0333"
FT   CDS_pept        357696..358901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0333"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: pol:Bpro_2111 peptidase M20D, amidohydrolase;
FT                   TIGRFAM: amidohydrolase; PFAM: peptidase M20; peptidase
FT                   dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16996"
FT                   /db_xref="GOA:C5CY92"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY92"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACS16996.1"
FT                   /translation="MKLIDSLVTQAAGIAAVRRDLHAHPELCFEEVRTADVVAGKLTEW
FT                   GIPIHRGLGTTGVVGIVKNGTSTRAVGLRADMDALPVTELNTFAHASKHHGKMHACGHD
FT                   GHTAMLLAAAQHLAKNRNFDGTVYLIFQPAEEGGGGAREMIKEGLFEQFPMDAVFGMHN
FT                   WPGMKAGQFAVSPGPVMASGNKFYVNVIGKGGHAALPQTGIDPVPIACEIVQAFQTILT
FT                   RKMKPTDSAVISVTTIHAGETNNVIPDNCELTGTVRTFSIEVLDMIESRMRQIAEHICA
FT                   AHDATCDFRFERYYPPTINTEAEANFARRVMGGIVGPENVLRQEAAMTSEDFAFMLQAK
FT                   PGAYAFIGNGDGTHRDVHHGEGPCTLHNASYDFNDELIPLGATCWVQLAEQFLGKPGGA
FT                   AP"
FT   gene            358898..359992
FT                   /locus_tag="Vapar_0334"
FT   CDS_pept        358898..359992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_0771 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16997"
FT                   /db_xref="InterPro:IPR021259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY93"
FT                   /inference="similar to AA sequence:KEGG:Aave_0771"
FT                   /protein_id="ACS16997.1"
FT                   /translation="MIGIGEAFSPRYAQARQKFLQACVSAGLAALPHAHPGKGRDGEEL
FT                   SMDVALDGAADAERLLIVSSGCHGVEGHCGSGVQVFALHDAEWREKARAQGVAVLYVHA
FT                   LNPHGFSYGRRVTQEKVDLNRNFVDFSKPLPANEPYAKLHPLLVPESWPPTPENEAAIE
FT                   KWIAKHGAEAYQAAVTSGQYQFEDGLFFGGKAPAWSNKTLRGVLRRHAASARRLAWIDL
FT                   HTGLGPNGLGERIFAGRDDKAAYARANAWWGTPAAPVTSIYDGSSSAALLRGLMWDTAH
FT                   QECPQAEYTGIALEYGTLPMLEVLAALRADHWLHKHPEAPADLADGIRARMLEAFYTDT
FT                   DAWRGQVVSQARQAMFQAVDGLCS"
FT   gene            complement(359989..361113)
FT                   /locus_tag="Vapar_0335"
FT   CDS_pept        complement(359989..361113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0335"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   vei:Veis_4876 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16998"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY94"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACS16998.1"
FT                   /translation="MINRRHFSLGAGAAALGGFQLARAQGDVPLVLGQSAPFTGPAAQL
FT                   GIQFHQGAKLFLDQYNAQAGRRNVVIKNLDDGYEPDRCAANTQKLIEEDVFALFGYIGT
FT                   PTSMAALPLAVKEKVPFIAPFTGAMSLREPFHRNVFHLRASYNDETALIVKQLTHLGLK
FT                   KIAVFYQNDAYGKAGLDGVTLALSQQELKPVALATVERNSVDVAAAVKSITAARPDAVV
FT                   QVGAYKACAAFIRQARKAGYGGTFFNVSFVGTQALADELGKEGAGVMVTQVVPSPYNAA
FT                   NAITREFSEAVKKAGAGASANFSSLEGYLAAKVLTEGLRRAPGKASRDGLITGLESIDR
FT                   QQFGGFEVSFSAKNHVASKFVELSMLTGDGRVRT"
FT   sig_peptide     complement(361039..361113)
FT                   /locus_tag="Vapar_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 25"
FT   gene            361171..363258
FT                   /locus_tag="Vapar_0336"
FT   CDS_pept        361171..363258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0336"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molybdopterin
FT                   oxidoreductase Fe4S4 region; molydopterin
FT                   dinucleotide-binding region; KEGG: pol:Bpro_4032
FT                   molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACS16999"
FT                   /db_xref="GOA:C5CY95"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR037920"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY95"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ACS16999.1"
FT                   /translation="MVDAPVSTTAVLPTNTSTVLGACPHDCPDTCALVTTVKDGVAVKL
FT                   QGNPAHSHTAGVLCTKVSRYIERNDHAERLVQPLRRTGPKGSGQFEPVSWDAALDDIAA
FT                   HLRALQTDPETIVPYSYAGTMGLVQGESMDRRFFHKLGATLLDRTICSMAGGEAMVHTL
FT                   GAKAGMRIEFFAEAKLILIWGSNSIASNLHFWRHAQAARRAGARLVCIDPRKTETADKC
FT                   DEHIALLPGTDAALALALMHELIVHGWLDHDFIANHTLGWEPLKERALQWPPSRAAAVC
FT                   GVPEAQIAALAQAYGTTRPAAIRLNYGMQRVRGGGNAARAVACLPALVGAWRDRAGGLL
FT                   LSSSGHFPVDRAALQRPDLLAGRQPRTINMSTIGDALLDQARPVKAIVVYNSNPVAVAP
FT                   ESGKVVAGFAREDLFTVVLEQFRTDTADYADYLLPATTQLEHWDIHTSYGHTDVLLNRP
FT                   AVAPRGEARSNAWVFRELARRMGFDEPCFSDDDEALCRSAFAPGAIDYAQLLEQGFTSL
FT                   ALPEAPFAEGRFPTPSGRCEFFSARLQAQGMDGLPDHVPNYEAAGSSTEFPLAMISPPA
FT                   RNFLNSTFVNVTSLRAIEGEPLLEIHEADAAARGIEDGAIVRVFNRRGEHRCRAEVSRR
FT                   ARPGVVHGMGIWWRKLGLDGTNVNQLTSQRLTDIGRGPTFYDCLVEVERVAPSSSGREP
FT                   G"
FT   gene            363255..364409
FT                   /locus_tag="Vapar_0337"
FT   CDS_pept        363255..364409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0337"
FT                   /product="putative zinc protease protein"
FT                   /note="KEGG: pna:Pnap_3501 putative zinc protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17000"
FT                   /db_xref="GOA:C5CY96"
FT                   /db_xref="InterPro:IPR014553"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY96"
FT                   /inference="similar to AA sequence:KEGG:Pnap_3501"
FT                   /protein_id="ACS17000.1"
FT                   /translation="MRAAPAFALAGALLLLGGCADLGYYWQSASGHLGILRVAKPVPEW
FT                   LADPAVSAPLKAKLELAQRIRRFAVTELALPDNASYTSYADLHRPAAVWNVVAAPPYSL
FT                   TLKSWCFPVAGCVGYRGYYDEAAARAEAEALRAKGLEAAVYPVPAYSTLGWMNWAGGDP
FT                   LLSTFIGYPEGELARIVFHELAHQVLYVPGDIVFNESYATAVERIGGAMWLQREASEAA
FT                   RGEYARFDGQRQQFRALALETRRALNQVYESAQAKAGDWPAVDAMKKAAMDAFREHYAM
FT                   LRAQWQGPRQGAYDLWVARANNAAFGAQGAYDDLVPGFEALFARENRNWPRFYKAVRRI
FT                   AALPTMEERRNALQTATGMLQTHSGHGGNNDNNSSSRSNGGHGA"
FT   sig_peptide     363255..363317
FT                   /locus_tag="Vapar_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.790) with cleavage site probability 0.594 at
FT                   residue 21"
FT   gene            364402..364719
FT                   /locus_tag="Vapar_0338"
FT   CDS_pept        364402..364719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0338"
FT                   /product="polyhydroxyalkanoic acid system protein"
FT                   /note="TIGRFAM: polyhydroxyalkanoic acid system protein;
FT                   KEGG: pna:Pnap_3503 putative polyhydroxyalkanoic acid
FT                   system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17001"
FT                   /db_xref="InterPro:IPR013433"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY97"
FT                   /inference="protein motif:TFAM:TIGR02610"
FT                   /protein_id="ACS17001.1"
FT                   /translation="MPDIHIERNHALGIAGAREVARQWIEQVGQDYGLECTYTEGEACD
FT                   VAQFSRAGIDGTVEVTADTLTLEATLGFLFSSFSDQIEQKISRKLDALLASPGGGGARF
FT                   A"
FT   gene            complement(364732..365469)
FT                   /locus_tag="Vapar_0339"
FT   CDS_pept        complement(364732..365469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0339"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   bcj:BCAM2013 putative short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17002"
FT                   /db_xref="GOA:C5CY98"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY98"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS17002.1"
FT                   /translation="MTTTFDFSGQRALVTGASSGIGRAVAVRLAQSGAAVTAVGRNAAA
FT                   LDTLHAEAGCTPLTVDVANPAELERALAALPAFDLVVNCAGIALLEPALDVQAESFDAV
FT                   MAVNARAAALVASRCAKAMIAAGVRGSIVNVSSQAALVALDAHLCYCASKAAMDAITRS
FT                   LCLELGPHGIRVNSVNPTVTLTPMAEQAWADPAKSAAALRNIPLGRFAQVDEVVAPILF
FT                   LLSDGASMVSGAALPVDGGYTIV"
FT   gene            complement(365789..367315)
FT                   /locus_tag="Vapar_0340"
FT   CDS_pept        complement(365789..367315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0340"
FT                   /product="Xylulokinase"
FT                   /EC_number="2.7.1.17"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG: bam:Bamb_4197
FT                   xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17003"
FT                   /db_xref="GOA:C5CY99"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C5CY99"
FT                   /inference="protein motif:PRIAM:2.7.1.17"
FT                   /protein_id="ACS17003.1"
FT                   /translation="MKYVIGVDIGTQSTKCLLAGTDGKVHAQASVAYQPDTPKPLWAQQ
FT                   DCDVWFDAVCESVRACVAKSGIAATEIAAMCVSSLYGGAGVPVDEAMQPLHPCLIWMDR
FT                   RATAEVDAVNANVDVARLQAITGNGVDSYYGFTKMLWIREHLPEVWAKTRWFLPPNSYV
FT                   NWRLSGELAVDHSSAGNIGGVYDAAQRSWSHEALGMLGIPARMMPPRLVESSEVVGGLS
FT                   AEWAAKLGLAEGMPLMGGGVDAAVATFCAGVTGSGDHVAMIGTSMCWGFVSPTVDARHK
FT                   LITMPHVYRGADRSYVFGGAITAGAAVTWFREAFCQAEVAEAARTGEDAHALIERKAIE
FT                   VPPGAEGLVFLPYLMGERSPIWDAQAKGAFIGLSLAHSRAHLYRAVLEGVSFALQHNIE
FT                   AGRQSGQPLDDRLIVVGGAAHSDLWMQIVADVTGYPVFTIEEEVEAALGAAMLAALGAG
FT                   LVDAASAERGWVTLVERARPGAAAQAVYRERFEIYKSLYPALRDAMHRLK"
FT   gene            complement(367312..368451)
FT                   /locus_tag="Vapar_0341"
FT   CDS_pept        complement(367312..368451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0341"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   bpy:Bphyt_3233 alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17004"
FT                   /db_xref="GOA:C5CYA0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYA0"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACS17004.1"
FT                   /translation="MSYQKLQPGASGAIGQLAAMQAVVCHGPKDYRLETVAMPGIGPNE
FT                   LLISIAACGICASDCKCHSGAKMFWGGDGQPSWVKAPVIPGHEFFGYVEALGEGAAEHF
FT                   GVEKGDRVIAEQIVPCGKCRFCTSGKYWMCEVHNIFGFQRIVADGGMADYMRLPPTSRV
FT                   HRIPDGISLEDAAIIEPLSCAIHTVNRGDIQLDDVVVIAGAGPLGLMMVQAAHLKTPKK
FT                   LIVIDLVPERLALAKKFGADVTIDARTENADAIVKGLTEGYGCDVYIETTGAPIGVTQG
FT                   LEMIRKLGRFVEFSVFGSETSADWSIIGDRKELDVRGAHLGPYCYPIAIDLLARGLVTS
FT                   KGIVTHDFPLTEWERAFTLANSLDSIKVLLKPQPRATTS"
FT   gene            complement(368600..369580)
FT                   /locus_tag="Vapar_0342"
FT   CDS_pept        complement(368600..369580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0342"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bac:BamMC406_4722 monosaccharide-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17005"
FT                   /db_xref="GOA:C5CYA1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYA1"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS17005.1"
FT                   /translation="MNATATHPTPPAPDGGLFTQLRRSTAFLPLVGLVAISVFMIAATD
FT                   NFLSWGNLQNIALQSSINAIIAVGMTAAILTGGIDLSVGAVVALSGTLASGMMVQFGLP
FT                   PVLAVPLGLAVGVVIGLFNGYCVAYLRMPPIIVTLATMGIARGIALIYTGGYPIDGLPD
FT                   SFAFLGGGVLAGIKVPILIMLATYLVAYVLLNMAPFGRYVYAIGGNEEATRLSGVRVSR
FT                   YKLLVYALSGFTAAVAGIVQAARVTSGQPGVGVGFELDAIAAVVMGGTSIAGGRGAIVG
FT                   TLVGALLLGVLNNGLNMIGVSPYLQLIIKGGIVLLAIFISREAKR"
FT   gene            complement(369906..371399)
FT                   /locus_tag="Vapar_0343"
FT   CDS_pept        complement(369906..371399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0343"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bph:Bphy_0501 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17006"
FT                   /db_xref="GOA:C5CYA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYA2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS17006.1"
FT                   /translation="MLRLEGVSKRFPGVKALSGIDLSIRKGEVHALLGENGAGKSTLMK
FT                   ILGGIYQADEGRIFIEGSERSFAGYADAIAAGIGIIFQEFSLVPYLNAVENIFLGRYLT
FT                   NRFGLMDRAAMKRSAQQLFDELGVQIDLGVPICRLSVAQQQFVEIGKALSLDAKLLVLD
FT                   EPTATLTPNEAGHLFRIMRELRARGVAMIFISHHLDEIFEVCDRISVLRDGANAGHAEV
FT                   GATDVDALVEMMVGRRIEHSFPPKPQPAPRGRKVLEVPEIQLAKGGPVNSFELHEGEIL
FT                   GFAGLVGSGRTELALGMMGADRAHRKTVLRNGRPVRLNDPTQALANGIGLLPESRKVEG
FT                   LITDFTVRFNISMNNLGRHRRAGLVSQKSERQSAAELSKRVGVKAPGIETRVATLSGGN
FT                   QQKVVIARWLGHASEVLIFDEPTRGIDVGAKAEIYGLMRELTQQGKAIIMISSELPEIV
FT                   GMCDRVAVFSGGSIVATLEGDAINSGDIMRHATSSGSLQ"
FT   gene            complement(371439..372359)
FT                   /locus_tag="Vapar_0344"
FT   CDS_pept        complement(371439..372359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0344"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bpy:Bphyt_3236 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17007"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYA3"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS17007.1"
FT                   /translation="MKNILKATALAAALAFGASAAQAQAPKQPLRIGMTFQELNNPYFV
FT                   TMKQALEEAAASIGATVVTTDARHDVAKQIGDVEDMIQKKIDILLLNPTDSTGVQSAVR
FT                   SAKKAGLIVVAVDANAQGPVDSFVGSKNTDAGRLACEYLAKSIGEKGDVAILDGIPVVP
FT                   ILERVKGCREALAKYPGIKVVSTQNGKQERATALTVTENILQANKDLKGIFSVNDGGSM
FT                   GALAAIEASGKDVKLASVDGAPEAIKAMQKPGSKFIATTAQYPRDQIRLAIGIALAKKW
FT                   GANVPAAVPVDVKLIDAEGAKTFSW"
FT   sig_peptide     complement(372288..372359)
FT                   /locus_tag="Vapar_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 24"
FT   gene            complement(372472..373362)
FT                   /locus_tag="Vapar_0345"
FT   CDS_pept        complement(372472..373362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0345"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AraC protein arabinose-binding/dimerisation;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: bpy:Bphyt_3237 transcriptional regulator, AraC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17008"
FT                   /db_xref="GOA:C5CYA4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYA4"
FT                   /inference="protein motif:PFAM:PF02311"
FT                   /protein_id="ACS17008.1"
FT                   /translation="MQPDLEIVEVRGDESFTAWAHGYPYRTVRWHFHPEYEIQLIVETR
FT                   GVYFVGDHVGHFEPGNLVLMGPDLPHNWISDVPAGQSVERRGIVIQFPAGLAKNMAATF
FT                   PEFERIAPLLAESGSGLLFPAETAAAAKPLMESLLEARGLRRVILLLSLLELLADSQDR
FT                   QRLASPAFKPDPKAFMSHAINNVLAHIAANLGDDLREPMLAELVGQSPSAFSRAFRKHT
FT                   GQSFVRYVNRLRISRACELLTSSEKPVLDVCMDVGFNNVSNFNRQFLLHKRMPPTKFRN
FT                   FHRMQAAASRAASPP"
FT   gene            373642..374880
FT                   /locus_tag="Vapar_0346"
FT   CDS_pept        373642..374880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0346"
FT                   /product="Formyl-CoA transferase"
FT                   /EC_number="2.8.3.16"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: pna:Pnap_3505 formyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17009"
FT                   /db_xref="GOA:C5CYA5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYA5"
FT                   /inference="protein motif:PRIAM:2.8.3.16"
FT                   /protein_id="ACS17009.1"
FT                   /translation="MTNTSSSPPAAGPLAGLKVVELGQLIAGPFAARTLADFGAEVIKI
FT                   EPPGAGDPLRTWRLLKDGTSVWWQVQSRNKRSLALDLRQAEAQAVVRQLAAEADVLVEN
FT                   FRPGAMEGWGLGPGELLAANPALVMLRISGYGQTGPYRDRPGFGVVAEAMGGLRHLTGE
FT                   PGRVPVRVGVSIGDTLASLHGVIGVLMAMQHRHATVSAEYPKGRGQVVDVALYEAVFNC
FT                   MESLLPEYSAFGAVREAAGSALPGIAPTNAYRCADGGYAIVAGNGDSIFRRLMACIGRP
FT                   DLAADPSLAGNTGRVAQVEMLDAAIGEWTAARTVDEVLAALDAAQVPAGRIYTIADIAA
FT                   DSHYAARGMLQQVHMPDGSTLAVPGFVPKLSLTPASHRRSAPALGADTDAVLKEIGLNA
FT                   EQIAALHARGIVG"
FT   gene            complement(374891..375148)
FT                   /locus_tag="Vapar_0347"
FT   CDS_pept        complement(374891..375148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0347"
FT                   /product="acyl-coA-binding protein ACBP"
FT                   /note="PFAM: acyl-coA-binding protein ACBP; KEGG:
FT                   dia:Dtpsy_0446 acyl-coA-binding protein ACBP"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17010"
FT                   /db_xref="GOA:C5CYA6"
FT                   /db_xref="InterPro:IPR000582"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR035984"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYA6"
FT                   /inference="protein motif:PFAM:PF00887"
FT                   /protein_id="ACS17010.1"
FT                   /translation="MSDLNALFEAAQANSKLLPERPDNPTLLKIYGLFKQATEGDNTAK
FT                   KPSFSDIVARAKWDAWTAQKGLGADEAKQKYIDLIESLRA"
FT   gene            complement(375219..376061)
FT                   /locus_tag="Vapar_0348"
FT   CDS_pept        complement(375219..376061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_3497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17011"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYA7"
FT                   /inference="similar to AA sequence:KEGG:Pnap_3497"
FT                   /protein_id="ACS17011.1"
FT                   /translation="MSHPDFKPLSLMSASPVAAAAAAQSWTPLPYADLPRYDAHSLLPH
FT                   WPRLHAGHALPPPPSGHPLADGWALYHNGEFERAAALGLAHGPEGLVLANQATAVYANY
FT                   LEPRESVRLSMFRQVIERAAAQVGAEPDNCHALYWQAYALGRYSQGISVARALAQGLGS
FT                   KLKGALERVIELQPQHADAHIALAAFHAEVIDKVGALVGRMTYGVRAEMSVELFERGLE
FT                   LHPHSPSALMEYGRALLMLHGDARLGEATQLYEKAAALQPADAKERLDVELARAGLTD"
FT   sig_peptide     complement(375990..376061)
FT                   /locus_tag="Vapar_0348"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.539 at
FT                   residue 24"
FT   gene            complement(376066..376779)
FT                   /locus_tag="Vapar_0349"
FT   CDS_pept        complement(376066..376779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0349"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rfr:Rfer_3529
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17012"
FT                   /db_xref="GOA:C5CYA8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025722"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYA8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS17012.1"
FT                   /translation="MAKKAPRRTAQRILEAALELFNRFGEPNVSTTLVAGELNISPGNL
FT                   YYHYPAKEELINKLYEGYEAELNELLHASEGVHDVEDAWFFMHSLFELIWRYRFLYRDL
FT                   NDLLSKNRHLETQFQLVLKNKTRAIRMLIAGLSRAGHLDIDVHEVDTLAQSMVVVLTYW
FT                   LSYEYVRNPREALEPAHAQGALMRGGQHTLHLLAPYLGGEQRRHLLTLSNAYSGDDSAS
FT                   ARPAQASADLAAEAR"
FT   gene            complement(376908..377411)
FT                   /locus_tag="Vapar_0350"
FT   CDS_pept        complement(376908..377411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0350"
FT                   /product="poly(hydroxyalkanoate) granule-associated
FT                   protein"
FT                   /note="TIGRFAM: poly(hydroxyalkanoate) granule-associated
FT                   protein; PFAM: poly granule associated family protein;
FT                   KEGG: pol:Bpro_4024 poly granule associated"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17013"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYA9"
FT                   /inference="protein motif:TFAM:TIGR01837"
FT                   /protein_id="ACS17013.1"
FT                   /translation="MATQDDDGNKGSDRIKDSAQQIWLAGLGAFAKMQQEGSKAFEALV
FT                   KDGAGLQKKTQQAAEETLAQAQTRMAGFANEFGTKAAGQWGKLENIFEERVARALEKLG
FT                   VPSAAEHAALQARVAALEAELQRRQGKSAAPARSASRKTAGRSAAPATAAKKAVRRGSS
FT                   SKPG"
FT   gene            complement(377501..377944)
FT                   /locus_tag="Vapar_0351"
FT   CDS_pept        complement(377501..377944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0351"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   pol:Bpro_4578 thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17014"
FT                   /db_xref="GOA:C5CYB0"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYB0"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACS17014.1"
FT                   /translation="MSSITLRFLAEPSTVNFGGKVHGGTVMKWIDEAGYACATSWAKRY
FT                   CVTAFIGSIRFHHPIMIGDLVEVEARLAYTGTTSMNISVEVRSGDMKGGTMDKTTECLI
FT                   VFVSVDSHGRPLPVQPYVPGTPGEMALAERAKTHLDASRAAGQ"
FT   gene            complement(378039..378938)
FT                   /locus_tag="Vapar_0352"
FT   CDS_pept        complement(378039..378938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0352"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: azo:azo2419 putative LysR-type
FT                   transcriptional regulator NahR"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17015"
FT                   /db_xref="GOA:C5CYB1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYB1"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACS17015.1"
FT                   /translation="MAQLDLEWLLVFDEVYKTANVSSAAERLGLSQSAASTALARLRTH
FT                   FGDKLFVRTSRGMEPTPYARQIQPLVLDILDRLNRAKGGRASFDPASAARSFRICMTDI
FT                   SEVVLLPSLLDHLRRTAPGVRIETEIISTESGRRLEEGAVDLAVGFMPQLDAGFYQQTL
FT                   FMQNFVCLAARNHPRIGERLTRKRFESEAHAVVASSGTGHAIVDKTIARLGLRRNVVAS
FT                   LSSFLSVARIVAHTELIVIVPSILGKVLATQEPVKLLEPPFELPAYAVKQHWHERFHAD
FT                   AGNAWLRRTLAELFGGGG"
FT   gene            379084..380172
FT                   /locus_tag="Vapar_0353"
FT   CDS_pept        379084..380172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0353"
FT                   /product="gentisate 1,2-dioxygenase"
FT                   /note="TIGRFAM: gentisate 1,2-dioxygenase; PFAM: Cupin 2
FT                   conserved barrel domain protein; KEGG: pae:PA2470 gentisate
FT                   1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17016"
FT                   /db_xref="GOA:C5CYB2"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR011960"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYB2"
FT                   /inference="protein motif:TFAM:TIGR02272"
FT                   /protein_id="ACS17016.1"
FT                   /translation="MNPTAQKSAAPAPANAAERRNYYERIRPLHLTPLWESLHALVPRE
FT                   PATPCVPALWRYDEIRPLLMESAALITAEEAVRRVLVLENPALPGNSSITQSIYAGLQL
FT                   IMPGEVAPSHRHVQSALRFIVDGKGAYTTVGGERTTMYPGDFIITPSWAWHDHGNEGIG
FT                   GTVEPVVWLDGLDIPMLRFFDAGFAENDDAKVQHVARPEGNSLARFGHNMVPVRHDHAS
FT                   PTSPIFNYPYARSREALALLQKQEAPDAWLGHKLRYINPLTGGAPMPTIGTQLQLLPRG
FT                   FAGKAHRATDGTVYSVVEGRGIAEIAGRRFEFGPRDTFVVPSWAPLRLSAPGEDVVLFS
FT                   FSDRPVQQAMGILREAFLDEDA"
FT   gene            380248..380952
FT                   /locus_tag="Vapar_0354"
FT   CDS_pept        380248..380952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0354"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rso:RSc1086 putative isomerase-decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17017"
FT                   /db_xref="GOA:C5CYB3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYB3"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACS17017.1"
FT                   /translation="MSFVFTPPSIVGLPIVGSSELFPVRRVYCVGRNYAAHAREMGFDP
FT                   DREPPFFFCKPNDDASVVPVAEGETGAIPYPPLTSNYHYEAELVVAIGKGGKDIAVEQA
FT                   ASHIHSYAVGLDMTRRDLQMKMREAGRPWEIGKAFDFSAPMAPLRTLADVGEINAGAIR
FT                   LEVDGQVRQNSDITHLIWSVNEVIANLSTLFTLQPGDLIFTGTPEGVGAVKPGQTLKVS
FT                   IDKLPSLTVRID"
FT   gene            380978..382261
FT                   /locus_tag="Vapar_0355"
FT   CDS_pept        380978..382261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0355"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: pen:PSEEN2596
FT                   salicylate hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17018"
FT                   /db_xref="GOA:C5CYB4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYB4"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACS17018.1"
FT                   /translation="MSTFPPKNPPTVLLVGGGIGGMAAALALARLGVSIDLLEQSATIG
FT                   EIGAGLQLGPNAFAALDALGVGEAVRRNSVFTDRLVMMDAVDCGEVASVPVGEAFRARF
FT                   RNPYAVSHRADLHGAIHEAVKQHPLIRFHTSAQVESLDFGTGGTKGVVATTRDGRRFKA
FT                   DAIVGCDGVKSVVRARLVGDEARVSGHVVYRAVVPVADMPADLRWNAPVVWAGPNCHLV
FT                   HYPLRHGEQYNLVVTFHSREQEEWGVSEGSKEEVLSYFEGVHARPRQLLDRPSSWRRWS
FT                   TADRDPVARWSDGPATLLGDAAHPMMQYLAQGACMALEDAVTLGAAVQACDFDMPAAFK
FT                   LYEAARIPRTARVVLSVREMGRLYHAKGVERLVRNSLWVGRTPERFYDAVEWLYAWRPE
FT                   HCLDDAPQPLRCSVAVPDTEAAALLSPH"
FT   sig_peptide     380978..381067
FT                   /locus_tag="Vapar_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.504 at
FT                   residue 30"
FT   gene            382321..383310
FT                   /locus_tag="Vapar_0356"
FT   CDS_pept        382321..383310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pna:Pnap_3148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17019"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYB5"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACS17019.1"
FT                   /translation="MSFSPRALRAGILALASLAAANGALAQAGDYPNKPVTLVTPFAAG
FT                   SGPDAVLRLVSDKLSRLWNQRVLIDNRPGGGGFIAIDQARRAAPDGYTLLQLDSEHIAA
FT                   LPHLYKSRNFVTLQHFDPVASLFRTPFFVAVSSESKWKNMGDLIAAAKANPDAIVYGSW
FT                   GVGSPGHLGAQQLEALTGIRMRHAPFREVSQLFSNVGTGEVPWSFASIPSSQGIYKAGK
FT                   LRYLAIAAPKRIPQMPDVPTMAEAGGPASLEVNSFVSLLAPKGVPAAVKAKINADVAKV
FT                   IADPEIRARFDTFAFEPLAWSPEEIERNAEAKSKVYGELVRRGNISLD"
FT   sig_peptide     382321..382401
FT                   /locus_tag="Vapar_0356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.599 at
FT                   residue 27"
FT   gene            383358..384335
FT                   /locus_tag="Vapar_0357"
FT   CDS_pept        383358..384335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   pol:Bpro_2127 uncharacterized protein UPF0065"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17020"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYB6"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACS17020.1"
FT                   /translation="MHATKRALLIACGLAAAAALPLAASAQSNAWPTKPIRLLVGFPGG
FT                   STPDIAARTIAEPLAKALGQPVVVDNKPGASGNIAADMVAKATDDHTLGIVINGNLTSS
FT                   KMLYPRLPYDPAKDFTYLSLIATAPLVLVAQNNLPSGTAFFDAARKGGDKWNYGSVGVG
FT                   SVGHLGMELLKSRVAGFNPEHVPYQGNPQVVTAMLGDQVQMGLIPPGVAMPQVRAGKLK
FT                   AIGLTGGRSALVPELPPLADAGVRDFNLEVWVALLGPANLSKTAQARISREIEVIMKQP
FT                   EVRQKLFDQGWQAVGTSPDGMRLRVKEEAAIMTRIISARGIKIQ"
FT   sig_peptide     383358..383438
FT                   /locus_tag="Vapar_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.709 at
FT                   residue 27"
FT   gene            384335..385696
FT                   /locus_tag="Vapar_0358"
FT   CDS_pept        384335..385696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0358"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase;
FT                   glucose-inhibited division protein A; HI0933 family
FT                   protein; fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: pol:Bpro_2126 fumarate
FT                   reductase/succinate dehydrogenase flavoprotein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17021"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYB7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACS17021.1"
FT                   /translation="MAAVPHKTLSEPARELPVFGEYDVVVVGGGPAGIAAAVSAARHGA
FT                   STLLVERYGFLGGMGTAGGVTNFAGLYGKRNGEMTLLVRGVADDLLARIDALGGLNTPQ
FT                   DGMQGRIRVRSYDTSAYKIAADQLLLDAGVKLLFHAWAAAVVREGERIAALVVETKSGR
FT                   QAIRANAFVDASGDADVAAFAGVPFEVGDGHGSGLFPTTMFRVGQVDAQPALTAVGEFK
FT                   AINDLMAQVQAQKPGAYRFPREGAILRPNIDPREWRANVTQIRNAAGRAMNGVDARELT
FT                   EGELEGRRQIAEYFRFMKAEVPGFAHSAIVEIAPQVGIRETRRIEGLYALTGEDILSSA
FT                   SFDDSIGINAWPMEMHADGRIEWAFPRDESRTYNQLPWRMLVPRSVDNLLVAGRCAAMT
FT                   HEGQSAARASGGCFVMGQAAGTAAASLGASAKFADVDVPALQKKLAADGADLDR"
FT   gene            385793..386671
FT                   /locus_tag="Vapar_0359"
FT   CDS_pept        385793..386671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0359"
FT                   /product="Choloyl-CoA hydrolase"
FT                   /EC_number="3.1.2.27"
FT                   /note="PFAM: acyl-CoA thioesterase; KEGG: rfr:Rfer_0997
FT                   palmitoyl-CoA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17022"
FT                   /db_xref="GOA:C5CYB8"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYB8"
FT                   /inference="protein motif:PRIAM:3.1.2.27"
FT                   /protein_id="ACS17022.1"
FT                   /translation="MTTDPATAARLVAELVALMQLEPLGGDKFLAQSEDIGTPAVFGGQ
FT                   VLGQSLAAASLTVGADRPVHSMHAYFLLPGEHAPIEYSVDRVRDGRSFTTRHVVARQQE
FT                   RIIFEMSASFQTVDDGVEHQFAMPAVEGPEGLASELDQRLALGERLPERWRIKGLEPHG
FT                   IEYRGVEADDLLAPAVRSSESAIWMRAIAPLPDDPVVHRALLAYASDHGLLRAAMLPHG
FT                   LSFMSGQVRPASLDHAMWFHRDFRMDDWLLYVLDSPSASGARGLCRGSLFTRDGRLVAS
FT                   TAQEGMLRVKR"
FT   gene            387034..387747
FT                   /locus_tag="Vapar_0360"
FT   CDS_pept        387034..387747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0360"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sme:SMc00136 putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17023"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYB9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS17023.1"
FT                   /translation="MSSEAQKKVAIVTAGGSGMGAAAARKLADDGFRVAILSSSGKGEA
FT                   LAAELGGIGVTGSNQSNDDIKRLVDKVTDTWGRVDVLVNSAGHGPRAPILDITDEDWHR
FT                   GMDVYLLSAVRPARLVAPLMVKQGGGSIINISTFAAFEPDPVFPTSGVFRAGLAAFTKL
FT                   FADKYAAQNVRMNNVLPGFIDSLPEKAEFRSRIPMGRYGKSSEIAAVIGFLASEGAGYI
FT                   TGQNLRVDGGITRSV"
FT   sig_peptide     387034..387108
FT                   /locus_tag="Vapar_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.903) with cleavage site probability 0.662 at
FT                   residue 25"
FT   gene            387793..388401
FT                   /locus_tag="Vapar_0361"
FT   CDS_pept        387793..388401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0361"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; Methyltransferase
FT                   type 11; KEGG: rle:pRL120768 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17024"
FT                   /db_xref="GOA:C5CYC0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYC0"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACS17024.1"
FT                   /translation="MNIPDPARENMRRTIESYEASAREYNAIVAGHRPAEIEDALRRMM
FT                   QLVPAGGSVLEIGSGTGQDADFVEALGGAVRRTDAVQAFLDLQAERGKKGELLNVVTDA
FT                   LGGPYNAIVAMCVLIHVDRAQIAPVLRKVFDALAPGGVFLAAMRIGEGETHGDYQTVYW
FT                   AKDRFAEQLEAAGLRMHWESQWIGRGNVAWANFLARRPR"
FT   gene            complement(388413..389144)
FT                   /locus_tag="Vapar_0362"
FT   CDS_pept        complement(388413..389144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0362"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: azo:azo1128 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17025"
FT                   /db_xref="GOA:C5CYC1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYC1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS17025.1"
FT                   /translation="MNAATTLLDAKSVEAGYGASQVLFGIDLKIGAGEVLALLGRNGMG
FT                   KSTLLKVLTGTLAPMRGSVHFGGDAIGGPHKTMRPDAIARRGVAIVPEGRHVFPNLSVD
FT                   EHLRAFARPRPGSAPRWTVEALYGLFPRLAERKANAGNQLSGGEQQMLAIARALSTHPR
FT                   LLILDEATEGLAPVIREEIWHCIATLKAEGEAILVVDKYVQRLLPLADRHVILERGRVV
FT                   WQGDSAALDADRSLWARYLGV"
FT   gene            complement(389141..389896)
FT                   /locus_tag="Vapar_0363"
FT   CDS_pept        complement(389141..389896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0363"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: azo:azo1127 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17026"
FT                   /db_xref="GOA:C5CYC2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYC2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS17026.1"
FT                   /translation="MSLFRIEGLVKRFGGLLATDHVNLTVERGEVHALIGPNGAGKTTL
FT                   VNLITGLLKADAGRILLDEKDITGFKDHQRVAAGMSRCFQVTRVFAKETVHDNLMLAAQ
FT                   AHAGSSLRFMAPRAAERGLVERAVALADRVGLGSERHRIAGTLPHGAQRALDVALALAA
FT                   EPKLLLLDEPMAGMGPDESARIVELIESLRESMAILLIEHDMDAVFRLADRLTVLVQGR
FT                   VLMSGTADEVRGHPDVQAVYLGTEAEGHA"
FT   gene            complement(389893..390876)
FT                   /locus_tag="Vapar_0364"
FT   CDS_pept        complement(389893..390876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0364"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bpt:Bpet3756 branched chain amino acid ABC transporter
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17027"
FT                   /db_xref="GOA:C5CYC3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYC3"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS17027.1"
FT                   /translation="MKLSSRSLGLGLLLLLLLAAFPLVAPLFGLEFYIGFVRRVLVVAL
FT                   AAASLNFILGFGGMVALGHAGFIGMGAYTVVALSDAGVVSAWVMWPLAALVAGLVAALI
FT                   GTVALRTRGVYFIMTTLAVAQMLYFVVVSLRRYGGDDGYTLMSRPTLLPGLDLGNESNF
FT                   YWVVLAIVALALWWLHRATQSRFGHALMGIRDNETRMRALGYPVFKLQLVAFAIAGAIA
FT                   GLAGALLAGGNGFVSPATMHWTQSATLLVMVVIGGLGRSWGGPVGAVVWLVLEEALKQH
FT                   TEHWHMPLGLLLIAVALWAPKGLAALYKRRLPLTPTLSPEGRGSKA"
FT   sig_peptide     complement(390787..390876)
FT                   /locus_tag="Vapar_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.681 at
FT                   residue 30"
FT   gene            complement(390873..391793)
FT                   /locus_tag="Vapar_0365"
FT   CDS_pept        complement(390873..391793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0365"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: azo:azo1125
FT                   ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17028"
FT                   /db_xref="GOA:C5CYC4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYC4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS17028.1"
FT                   /translation="MSGILVLEQLLNGLGYGLMLFLLAAGLTLVFGIMDVLNLAHGSLF
FT                   MSGAYVAAEAHTRTGSFTAAIVIAVAVTVVVALLLEVLLMRRLYTRDHLAQVLATFGVI
FT                   LVADDIVKMAWGPSPVMAPTPAALSGPIDLVDGLPYPSYRLVILAGGLLVALALYLLVN
FT                   HTRIGMRVRAGASDRPMAELMGVRVGRIFNGVFLLGAALAALAGALMGPIVAVQVGMGE
FT                   AILIPALVVLVIGGIGSVRGAFVAALMVGVVDTVGRAFVPMLLRATLPPATAADLGPLF
FT                   AEVAMYALMVVVLIFRPSGLFSARS"
FT   gene            complement(391790..392995)
FT                   /locus_tag="Vapar_0366"
FT   CDS_pept        complement(391790..392995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0366"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bpt:Bpet0544 putative ABC transporter substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17029"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYC5"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACS17029.1"
FT                   /translation="MSHPSPKSPALPRTLLSLLLCGAALGGAASAMAAPVKVGLALDIS
FT                   GPFAALGAEARDGFALGIKQLGGKLGGQDVEFVQADMAGSPDQAKQLVDRMIQRDKIDL
FT                   FSGPIGSNVALAVGPTLFNAKVPYLSANAGPSQFAGAQCNAYFFGTAYQNDQFHEAAGK
FT                   FAQDRGFKKTVLIAPNYPAGKDALGGFKRQFKGQVADELYTKLGQIDYAAELAQLRAAK
FT                   PDSIYFFLPGAMGINFIKQFVGAGLSKDITLVTSGFSADEDVIGAVGEPMLGLFNTSHW
FT                   AHDLDNAANKAFVAAFRKEYNGRYPSVYAAQAYDAILAMDAAVKQSGGNAQNREAVVAA
FT                   LKKANYASTRGSFKYANNHYPVENFYLRVIGKDAQGKVTNKLINTVLTNYGDSYADKCP
FT                   LK"
FT   sig_peptide     complement(392894..392995)
FT                   /locus_tag="Vapar_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 34"
FT   gene            complement(393190..393429)
FT                   /locus_tag="Vapar_0367"
FT   CDS_pept        complement(393190..393429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0367"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   mms:mma_3632 F0F1 ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17030"
FT                   /db_xref="GOA:C5CYC6"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYC6"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ACS17030.1"
FT                   /translation="MTGFNILPLAVALLIGVAALGSCLGIGLVGQKFLESTARQPELVD
FT                   TLQTKFFLVAGVTDGAFIIATGIGLWFATANPFG"
FT   sig_peptide     complement(393352..393429)
FT                   /locus_tag="Vapar_0367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.477 at
FT                   residue 26"
FT   gene            complement(393725..398458)
FT                   /locus_tag="Vapar_0368"
FT   CDS_pept        complement(393725..398458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0368"
FT                   /product="Ricin B lectin"
FT                   /note="PFAM: Ricin B lectin; PKD domain containing protein;
FT                   SMART: Ricin B lectin; PKD domain containing protein; KEGG:
FT                   scl:sce8906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17031"
FT                   /db_xref="GOA:C5CYC7"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYC7"
FT                   /inference="protein motif:PFAM:PF00652"
FT                   /protein_id="ACS17031.1"
FT                   /translation="MKIRYFLMAFLAPLVTLLTHAAITGVSPMTTLGNMATAVSEAVAD
FT                   PLPLQGPGLGNLSYTSAELFKPVSMITSLAHPLDPAHSSAYESREVPATYPGRKDYGMN
FT                   AGIMVNGYFLTSFAPDSGLGPGGFLLYDVSNPRQIRLVKKIYEPDDATGGRTKEFRETH
FT                   SFGTAKIGGKTYVVLPSINGVEFWDFTDVNDIKQVKKLALPGVNAGDYENVAWQLWWQA
FT                   PYLYVASAGRGIFIVDAADPANAVVANRGAGKPNPVPTGELGNFRIGPIFTMGNHMVLT
FT                   AMESNGGFASLDISDPLNPKVLDSIVGTTPFYYATCFDGRNLHVSTRGSGAKMYSYDLS
FT                   DRSRFVAEDNRLVIDEQLYCATQDNYVIQGAQTRIHKVDVSNPLNHVEVGRGSILREDD
FT                   PNYSHSDNGQVAMFGNLVFVGNDHGSGSGFVVHAVDPDTTRPEVKQVSPANGAKQQALS
FT                   SRIGLGMTDNIRPESVNANTFIVRPVGGNTLAGTYSVQLGIINFHPELPLSPGTSYEVF
FT                   LPANGVKDYAGNAIGADFKSTFNTGNATDINLQHYWTLAGNLSDPIGSNNGTPASGDTF
FT                   ESIGMSFANRTAGVPLKNDSVATVLGGTASLSFYMKTTQAGSANPWTAPGIFGRDQASG
FT                   ADDVFWGWIDGSGFMNLSVANKAANNPGTRSLAAVNDGNWHHVVMTRDAASGAQAMYVD
FT                   GVKTSSTGLTGTKGLANKFQVMGQIQGNADLFKGTLAEVRVYSRVLTDGEVATLRGQAI
FT                   IGDPGIGGGPKIVNGQLVFDPATLGSSGAQFRWNFGDGTRTAYSTQPRYTYTYTRPGHY
FT                   TVTLTVRDASGRETFYTYNLTVIVPVTARAPTHTTNIAGDANSVYSLNPDSGTVAAVDA
FT                   QTLAKRWEVRVGDEPKTLAVGPDGRIWVAVQGEDKLVALSAADGSLSATVPLAYGSGPY
FT                   GVAFTPDGAKGLLTLESKSVLMSFDPSNGATTGAVALEGSLRGIAVSSDAQVAYVTRFK
FT                   SKLTGGQLHKVNLQSMSAMPTIALPVDTTTVDTESRARGVANYLSQVVISPDGRRAVLP
FT                   SKKDNIVRGRFRDGVDLTHDQSVRSILSQVDLQAAAEVFGEQIDFDDRAPARAALFSPP
FT                   GDYLFVAQMEGNRVAIVDPYSRAVRGEINASSAPHGLYLDAARKRLFVNNFLARSVSVH
FT                   DVSLVLSSESAAATFLQNVATVAQEPMAAAALRGKQVFYNASDRRMSKDNYISCASCHA
FT                   DGGDDGMVWDFTQRGEGLRRTISLMGRRGAGHGKMHWTANFDEVQDFENDIRNEFGGTG
FT                   FLTNADFAATVDPLGAPKAGKSAQLDDLAAYLSSLNKYMRSPARAADGSLSVEAARGQT
FT                   VFNTAQCATCHTGGTFRDGLRHDVGTIQLSSGKGHNQPLAGLGFDTPTLSGTWNTAAFF
FT                   HNGQAATLQDVLNSGHGNASSLPPADVVALREYVRSLDTAPAVVTRLRSDLNPTMCVNI
FT                   KGGATASGTVAVQWPCGTASHEKFTVTSVTGGYVQLVAEHSGLCLAQNGTATTNAPVVQ
FT                   LACTVGNTAQWSLAVGTLRNRASGSCLDVPNGSTTQDTALITWTCNGGNNQNWTQLP"
FT   sig_peptide     complement(398393..398458)
FT                   /locus_tag="Vapar_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.951 at
FT                   residue 22"
FT   gene            complement(398584..399435)
FT                   /locus_tag="Vapar_0369"
FT   CDS_pept        complement(398584..399435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0369"
FT                   /product="deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /note="PFAM: deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase; KEGG:
FT                   oan:Oant_3078 deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17032"
FT                   /db_xref="GOA:C5CYC8"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYC8"
FT                   /inference="protein motif:PFAM:PF01791"
FT                   /protein_id="ACS17032.1"
FT                   /translation="MSKDKTARLNRLLTNGRCLDIALDHGVCNEPSFLDGLEDMPQVME
FT                   KLLAAGPDAIQLNYGQSDLLQDRPGRNKPALVMRIDMGNPYNATLHRVMWAQLQNEHDP
FT                   VLPAVQRDAACVVVNLFMLPNEPDLFRQCVQNIARVRADCDRYGMPLMIEPLVMQSPTP
FT                   GSRYQVDGDAEKIVTLVRLAREMGADIVKADPTSDPKDFHRVVQAARCPVLVRGGGRED
FT                   LQQVFARSRVLLDQGAVGMVYGRNVYQHANPSAVVSALMAMIHRGASAEAAWALYESDG
FT                   AK"
FT   gene            complement(399481..400467)
FT                   /locus_tag="Vapar_0370"
FT   CDS_pept        complement(399481..400467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0370"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: sme:SM_b20500
FT                   putative aldoketo reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17033"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYC9"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACS17033.1"
FT                   /translation="MKMKKTTLGPSGIECSAIGLGTWAMGGWMWGGGDNAAAEAAIQAS
FT                   LDAGVTLIDTAPAYGLGRSESIVGTALKGRRHEAVIATKCGLVWHTQKGTHFFEEDGHP
FT                   VYRYLGRESIFHECEESLKRLQTDYIDLYITHWQDSTTPVAETMDALLALKKEGKIRAI
FT                   GVSNVSPETLAEYLRHGPVDAAQERYSLIDREIEQTLAPLCSEHNVAVLGYSSLALGLL
FT                   AGPIDPAREFKGDDQRASNPRFSEANRSRLKAFFEALEPLREQLGCSFGQMMIAWTVAR
FT                   GTVAVALCGARVRQQAIENAGAGAVALGGDALRLIDAAAKRHLGALA"
FT   gene            complement(400464..401480)
FT                   /locus_tag="Vapar_0371"
FT   CDS_pept        complement(400464..401480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0371"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rle:pRL120758 putative permease component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17034"
FT                   /db_xref="GOA:C5CYD0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYD0"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS17034.1"
FT                   /translation="MNYPAQLDAGLAPRPSGGGPVKPASKLTSMREMGLLLIIAVLCVA
FT                   MSFASPYFLTWDNVRAMLLSFSIEGIVVVGMTILLIVGGIDLSVGSVVCFAMVVTGKLF
FT                   LMGVDPWIASLVAIGASGLVGAMIGGCVTRIGLNHFIASLAFMVIVRGLCLALTQGTPQ
FT                   SLFSLPAEFKFIGQGTLFGVPAVILIFVAIVVVSDFVLRRSTLLRRVFYTGSNEKAALY
FT                   SGIRVGRVKFWVTVLCSASAGLAGVIYTARFGAATPTFGVGMELNVIAAAVIGGASLKG
FT                   GSGTVLGAVLGLALLSVVTSSLILLDVSPYWQDVIKGLILLAAVTIDHLLNTRKTTR"
FT   gene            complement(401477..403006)
FT                   /locus_tag="Vapar_0372"
FT   CDS_pept        complement(401477..403006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0372"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ret:RHE_PB00077 sugar ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17035"
FT                   /db_xref="GOA:C5CYD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYD1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS17035.1"
FT                   /translation="MSAVGSSALLELRGISKRFGASRALSGVDFSLHAGEIHALCGENG
FT                   AGKSTLMNIIDGIHRPDEGDILLNGQKVVIDGPAHAMRLGIGLVHQEIALCADATVAEN
FT                   IFMPEINAGRQAWMNYASLNARAAQVLARLGQDIAPATPVRELSISSQQLVEIAKALTL
FT                   DCKVLILDEPTAALTDNESAALFRVLHDLKAQGIGIIYISHRMAEIFTHCDRVTVLRDG
FT                   RNVHCGPLAGLSADELVRRMVGRDLGNYYPPKQEATESSGPVLEAVDIADGERVHGISF
FT                   ALQRGEILGIAGLMGAGRSELAETICGLRPATRGTLRLHGRALAIRKYSDALREGIAYL
FT                   SEDRKAAGVYLDLPIAQNISSMALRRVSSGWGLLQRAAEHRLARELGARLKLKSDGVAI
FT                   EVSSLSGGNQQKVAIAKLLATNPVVLLMDEPTRGVDVGAKSEIHHILRELANQGVGVIV
FT                   ISSELPEIIGLCDRALVIRDGRLAGELNSNDMTEEALLRLASGLCEQEEMA"
FT   gene            complement(403003..404043)
FT                   /locus_tag="Vapar_0373"
FT   CDS_pept        complement(403003..404043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0373"
FT                   /product="sugar ABC transporter"
FT                   /note="KEGG: ara:Arad_8598 sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17036"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYD2"
FT                   /inference="similar to AA sequence:KEGG:Arad_8598"
FT                   /protein_id="ACS17036.1"
FT                   /translation="MRRNFLKSAAAAGIGLAGTSAFAQSTPTPAATGLRGNASDVYVMN
FT                   VMVSGVEYWFPVYEMMKQLGRTLGVRTRYTGTPEYDVNKQLASFEQELARKPAGILLHP
FT                   MNPDPFIEPINRAVAMGIPVVTFAADSPNSKRASFVTSDNDREGTQAADAIAAALGGKG
FT                   EYAVLENPGQDNHDRRIAAFVNRMKTKHAGMKLVGRAASNQDPSKAYQAVLSLAQANPN
FT                   LGALFMPEANSALGAAQAKIESKKNIRVMCCDVNAKILDMIKAGDVFGAINPNQGMQGY
FT                   MGMMMLFLAKNPSLIDPMNDAKRNGTNPMSVPFLDNGLSVVSKANADDFYWDKYLARRG
FT                   TKGIGE"
FT   sig_peptide     complement(403972..404043)
FT                   /locus_tag="Vapar_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 24"
FT   gene            404223..405710
FT                   /locus_tag="Vapar_0374"
FT   CDS_pept        404223..405710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0374"
FT                   /product="carbohydrate kinase FGGY"
FT                   /note="PFAM: carbohydrate kinase FGGY; KEGG:
FT                   ret:RHE_PB00071 L-xylulose kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17037"
FT                   /db_xref="GOA:C5CYD3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYD3"
FT                   /inference="protein motif:PFAM:PF00370"
FT                   /protein_id="ACS17037.1"
FT                   /translation="MKSNILIGVDMGSSSLKALALEAASGRTVALSRMPLPHDRLPGGG
FT                   CEVGAPAIRAALTCVLQDVARQLGPRAAEVRAMACTGHGAGLYALDAGNQLIGGRAVAS
FT                   TDQRADARARALAASHGAQLFEEVGCSPWPGQPTVIAAELLGADAVQRGELQRLLFAKD
FT                   YLGFLLTGQIATDASDASTAGLVSLATGSWSRTALEASGIAELGAGAFGPIVPSGTTIG
FT                   KLLRAEAALCGLPAGIPVAMGAIDLLASMTAIRAEGRGRAVSVLGTWCVNAVVGPVMAP
FT                   KPAVAAIVNFGRGNARLYMENSPSSMANIAWLAGVLALPDARAVVDLAMTVPLGAGGLR
FT                   FLPFVNGGGGVTAGFVGLKSHHARADMARAVVDAVAALHARHTARLAAAGLAVDQTTVL
FT                   GGGAGDAHLVRLLAAFLGRPVERCADDETGARGAAIYAAMSQGLGDAAQGSALLAPCDV
FT                   IEPDAREARAHADFNAGFNELIDSMSPVFTHVAESVQ"
FT   gene            405707..407470
FT                   /locus_tag="Vapar_0375"
FT   CDS_pept        405707..407470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0375"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   oan:Oant_2918 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17038"
FT                   /db_xref="GOA:C5CYD4"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYD4"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACS17038.1"
FT                   /translation="MSAWQLPFVRPASLAGRHFSTVIVGAGINGVGVFRDLSLQRVDCL
FT                   IVDKGDFGAGASSAPSRMIHGGLRYLENGSFSLVAEATRERNLLLRNAPHLVRPLKTVV
FT                   PLASFFGGLMSSALKFFGRTPPQRTRGLLAVALGLRLYDILGRRQRVMPGHRISRVPLA
FT                   DRSLFRAAIRWTATFFDAWISHPEWLILELIADACRDQPRSAAANYCRVTGCAGNILTL
FT                   RDEITGALVRVTADTVVNATGAWLDRSAAVLGGAGPRVMGTKGSHLVLDHPALRDALDG
FT                   RMAYFEAVDGRVCIVYPFLDRVLVGSTDIPVEDPDQIVTEPAEVDYLIDVLREVFPNMA
FT                   FGRGDVVYTYVGVRPLARSEADKPGQISRDHSVVVDPPNATRDIAIVGLVGGKWTTFRS
FT                   LAEEATNEVLQLLGRSRTASTELLPIGGGAELPADAPAADRFVEKMMAACGMDRRRALT
FT                   LLGRYGSKALPLAQRLAASGDVPLQHAPDYSAAELSYLCLETGVLHLDDLVIRRTLLAI
FT                   RGLVTDAALAEIAGVAAEALGWDATHAHNELCACATALRERHNVRLHAVAAGEAPSFDA
FT                   SLMASSVLGQA"
FT   gene            407473..408231
FT                   /locus_tag="Vapar_0376"
FT   CDS_pept        407473..408231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0376"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: rsk:RSKD131_4320 transcriptional
FT                   regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17039"
FT                   /db_xref="GOA:C5CYD5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYD5"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACS17039.1"
FT                   /translation="MNSSPNDISTVLDRNSESPLWAQFRDAIRLQILQGALPIGAKLPS
FT                   EAELGEQFGISRIVVREALADLVRNNLIYKIKGRGAFVSARERDEDFVSTVLGFSDEME
FT                   RKGRSVRTQILAQELRAPTEHEAAALGLADDAQVVALKRLRSVDGELRLLVETAVPADL
FT                   APGLHRARLEDRSLYDVLRRQYGLRLVRAERWIDAVLPDAETCRLLDLPQPEPLLRIES
FT                   IAYGANGRPLEHYRALHRCKTSRLHVQTTT"
FT   gene            complement(408240..409130)
FT                   /locus_tag="Vapar_0377"
FT   CDS_pept        complement(408240..409130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0377"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: pol:Bpro_4618 protein of unknown
FT                   function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17040"
FT                   /db_xref="GOA:C5CYD6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYD6"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS17040.1"
FT                   /translation="MPSFTPRQFLLLVLLTLAWGLNWPVMKLGVADYPPLAFRAISIWL
FT                   GVPVLGLALAWMKVPFHVPRRAWPELVWLGATNMFIWHACIILAVKALSGGRAAILGYT
FT                   MPVFSAVIGALLFSAVLTRRSWVGVGACAVGVGLLLWHELTDLAGRPGYVALALVAAAT
FT                   WALGTQLLRHSRIGLPTLTLSFWMTAMTAVVMTVLSLLFERGPWRWPGPVTWGSIAYNA
FT                   VLIFGFAHAAWFYLARGLPPVASTLSVMFIPVLGVFSGAVWLGEVVHWQDWVAVALMMV
FT                   AIASVLWPSRSAAKA"
FT   gene            complement(409182..412325)
FT                   /locus_tag="Vapar_0378"
FT   CDS_pept        complement(409182..412325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0378"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: pol:Bpro_4568 excinuclease ABC
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17041"
FT                   /db_xref="GOA:C5CYD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYD7"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ACS17041.1"
FT                   /translation="MSGCPRTIAPLNSKAIEYADDGAQRARDAELERDTYLGAVLAQQR
FT                   ISIRGARTHNLKNVDLDIPRNKLVVITGLSGSGKSSLAFDTLYAEGQRRYVESLSAYAR
FT                   QFLQLMDKPDVDVIEGLSPAISIEQKATSHNPRSTVGTVTEIHDYLRLLYARAGTPYCP
FT                   DHHLPLQAQTVSQMVDATLAIPDEPRLMILAPVAREKKGEFLELFAEMQAAGYVRFRVD
FT                   GQTYEYNDLPKLKKTEKHDIDVVIDRLRARPDMQQRLAESFEAALRLAEGRAIALELGA
FT                   RPEGSADGTAGAPDKEHLFNAKFACPICHYSLSELEPRLFSFNSPVGACPSCDGLGHRE
FT                   VFDPARVVAFPSLSLASGAIKGWDRRNGYYFSMIESVAKHYKFDVDAPFESLPASVQQV
FT                   LLHGSAAEEIKFNYTMESGNFAGKKLTKKHPFEGIIPNMARRYRETDSVMVREDLARFR
FT                   NLQPCPDCGGSRLRPEARNVFLVDESARPADGGEPPRMAIFELSHLTLRDSLAWFQTLK
FT                   LRGAKADIADKVVREIGLRLKFLNDVGLNYLSLDRSAETLSGGEAQRIRLASQIGSGLT
FT                   GVMYVLDEPSIGLHQRDNDRLIGTLKHLRDIGNSVIVVEHDEDMIHAADHVIDMGPGAG
FT                   IHGGRVMAQGSYAQVAANPDSLTGQYLSGTKKIEVPKRRTAWLPVVKKPAFNEGKKASR
FT                   FPPSPAAERRAAREAAHLASQTDLQEIRVVGATGNNLKNVSVAFPVGLLTCVTGVSGSG
FT                   KSTLVNDTLYTAVARTLYRAHEEPAAHESVEGIEYFDKVINVDQSPIGRTPRSNPATYT
FT                   GLFTPIRELMAETNTARERGYGPGRFSFNVAGGRCEACQGDGVVKVEMHFLPDVYVPCE
FT                   VCHGQRYNRETLEVLYKGKNIAQILEMTVETAHEFLKAVPTIERKLRTLLDVGLSYIKL
FT                   GQSATTLSGGEAQRVKLALELSKRDTGRTLYILDEPTTGLHFADIELLLKVLHQLRDAG
FT                   NTIVVIEHNLDVIKTADWLIDMGPEGGAGGGTVVGEGTPEDIAANEASHTGRYLKRLL"
FT   gene            412488..413042
FT                   /locus_tag="Vapar_0379"
FT   CDS_pept        412488..413042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0379"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: aav:Aave_4713 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17042"
FT                   /db_xref="GOA:C5CYD8"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYD8"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACS17042.1"
FT                   /translation="MASVNKVIVVGNLGRDPEMRTFPSGDQVANVTVATTDRWKDKQSG
FT                   EMREATEWHRIVFNGRLAEIAGQYLRKGSQVYVEGSLRTRKWTDKDGIEKYTTEIRADQ
FT                   MQMLGSRQGQGGPSGGPEDDGGYSQGGGGGGYSQGAGGGGGGGYAPRAPAAAPRAPAPA
FT                   PRQAPAKSSSGFDDMDDDIPF"
FT   gene            413101..415074
FT                   /locus_tag="Vapar_0380"
FT   CDS_pept        413101..415074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0380"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   rso:RSc3160 two component sensor histidine kinase
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17043"
FT                   /db_xref="GOA:C5CYD9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CYD9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS17043.1"
FT                   /translation="MSLGSARRLLEHFSRYRFASFWANVVLAASVALLVAMAAFFGTSA
FT                   AQHNAALHLTQADWQVQDAPGFRALPLAVDSKALPSAWQPVELPLALPIALLRQADGSA
FT                   SAGATRITWLRISTRGLPATQAPLALYGARIKTDGTIAVYANGRQVHRAQVQGPLWNST
FT                   RTPLWVLLGKTTDGAPLDEILVRMEHTRGAQVAVSSLWLGPAEALEPRYRMRQWLQQEL
FT                   PAMLSTAFMAVGVFALFVWFRRSHETGYLLFFNLATTSFLRSLHFYVGVPVANDWFAWL
FT                   TVNSLFWLVAVVHFALRQLHGRPLRWFTGAVVAWTVLTGVLTLPGLAILRNTPQVTPLI
FT                   YLGAALMGVAVALVGGISAWRRSGEGRLVAVGIGVCVLLGVSDWLLQNNFVSPEGWYLG
FT                   AYTNAVTFSVFGVLLYRRYVNAIAEVERVNASLAQRLAAREAELELSHRRLREVERKQT
FT                   ISDERQRLMQDMHDGLGSSLISAIRSVEGGSMSDDKVSQVLKSCLDDLKLTIDSMEPLE
FT                   DDLLLLLATLRYRLGPRLESSGVALQWQVQELPALDWLDPTSALHILRIVQESIANVLR
FT                   HTRATEIRVATERQASGVRVSIEDNGQGFDVEKALAGAGGRGMQNQQRRAQAVGGEVSW
FT                   RSGPAGTLFTLWLPLQRGVRAA"
FT   sig_peptide     413101..413241
FT                   /locus_tag="Vapar_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.603 at
FT                   residue 47"
FT   gene            complement(415087..415527)
FT                   /locus_tag="Vapar_0381"
FT   CDS_pept        complement(415087..415527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0381"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: bid:Bind_2367 glutathione-dependent
FT                   formaldehyde-activating GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17044"
FT                   /db_xref="GOA:C5CJ44"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ44"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ACS17044.1"
FT                   /translation="MDSPVSSPENAANRTLAGRCLCGAVRYTVADAFAYALNCHCADCR
FT                   RATGSAFKPFAGIERHKLAIAQGQDELLVFGKEDAGDVHCRHCGSLLYSVVRDGLFVHV
FT                   TLGTLADDPSIRPRAHIFVGSKAPWFTITDDLPQYAGHADAD"
FT   gene            complement(415546..416259)
FT                   /locus_tag="Vapar_0382"
FT   CDS_pept        complement(415546..416259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0382"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   pna:Pnap_3561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17045"
FT                   /db_xref="GOA:C5CJ45"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ45"
FT                   /inference="protein motif:PFAM:PF01709"
FT                   /protein_id="ACS17045.1"
FT                   /translation="MGAQWKAKHKDLAANAKGRLFGKLAKEIMVAARSGADPASNARLR
FT                   LVVEQARKVSMPKDTLDRAIKKGAGLSGEAVHFEHVIYEGFAPHQVPVMVECLTDNVNR
FT                   TAPEMRVLFRKGQLGTSGSVSWDFDHVGMIEAEPSRADADAEVAAIEAGAQDFEAAGEG
FT                   GATVFLTDPTDLDLVSRALPAQGFTVLSAKLGYKPKNPVDPASLSAEHLEEVEVFLAAI
FT                   DANDDVQNVFVGLAG"
FT   gene            416615..416995
FT                   /locus_tag="Vapar_0383"
FT   CDS_pept        416615..416995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0383"
FT                   /product="SNF2 superfamily protein"
FT                   /note="KEGG: SNF2 superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17046"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ46"
FT                   /inference="similar to AA sequence:KEGG:CHLREDRAFT_6783"
FT                   /protein_id="ACS17046.1"
FT                   /translation="MTASKILSAVAVALMAVAGAAHAETYEGVHQLTSAASRADVASQA
FT                   VVAAHSANPYATGANAGPAQVLVSSNSRDAVRAEAAVAARSADPYAEGASSGVAPIVAS
FT                   TVDRATVRAAARAAARGDALPL"
FT   sig_peptide     416615..416686
FT                   /locus_tag="Vapar_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            417202..417345
FT                   /locus_tag="Vapar_0384"
FT   CDS_pept        417202..417345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17047"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ47"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17047.1"
FT                   /translation="MVPAAAGLAGAVLVASHPQDTHNVSCTLVLKDDAGRFEADAFACL
FT                   AG"
FT   gene            417357..417956
FT                   /locus_tag="Vapar_0385"
FT   CDS_pept        417357..417956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_0843 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17048"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ48"
FT                   /inference="similar to AA sequence:KEGG:Mpop_0843"
FT                   /protein_id="ACS17048.1"
FT                   /translation="MALTLDPEDTRERIHGLAWCGFHPDGDIEWMITDEYLDPDELTAE
FT                   DRAWVKAEAARACAAKRAAEASWPAQTEYDRLEAVFAQLRSEKIIALHRAGNSLADGHD
FT                   DVREQWRAAGRLASGIRGCCFYHAQDLDTAVRTGRLYLAFSGGMIPEIDQREANTVAVG
FT                   RRIVELLRAAGFGAQWSGNINERIEADLGQWRKRSP"
FT   gene            418036..419022
FT                   /locus_tag="Vapar_0386"
FT   CDS_pept        418036..419022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0386"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   rfr:Rfer_3316 luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17049"
FT                   /db_xref="GOA:C5CJ49"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ49"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACS17049.1"
FT                   /translation="MIPFSILDLSPITEGSDAAQSFRNSLSLAQHGEKLGYRRYWLAEH
FT                   HGMPGIASAATAVLLAYVGAGTSTIRIGAGGVMLPNHSPLVIAEQFGTLESLYPGRIDL
FT                   GLGRAPGSDQRTARALRRNLESDADQFPQDVVELMDFMSKAPQQPVRAVPGAGLEVPVW
FT                   ILGSSTFGAQLAAHLGLPYAFASHFAPQQLMQAIQIYRETFKPSAQLQKPHVMLGFNVF
FT                   VADTDEEAEFRATSWQQAFVNLRSGRPGRLPPPVEGYRQKVGPAENALLDSVLSCSAVG
FT                   SPARVREGVQAFIERTGADELMITSQVFDHAARLRSYELLAGLRGQA"
FT   gene            419072..420181
FT                   /locus_tag="Vapar_0387"
FT   CDS_pept        419072..420181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0387"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /note="TIGRFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   PFAM: tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase;
FT                   KEGG: pol:Bpro_4559 tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17050"
FT                   /db_xref="GOA:C5CJ50"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ50"
FT                   /inference="protein motif:TFAM:TIGR00420"
FT                   /protein_id="ACS17050.1"
FT                   /translation="MAKQRIVVGLSGGVDSAVTAHLLKQQGHEVVGIFMKNWEDDDDSE
FT                   YCSSNIDFVDAASVADVLGIEIEHVNFAADYKDRVFAEFLREYKAGRTPNPDVLCNAEI
FT                   KFKAFLDHAMRLGAEKIATGHYARVRLNETTGRHELLKGLDPSKDQSYFLHRLNQAQLS
FT                   KTLFPVGELHKTEVRRIAEEIGLPNAKKKDSTGICFIGERPFREFLNRYISKEPGPIKD
FT                   DRGRKLGEHQGLSFYTLGQRQGLGIGGVKEKGAQRGSGDHSPWFVARKDVEKNTLWVVQ
FT                   GHDHPWLLSSALAAGDASWVSGEAPAPGRYGSKARYRQADAACELEEGGGDPAASFSLR
FT                   FGEPQWAVTPGQSAVLYDGERCLGGGVIV"
FT   gene            complement(420209..420688)
FT                   /locus_tag="Vapar_0388"
FT   CDS_pept        complement(420209..420688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0388"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: aav:Aave_4725 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17051"
FT                   /db_xref="GOA:C5CJ51"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR033713"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ51"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACS17051.1"
FT                   /translation="MTTPRWKPNVTVAAVIEQDGRFLLVEEHTAQGLRLNTPAGHLDPG
FT                   ESPIEGCARETLEETAHAFTPTALVGIYMARSSHRTGSKEDVTYLRFAFAGTLGAQEAG
FT                   RALDEGIVRTVWMSADEIRACVPRHRSPLLLQCVEDHLAGKRYPLDLIHVHESVR"
FT   gene            complement(420712..421146)
FT                   /locus_tag="Vapar_0389"
FT   CDS_pept        complement(420712..421146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sml:Smlt1455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17052"
FT                   /db_xref="InterPro:IPR025091"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ52"
FT                   /inference="similar to AA sequence:KEGG:Smlt1455"
FT                   /protein_id="ACS17052.1"
FT                   /translation="MKVLARLLLAAVLCWGVFGTAAAQDVEASDLVQGGMQAIRMIDQG
FT                   RTGELWDGATAATRKRIARTDFAAKVSGSRSALGAPLQRTWVAVKRRAVADPDAEAAGQ
FT                   YVSIEYETRFSNKPDGTLRELVSFHLDSDRIWRFSGYALH"
FT   sig_peptide     complement(421075..421146)
FT                   /locus_tag="Vapar_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 24"
FT   gene            complement(421232..421945)
FT                   /locus_tag="Vapar_0390"
FT   CDS_pept        complement(421232..421945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0390"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   response regulator receiver; SMART: response regulator
FT                   receiver; KEGG: dac:Daci_5416 two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17053"
FT                   /db_xref="GOA:C5CJ53"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ53"
FT                   /inference="protein motif:PFAM:PF00486"
FT                   /protein_id="ACS17053.1"
FT                   /translation="MRIAVLDHEPDQLRLIAEAMSGLGHECHSYTEGRPLLQALRRQTF
FT                   DLLILEWNPPDMRGLELVKTARNELRSRAPILFVTTTRDETAVVEGLNAGADDFMVAPV
FT                   RATELEARVNALLRRSYPAQHETELVFGPYHFYPPARVLKVNGTPVELKNREYALALFL
FT                   FQNLGRLLSREHLHEAVWGVGTAALSRSLDTHISRLRTKLGLGPASGFLLLAIYGLGYR
FT                   LEVVDASTHPDSLAR"
FT   gene            422363..423493
FT                   /locus_tag="Vapar_0391"
FT   CDS_pept        422363..423493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0391"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: alanine dehydrogenase/PNT domain protein;
FT                   KEGG: vei:Veis_4748 NAD(P)(+) transhydrogenase
FT                   (AB-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17054"
FT                   /db_xref="GOA:C5CJ54"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ54"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ACS17054.1"
FT                   /translation="MLIGVPAETMAGETRVAVTPETVKKLAASGHTVRVQSGAGIAASV
FT                   TDAAYEAAGAEIVNMNAAFAADMVLKVRTPSDAETALMKPGTVVIGMLNPFDAAGLQRL
FT                   ATAGLTAFALEAAPRTTRAQSMDVLSSQANIAGYKAVIIAADKYQRFFPMLMTAAGTVK
FT                   AARVVILGVGVAGLQAIATAKRLGAVIEASDVRPSVKEQIESLGGKFIEVSYDTDEEKE
FT                   AAVGVGGYARPMPPSWLARQQVEVAKRVALADIVISTALIPGRAAPTLITEDMVKAMKP
FT                   GSVIVDIAAGKGADGIGGNCPLSEADKTVVKHGVTIVGETNLPALVAADASALYARNVL
FT                   DFLKLIVTKEGGLKIDLEDDIVAACRVAQDGQVTKP"
FT   gene            423526..423855
FT                   /locus_tag="Vapar_0392"
FT   CDS_pept        423526..423855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0392"
FT                   /product="NAD(P) transhydrogenase, subunit alpha part 2"
FT                   /note="KEGG: pna:Pnap_3799 NAD(P) transhydrogenase, subunit
FT                   alpha part 2"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17055"
FT                   /db_xref="GOA:C5CJ55"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ55"
FT                   /inference="similar to AA sequence:KEGG:Pnap_3799"
FT                   /protein_id="ACS17055.1"
FT                   /translation="MDPVSHTVINLIIFVLAIYVGYHVVWTVTPALHTPLMAVTNAISA
FT                   IVVVGAMLAAALTETPLGKTMGVLAVALAAVNIFGGFLVTRRMLEMFKKKEKKAAPKAE
FT                   AGASQ"
FT   gene            423852..425279
FT                   /locus_tag="Vapar_0393"
FT   CDS_pept        423852..425279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0393"
FT                   /product="NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /EC_number="1.6.1.2"
FT                   /note="PFAM: NAD(P) transhydrogenase beta subunit; KEGG:
FT                   lch:Lcho_0425 NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17056"
FT                   /db_xref="GOA:C5CJ56"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ56"
FT                   /inference="protein motif:PRIAM:1.6.1.2"
FT                   /protein_id="ACS17056.1"
FT                   /translation="MSMNVVTLLYLVASVCFIQALKGLSHPTTSIRGNLFGMAGMAIAV
FT                   VTTGALIYKLAGGQLTGLAWVLLGLAAGGGYGAYRAKTVEMTKMPELVAFFHSMIGLAA
FT                   VFIAVAAVVEPAAMLEGIAKGAPIPAGNRLELFLGAAIGAITFSGSVIAFGKLSGTYKF
FT                   RLFQGAPVQFKGQHMLNLVLGLAMIGLGLVFMATESWPAFFAMLALAFVMGVLIIIPIG
FT                   GADMPVVVSMLNSYSGWAAAGIGFSLNNAMLIVAGSLVGSSGAILSYIMCKAMNRSFFN
FT                   VILGGFGGEAVSAAGGAKEQRPVKSGSADDAAFVLGNAETVVIVPGYGLAVARAQHAVK
FT                   ELAEKLTHKGITVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINGEFGQADVAI
FT                   ILGANDVVNPAALQKGSPIYGMPILEAYKAKTVIVNKRSMAAGYAGLDNELFYMDKTMM
FT                   VFGDAKKVVEDMGKAIE"
FT   gene            425381..427060
FT                   /locus_tag="Vapar_0394"
FT   CDS_pept        425381..427060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0394"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   pol:Bpro_4543 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17057"
FT                   /db_xref="GOA:C5CJ57"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ57"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACS17057.1"
FT                   /translation="MTDRPWLSSYPQGVPADIDASQYSSLVGLMEESFARYADRTAYSF
FT                   MGKDVSYAETDKLSKAFGAYLQGLGLAKGDRVAVMMPNCPQYPIAVAAILRAGLILVNV
FT                   NPLYTPRELEHQLKDSGAKAIVIMENFGTTLQQCIAATPIKHIVLAAMGDRLGFLKGAL
FT                   VNYVVRNVKKLVPHYSLPGAVRFNDALDQGAGRTLKAPALGPDDVAVLQYTGGTTGVSK
FT                   GAVLLHRNVIANVLQSEAWNEPVMAQVPAGEQPTSVCALPLYHIFAFTVGMMLNMRTGG
FT                   KLILIPNPRDLAGVLKELSKHTIHSFPAVNTLFNGLANHPDFNTVNWKNLKVSVGGGMA
FT                   VQAAVAKLWLEKTGCPICEGYGLSETSPSATCNPTNSKAYTGTIGLPLPSTWLKLLDDE
FT                   GREVPPGQPGEIAIKGPQVMAGYWQRPDETAKVMTPDGYFKSGDIGVVDERGYFKVVDR
FT                   KKDMILVSGFNVYPNEIEDVVAQIPGVLECAAVGVADEKTGEAVKLVIVKKDESLTEAQ
FT                   VREYCRANLTGYKQPRIVEFRGELPKTPVGKILRRELRDVKK"
FT   gene            427111..428115
FT                   /locus_tag="Vapar_0395"
FT   CDS_pept        427111..428115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0395"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pol:Bpro_2812
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17058"
FT                   /db_xref="GOA:C5CJ58"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ58"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS17058.1"
FT                   /translation="MLRFLLTRVSLLVPTFIGMTLLAFFLIRLVPGDPIETMAGERGID
FT                   PERHAQLRAAYGFDKPVIVQYGIYIGRVLHGDLGKSLVTQESVANEFLALFPATVELAV
FT                   CAIAFALLLGLPAGILAAVRRNSIFDHGVMATSLTGYSMPIFWWGLLLILFFSVQLGWT
FT                   PVSGRIAVQYFVEPETGFLLIDALRAGDTGAFWSALHHLVLPAIVLGTVPLAVIARMTR
FT                   SAMLEVLGEDYIRTARAKGLSRLRVVGLHALRNALIPVVTVIGLQVGVLFTGAILTETI
FT                   FSWPGVGKWLIEAIGRRDYPVLQGGMLLLGGIVMLVNLLVDVAYGVINPRIRH"
FT   gene            428124..429035
FT                   /locus_tag="Vapar_0396"
FT   CDS_pept        428124..429035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0396"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pol:Bpro_2813
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17059"
FT                   /db_xref="GOA:C5CJ59"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ59"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS17059.1"
FT                   /translation="MATTTPHAVSGSAGGAAPPGPWREFWTAFSANRGAVIGLATVALL
FT                   LLVALFAPWIAPHAPNETNSAVFLLPPAWQQGGSASYLLGTDAIGRDILSRLMHGARLS
FT                   LSIGVAVVALSVVVGVVLGLVAGFFRGVLEIAIMRLMDIVLTMPSLLMAIVIVAILGPG
FT                   LVNAMVAVAIVVLPHYVRITRAAVIAEISRDYVTAARVSGAGTLRLMFREVLPNCAAPL
FT                   IVQASLGISTAILDAAALGFIGLGAQPPSPEWGTMLADAREFVLRAWWVVTFPGLAILA
FT                   AVLAFNLLGDGLRDALDPKLKR"
FT   gene            429032..430069
FT                   /locus_tag="Vapar_0397"
FT   CDS_pept        429032..430069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0397"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: pol:Bpro_2814 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17060"
FT                   /db_xref="GOA:C5CJ60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ60"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACS17060.1"
FT                   /translation="MNMLLDIKDLHVEFPTQGGVLHAVDGVSLRLEEGEVLGIVGESGS
FT                   GKSVTMMALMGLVGFPGRVRAQHMRFAGKELLGISDKARRALVGKEVAMIFQEPTTSLN
FT                   PCFTIGFQLMETLRLHLHLDRRTAKKRATELLEQVGIPAASSRLGSYPHQLSGGMNQRV
FT                   MIAMAIACNPRLLIADEPTTALDVTIQAQILDLLRELQKERGMALVLITHNMGVVSEMA
FT                   QRIAVMYAGQVMEQQRVDRLFADPQHPYTEALLAALPERAAPEGRLATIAGVVPGVHDR
FT                   PAGCLFAPRCSYVTTKACNVRPALREVESPPGAEVRCHFPLGEPGRMAAIEADRPRPQA
FT                   AEALP"
FT   gene            430066..431112
FT                   /locus_tag="Vapar_0398"
FT   CDS_pept        430066..431112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0398"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: mno:Mnod_0486 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17061"
FT                   /db_xref="GOA:C5CJ61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ61"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACS17061.1"
FT                   /translation="MSGDAIGDVVVEARNLQRTYAVRRGMFRAPAQLRAVGDISFRIER
FT                   GRTLAVVGESGCGKSTLARMVALIEKPTAGQLVLAGHDAVDPPPAYRRELRQAVQLVFQ
FT                   NPYGSLNPRKKISAVLEDPLAINTALGKPERVAKAREMLARVGLRPEHANRYPHMFSGG
FT                   QRQRIAIARALMLEPRLLVADEPVSALDVSIQAQVLNLLADLQAELGLAYLFISHDLGV
FT                   VRHIAHEVLVMYLGHAVEQGPKARIFARPLHPYTQALLASTPGLSSQRIVLKGELPSPL
FT                   DPPTGCVFNTRCPHATQRCREERPLLRALDERLVACHYAEKFLDGTPPVSADVPLSPPF
FT                   AAPLAANP"
FT   gene            431143..432783
FT                   /locus_tag="Vapar_0399"
FT   CDS_pept        431143..432783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0399"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: pol:Bpro_2816 extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17062"
FT                   /db_xref="GOA:C5CJ62"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ62"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACS17062.1"
FT                   /translation="MKKTTQPSVSRRSPRLGALLAPAALAMLALGAGAVSAKTLVYCSE
FT                   GSPENFYPGVNTTGTSFDVTTQVYNTIVEFERGGTKVVPGLAEKWDISADGTVYTFHLR
FT                   KGVKWHSTSKSFKPTRDFNADDFIFMLERQWKESDPFFKVTSQNHSYFNDMGMPKLLKS
FT                   VDRIDDLTVKITLNQAEAPFLANLAMQYAGIQSKEYAIAMLKAGTPEKVDQDPIGTGPF
FT                   YLVQYQKDAVIRFKAFPQYWGGKAKIDDLVFAITPDASVRWAKLQKGECHVMPYPNPAD
FT                   LDAIRKDPNVQVLEQPGLNVGYLSYNTTKKPFDDVRVRKAINMAINKKAIIDGVYLSTG
FT                   VAAKNPIPPTMWSYNDAVKDDPYDPEAAKKLLAQAGFPDGFSTDLWAMPVQRPYNPNAK
FT                   RIAELMQADLAKINVKAEIKSFEWGEYRKRLQAGEHQMGMLGWTGDNGDPDNFLYTLLG
FT                   CASAKSASGSNISKFCYQPYEDLVLKAKSATKQAERDALYKKAQVIFKEQAPWFTIAHA
FT                   VQLKPVRKEVVDFKLSPFGRHTFYGVDIK"
FT   sig_peptide     431143..431256
FT                   /locus_tag="Vapar_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 38"
FT   gene            432787..433569
FT                   /locus_tag="Vapar_0400"
FT   CDS_pept        432787..433569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0400"
FT                   /product="Adenosylhomocysteine nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   rpi:Rpic_3891 adenosylhomocysteine nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17063"
FT                   /db_xref="GOA:C5CJ63"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ63"
FT                   /inference="protein motif:PRIAM:3.2.2.9"
FT                   /protein_id="ACS17063.1"
FT                   /translation="MNAPVAIVAAMHEELGALLAQMPDEQRVRAAGRDFWVGHLHGQPV
FT                   VAVLSRIGKVAAAVTATVLLERFGVRAIVFTGVAGGLAPGVDVGDVVVATQLLQHDLDA
FT                   SPIFPKYEVPLMGLSRFAADASIGDALAAVAEAALRDPVALVGQAAADEFGLRSPKVHR
FT                   GLLVSGDRFVSTAAESAALRRSLPDALAVEMEGAAVAQVCHDYGVPFAAMRTISDRADD
FT                   AAHGDFARFVAEVASRYSLALVDAWLATLPPRGMPAAT"
FT   gene            complement(433562..434548)
FT                   /locus_tag="Vapar_0401"
FT   CDS_pept        complement(433562..434548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0401"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: pol:Bpro_4615 magnesium and cobalt transport protein
FT                   CorA"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17064"
FT                   /db_xref="GOA:C5CJ64"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ64"
FT                   /inference="protein motif:TFAM:TIGR00383"
FT                   /protein_id="ACS17064.1"
FT                   /translation="MLNIFTLANGRLVQEEIEALEELSKFQPIWVDLESPTLEEKRWIK
FT                   QYYGLSIPEDAMDEDIEESARFYEEDNGELHIRSDFLIDDDEDPRSVRVAFILNQHNTE
FT                   LRSRGVLFSIHDEDVPVFRLLRMRARRAPGLIEDAKEVLLKLFDADAEYSADTLENIYD
FT                   ELEIAGKKVLEGNVSDELAGEVLGAIARQEDLNGRIRRNVMDTRRAVSFMMRSRMLNAE
FT                   QFEEARQILRDIESLDNHTAFLFDKINFLMDATVGFININQNKTIKIFSVASVALLPPT
FT                   LIASIYGMNFKLMPELDWSLGYPYALALMAASALVPMWYFRRRGWLK"
FT   gene            434761..436899
FT                   /locus_tag="Vapar_0402"
FT   CDS_pept        434761..436899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0402"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: bpe:BP1980
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17065"
FT                   /db_xref="GOA:C5CJ65"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ65"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACS17065.1"
FT                   /translation="MQTAALPAFSATGTPLTTGATQAERLAAALSALNDEQRAAVEHGV
FT                   GTLTAGRDERPLLVIAGAGSGKTSTLAHRVAHLIAGGVDLQRLLLLTFSRRAAQEMERR
FT                   AGQVLARVLGLKSDKPPALPWAGTFHGIGARLLREYAAHIGLNDHFTIHDRGDAEDLMG
FT                   LVRHELGLSSSVNRFPRKGTCLSIYSRCVNTRAPLAEVLAEAFPWCAEWEAELKRLFGA
FT                   YVEAKQQQNVLDYDDLLLYWAGMVAEPALAALVGERFDHVLVDEYQDTNLLQASILRAL
FT                   KPDGRGVTVVGDDAQSIYSFRGATVRNILDFPSQFSQAARVVTLERNYRSTQPILDVSN
FT                   RVIAQAAERHAKTLWTDKPSAGRPQLVLVPDEAQQAVWVADKVLAHREGGLALKSQAVL
FT                   FRAATHSAPLELELARRNIPFVKYGGLKFLEASHVKDLLAVLRFAENPRGRMAGFRVTQ
FT                   LIPGIGPATGARLLDAMDQAADPAAAVREFVPPSAAREEWAVFAEAYAALCAPSLPWPA
FT                   DVELAVRWYLPHLDRLYDDPSGVRRGDVEQLARLASGYGSRERFLTELTLDPPEATSDK
FT                   PGPPSLDEDYLILSTIHSAKGQEWNSVHVLNVVDGCLPADVAQGAHELEEERRLLYVAM
FT                   TRARDHLHLLVPQRFYVTQQAVRGDRHLYANRTRFISESDLAGFEQQTWPPPPARPPAV
FT                   PPPAAVIDLRNRMRAAWS"
FT   sig_peptide     434761..434832
FT                   /locus_tag="Vapar_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.905) with cleavage site probability 0.516 at
FT                   residue 24"
FT   gene            437216..437545
FT                   /locus_tag="Vapar_0403"
FT   CDS_pept        437216..437545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0403"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   vei:Veis_0600 sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17066"
FT                   /db_xref="GOA:C5CJ66"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ66"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ACS17066.1"
FT                   /translation="MNLTISGHHLDVTPALRTYVTSKLDRITRHFDQVVDVKVLLTVEK
FT                   QKEKERRQRAECNIHVKGNDMFAESSHADLYAAVDELVDKLDRQVVRHKDRLQDHHHAA
FT                   PKRVM"
FT   gene            437730..438197
FT                   /locus_tag="Vapar_0404"
FT   CDS_pept        437730..438197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0404"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: aav:Aave_4557 PTS
FT                   IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17067"
FT                   /db_xref="GOA:C5CJ67"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ67"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACS17067.1"
FT                   /translation="MNRLASILPPAQVLVSVDATSKKRAFEEAGLLFESLHGLGRALIT
FT                   DSLFARERLGSTGLGHGVAIPHGRIKGLKAPMAAVFQLANPIGFDAPDEQPVGLLIFLL
FT                   VPEAATQKHLEILSEIAELLSDANLREQIKSSTDAAELHGLIAGWQSTQVA"
FT   gene            438292..439251
FT                   /locus_tag="Vapar_0405"
FT   CDS_pept        438292..439251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0405"
FT                   /product="HPr kinase"
FT                   /note="PFAM: HPr serine kinase domain protein; KEGG:
FT                   vei:Veis_0602 HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17068"
FT                   /db_xref="GOA:C5CJ68"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CJ68"
FT                   /inference="protein motif:PFAM:PF07475"
FT                   /protein_id="ACS17068.1"
FT                   /translation="MKPTVISADAMFEEFRGSLRWEWLAGLGASERQFDPEVISRAQSA
FT                   ADLVGYLNYIHPYRVQILGAREVAYLTRGSQEDCARRIARIVTLEPPMLVLADGQAAPD
FT                   ELLSICERAQLPLFATRESSAFVIDLLRAYLSKHFAERTSMHGVFMDILGMGVMITGES
FT                   GLGKSELGLELISRGNGLVADDAVDLFRINQNTIEGRCPDLLLNLLEVRGIGLLDIRAI
FT                   FGETAVRRKMRLKLIVHLVRRDSFERDYERMPSAPLTQDVLGIPVRKVIIQVVAGRNIA
FT                   VLVEAAVRNSILQLRGIDTYADFVARHHKAMESGRDGD"
FT   gene            complement(439256..439675)
FT                   /locus_tag="Vapar_0406"
FT   CDS_pept        complement(439256..439675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0406"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: dac:Daci_6009
FT                   ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17069"
FT                   /db_xref="GOA:C5CJ69"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ69"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACS17069.1"
FT                   /translation="MANIDELKNTGLKATLPRLKILEIFQTGSQRHMTAEDVFRVLLNE
FT                   HSDIGLATVYRVLTQFEQAGILERSHFESGKAVYELNEGTHHDHLICTSCGKVEEFYDA
FT                   EIERRQQMISKDKGWILQDHAMSLYGLCGDCVNKR"
FT   gene            439767..440327
FT                   /locus_tag="Vapar_0407"
FT   CDS_pept        439767..440327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0407"
FT                   /product="SmpA/OmlA domain protein"
FT                   /note="PFAM: SmpA/OmlA domain protein; KEGG: dac:Daci_6008
FT                   SmpA/OmlA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17070"
FT                   /db_xref="GOA:C5CJ70"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR026592"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ70"
FT                   /inference="protein motif:PFAM:PF04355"
FT                   /protein_id="ACS17070.1"
FT                   /translation="MPAILQRRPWLLAAAVAATFCLGACSGFSDRTRGALTAITPYKVE
FT                   VVQGNFVSKEQVEALKPGMSRQQVREILGTSLLTDVFHKDRWDYVFTIRRQGVDPQERR
FT                   LTVFFNGELLDRFEGDPMPSEEEFVATLDTRKKSGKVPPLEASEEELKKFAPKDDGKKA
FT                   DATATATSLPPLPAAYPPLEAAR"
FT   sig_peptide     439767..439856
FT                   /locus_tag="Vapar_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.442 at
FT                   residue 30"
FT   gene            440508..441272
FT                   /locus_tag="Vapar_0408"
FT   CDS_pept        440508..441272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0408"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="KEGG: pol:Bpro_4608 dihydrodipicolinate reductase;
FT                   TIGRFAM: dihydrodipicolinate reductase; PFAM:
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17071"
FT                   /db_xref="GOA:C5CJ71"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ71"
FT                   /inference="protein motif:TFAM:TIGR00036"
FT                   /protein_id="ACS17071.1"
FT                   /translation="MGRMLVEAVREAPDCRLAGALDMAGSNAIGADAAAFLGFTSGVPI
FT                   VADLRTGLKDAQVLIDFTRPEGTLAHLAACRELGVQAVIGTTGFSDAQKAEIAEIAKDI
FT                   AIMVSPNMSVGVNVTFKLLEMAAKALSTGYDIEIIEAHHRHKVDAPSGTALKMGEVIAG
FT                   ALGRDLKDCAVYAREGITGERDPSTIGFSAIRGGDIVGDHTVLFAGTGERIEITHKSAS
FT                   RVTYAQGALRAVRFLAGQKAGLFDMFDVLGLR"
FT   gene            441280..441987
FT                   /locus_tag="Vapar_0409"
FT   CDS_pept        441280..441987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0409"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   rfr:Rfer_0756 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17072"
FT                   /db_xref="GOA:C5CJ72"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ72"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ACS17072.1"
FT                   /translation="MSVLELLTQGDGVSRSVAALLLAMSIASWVVILWKAWLLRGGTRD
FT                   VLRSIAAFWQSATLADAQQRLQAFDRAMLVGPAVSAIRNAAATDAGDATLGATTGDRNQ
FT                   RLTRALRGALHGALRRLQSGQILLATVGATAPFVGLLGTVWGIYGALSGIAGQTGGFTI
FT                   DKVAGPVGEALVMTAFGLAVAIPAVLAYNVFGRVIGRIEAELEGFAHDLLGSFGSPPPP
FT                   AAPPPARPMPVSA"
FT   gene            442008..442478
FT                   /locus_tag="Vapar_0410"
FT   CDS_pept        442008..442478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0410"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   pna:Pnap_3787 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17073"
FT                   /db_xref="GOA:C5CJ73"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ73"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ACS17073.1"
FT                   /translation="MAFGRTSLGSSAAGGGRATGAGGQRPLSDINVTPLVDVMLVLLVI
FT                   FIITAPLMASSIKLDLPQTDAGQPNDTPKFVSVSVDAAGKTFFNDQPVTDEELAARLQK
FT                   AAADSKDTEVQLRADQTVPYGKLVALMGIANKAGLNRIGFVTEAKAAPETPR"
FT   sig_peptide     442008..442070
FT                   /locus_tag="Vapar_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.768) with cleavage site probability 0.625 at
FT                   residue 21"
FT   gene            complement(442615..445098)
FT                   /locus_tag="Vapar_0411"
FT   CDS_pept        complement(442615..445098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0411"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: lch:Lcho_1891 glycogen/starch/alpha-glucan
FT                   phosphorylase; TIGRFAM: glycogen/starch/alpha-glucan
FT                   phosphorylase; PFAM: glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17074"
FT                   /db_xref="GOA:C5CJ74"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ74"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ACS17074.1"
FT                   /translation="MTLKDFAYDHPDRDVAAFKRAVANKLIYAVGKDPVAASQDDWLHA
FT                   TALAVRDQLVERWMATTRANYAQDLKRVYYLSMEFLIGRTFTNALLAVDLYDTVREALA
FT                   DFGVDMAALAEREPDAALGNGGLGRLAACFLDSMATLGVPGMGYGIRYEYGMFRQRIVD
FT                   GQQVETPDYWLTRGNPWEFQRPEVNYRVRFGGRVQKREGTNAPYGAADWVDTHDVLAVA
FT                   YDTIIPGYGTQATNTLRLWSARATEEIDLSAFNRGNYMAAVESKNHSENVSRVLYPDDS
FT                   TPSGRELRLHQEYFFCSASVQDLLRRYLRNHKSFDQLADKVSIHLNDTHPVLAVPELMR
FT                   LLLDEHGLAWDTAWAHTQKVFSYTNHTLMHEALETWPVEMLGRILPRHLQIIYDMNAKF
FT                   LAAVTQKAGNDVELLRRLSLVDEAGERRVRMAYVAVLASHSINGVSGLHSELMKQSIFA
FT                   DFARIFPERFNNKTNGVTPRRWLAQANPPLASLLDQRLGKGWRRDLSQLEALRPMAAQP
FT                   PFARAFRHAKRENKLRLANWVEQHMGLVLDTDAMFDVQVKRIHEYKRQLLNVLHVVTRY
FT                   HRILDAQAAGAPVDIVPRVVVFAGKAASAYQMAKLVIRLVNDVAHTINNDSRVGKLLKV
FT                   VFLPNYSVSLAEVIMPAADLSEQISTAGTEASGTGNMKFALNGALTIGTLDGANVEMRD
FT                   NVGAENIFIFGNTTPEVADIRAHGYQPRDIYEENAELKRVLDAIRDGAFSAGEPSRYQG
FT                   IYDALVNWGDHYLLLADYASYVAKQAEVDALYRDPDAWTHMAILNVAGMGAFSSDRTIA
FT                   QYAHEIWHTKPVVLG"
FT   gene            complement(445144..446631)
FT                   /locus_tag="Vapar_0412"
FT   CDS_pept        complement(445144..446631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0412"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /EC_number="2.4.1.21"
FT                   /note="KEGG: tmz:Tmz1t_2043 glycogen/starch synthase,
FT                   ADP-glucose type; TIGRFAM: glycogen/starch synthase,
FT                   ADP-glucose type; PFAM: Starch synthase catalytic domain
FT                   protein; glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17075"
FT                   /db_xref="GOA:C5CJ75"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CJ75"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ACS17075.1"
FT                   /translation="MRILQVSAELFPLLKTGGLADVAGALPLALMAAGQDARVLLPGFP
FT                   AILAGVRELAPVAEFTAPWGPERFGLRAGRIAIDGAAAPITAYVIDAPVLYDRPGNPYE
FT                   DATRQPYGDNHRRFALLGWAAAQLAQGLDPAWQPEVVHAHDWHAGLAPAYLHFAREAGL
FT                   TRTGSVFTVHNLAYQGISAPWNFADLGLPAPAFHMNGLEYHGQVSFMKGGLYFADRLTT
FT                   VSPTYAREIQTPEQGFGLDGLLRLRGGVLTGILNAVDDEVWNPATDSALVQGYHTPDGR
FT                   HMAGKARCKAVLQHQLGLAERPDAPLFILVSRLTEQKGLHLVLGGLDTLLAEGGQLALL
FT                   GSGEAGLEQAFRERAAAAPRAVSVTIGYNETLAHQLFGGGDVTLVPSLFEPCGLTQMYG
FT                   LKYGSLPLVRRVGGLADTVVDCTLEDMASGHATGFVFDRFDAADYDRALRRAFALYQRA
FT                   PDWRRVRGNAMRRPADWASAAGQYIEVYRQALESAGT"
FT   gene            complement(446649..447965)
FT                   /locus_tag="Vapar_0413"
FT   CDS_pept        complement(446649..447965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0413"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate adenylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: lch:Lcho_1889
FT                   glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17076"
FT                   /db_xref="GOA:C5CJ76"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ76"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ACS17076.1"
FT                   /translation="MDNHSISSNSTPQAPLQAHQLVRRTIALVLAGGRGSRLKQLTDRR
FT                   AKPAVYFGGKFRIIDFALSNCLNSGIRRMAVVTQYKSHSLMRHLQRGWSFLRAELNEMV
FT                   DVLPAQQRTGDEHWYRGTADAVYQNLDIIQTRSTKHDYVVVLAGDHIYKMDYSIMVKDH
FT                   AERGLGCTVGCIEVPRMEATAFGVMAIDDGRQITAFLEKPADPPAMPGHPDVALASMGI
FT                   YVFDSEYLYQLLEEDAANPDSSHDFGKDIIPRAVAQGRALAHPFGMSCVTRASRGPDAK
FT                   AYWRDVGTIDAFWAANLDLASITPELDIYDTDWPIWTYQRQLPPAKFVLDREGKHGMTV
FT                   NTIVSGGCIVSGSKVSSSVLFSGVRIHSFCDINEAVLLPDVEVGRGARLNRVVVDRGCV
FT                   IPDEMVIGEDADADAARFERTDNGVVLVTREMLKRLLAA"
FT   gene            complement(448060..450141)
FT                   /locus_tag="Vapar_0414"
FT   CDS_pept        complement(448060..450141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0414"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="KEGG: lch:Lcho_1887 glycogen debranching enzyme
FT                   GlgX; TIGRFAM: glycogen debranching enzyme GlgX; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; SMART: alpha amylase catalytic sub
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17077"
FT                   /db_xref="GOA:C5CJ77"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR040784"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ77"
FT                   /inference="protein motif:TFAM:TIGR02100"
FT                   /protein_id="ACS17077.1"
FT                   /translation="MLSPGSPFPLGATLSPNGVNFALAAPSAEAVELCLFDGTGQHEQQ
FT                   RIRLPAFTDGVWHGLLPSGRAGLVYGFRVHGPWAPHAGQRFNPARLLLDPYAREIVGRY
FT                   DGSELFLGHDPANPDQRNTRDNGAVALKGRVAAAADGSAAPGHARIPAGERVLYELHVR
FT                   GQTRLHPGVPAALRGTYAGLAEPVVLDHLQALGVTTLSLMPVQHRADEQRLLAMGLGNY
FT                   WGYNTIGWFAPEARYWSGRAGTTPASEFRALADAVHARGMELVIDVVYNHSAESDELGP
FT                   TLSMRGIDNALYYHLRADDRALYTNWAGTGNCLDLAEPRVLQLVMDSLRHWTCALGVDG
FT                   FRFDLAPVLGRGADGHFDPRAPFFAAIAQDPVLSRTLLIAEPWDIGPGGYRLGEFPPGW
FT                   LEWNDRYRDTQRGFWLRQGREGAAGLGDFAHRFTASSAQFAHHGRAPTASVNFITAHDG
FT                   FTLRDLLCYEERHNLANGENNRDGHAHNLSNNCGVEGPSDDPAVQAERGRLQRALLAAL
FT                   LLSQGTPMLLAGDELGHSQQGNNNAYCQDNETTWLAWIGAHDPASEAARLSAFVARLIA
FT                   LRREAPVLRSTRWWPAEPAEGAPGIRWLRPDGQPMREADWHGGTALAILFEAAAADAGA
FT                   WLVLVNAGPAAMPFRLPAGSWKWRLATDDPAPEAGAAQPQPHAGTVEVPRSSLRIART"
FT   sig_peptide     complement(450067..450141)
FT                   /locus_tag="Vapar_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.701) with cleavage site probability 0.664 at
FT                   residue 25"
FT   gene            complement(450146..452317)
FT                   /locus_tag="Vapar_0415"
FT   CDS_pept        complement(450146..452317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0415"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: lch:Lcho_3321 1,4-alpha-glucan branching
FT                   enzyme; TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   alpha amylase all-beta; glycoside hydrolase family 13
FT                   domain protein; alpha amylase catalytic region; SMART:
FT                   alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17078"
FT                   /db_xref="GOA:C5CJ78"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ78"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ACS17078.1"
FT                   /translation="MPSLLLPEREVHALMRAEHGDPFAVLGPHETRDGLLVRALLPGAQ
FT                   SVAVVHTRTGWPLALLSRQEGSDLFAGLVPAAEALLGYSFQVDWGTHSSRLEDPYRFAF
FT                   VLGATDVWLLAEGTHLRPWERLGAHLCEMDGVKGVAFAVWAPNARRVSVVGDFNNWDGR
FT                   RHMMRLRRECGVWEIFAPQLATGDSYEFEILSAQGEVLRKADPFAFSSRLRPETACVVA
FT                   PLPAPVAMPPERAAANGRHAPMSIYEVHLGSWRRKNGHEWLDYRELADTLVPYARDMGF
FT                   THIELLPVSEHPFDGSWGYQPIGLYAPTSRFGTPGDFRHLVEAAHAAGLGVILDWVPAH
FT                   FPTDAHGLGRFDGTALYEYADPREGFHNDWKTFIFNYGRTEVRNYLVGNALYWLERYGV
FT                   DGLRVDAVASMLYRDYSRQPGEWVPNIHGGRENLEAIDFLRRMNRVVGVERPGAITLAE
FT                   ESTSFPGVTRPPEDGGLGFHYKWNMGWMNDTLAYAGIDPVHRKHHHQKITFGLMYAHSE
FT                   NFVLPLSHDEVVHGKGSMFGRMPGDEWQKFAGLRNLYGYLWAYPGKKLLFMGNEFAQVA
FT                   EWNADRSLDWHLLEQAPHQGMRRLVRDLNNVYRHFPALHELDTERAGFEWLVHDDREQS
FT                   VFAFVRRAQGGSFVVAVCNFTPLPRHGYRLGVPAAGAYREAINTDGAVYGGSGVGNGVV
FT                   DSEPVPWHGRADSILISVPPLATVMWVLA"
FT   gene            complement(452326..453999)
FT                   /locus_tag="Vapar_0416"
FT   CDS_pept        complement(452326..453999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0416"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: hch:HCH_00480
FT                   glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17079"
FT                   /db_xref="GOA:C5CJ79"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ79"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACS17079.1"
FT                   /translation="MRSNNSSNGEWWRGAVIYQIYPRSFMDSNGDGIGDLPGITSRLDH
FT                   VASLGVDAIWVSPFFRSPMKDFGYDVADYRAVDPIFGTLADFDEMLARAHALGLKIIID
FT                   QVLSHTSDQHAWFAESRASRDNSKADWYVWADPRPDGTPPNNWLSVFGGPAWQWDSRRR
FT                   QYYLHSFLQEQPDLNFHCAEVQQALLGEVRFWCERGVDGFRFDACNHQFHDALLRDNPP
FT                   ASAASLDEVSTVRADNPYAMQQHLYDKSQMENLRFLESLRGLLDDYGAVALGEVGDENA
FT                   PPVMAQYTELGKRLHLAYSFSLLTAEHSARHLRHQVETLDQALAPTGGWGCWAVSNHDV
FT                   PRVATRWSGGGPEDTRRDRLWLALLLALRGSASIYQGEELGLPEAEVPFELLQDPYGRA
FT                   FWPEFKGRDGCRTPMPWKADELHAGFTTGGPWLPVYGRHLPLAVDRQSTDPDSMLAFSR
FT                   ALLRWRRAQPLLRTGSIAFIDAPEPVLWFERREGNQSLQAVFNLGGESVSIALHGALEP
FT                   LAGHPLASSSTLQAGAERRMLRLAPYGVFFGRPAGEEEPM"
FT   gene            454141..455616
FT                   /locus_tag="Vapar_0417"
FT   CDS_pept        454141..455616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0417"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; FAD dependent oxidoreductase; KEGG:
FT                   aav:Aave_4505 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17080"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ80"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACS17080.1"
FT                   /translation="MTTDAASPAPSLHPQGLAALEQRLARDLECLGWPARAWMPARTHG
FT                   GEPVLDVAIIGAGQAGLAAAAALAQQGIRAVVFDRSPAGSEGPWATTARMETLRSPKEL
FT                   TGPALGLPALTFRAWFEAQFGSEAWAAMDKIPRLQWMDYLRWYRRVMNIDVRNDMAVTG
FT                   IQPLADGAMVRLALRTPAGAQQVLARRVVLATGRDGLGGPAVPAFVNALPRSQWAHSSD
FT                   EMDYGRLAGLRVGVVGAGSSAMDSAATALEAGVHSVELLIRRPDLPRVNKGKGAGVPGL
FT                   TQGHYDLPDAFKWRIRHYINVANVPPPHGSTLRVSRHPNAFFNFGCPVLAVEPQGAAMR
FT                   VATPRGDFVFDFLVVSTGFKIDWRCRPEFDTIASHVRTWKDRFVPAPGDEDQELADSPD
FT                   LGPAFEFRERTAGECPGLERIHCFCYPAALSHGTVSGDIPAISDGARRLASGMASLFYR
FT                   EDFEQHFANLEAYSEPELFGDEWVPAPPPSERG"
FT   gene            455642..456163
FT                   /locus_tag="Vapar_0418"
FT   CDS_pept        455642..456163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0418"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cti:RALTA_A1512 conserved hypothetical
FT                   protein, COG4950"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17081"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ81"
FT                   /inference="similar to AA sequence:KEGG:RALTA_A1512"
FT                   /protein_id="ACS17081.1"
FT                   /translation="MTTLSESPLAIDVIDATVPLVPGHATRLLRQQRDKVVAATQGSYD
FT                   AMFSPSVEGLSVAERLLVALHACSVSKAATLAAHYREQLLAEGVDRELIAAVGSGAPVA
FT                   DARLRTALAFTASLIERPIEGDKAAVQSLADAGLSTPAIVALGQLIAFLSYQVRVVAGL
FT                   QALAAAEVAA"
FT   gene            456160..456774
FT                   /locus_tag="Vapar_0419"
FT   CDS_pept        456160..456774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0419"
FT                   /product="uncharacterized peroxidase-related enzyme"
FT                   /note="TIGRFAM: uncharacterized peroxidase-related enzyme;
FT                   PFAM: Carboxymuconolactone decarboxylase; KEGG: bav:BAV1556
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17082"
FT                   /db_xref="GOA:C5CJ82"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ82"
FT                   /inference="protein motif:TFAM:TIGR01926"
FT                   /protein_id="ACS17082.1"
FT                   /translation="MSTSNTNTPIRIKGFTNEVLSWKPWLDPVDVASATPAQLAALDEM
FT                   SPQARTSPYFLLLAHQPEMLLQRSIAFNAIMFAPGGMPRAERELGATVESRVNGCVYCA
FT                   SVHAQRFEQLAKRSDVISQVFEEPASAGTTPREKAIVEFSIQLGAEPGKVSADNVRTLK
FT                   AVGLAELEILDLVHSVALFAWANRLMLNLGEPVFPPVTAAS"
FT   gene            complement(456769..457848)
FT                   /locus_tag="Vapar_0420"
FT   CDS_pept        complement(456769..457848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0420"
FT                   /product="NAD/NADP octopine/nopaline dehydrogenase"
FT                   /note="PFAM: NAD/NADP octopine/nopaline dehydrogenase;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; Ketopantoate reductase ApbA/PanE domain protein;
FT                   KEGG: ppu:PP_4452 NAD/NADP octopine/nopaline dehydrogenase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17083"
FT                   /db_xref="GOA:C5CJ83"
FT                   /db_xref="InterPro:IPR003421"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ83"
FT                   /inference="protein motif:PFAM:PF02317"
FT                   /protein_id="ACS17083.1"
FT                   /translation="MTEPAAGRLRVGIAGTGAIALASAAWLRQAGHAAMLWSPGGQGAE
FT                   ALRTQPLEAAGVQPCRVAVEVAGDAAQLCRASDVLLIALPVNGHRRVMDALLPFLRDGQ
FT                   TVIVSSMASLSSLYLHEGARRAGKRVTVASFGTTVLTARRESATQVRVMTRRQAVGVSA
FT                   LPRTEIESAIELCAALFGGGFFAQENTLASALANVNPQSHGPLAVFNWTRIEHAENWPQ
FT                   YHCMTPGVARAIEALDRERRAVAQAFGIALGPIEEHFARSFGTESARLEDIAAELHAKR
FT                   GGPPGPVRTDTRYLSEDMPYGLAFVEALGAIAGVATPATRTIVDAASLVSGIDFRQQND
FT                   LLAPLNLGTETVAGLLARL"
FT   gene            complement(457841..458854)
FT                   /locus_tag="Vapar_0421"
FT   CDS_pept        complement(457841..458854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   vei:Veis_1562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17084"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ84"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACS17084.1"
FT                   /translation="MTSCHLTQTENAMKLLLKHLALGLAAAASLAAVPLHAQPNGDKPL
FT                   RIVVPFAAGGAQDVIARYLGAKLTDKLGGSVIIDNKAGAGGIVAADAVAKATDGATVLL
FT                   ATGGAITIAPHLQSKLPYDPVHDLAPVALVGDTPMTVAVRTESPYKTLADLLRDAKAKP
FT                   GQLTYASTGNGTVSHLTGALLAQASGVDLLHVPYRGAAPALTDLLGGQVALIVTSAASI
FT                   EPMVASGKARVLGTFSRAALPSLGTPPTVAEAAGLAGMDVPVWVGVMAPARMPAASIEK
FT                   LSAALVEVCNLPETKQRFAQLGAVNTCGGGAALGKVIAEDSQRWAKVIKQGGIKVD"
FT   sig_peptide     complement(458741..458854)
FT                   /locus_tag="Vapar_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 38"
FT   gene            459022..461652
FT                   /locus_tag="Vapar_0422"
FT   CDS_pept        459022..461652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0422"
FT                   /product="leucyl-tRNA synthetase"
FT                   /note="TIGRFAM: leucyl-tRNA synthetase; KEGG: aav:Aave_4548
FT                   leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17085"
FT                   /db_xref="GOA:C5CJ85"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CJ85"
FT                   /inference="protein motif:TFAM:TIGR00396"
FT                   /protein_id="ACS17085.1"
FT                   /translation="MNPSYKPSDVESAAQAQWSAADAYRVTEDASRKKYYACSMLPYPS
FT                   GKLHMGHVRNYTINDMLTRYLRMSGYNVLMPMGWDAFGLPAENAALKNGVPPAKWTYEN
FT                   IDYMRGQLQAMGLAIDWSREIATCDPSYYKWNQWLFLKMLEKGIAYRKTQVVNWDPVDQ
FT                   TVLANEQVIDGKGWRTGATVERREIPGYYLKISDYAEELLEHTQHKLPGWPERVKLMQE
FT                   NWIGKSEGVRFAFTHDIQDASGRLIQDGRMYVFTTRADTIMGVTFCAVAPEHPLAAHAA
FT                   TLDPKVAAFIEECKSGGTTEAELATQEKKGVPTGLTVKHPITEEQVPVWVGNYVLINYG
FT                   DGAVMGVPAHDERDFAFANKYGIEIIQVVLVDDEPHFDYHRWQDWYGDKQRGVTINSDN
FT                   FSGMTHKEAVAAVAHALAQKGLGEMQTTWRLRDWGVSRQRYWGTPIPIIHCDEHGAVPV
FT                   PEKDLPVVLPTDCVPDGSGNPLAKHEGFHAGVVCPVCGKPARRETDTMDTFVDSSWYFM
FT                   RYCDPKNEQAMVAEGADYWMPMDQYIGGIEHAILHLLYARFWTKVMRDLGLVKVDEPFS
FT                   KLLTQGMVLNHIYYHRDEKGGKNYHPPLEVTPTLDAQGRIVGGTTADGTKIEYGGVGKM
FT                   GKSERNGVDPQDLIEKYGADTARLYTMFTAPPEATLEWNDAAVEGSYRFLRRVWNFGVA
FT                   QADVAPVAFGGQAFGKAAQALRREVHTVLRQVDYDYQRMQYNTVVSGAMKLLNALEGFK
FT                   PDGSAGDAAALREGLGILLRCLYPATPHITHQLWQHLGYDKELGDLLDAPWPVVDVAAL
FT                   EQDEIELMLQVNGKLRGALRVPAGASKAEIEALALSCDDFVKFAEGAPAKRVIVVPGRL
FT                   VNVVI"
FT   gene            461673..462194
FT                   /locus_tag="Vapar_0423"
FT   CDS_pept        461673..462194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0423"
FT                   /product="Rare lipoprotein B"
FT                   /note="PFAM: Rare lipoprotein B; KEGG: pol:Bpro_4604 rare
FT                   lipoprotein B"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17086"
FT                   /db_xref="GOA:C5CJ86"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ86"
FT                   /inference="protein motif:PFAM:PF04390"
FT                   /protein_id="ACS17086.1"
FT                   /translation="MNNRNAPLPRRGLLLGLAAAGASLALAGCGFELRKAPVFAFKTLS
FT                   LSGNSELINRLRREMRAAGTVTLVPPDQTQSADAILEILGENRDRIVISTNSAGLLREL
FT                   QLQLRVRFSLRTPGGKMLLAPSEVSQTRDLSFNETNALAKEGEAELLYRDMQADIAQQL
FT                   MRRLAAVKEL"
FT   sig_peptide     461673..461756
FT                   /locus_tag="Vapar_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.817 at
FT                   residue 28"
FT   gene            462199..463284
FT                   /locus_tag="Vapar_0424"
FT   CDS_pept        462199..463284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0424"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: aav:Aave_4546 DNA polymerase III subunit
FT                   delta; TIGRFAM: DNA polymerase III, delta subunit; PFAM:
FT                   DNA polymerase III delta"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17087"
FT                   /db_xref="GOA:C5CJ87"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ87"
FT                   /inference="protein motif:TFAM:TIGR01128"
FT                   /protein_id="ACS17087.1"
FT                   /translation="MQLASAQLGSHLQKGLKSLYAIHGDEPLLAQEAADAIRTAARAAG
FT                   YTERSSYTVAGAHFDWSAVLAAGGSLSLFADKQIVEIRIPSGKPGKDGSIALQQLAESA
FT                   QGNDSTLTLVMLPRLDKATRTGAWFSALENNGVSLQVDPIERNALPQWIAQRLGLQGQR
FT                   VMPGDEGQRTLQFFADRVEGNLLAAHQEIQKLALLHPAGELSWEQVEGAVNNVARYDVF
FT                   KLSEAVLAGNPQRVARMLDGLQAEGEAEVLVHYTIAEDIRALKRVKDAMAAGRPLPMAL
FT                   RENRIWGPRERAFERVLPRLDDRMLARLLRAAHVVDGICKGLKQPDWPAGGWQALQRLA
FT                   LMLCRACSTGPAPSPSGRGLG"
FT   gene            463401..464714
FT                   /locus_tag="Vapar_0425"
FT   CDS_pept        463401..464714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0425"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /note="TIGRFAM: gamma-glutamyl phosphate reductase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: pna:Pnap_3751 gamma-glutamyl
FT                   phosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17088"
FT                   /db_xref="GOA:C5CJ88"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ88"
FT                   /inference="protein motif:TFAM:TIGR00407"
FT                   /protein_id="ACS17088.1"
FT                   /translation="MHENARMNAFNVSEHMQTLGLQAKTAAFLMARADAATKNRALKAL
FT                   AKRLREAGPGLAEANQKDLARATAAGLSAPMVDRLKLTPKVIETVALGCEQLAGMADVI
FT                   GEIIGMKQQPSGIRVGQMRVPIGVFGMIYESRPNVTIEAASLAIKSGNAAILRGGSEAI
FT                   ESNKALALLVSGALAEAGLPVEAVQLVQTTDREAVGQLIAMPEFVDVIIPRGGKGLIER
FT                   ISRDAKVPVIKHLDGNCHVYVDDTAEFEMALRIVDNAKTQKYSPCNAAEGLLVSAAVAE
FT                   DFLPRIAAIFAAKGVEMRCDPVAARILRADEALAGAGARIVDAVESDWSEEYLAAVISI
FT                   KVVQGVDEAIAHINRYSSHHTDAIVTRDHVHAQRFLREVDSASVMVNASTRFADGFEFG
FT                   LGAEIGISTDKFHARGPVGIEGLTSLKYVVLGQGEVRS"
FT   gene            464836..466146
FT                   /locus_tag="Vapar_0426"
FT   CDS_pept        464836..466146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0426"
FT                   /product="glutamate/cysteine ligase"
FT                   /note="TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GshA; KEGG: dia:Dtpsy_3259
FT                   glutamate/cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17089"
FT                   /db_xref="GOA:C5CJ89"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="InterPro:IPR042520"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ89"
FT                   /inference="protein motif:TFAM:TIGR02049"
FT                   /protein_id="ACS17089.1"
FT                   /translation="MVPHLVTALTGPINELEQRVLDSTPAIERWFRLEWMEHTPPFYSA
FT                   VDIRNAGFKLAPVDTNLFPGGWNNLTKEMLPLAVQAAQAAIEKICPEARNLLVIPENHS
FT                   KNTFYLANVAQLVRIFHMAGLNVRVGSIDPAIKSPKKIELPNGETVCLEPVVRSKRRLG
FT                   LKNFDPCTILLNNELTAGTPGILEDLHEQYLLPPLHAGWSVRRKSNHLHSYEELSKRFG
FT                   KLLGIDPWLINPIYARADGVDFSEGRGIDVLTSHVDAVLTKVRRKYKEYGINEKPFVVV
FT                   KGHVGGDGPGVVTVRDAKEVEGLVGKPRSAPAGKAGAAARELREPGEVIVQEGVLTNER
FT                   VHNGVAEPVVYMMDRYVVGGFYRVHAERAPDENLKLPGASFVPLAFSESAHLPQPGAKP
FT                   GASAPNRFYMYGVVGRLAMVAASYEMEATDPDAEIYE"
FT   gene            466273..468192
FT                   /locus_tag="Vapar_0427"
FT   CDS_pept        466273..468192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0427"
FT                   /product="K potassium transporter"
FT                   /note="PFAM: K potassium transporter; KEGG: pna:Pnap_3749
FT                   K+ potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17090"
FT                   /db_xref="GOA:C5CJ90"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ90"
FT                   /inference="protein motif:PFAM:PF02705"
FT                   /protein_id="ACS17090.1"
FT                   /translation="MTSGYARAASLFPIDFVSPPKSTSAAALIIGAIGVVYGDIGTSVL
FT                   YAVKEVFGHGHLPFTVENVYGILSMFFWTLTVIVSIKYVVLVLRADNEGEGGLVAMLAL
FT                   ASRAVADKPRLRHVLLLVGIFGTSLFYGDGVITPAISVLSAVEGLEVVSPHFKHYVLPV
FT                   TLVVLFGLFVVQKRGTAGIGKFFGPITLAWFLAIAVLGVSQILHHPEILKSLNPWFALK
FT                   FMWDNPGTSFILLGATVLCVTGAEALYADLGHFGKRPIRVAWFTVVMPALTLNYFGQGA
FT                   LLLANPEAVKNPFFMMAPEWALVPLVLLATAATVIASQALITGAFSVTRQVIQLGYLPR
FT                   LNIEHTSVRTAGQIYIPLVNWGLFVAIVLAVVMFRSSSSLAAAYGIAVTTDMLITTILT
FT                   FFVIRYAWKLPLALCIASTAMFFVVDFLFFASNLLKLFEGGWFPLVIGGAVFTLMITWK
FT                   EGRRLMGEVQRADAIELKAFLDSVFESPPARVDGTAVFLTAEPGVVPNALLHNLKHNKV
FT                   LHEQNMFVTVRNHEVPWIPMDKRIEIEALGHHCWQVTVHYGFKNDIDLPRALDNARMRG
FT                   CQLEPMTTSYFLSRDVVIPTLGSGMAPWREKLFAQMHHNASGAAAFLGLPNNAVVELGS
FT                   KIEI"
FT   gene            complement(468238..469005)
FT                   /locus_tag="Vapar_0428"
FT   CDS_pept        complement(468238..469005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0428"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   pol:Bpro_1052 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17091"
FT                   /db_xref="GOA:C5CJ91"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ91"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACS17091.1"
FT                   /translation="MPRSSSPPKPATAPRPTRRKLPPTGGAAAKNEGNGDIEERIFRSV
FT                   FESVASQRLAPGTKLPEASLCELFGVSRALVRKVLQRLAHDHIVELRPNRGAIVAMPSP
FT                   EETRQIFEARRALEAALVRMAVRNATRAEVAELRRHLKQEHAAMHRYAQPEWARLASTF
FT                   HLRVAKLARNPILERYLSELMSRCSLIVALYEPPGNASCEHGEHADVVDAIARGDADEA
FT                   VRLMEAHLLVLEKNIALDRPASGRSLGQMLGLG"
FT   gene            complement(469063..469986)
FT                   /locus_tag="Vapar_0429"
FT   CDS_pept        complement(469063..469986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0429"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   vei:Veis_3554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17092"
FT                   /db_xref="GOA:C5CJ92"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ92"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ACS17092.1"
FT                   /translation="MTACWPGRLPTHGRFGYSPITRRPDYAWPNGARLAVYIGFNIEHF
FT                   AFGDGLGACIGPASPQPDVLNHGWREYGNRVGAWRCLELFDALALPAGALVNTALYDHC
FT                   PELVQACVARGDELIGHGHSNAERQGAWDEAHERALLSGCRERMQRESGQAPAGWLSPW
FT                   ISESAVTPDLLAETGYGYTLNWCHDDQPVRMRTRGGSSIWSVPYPQELNDIPMIVGRLM
FT                   DARDFSAMVVDNFDEMREQSRAQPLVMGLALHPYIVGQPYRLRHLRTALAHLARARDRG
FT                   DIWFTTPGAIASHMQQLAADRPADFA"
FT   gene            complement(469997..470437)
FT                   /locus_tag="Vapar_0430"
FT   CDS_pept        complement(469997..470437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpb:RPB_2080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17093"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ93"
FT                   /inference="similar to AA sequence:KEGG:RPB_2080"
FT                   /protein_id="ACS17093.1"
FT                   /translation="MNTPASPDAPPSPHPSTPAEVVDEFLRLVMIPDPQSASRFTAPDI
FT                   RIRFTGNREMQAPGDTSAFNAKRYAWVKKKIERTEVVAGGTPEETVVYSLGTLYGAWPD
FT                   GTAFEGNRYVDRYVVRHGLISRMDVWNDSAEWLLVRAGLAVL"
FT   gene            470609..471874
FT                   /locus_tag="Vapar_0431"
FT   CDS_pept        470609..471874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0431"
FT                   /product="benzoate transporter"
FT                   /note="TIGRFAM: benzoate transporter; PFAM: Benzoate
FT                   membrane transport protein; Xanthine/uracil/vitamin C
FT                   permease; KEGG: dia:Dtpsy_3257 benzoate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17094"
FT                   /db_xref="GOA:C5CJ94"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ94"
FT                   /inference="protein motif:TFAM:TIGR00843"
FT                   /protein_id="ACS17094.1"
FT                   /translation="MRFFKDLSLSAFTAGFVAVLVGFMSSVAIVFQAAQAFGATPELAA
FT                   SWMWALGIGMGLPSILLSLWWRKPVMIAWSTPGAAVLAVAAGSYGMGEAVGAFIACALL
FT                   VVLAGATGWFERVMNRIPMAIAAALLAGVLARFGLDAFIAARTALPLVLLMLGTYLVAR
FT                   RLLPRYAVPLTLLAAVAFAAARGEMSVSAVQFSLTWPVFTMPVFSWQAIVSLALPLFIV
FT                   TMASQNLPGVATIRAAGYGDLPISKIITATGFATLVLAPFGAFALNLGAITAAICMGRE
FT                   AHEDPARRYTAAVSCGALYVVIAFFGAAVTGLLTAFPKELVAAIAGLALLGTIGSGLAA
FT                   AVRDEPHREAAVITFLVTLSGVAIAGIGSAFWGVVAGALALAVQQAGRTKASAGKGIAA
FT                   SGNIAPDSSNMAATPGAGKTPR"
FT   sig_peptide     470609..470725
FT                   /locus_tag="Vapar_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.620 at
FT                   residue 39"
FT   gene            471871..472824
FT                   /locus_tag="Vapar_0432"
FT   CDS_pept        471871..472824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0432"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: mpt:Mpe_A0180 glutathione synthetase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase
FT                   ATP-binding; RimK domain protein ATP-grasp; glutathione
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17095"
FT                   /db_xref="GOA:C5CJ95"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ95"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ACS17095.1"
FT                   /translation="MKNILFVADPLDHFKIYKDTTFSMMREAQRRGYRIAACLPEELQW
FT                   VSGGLVTANVQQITLTGDSKAWYREDIRESKALKDFDAVLMRKDPPFDAEYIYATHLLE
FT                   QAEREGAHVVNKPRALRDHPEKLAIMEFPQFTTPTLVTRSAQAVRDFHAEHGDIILKPL
FT                   DGMGGMGIFRVRQDALNLGSIVETLNKNGAETIMVQRFVPDIVQGDKRILIIAGEPAPF
FT                   VLARIPQGTEVRGNLAAGGKGVAQPLTPRNREIAETVGRALAPRGLLLIGLDVIGDCVT
FT                   EINVTSPTCFQEITEQTGFDVPAMFIDALEKTLRPA"
FT   gene            complement(472787..474088)
FT                   /locus_tag="Vapar_0433"
FT   CDS_pept        complement(472787..474088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0433"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: dac:Daci_2267 PepSY-associated TM helix
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17096"
FT                   /db_xref="GOA:C5CJ96"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ96"
FT                   /inference="protein motif:PFAM:PF03929"
FT                   /protein_id="ACS17096.1"
FT                   /translation="MRALATAVHRWAGLAVALFLVVSGLTGAVISWDHEIDGWLNRKLY
FT                   DTASRGPFKDPFELAAAVEAHDPRARVAYLPLGFEEGHAAGYFVQPRTDPATGKPFRLG
FT                   YNQVFVDPVTAEVRGRRDSTAISLKPETLMPFLRKLHYMLHVPAMWGTDRLGYWIMGTV
FT                   ALVWLLDSFVALYLTTPRRLRQAVHPAHRPAGAWWQRWKPAWTVRWAAGGYRLNFDLHR
FT                   AGGLWMWLLIIVIAFTSFSLNLYKEVFHPMLSLVSKTTPGPSALVPLAPLGTRIEPAIG
FT                   FREIVAQADAEARRRGWTTPLGGVFYNARGGFYNISFFDRASHDDSDGMGLSNLYLDGR
FT                   DGHLIGSNRPWHGTAADVFAQLQLPLHGGRILGLPGRILMSAMGLAVAMLSITGIVIWG
FT                   RKLRSRRLQDRRQREPAGAAPALRQGAGFSPARR"
FT   sig_peptide     complement(474002..474088)
FT                   /locus_tag="Vapar_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.748 at
FT                   residue 29"
FT   gene            complement(474088..476349)
FT                   /locus_tag="Vapar_0434"
FT   CDS_pept        complement(474088..476349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0434"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: dia:Dtpsy_2068 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17097"
FT                   /db_xref="GOA:C5CJ97"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ97"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ACS17097.1"
FT                   /translation="MSAAPFPRLRPTVAASLLALHAVAALAQTTAAQPAASPSPSSSNG
FT                   TLATVTVEASADASAEGLTKPYAGGQVARGGRVGILGNQDMMSTPFSGTSYTHELIQNQ
FT                   QARSVADVLQNDPTVRVARGFGNFQESYFIRGFIVNSDDIAYNGLYGLLPRQYISSELF
FT                   ERVEVFRGASAFLNGATPSGGGIGGNINLLPKRAPNEPLTQVTLGTASGSQAYAATDIA
FT                   RRFGPDQSVGVRLNAAHRDGGTGVDGEGVKLDVLSVGLDWRSRDARISADIGHQEHRLR
FT                   NTRPNVTLGSGVTLVPRAPDNSTNFAQPWTYSYERDTFGSVRGEYDITPDITAWAAAGA
FT                   RSSYENNSLAGPTVSNGLTGAATMTRFDNTREDKVKTAEIGVRGKLRTGSVGHEWVLGY
FT                   SYFDLEKKNAYGMGLGAGGTLNTGIYSPRSYFPPALTYLGNDLANPALNGTTTLKSLAI
FT                   GDTLSFMDDRLRLTLGARRQTIETADIGYRIVSNGQQTAAGGTVTSYDQSRTSPLAGIV
FT                   FKANDRLSVYANYIEGLAQGETAPAQSGGQPVLNAGQQLRPYVSKQKEVGIKYDAGQVG
FT                   GTLAFFSTEKPRAFVQGNYFSANGKDRHQGAELSVFGQVSKGLRLLGGVTWLDAKQKDT
FT                   GSSTTDGKRVIGVPKAQGSIGVEWDVPGVQGLSLDGRVVASGSSYANAANTLRVPGWTR
FT                   VDIGARYVTEVSGKLLTLRARIENLADRNYWSSVGGYPGSGYLVLGAPRTFNLSATLEF
FT                   "
FT   sig_peptide     complement(476266..476349)
FT                   /locus_tag="Vapar_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 28"
FT   gene            complement(476488..477255)
FT                   /locus_tag="Vapar_0435"
FT   CDS_pept        complement(476488..477255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0435"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   ajs:Ajs_0335 glutamine amidotransferase, class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17098"
FT                   /db_xref="GOA:C5CJ98"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ98"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ACS17098.1"
FT                   /translation="MCQLLGMNCNTPTDVTFSFTGFAQRGGRTDHHADGWGIAFFEDRG
FT                   LRHFVDHMPASESPVAELIRRYPIQSRNVIAHIRKATQGAVNLQNCHPFVRELWGRYWV
FT                   FAHNGDLKDFRPRLHGNFHPVGNTDSEHAFCWIMQELAKSHAGVPSIEELTLTLRELAP
FT                   QLAGHGTFNFMLSNGQALWAHASTHLWYVERRHPFVTAQLSDEDLEIDFAQHTTPNDRV
FT                   AVVVTAPLTTNESWTAFAPGELHVFVDGQLAPF"
FT   gene            complement(477306..478445)
FT                   /locus_tag="Vapar_0436"
FT   CDS_pept        complement(477306..478445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0436"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   lch:Lcho_1126 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17099"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJ99"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACS17099.1"
FT                   /translation="MQRRSFVAGTAVFAAGLAHLSSAQAAESGVTDTEIVLGSSAVLSG
FT                   PLGSQIKVVHNGAALAFDAINEQGGVGGRKIKLVALDDELKPEKAVENYAKLLNDHRVF
FT                   AFFGCVGSGTTAAAAKLLQQSGAPSVGGYGVGDSARERVAGSAYFVRASNAREAQALVE
FT                   HLSTIGVNKIAIAHLDNPGGVEAVKLIEAAMATNKQAPALVVSVKGDGSTSAAAGKMLA
FT                   DSQSQAVLMYLAGTVAGEVIKATYAAGSKPMFYGMSIVPGEVTAKVVQLQASGLAISQV
FT                   MPYPWGEVESVTRDYRRLAERAQVPVGYGSFEGYLNALVMIEALKRTGRDLTRARLHAT
FT                   LRAFRLRLAGMDIDFSTGANAGSRFIEMVRVTPEGRFVR"
FT   sig_peptide     complement(478368..478445)
FT                   /locus_tag="Vapar_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 26"
FT   gene            complement(478510..480003)
FT                   /locus_tag="Vapar_0437"
FT   CDS_pept        complement(478510..480003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0437"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_4538 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17100"
FT                   /db_xref="GOA:C5CJA0"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJA0"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACS17100.1"
FT                   /translation="MTTTPKPEAASPAPPSIGTLRERYGPRYRWYLLLSVMVGVMASIM
FT                   SSTIVNVAIPGMSHHFSLGQERAQWVSSGFMVAMTVSMLTTPWLLSRYGYRRTYAGTMV
FT                   LLLAGGVAGGLANNFSLVLLARVAEGLAAGVVQPIPAIIILRAFEPHEQGRASGIFGMG
FT                   VVLAPAIGPSIGGVLVDLFGWRSIFFMVVPFCLASLWLAYRFVPTTAPGGVAATRGSGL
FT                   DWRGLALGTVGTLCLLNGLVELRGDSPLQAGLLLAAAALAFAAFVWWQRRHAAGGGEPL
FT                   MNLALFQYRQFAMGSVVAFIYGTALFGSTYLLPVYMQVGLQLSASHVGTILLPAGIVLA
FT                   LTIAGVGRLADRQPTWMLVSIGLVLLAASFALMVVLRLDSALWLLVAFAIIGRIGLGFI
FT                   LPSLNLGSMRPLAKPLIPQGASAINFLRMLGGAAGVSLCAIVLEWRLAAHGDSLANAAS
FT                   SPARLAAFDEVFLMLAALCALAICAAWQLRQSDPARVST"
FT   gene            480137..481510
FT                   /locus_tag="Vapar_0438"
FT   CDS_pept        480137..481510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A3629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17101"
FT                   /db_xref="InterPro:IPR011201"
FT                   /db_xref="InterPro:IPR031321"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJA1"
FT                   /inference="similar to AA sequence:KEGG:Mpe_A3629"
FT                   /protein_id="ACS17101.1"
FT                   /translation="MNTPPDHASAPEPGAPSHLASELAAPTVSRAYRCQCGRPVFLRNS
FT                   QCLACRTPLGYVIERLGVVPLAPVEAEDKAEGGAADGAEPEEQEQLFTVFGNPDGRTYR
FT                   RCANLMTAASCNWMVPAPREGDDPSFNTDGLAPGYCLACSVTRTIPDLSVESNGELWRK
FT                   LEHAKRRLISQLLALGLPVVSRHADPVHGLAFDFLGNMPGGPHVMTGHEQGVITLNAEE
FT                   AEDAVRERIRAEMREPYRTLLGHFRHEVGHYYWDLLVQPTPWLDGFRALFGDERADYAA
FT                   ALQQHYEQGPPPDWANRFVSSYASMHPWEDWAETWAHYLHMADTADTAMSFGVDATNVE
FT                   LATDLFTAEDLWQPEHPGAAKFLDFLNGWVLLTNVLNELSRSMGQPDYYPFVLPRVAVG
FT                   KLQFIHCVITQQRDRGMSAAASPGVPLPPEAKAPAAASQAAPAPVPQAQNQQQGAAQS"
FT   gene            complement(481501..481737)
FT                   /locus_tag="Vapar_0439"
FT   CDS_pept        complement(481501..481737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0439"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17102"
FT                   /db_xref="InterPro:IPR032720"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJA2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17102.1"
FT                   /translation="METAATTIDTTRCPLCGEENRCAMETARETGQPQPPCWCMAADFG
FT                   KAPFAALPPASRGKACMCARCAAGIAAAEPRQD"
FT   gene            complement(481742..483007)
FT                   /locus_tag="Vapar_0440"
FT   CDS_pept        complement(481742..483007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0440"
FT                   /product="phosphofructokinase"
FT                   /note="PFAM: phosphofructokinase; KEGG: mpt:Mpe_A2776
FT                   6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17103"
FT                   /db_xref="GOA:C5CJA3"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR011404"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJA3"
FT                   /inference="protein motif:PFAM:PF00365"
FT                   /protein_id="ACS17103.1"
FT                   /translation="MSNTTLTNAFYAQSGGVTSVINASACGVIETARKHPDRIGNVYAG
FT                   RNGIIGALTEELIDTGAEPAEAIAALRSTPSGAFGSCRYKLKSLEKNRREYERLIEVFK
FT                   AHGIGYFFYNGGGDSADTCFKVSQLSQSLGYPLQAIHVPKTIDNDLPLTDCCPGFGSVA
FT                   KYVAVSTLEASFDVRSMAATSTKVFVLEVMGRHAGWIAAAGGLVADHGIPVVVLFPEIE
FT                   FDKARFLARVDALVKQHGYCSVVVSEGCHYPDGTFLAEQGTRDAFGHAQLGGAAPVVAQ
FT                   MVKEALGHKFHWAVADYLQRAARHIASATDVKQAYELGQRAVELALEGRNAVMPTIERT
FT                   SDAPYTYRIGSAPLDAVANVEKPMPRDFISDDGWGITDKCRLYLLPLIEGEDYPAYRNG
FT                   LPVYATLRNVAVPRKLPAFELA"
FT   gene            483363..483866
FT                   /locus_tag="Vapar_0441"
FT   CDS_pept        483363..483866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0441"
FT                   /product="Fimbrial protein pilin"
FT                   /note="PFAM: Fimbrial protein pilin; KEGG: abb:ABBFA_000333
FT                   fimbrial protein precursor (pilin) (Strain P1)"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17104"
FT                   /db_xref="GOA:C5CJA4"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJA4"
FT                   /inference="protein motif:PFAM:PF00114"
FT                   /protein_id="ACS17104.1"
FT                   /translation="MKRSITRAAQKGFTLIELMIVVAIIGILAAIAIPQYQTYVAKSQF
FT                   TRAMGEAGSLKTAVDTCLLDGKTVVGTAAAECNPAASASTILVGAAQAGAPAVTTGVNG
FT                   YPQVSLGATAAAASTVIATLGNSAAQPLKTKTITWSRAGDSGTWTCSTNADQKYVPTGC
FT                   TVVP"
FT   gene            484113..484475
FT                   /locus_tag="Vapar_0442"
FT   CDS_pept        484113..484475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0442"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   SMART: Sel1 domain protein repeat-containing protein; KEGG:
FT                   rfr:Rfer_1266 Sel1-like"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17105"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJA5"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ACS17105.1"
FT                   /translation="MLSLGEVAPFICVPLDQVDLGFLVRADAGNADAQNDIGQLFSNAG
FT                   KPTVALYWLEQAAHQGHADAMQWLGRCYIGGEGVPKNRNIGLMWIAKAAAHGHIIAQAQ
FT                   MQDSFRIPPANGLKRI"
FT   gene            complement(484513..485670)
FT                   /locus_tag="Vapar_0443"
FT   CDS_pept        complement(484513..485670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0443"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: pol:Bpro_3014
FT                   acyl-CoA dehydrogenase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17106"
FT                   /db_xref="GOA:C5CJA6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJA6"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS17106.1"
FT                   /translation="MIERTLFSADHEAFRDSFRRFMDKEIAPFHEAWEERGYVDRSVWS
FT                   KAGENGFLCMALPEDYGGAGADLLYSVIQFEELWARGFTGIGFGLHSEIVAPYVLRYGT
FT                   EAQKQHYLPRLASGEMVGAIAMSEPGAGSDLQAVKTSAIRQADGSYLLNGSKTFITNGW
FT                   HADLVIVVAKTDPAAGAKGTSLFLVERGMPGFEKGKRLKKLGLKAQDTSELFFTDVRLP
FT                   ADALLGDAAQLNRGFVCLMEQLPWERLQIAISAVAASQAAIDQTVTYVKERKVFGQPVG
FT                   SYQNTRYTLAELQTEVQVAQVFVDKCIELLMAEKLDTATASMAKYWTTDLQCKVMDACV
FT                   QLHGGYGFMWEYPITRAYADARVQRIYGGTNEIMKEVITRAMGLR"
FT   gene            complement(485674..486480)
FT                   /locus_tag="Vapar_0444"
FT   CDS_pept        complement(485674..486480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0444"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   dac:Daci_4822 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17107"
FT                   /db_xref="GOA:C5CJA7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJA7"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACS17107.1"
FT                   /translation="MNAPQPYVLYALADGIATLTLNLPAKLNPIARELQVELRDTLERI
FT                   RDDRAVRAVILTGAGKAFCVGADLSAMAPGDEGKSLGAQTAEWMQSLSNPLIETLRTLP
FT                   VPVVAAVNGAAAGAGVGLALAADVTIAARSAYFYLSFLPKLGIVPDLGCTWAIPRRAGR
FT                   ARAMGMALLDERLGAEQAVQWGLIWACADDEQLLDEARAIAQRLARLPAHAVVEAREAF
FT                   EAAERHTLAEQLHYESERQRELIDRPTFREGVSAFLQKRPPRFPGR"
FT   gene            complement(486480..487658)
FT                   /locus_tag="Vapar_0445"
FT   CDS_pept        complement(486480..487658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0445"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: dac:Daci_4817 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17108"
FT                   /db_xref="GOA:C5CJA8"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJA8"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACS17108.1"
FT                   /translation="MAEAYIVAAARTAGGRRGGKLAGWHPADLAAQVIDALVARSGIDP
FT                   AAVEDVILGCVSQVGEQATNVARNAVLASRLPESVPGTSVDRQCGSSQQALHFAAQAVM
FT                   SGAMDAVIAGGVESMTRVPMFTPNALPAKAGLGTYMSPAMKRRYPGVEFSQFTGAEMIA
FT                   KNYGIDKDALDRYALESHRRAMAATRSGAFEGEIVPIEILQADGSGTGEQHMVDEGIRV
FT                   DATLEGIAGVKLIAEGGRCTAATASQICDGASGVLVVNERGLKALGVKPIARIHHMSVM
FT                   GHDPVIMLEAPLPATLRALKKAGMRIQDIDLYEVNEAFAPVPIAWLEALDADPARLNVN
FT                   GGAIALGHPLGASGTKLMTTLVHALGRRGKRYGLQTMCEGGGMANVTIVERL"
FT   gene            complement(487792..488109)
FT                   /locus_tag="Vapar_0446"
FT   CDS_pept        complement(487792..488109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4367 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17109"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17109.1"
FT                   /translation="MSTQPLSSSRFQVSLPTRSIFSVPDGAGVGIECRSGSVWVTLDRD
FT                   PRDIVLAPGERFEGSEHRRVLVSALEASCITVSDAQPAAMPLPARRRSPWRLLPLGLSP
FT                   A"
FT   gene            488192..489127
FT                   /locus_tag="Vapar_0447"
FT   CDS_pept        488192..489127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0447"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bbr:BB4633 LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17110"
FT                   /db_xref="GOA:C5CJB0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJB0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS17110.1"
FT                   /translation="MLPENAKALGTASGELPPLELLRSFEAAARRLSFTLAAGELHLTQ
FT                   SAVSRQIQQLEASLGVLLFERRHRALALTEAGGVMQRAVTDSLERLRDATARVRASSAP
FT                   RQVAITTTPGFASLWLIPKLARFTGSHPQVDVRVSATLDVLDLESSRLDLAVRFMPIGR
FT                   GIGPALFEESVIPLCSPQLAASLRTPADFSKLTLLTVEYPDHSEAPTADWEPWLKVMGL
FT                   DDLRMKSTLRFTQYADAVAAAVAGQGVVIGRLPLLRELVQDGRLVAPLGEGAASHRGYF
FT                   IEASRRAAGNRDAQEFAEWLRDEAEAAQRS"
FT   gene            489435..489653
FT                   /locus_tag="Vapar_0448"
FT   CDS_pept        489435..489653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_2555 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17111"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJB1"
FT                   /inference="similar to AA sequence:KEGG:Aave_2555"
FT                   /protein_id="ACS17111.1"
FT                   /translation="MSAQRKARDDDKRLGRFYFSVPNAAPRNPVVAAIARGESNQKAGR
FT                   HLRTHRAERRAQKVALQKAARSLGREG"
FT   gene            489656..490450
FT                   /locus_tag="Vapar_0449"
FT   CDS_pept        489656..490450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17112"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17112.1"
FT                   /translation="MREDMDKLIVERPRRGGGVQGDGRVFRNSRERGSHLGMKRGYDHP
FT                   KGLNENLQPLRRWLHKQVHRPWDKVWSELCQGIDRRSTVQAHIFLHIDDFVVRDAVMHG
FT                   GEVLVRSRWWAGSDRVPLREAPHVELFVHPGTGILLPNRYRRGSAQRRKAEREAKVAAA
FT                   AQGVVKPYAPCHVIDAVTQWHRIDGCWWEVTLARVPEVRRLEPAPRCYDVLRRCLVTSR
FT                   GCEPPAFGTTDTMAMYGRPNVYAECMRKLGRAEVRSRLGERG"
FT   gene            complement(490473..491783)
FT                   /locus_tag="Vapar_0450"
FT   CDS_pept        complement(490473..491783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0450"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ajs:Ajs_1147 major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17113"
FT                   /db_xref="GOA:C5CJB3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJB3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS17113.1"
FT                   /translation="MNPNAASKPAERPSSRLSRFSRWSTSTTAMLIALASAFALSQAFR
FT                   TVGAMMATPLSGHFGLSPQQIGTWAGTFHFMFGIMQLAMGVSIDTFGVRRTVLAAFPLA
FT                   VAGAVLCAVASSFHALLLGQALIGVGCAPAFLACTVFIARHFDASRFTAMSGLVMSLAG
FT                   LGILFTGTPLALLIEAASWRAGYAVLAASAVLSWILIFWRVRDPVRAEDRTSAETAPAE
FT                   RQSLRKAVRELLPLFAMPHTLGLLCFACVSYAAFITLRGLWLGPVLHDRHGLSLVSSGN
FT                   VALVMTIAGMISPAMFGRLDPGGRRRGRWLMGCAFAAAVIFAFMALTHSLAVDIGLPIL
FT                   YGLLSGYSVLQYSYTRAAYPAAMTGRALSLLNMAMFLGVSLMQWTTGVAASWAASNGVE
FT                   PFRAVFLTITAMLAVGTLAFLLLPRAHEKAGLASAQP"
FT   sig_peptide     complement(491658..491783)
FT                   /locus_tag="Vapar_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.661 at
FT                   residue 42"
FT   gene            492005..493132
FT                   /locus_tag="Vapar_0451"
FT   CDS_pept        492005..493132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0451"
FT                   /product="protein of unknown function DUF1016"
FT                   /note="PFAM: protein of unknown function DUF1016; KEGG:
FT                   hap:HAPS_1837 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17114"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJB4"
FT                   /inference="protein motif:PFAM:PF06250"
FT                   /protein_id="ACS17114.1"
FT                   /translation="MREILDTARAGVARTVNTTQVAANWLIGREIVEEEQRGQRRAGYG
FT                   ARLLADLSTRLNAEFGRGYSVDNLEAFRQFYLDYPQLISETASRKSTTPTALPLQVSSE
FT                   TSSRKSEGDTDWCPGALHPSLSWSHYRQLLRVARPEARAFYEIEAIRNAWSVRELQRQT
FT                   ASLLYDRLAKSKDKKGLMRLATHGQEVMQPLDVLKDPVVIEFLGLPESPRLVESKLEQA
FT                   LIDNLQTFLLELGKGFAFVSRQERITIDGDHFYIDLVFYHAVLKCYVLIDLKVGKLTHG
FT                   DLGQIQFYVNYYDRERRTEGDNPTLGVILCPDKNDAVVKYTLGEQQERNIFASRYQLHL
FT                   PTEQELERELRREIRQLSVATPLKMPPRKKAGPDA"
FT   gene            complement(493188..495362)
FT                   /locus_tag="Vapar_0452"
FT   CDS_pept        complement(493188..495362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0452"
FT                   /product="malate synthase G"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: pna:Pnap_3683 malate synthase G; TIGRFAM:
FT                   malate synthase G; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17115"
FT                   /db_xref="GOA:C5CJB5"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5CJB5"
FT                   /inference="protein motif:TFAM:TIGR01345"
FT                   /protein_id="ACS17115.1"
FT                   /translation="MTARTTTHGLQVATELHRFIEDKVLPASGVASDVFWKGFDAIVHD
FT                   LAPKNIALLAERDRLQAELDAWHKKNPGPIADMPAYRAFLEKIGYLLPQPKGAKATTAN
FT                   VDSELALQAGPQLVVPILNARYALNAANARWGSLYDALYGTDAIPETGGAEKGKGYNPV
FT                   RGAKVIEFARNVLDQAAPLENGSHKMATGYSVKDGKLVVALQSSSTGLADPAQFVGYQG
FT                   DAAAPSSVLLKHNGIHLDIRIDRSTPIGKGDAAGVSDLVLEAALSTILDLEDSVAVVDA
FT                   ADKVVAYSNWLGIVEGTLTEEVAKGGKTFTRGLNPDREYTGADGRPVKLHGRSLMFLRN
FT                   VGHLMTNPAVLYAGGKEIPEGILDAVVTTTIAMIDLKRKGNSRTGSIYIVKPKMHGPAE
FT                   VAFASELFGRVEQLLGLPANTVKLGIMDEERRTSVNLKACIAEAAARVAFINTGFLDRT
FT                   GDEMHTAMHGGPMIRKGDMKSSAWIGAYEKNNVLVGLSCGLRGKAQIGKGMWAMPDLMA
FT                   AMLEQKIAHPKAGANTAWVPSPTAATLHALHYHQVSVTAVQQELEKIDADAERDNILNA
FT                   LLQVPIAPAANWTEAEKQQEIDNNVQGILGYVVRWIDQGVGCSKVPDIHNVGLMEDRAT
FT                   LRISSQHIANWLLHGVVTKAQVDETFQRMAKVVDEQNAGDPVYQPMAGHFDTSAAYKAA
FT                   QDLVFKGIEQPSGYTEPLLHAWRLKVKGEV"
FT   gene            complement(495419..496096)
FT                   /locus_tag="Vapar_0453"
FT   CDS_pept        complement(495419..496096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0453"
FT                   /product="haloacid dehalogenase, type II"
FT                   /EC_number="3.8.1.2"
FT                   /note="KEGG: pol:Bpro_4516 haloacid dehalogenase, type II;
FT                   TIGRFAM: haloacid dehalogenase, type II; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 2 (HAD-like); PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17116"
FT                   /db_xref="GOA:C5CJB6"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJB6"
FT                   /inference="protein motif:TFAM:TIGR01428"
FT                   /protein_id="ACS17116.1"
FT                   /translation="MDQPGAVLFDAYGTLFDVYSVGQTAERLFAGQGQALAAGWRDKQI
FT                   EYTRLVTTSNHGAHYRPFGELTRAALRYTCKRLGLGLTEAAEQQLMDQYRTLTAFPECR
FT                   EVLQALKARGVATGILSNGDPGMLDAAVRSAGLDGLLDHVLSVDGIRKYKTHPDAYQLG
FT                   VAAAGLPPARIAFVSCNGWDALGATWFGFRTLWVNRYQLPFEELGTQPERIGSSLRDVL
FT                   GFF"
FT   gene            complement(496208..496948)
FT                   /locus_tag="Vapar_0454"
FT   CDS_pept        complement(496208..496948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0454"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   pol:Bpro_4515 transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17117"
FT                   /db_xref="GOA:C5CJB7"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJB7"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACS17117.1"
FT                   /translation="MPRKAQTESVSDLNAAPGGAAAVDRALSLLSAFQPGDEALSLAQF
FT                   AERTQLYKSTVLRLLASLEHARLIRRQDDGRYALGAEIARLHGLYAASLSLDRIVLPVL
FT                   RALAATTGESAAYHVRQEQGDSWVRLCQFRVDSSHVVRDHVRAGDLLPNDRGAGARVLI
FT                   AFGPEAERPRGTRERKLYDEIRAQGYCALVGDRTAELAGISAPVFHADGSLAAAVTLTM
FT                   PAHRYDARHIEPVRAAARELSGTL"
FT   gene            497074..498015
FT                   /locus_tag="Vapar_0455"
FT   CDS_pept        497074..498015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0455"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   pol:Bpro_4514 hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17118"
FT                   /db_xref="GOA:C5CJB8"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJB8"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ACS17118.1"
FT                   /translation="MTPPDVLISEVGPRDGLQSVKATMPTADKLRWIDALHAAGVREIE
FT                   VASFVPARLLPQMADAAEVVRHAITLPGLTVMALVPNRKGAQAALEAGVHKLTMPVSAS
FT                   VAHSLANVRKTPTEMVEEVRAISELRRAMAPHVRLEAGISTAFGCTLQGLVPEDDVIRL
FT                   AAQCIEAGAEEAGLSDTVGYANPAQVRRLFRRLRAELGTHAGAAHMHNTRGLGIANCLA
FT                   AWDEGVRTFDASLGGLGGCPYAPGASGNAVTEDLVFMFEAMGVRTGIDIQKLIAARAPL
FT                   MAGLPGEPVYGMTPEAGLPKGFAVQQETTPHA"
FT   gene            498008..499198
FT                   /locus_tag="Vapar_0456"
FT   CDS_pept        498008..499198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0456"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: pol:Bpro_4514 hydroxymethylglutaryl-CoA
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17119"
FT                   /db_xref="GOA:C5CJB9"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJB9"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACS17119.1"
FT                   /translation="MPESQPLPYAGVRVVEFTHMVMGPTCGLLLADLGAEVIKVEPIEG
FT                   DSTRRLLGSGSGFFPTFNRNKKSIALDLKTREGVEAALRLVATADIVSENFKPGTMKKL
FT                   GLDYDSLKQLNPRLIYVSHKGFLPGPYDHRTALDEVVQMMGGLAYMTGRAGDPLRAGTS
FT                   VNDIMGGMFGAIGAMAALRQRELTGKGCEVQSALFENNVFLVAQHMMQFAATGKAADPM
FT                   PSRISAWAVYDVFTVKDGEQIFLAAVSDKQWAIFCRAFGLEEMLADPRLKTNNDRVLAR
FT                   DWMMPILRSHLAGYSAAELSAVFEQNELPFAPITKPQQLFDDPHLNATGGLAPVRMNDG
FT                   HMAKVPLMPFTLDGERPGIRLQPPRVGEHTGELLREVGYSEEEIAAFESRQAGIAR"
FT   gene            499245..500189
FT                   /locus_tag="Vapar_0457"
FT   CDS_pept        499245..500189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0457"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dia:Dtpsy_0328 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17120"
FT                   /db_xref="GOA:C5CJC0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJC0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS17120.1"
FT                   /translation="MDRLKQLESFVSVATRGGLTAAAKAEGVAPAIMGRRLDALEARLG
FT                   VKLLVRTTRRITLTHEGSAFLEDCQRLLTEFANAEASVSAGGVKASGHLRVTAPAGFGR
FT                   RHVAPLVPRFHALHPEVTISLNLSDRVVDVRGESFDCAVRVGDMPDSSLVSVRLADNRR
FT                   RCVATPEFVRRHGMPRHPNELSRFACLTLSSDASQTRGWAFRIPRAPAAAGEEAGEELI
FT                   YLRPEGPLDCSDGQVLHDWCLAGHGIAWRSTWEVEAEIDAGLLVPLLDEFAAPPNGIYA
FT                   VFAGTKHLPLRVRLWLDFLKEQYGRPEFWGGRA"
FT   gene            500251..500703
FT                   /locus_tag="Vapar_0458"
FT   CDS_pept        500251..500703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0458"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: aav:Aave_0412 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17121"
FT                   /db_xref="GOA:C5CJC1"
FT                   /db_xref="InterPro:IPR018706"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJC1"
FT                   /inference="similar to AA sequence:KEGG:Aave_0412"
FT                   /protein_id="ACS17121.1"
FT                   /translation="MTLEAILAYLHLLAILTMVVFISSEAALCRVQWLNAAVVERLAKV
FT                   DMVYGMAAIAVLATGIARTVWGVKGTAWYWTNPLLHVKLGLFIIVGVLSIFPTLTYFRW
FT                   RKALRANGTLPAEADIRKTRRLVMVQAHLIALIPLVAVFLARGFGK"
FT   gene            500710..502755
FT                   /locus_tag="Vapar_0459"
FT   CDS_pept        500710..502755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0459"
FT                   /product="integral membrane protein-like protein"
FT                   /note="KEGG: sus:Acid_0041 integral membrane protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17122"
FT                   /db_xref="GOA:C5CJC2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJC2"
FT                   /inference="similar to AA sequence:KEGG:Acid_0041"
FT                   /protein_id="ACS17122.1"
FT                   /translation="MERAGIQLLFAGTIFSSAFLLFLVQPLIAKQILPWFGGSAAVWST
FT                   CMVFFQAVLLAGYAYSDWVTRRLRVRAQAALHVGLLLASLAFLPLVVAARWKPTGAEDP
FT                   AWLILGLLLATIGLPYFLLSTTGPLVQSWVARTPWSARVYRYFSLSNLASLLSLLSYPV
FT                   LIEPRSSLLQQALGWSWGYGLFALLCAGTTLLVAYRWPAAVPVGAAPGQAAAAADSEKP
FT                   PRWSDGLLWLVLPALASWLLLAVTNHITQNVAAVPFLWIVPLSLYLFTFVLCFESDRWY
FT                   RRGAFLPLAAGVLLLCAFGLQHHIGSDVRTGLPIYVGGLFVLCMFLHGETAGLRPAPRY
FT                   LTRFYLMLALGGALGGATVGLVAPHVLPAYYELGIGLVLTALAAAAVLRRRNWLRAMSV
FT                   ALAAGCAYFLMAQIASDRSDARHLLRNFHGALITFDMRRLHPSDSVRVLSHGSIKHGEQ
FT                   FLDPARRREPTTYYGATSGIGRAMAAAPAGPRRVGLIGLGAGTLASYGRSGDAYRIYEI
FT                   NPQVFELADSEFSFLRDSPARIERVLGDARLALEREPPQGFDLLAVDAFSGDAVPAHLL
FT                   TAQAMDVYLRHMKPDGIVAFHVTNRFLELAPVVARIAELKGLHAVLVSDDAEASRWLSP
FT                   TDWVLVARDPAVLAREPVRAAASPIVLRAGVRPWTDDFNNLLSVLK"
FT   gene            complement(502816..503211)
FT                   /locus_tag="Vapar_0460"
FT   CDS_pept        complement(502816..503211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0460"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lch:Lcho_4232 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17123"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17123.1"
FT                   /translation="MKKFLSLVALGACLSFGAAQAQDKAPAAKAPAPVTAPAATPATPA
FT                   APAAATPAAPATAAAPAASCESKAIDKNGKPLAGAAKGSFIKKCEKDTKAAAAPACAAK
FT                   AVDKNGKPLAGAAKNSFMKKCEKDAKA"
FT   sig_peptide     complement(503146..503211)
FT                   /locus_tag="Vapar_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            503343..505028
FT                   /locus_tag="Vapar_0461"
FT   CDS_pept        503343..505028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0461"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: rfr:Rfer_0773 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17124"
FT                   /db_xref="GOA:C5CJC4"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJC4"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ACS17124.1"
FT                   /translation="MLLVKQELLAALANTLESLSPGAGSKAAFESPKVAAHGDFASTAA
FT                   MQLAKPLGRKPRELAEELSAALLATPVFGQWVEAIEVAGPGFLNIRLKTAAKQQIVREV
FT                   LAAGSAFGQQPATGEKVLVEFVSANPTGPLHVGHGRQAALGDAICNLRASQGDTVWREF
FT                   YYNDAGVQIQTLAHSTQLRARGFKPGDPEWPSGEKAPAYNGDYIADIAEDFKAKKTVKS
FT                   DDREYTASGNIDDLDSIREFAVAYLRREQDLDLQAFRVRFDNYYLESSLYTSGRVEEAV
FT                   RKLVAAGKTYEQDGALWLKSTDYGDDKDRVMKKQDGTYTYFVPDVAYHIAKWERGFHKV
FT                   VNIQGTDHHGTIARVRAGLQAAGVGIPEGYPDYVLHTMVRVMKGGEEVKISKRAGSYVT
FT                   LRDLIEWTSTDAVRFFLLSRKPDTEYTFDVDLAVAKNNDNPVYYVQYAHARICSVLAGW
FT                   GGDATALKDVDLSPLESPAAQALMLLLAKYPAMLTAAAKDFAPHDVTFYLRELAASYHS
FT                   YYDAERILVDDEPVKLARLALVAATAQVLHNGLAILGVSAPSKM"
FT   gene            505036..505773
FT                   /locus_tag="Vapar_0462"
FT   CDS_pept        505036..505773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0462"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   pol:Bpro_4489 sporulation related"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17125"
FT                   /db_xref="GOA:C5CJC5"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJC5"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ACS17125.1"
FT                   /translation="MKKTTRQRGNIVIGLIVGLVLGLGVALGIAVYVTKVPIPFVTKTQ
FT                   RGGAEQDEAEARKNRDWDPNAPLAGKAGAPKPPAAAGPVAPPASGDTAAVAPGTAPPPA
FT                   PPVPVVVAPKPARPAPVPAEANSLPPSNDPLGDLARARAGGSSGSTTTASAAPSSNSAA
FT                   AGADPFMYFVQAGAFRTTDDAEAQRAKLSLMGVEARVTEREQAGRTVYRVRAGPFNKKD
FT                   EADRLKERLDSGGLESALVRVQR"
FT   sig_peptide     505036..505122
FT                   /locus_tag="Vapar_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.592 at
FT                   residue 29"
FT   gene            505919..506566
FT                   /locus_tag="Vapar_0463"
FT   CDS_pept        505919..506566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0463"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: xcv:XCV2315
FT                   putative thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17126"
FT                   /db_xref="GOA:C5CJC6"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJC6"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ACS17126.1"
FT                   /translation="MKRRDFSLAATSLGLLSLAGNTAHAQARAPKAGTEYLVLDKRVPV
FT                   DAPAGKVEVIEFFSYNCPHCNDFEPQLEAWLKTVPKEVAFRRVPVPFVGNDVEAKQRLY
FT                   YALEAMGKVDEFQPKVFDAIHKQRQNVNGDANIIAWAGANGLDGAKFKEVFTSFGVASK
FT                   AKRAAQLTDAYKVAGVPALAVNGRWYVDGELAGNMTKALQVTNYLIGEAKKG"
FT   sig_peptide     505919..505996
FT                   /locus_tag="Vapar_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 26"
FT   gene            506760..507479
FT                   /locus_tag="Vapar_0464"
FT   CDS_pept        506760..507479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0464"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="TIGRFAM: lipopolysaccharide transport periplasmic
FT                   protein LptA; PFAM: OstA family protein; KEGG:
FT                   rfr:Rfer_0776 OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17127"
FT                   /db_xref="GOA:C5CJC7"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJC7"
FT                   /inference="protein motif:TFAM:TIGR03002"
FT                   /protein_id="ACS17127.1"
FT                   /translation="MTLPSYPHTTPFVRRIRRLAAGALLLAGLASGALAETADRSKPMN
FT                   IESDAMRYDDLKQTSVFTGNVLVTKGTIIIRGARIDVRQDAEGYQYGVVTAAPGKRAYY
FT                   KQKRNAPDEWIEGESEVIEYDSRADNVKFIRNAVMRRLIGATPNDESTGALIVYDQSND
FT                   TYTVNGSTVPPNTGVNAPPVGRVRTILTPKSATAPAPGASAPAAGRAAPAAAAPQPAPG
FT                   AGLRSSTTLGGDGERRK"
FT   sig_peptide     506760..506867
FT                   /locus_tag="Vapar_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 36"
FT   gene            507476..508270
FT                   /locus_tag="Vapar_0465"
FT   CDS_pept        507476..508270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0465"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pol:Bpro_4486 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17128"
FT                   /db_xref="GOA:C5CJC8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJC8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS17128.1"
FT                   /translation="MIEAAGTQNADGTPGSRLVVRGLQKSYGSRKVVRDVSLDVQKGEV
FT                   VGLLGPNGAGKTTSFYMIVGLVRADAGEITIDGEPIAHMPIHRRARMGLSYLPQEASIF
FT                   RKLTVEENVRAVLELQREPDAGGKPAPLTKQRIEERLSGLLADLRVDHLRDSPALALSG
FT                   GERRRVEIARALATQPRFILLDEPFAGIDPIAVIEIQRIISFLKERGIGVLITDHNVRE
FT                   TLGICDHAFIISDGHVLAQGTPSEIVDNAEVRRVYLGEHFRM"
FT   gene            508288..509880
FT                   /locus_tag="Vapar_0466"
FT   CDS_pept        508288..509880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0466"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 DNA-binding domain protein; sigma-54 factor
FT                   core-binding region; sigma-54 factor; KEGG: dia:Dtpsy_0337
FT                   RNA polymerase, sigma 54 subunit, RpoN"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17129"
FT                   /db_xref="GOA:C5CJC9"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJC9"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ACS17129.1"
FT                   /translation="MKQGLSLRVSQHLALTPQLQQSIRLLQLSTLELSQEVEQMLDENP
FT                   FLERTAEEAAREEFGLDAIDTPVPRDEAGEAAEGEFSSAPASSTTSTSSETASTAESEV
FT                   PAADATEREPDWEGDGTVDMAPDDSEWGSDAPARQNNLGDDERADATELARSQESLQSF
FT                   LHRQALSLRLNENDSAALRFLIESLNDDGYLEDSLPALASGLAGDDNDQFDELVHHFQV
FT                   ALGLLQSLEPAGVGARDLGECLCIQLRALASESETEEQALVRKTAIAICKQPMELLARR
FT                   DFKRLATLTRTNEELVRSALQVISRLEPKPGRRFVDVERNIVIPDVIVTKIGRGTNAKF
FT                   RVMLNPEVMPRLRVHDIYAGALKSHKGEGSQALSQRLQEARWFIKNIQQRFDTILRVSN
FT                   AIVERQKSFFVHGELAMRPLVLREIADELGLHESTISRVTTAKYMSTPFGTVELKYFFG
FT                   SALGTETGGNASSTAVRALIKQFVSSESIKKPLSDSQISEMLKEQGIECARRTVAKYRE
FT                   ALRIAPANLRKAL"
FT   gene            509891..511495
FT                   /locus_tag="Vapar_0467"
FT   CDS_pept        509891..511495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0467"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; SMART:
FT                   phospholipase D/Transphosphatidylase; KEGG: rpi:Rpic_4172
FT                   phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17130"
FT                   /db_xref="GOA:C5CJD0"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJD0"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ACS17130.1"
FT                   /translation="MARRLLSRCGQWVFAMAAVLLFAGCATLPDEAPRPATRAMAASAD
FT                   TALGKIAQASQPDPDLSGFRLMPGGDFAFDTRIQLARRAQRTLDVQYYQIENDETGRYL
FT                   LRTLRDAARRGVRVRLLMDDLYTSGEDELLLGLAATPNVELRLFNPFPAGRGSLLRRFT
FT                   ASLFDFSRVNRRMHNKLFIADGAMAVAGGRNIGNQYFRRTAGENFLDLDTFVAGALIPR
FT                   LGALFDQYWNSVYVRPVQSVVASALTRDELQKRFDTATGPDTTPPPPRPAPNDLLGYSP
FT                   IAEDLDAGKLDLIWTLAEAYADSPERVIGKTASYGGVPLLDVDSVRYNVVEQMRRARSE
FT                   VTIVSPYLIPGKAGLEVMREIRRRNVKISIVTNSFAATDEPLVHTAYRRYRPEMLELGA
FT                   ELYELSTTRTRRSVRLGLFGTSVGRLHAKSAVIDRQVLFVGSMNFDPRSETHNTEIGLF
FT                   IRSPEMAQQTLKLIEVLKQQGAYRLRFAKDSGNARIEWISEEEAGRTTVLNEEPDSDFW
FT                   GRTMLEMLAPLTPESLL"
FT   gene            complement(511506..512153)
FT                   /locus_tag="Vapar_0468"
FT   CDS_pept        complement(511506..512153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0468"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   eba:ebA6561 putative amino acid efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17131"
FT                   /db_xref="GOA:C5CJD1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJD1"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACS17131.1"
FT                   /translation="MSGITVPLLGIAGAMIVGAMSPGPSFVMVARTAVSSSRRDGLAAA
FT                   LGMGAGGVVFAIAALVGLQAAFLAVPALYLAVKLLGGAYLVYLGIRIWRGAREPLSAAQ
FT                   DERAAAGTGSNARRAFLLGMGTQVSNPKTAVVYASIFAAFLPREVPLALALAVPAVIFC
FT                   IETGWYAVVALALSSAAPRSAYLRYKAWIDRAAGGVMVLLGLKLLSGVRSSS"
FT   sig_peptide     complement(512070..512153)
FT                   /locus_tag="Vapar_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.463 at
FT                   residue 28"
FT   gene            complement(512172..512807)
FT                   /locus_tag="Vapar_0469"
FT   CDS_pept        complement(512172..512807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0469"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: lch:Lcho_0457 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17132"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJD2"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACS17132.1"
FT                   /translation="MKKLLLAAALSAAAALATPALAQEYTAPPVAAKPAGGPVKNASYV
FT                   IDPTHTFVMYEMGHYGTTTNRGRFSTKDGSVQIDGSGSSGKVDITMDISSINTGVDLLN
FT                   RHVQSKDFFNVAEFPTGRFVADRIEFNGDKVADVPGTLTLMGQTRPVTLRAVRFNCYLN
FT                   PLINRQVCGGDFETTVQRSDWGITWGLNFGFENKVKLLVQVEAVNVQQ"
FT   sig_peptide     complement(512739..512807)
FT                   /locus_tag="Vapar_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(512848..513429)
FT                   /locus_tag="Vapar_0470"
FT   CDS_pept        complement(512848..513429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0470"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein; KEGG: lch:Lcho_0458 YceI
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17133"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJD3"
FT                   /inference="protein motif:PFAM:PF04264"
FT                   /protein_id="ACS17133.1"
FT                   /translation="MKRTSRLCLAAALAFAPLAPALAEPATATRLVADKSQIAFVSKQM
FT                   GVPVEGTFKKFDAQVAFDPRKPEGGTVALQIDTGSASLGVPMSDAELPKPPWFDTAHFP
FT                   QASFQSSAIKALGDGRFEMAGKLTIKNISRPITVPVSIAPAGAHAVASGSFTIQRLDYK
FT                   VGDGEWTDTSVVGNEVLVRFKFTLAGFGPL"
FT   sig_peptide     complement(513358..513429)
FT                   /locus_tag="Vapar_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            complement(513426..514055)
FT                   /locus_tag="Vapar_0471"
FT   CDS_pept        complement(513426..514055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0471"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: lch:Lcho_0459
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17134"
FT                   /db_xref="GOA:C5CJD4"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJD4"
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /protein_id="ACS17134.1"
FT                   /translation="MSIDAPSHPAAMADAPADPRGLRELRYGPVAMALHWLLAAMIVGS
FT                   LGVGLYMTGLPLSPARIKLYNWHKWAGVTILLLSAVRLLWRLRHPPPPLPAEAAAAMPR
FT                   WQRSGYRASHALMYLLFLAVPLFGWAYSSALGFPVVWFGVLPLPDFVAVDKEWAEAVLK
FT                   PLHKGSAFTLAAVALLHVAAVLKHHWIDRDGILKRMWPAPRKESAG"
FT   gene            complement(514146..515942)
FT                   /locus_tag="Vapar_0472"
FT   CDS_pept        complement(514146..515942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0472"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; KEGG: azo:azo3438 putative virulence regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17135"
FT                   /db_xref="GOA:C5CJD5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJD5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS17135.1"
FT                   /translation="MNSTTAPMVAPAVADDDGRFAIQCEVLRLSIRPIGPVLLAQYLLN
FT                   CGVAALFAWQYSLSRALVWISLITAVTLMRGFFPQRLPTPFTPQSLRDAQRTHTARTGI
FT                   WELAHGLAGVLLFNPAQPEQQLLLGLMLMGMTLSSAFSVSFYVPATQLAITLLLAPVIV
FT                   TGLWLGAPAMKAVALIGIGLTAMMWKLVAEHSRQLEENIGLRLNERSLREQALAGLRAS
FT                   EQAQAERLRFFSAANHDLRQPVMAIGLQAEVLRQQLDNGADAPVVQHTVASLARAQQAL
FT                   EGLTNQLLEIGRIEAAADPLQPVAVPLAPLLADLARQAGNGRVTVRCPADAVGWADAVS
FT                   LRRVLANLVDNAVKFTPRGRVLLAVRARQRDTGRAWRVEVRDSGIGIAADSQERVFGDF
FT                   EQIGNVERNLQRGHGLGLAIVRRLAAQLGIQVSLRSAPGRGSVFGFELPAAPADAPVAA
FT                   PAPAAQPRSGAAHALRPGLAVLVVEDNAVVADSLGALLQQWQLAPRVYASAAEALALAD
FT                   LRALDVALCDIRLPGALDGIALAERLQRQKPSLAIALVSADIGEATQRLAAERGWHALR
FT                   KPVQPAELHAVLVQAQQAASGR"
FT   gene            516023..517264
FT                   /locus_tag="Vapar_0473"
FT   CDS_pept        516023..517264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0473"
FT                   /product="putative RNA methylase"
FT                   /note="PFAM: putative RNA methylase; THUMP domain protein;
FT                   KEGG: aav:Aave_0422 putative RNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17136"
FT                   /db_xref="GOA:C5CJD6"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJD6"
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /protein_id="ACS17136.1"
FT                   /translation="MNDLSLFLPCAAGVEEFLAQEVHALTGRVGQDLLTLRGGVRVRAE
FT                   WRDALKLNLHSRLAQRVLVELAHAPYRSENDLYAIASGVAWEIWFTPKQTFKIETTAQH
FT                   SPLQSLNFATLRIKDAIADRFRAKAGGVRPSIETQWPDCRVFAHLTTEHCTLYIDTSGE
FT                   PLFKRGWRQDKGDAPLKETLAAAMLAASGWWNPETGAVAAEPLYDPCCGSGTIAIEAAQ
FT                   IARGIAAGSLRRFGFEKLLPFQAHVWDAIRKEAQSSAVPRDVAIFGSDVSHRMVDFAER
FT                   NAERAGVADAIEFRGGDALQRMPPAEGGVIMLNPPYGERIEVGGVARFGAREAAQTPGE
FT                   GGGEGSDGGGDFFPQLATHWKKNYAGWTAWVLTPDLKLPRQMRLKESRRVPMWNGPIEC
FT                   RLFRFDMVAGSARK"
FT   gene            517305..517736
FT                   /locus_tag="Vapar_0474"
FT   CDS_pept        517305..517736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0474"
FT                   /product="protein of unknown function DUF132"
FT                   /note="KEGG: pol:Bpro_4483 protein of unknown function
FT                   DUF132"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17137"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJD7"
FT                   /inference="similar to AA sequence:KEGG:Bpro_4483"
FT                   /protein_id="ACS17137.1"
FT                   /translation="MLVPESGLVVIDTNIALDLLVFEDPAWVPLIAMLAAGELRWLATA
FT                   AMRVELERVLGYPLIARRMAQRGLQVPAVLADFDARVRMVEGVPSRAPCVCSDPDDQVF
FT                   IDLAVAHRALLLSKDRAVLSMKKRLALRGVVVQAALGIS"
FT   gene            517966..518208
FT                   /locus_tag="Vapar_0475"
FT   CDS_pept        517966..518208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17138"
FT                   /db_xref="GOA:C5CJD8"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJD8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17138.1"
FT                   /translation="MRSIARILFIVSGAIALGLVFYKLIGPVGHGYELNFARNDGDLGQ
FT                   AHMVALAVQFLALIAGGWLGDWAFRKWRQRQPDRP"
FT   gene            518241..518495
FT                   /locus_tag="Vapar_0476"
FT   CDS_pept        518241..518495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17139"
FT                   /db_xref="GOA:C5CJD9"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJD9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17139.1"
FT                   /translation="MKILIRLLCILAGAFALSFLVAKVVLAPIGQWYEMNKAQSFDDVS
FT                   EAFVVALAVQALCAIAGGWLGDLAFRRWRQKQLSRQQRP"
FT   sig_peptide     518241..518309
FT                   /locus_tag="Vapar_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.771 at
FT                   residue 23"
FT   gene            complement(518505..519422)
FT                   /locus_tag="Vapar_0477"
FT   CDS_pept        complement(518505..519422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_0425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17140"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJE0"
FT                   /inference="similar to AA sequence:KEGG:Aave_0425"
FT                   /protein_id="ACS17140.1"
FT                   /translation="MNPLRRGASARLHSAKGAASAPAPLDAQPFVPAPGDYAEFLRLML
FT                   PKQQKNVASHRLGSERVWLKKAGPRHGKWGYRVMAAVARMARLDIIKPVPNPGGEAAIA
FT                   TEARRLRQLAAAGLRVPAVLAQQPDGLLISDLGQSGRATVVLQERLDQAAAAGPAALLA
FT                   VWRVGLAAIAKVHVRGQHLSQAFDRNLVQCPDGVIGYIDFEDDPSEVMTLAECQARDWL
FT                   SYLHSTAMMLEAAAPEAAGQHWHAALAEVDTQVRERIAEAARRMKWAQKLPASRRWGRD
FT                   TQRVRAVARLLGRWHLGPAAALQN"
FT   gene            complement(519419..521137)
FT                   /locus_tag="Vapar_0478"
FT   CDS_pept        complement(519419..521137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0478"
FT                   /product="ferredoxin-dependent glutamate synthase"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase; KEGG:
FT                   dac:Daci_3073 ferredoxin-dependent glutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17141"
FT                   /db_xref="GOA:C5CJE1"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="InterPro:IPR027283"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJE1"
FT                   /inference="protein motif:PFAM:PF01645"
FT                   /protein_id="ACS17141.1"
FT                   /translation="MPTIIPFPTRYSAFALCVVGLAACIALVLVSPHLWLAWVGVAIFA
FT                   VLSGTGVHDLRQARHAILRNYPVIGHLRFLLEFIRPEMRQYFIESDSEAAPFSRAQRSL
FT                   VYQRAKGEPDNRPFGTQLDVTIAGYEWINHSMQPTKLDNHDFRIVIGGTPHTADASPPP
FT                   LGAASHHPCTQPYSASVFNISAMSFGALSANAILALNQGARLGGFAHDTGEGSISQHHR
FT                   VHGGDLIWEIGSGYFGCRNEDGSFNAERFSANARDPQVKMIEIKLSQGAKPGHGGVLPA
FT                   PKVTPEIAAARGVPIGIDCVSPSSHSAFSTPIEMMHFIAKLRELSGGKPTGFKFCLGHP
FT                   WEWFAIVKAMQATGITPDFIVVDGAEGGTGAAPVEFSDHVGAPLQEGLLLVHNTLVGVN
FT                   LRHRIKLGCAGKVITAFDVARMMALGADWCNAARGFMMALGCIQAQSCHTGHCPTGVTT
FT                   QDPVRQQALVVPTKAERVRNFHRSTLHALQELVQAAGLDHPQQITAHHIVRRISDTEVR
FT                   LLSNLVMQVQPGALLGPLDKQHNVFRTYWPLASAESFQPLTQGPHGLVSNLPLAA"
FT   sig_peptide     complement(521027..521137)
FT                   /locus_tag="Vapar_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.572 at
FT                   residue 37"
FT   gene            521195..521977
FT                   /locus_tag="Vapar_0479"
FT   CDS_pept        521195..521977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0479"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   aav:Aave_0426 SecC motif-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17142"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJE2"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ACS17142.1"
FT                   /translation="MTNNHDAPQPEAAASAPLGPDDFDALDQALDAMREQDEEIPQWEF
FT                   CEGFMAALICTRRRIEPAEYWPVLLGEGFVPAQHMEFVWNWKRRWLEIEEGLDADVQSL
FT                   DDERSWQPEVLDTRGAIASLPEEERAEVAGEEIPSFAQVWALGFMYAVENWPEDWAAPR
FT                   DKEAAQMLDDALDNIVALTEDDKAKPTLSMFSDDGPPSVSQQRLDDFGAAIWAVYDLRQ
FT                   LWKSLGPKVETVRKEATPGRNDPCPCGSGKKYKKCHGA"
FT   gene            522024..523211
FT                   /locus_tag="Vapar_0480"
FT   CDS_pept        522024..523211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0480"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ajs:Ajs_1147 major facilitator superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17143"
FT                   /db_xref="GOA:C5CJE3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJE3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS17143.1"
FT                   /translation="MVLALCAGVALSQAFRTVGAIMASPLQADFRLSAQALGIFSGAFH
FT                   FAFGAMQLFMGIGIDLHGVRRTVLVAFPVAIAGALLSALAPSYAVLVAGQALIGVGCAP
FT                   AFLVCTVFIARHFPAARFATVSGLVLAIGGLGMLATGTPLAWLVQAYSWRAGFLVLAVA
FT                   SALAWLAIWHWVREPAAAVPRVNESIPEAIRQFGALLAMPHTLGIVMLGAVTYAAFISL
FT                   RGLWLGPLMMERHGYSLVQSGNVAIAVSVISLFGAPLFGRFDRDGAARRRRIVVCALGY
FT                   AALFALIAFTHSAWLDIGGMVLIGVLSGFIVWQYADVRVAYPATLTGRAMAVFTMAMFL
FT                   GVALMQWATGVAASVAAAHGGDPLRAVLATIAALLVLGIAAFAWLPAPKADALRS"
FT   gene            complement(523201..523515)
FT                   /locus_tag="Vapar_0481"
FT   CDS_pept        complement(523201..523515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0481"
FT                   /product="acetyltransferase"
FT                   /note="KEGG: psa:PST_4142 predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17144"
FT                   /db_xref="GOA:C5CJE4"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJE4"
FT                   /inference="similar to AA sequence:KEGG:PST_4142"
FT                   /protein_id="ACS17144.1"
FT                   /translation="MSNSNLAITNNEAQHRYEAALEGQLAAYAEYNLLTDAIMFTHTEV
FT                   LPEHEGKGVGSGIARHVLDEARAKGLHVIPVCQFIAGYIRKHREYADLVRPDIQRAFKI
FT                   "
FT   gene            complement(523512..524009)
FT                   /locus_tag="Vapar_0482"
FT   CDS_pept        complement(523512..524009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0482"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_4477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17145"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJE5"
FT                   /inference="similar to AA sequence:KEGG:Bpro_4477"
FT                   /protein_id="ACS17145.1"
FT                   /translation="MTTATANAQTIERFYEAFSRLDARAMAACYASDAAFDDEAFSLRG
FT                   RQQVGGMWRMLCDATRAKGADVWRLTWRDVQADGTSGQAHWDAHYRFSATGRLVDNSVD
FT                   ARFGFTPEGLIATHRDSFAFWTWSRQALGAPGLLLGWTPMLRNKVRATAAANLATYLAR
FT                   QP"
FT   gene            complement(524011..524565)
FT                   /locus_tag="Vapar_0483"
FT   CDS_pept        complement(524011..524565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0483"
FT                   /product="CinA domain protein"
FT                   /note="PFAM: CinA domain protein; KEGG: ajs:Ajs_0354 CinA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17146"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJE6"
FT                   /inference="protein motif:PFAM:PF02464"
FT                   /protein_id="ACS17146.1"
FT                   /translation="MVNTMEASTPANFLADQDTPALVAALAELLLKKGWMLATAESCTG
FT                   GLIAGACTELAGSSAWFERGFVSYSNAAKTELLGVDAALIEAHGAVSEPVARAMAEGAI
FT                   AHSAARAAVAVTGVAGPTGGSPDKPVGTVWFGWSAGGQVRTERRRFDGDRAAVRAATVH
FT                   YALQTLVGLLGPQPGTTTKAP"
FT   gene            complement(524559..525086)
FT                   /locus_tag="Vapar_0484"
FT   CDS_pept        complement(524559..525086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0484"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /note="PFAM: phosphatidylglycerophosphatase A; KEGG:
FT                   pol:Bpro_4475 phosphatidylglycerophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17147"
FT                   /db_xref="GOA:C5CJE7"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJE7"
FT                   /inference="protein motif:PFAM:PF04608"
FT                   /protein_id="ACS17147.1"
FT                   /translation="MPPATPRRPSIAFLLSHPAHFIAMGFGSGLPRVAPGTVGTLWAWA
FT                   AFAVMQLWLTPAAIGWIILASLPIGWWACSITARDMGVADPGSIVWDEVIAFWIVLWLV
FT                   TPAGLFAQAIAFGLFRFFDAAKPGPVAWADALFKQRDAVQVRWWRAGFGIILDDLVAAF
FT                   CTLLVIALWRAW"
FT   gene            525253..526713
FT                   /locus_tag="Vapar_0485"
FT   CDS_pept        525253..526713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0485"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mms:mma_1590 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17148"
FT                   /db_xref="GOA:C5CJE8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJE8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS17148.1"
FT                   /translation="MPAASSNAPASLHPASPAADWSELFSGRNGWRALALTGGVALHAV
FT                   NVHIVTTVLPSVVNEIGGLDWYAWSTTLFVVGSILGATLSVRLLARLGPRGACLAALVV
FT                   FGAGSTACALAPAMPWLLAGRTVQGLGGGLLAALSYALIQRVFAPRLWPRAVALVSGMW
FT                   GVATLCGPAVGGLFAQAGHWRWAFWSLLPLAAVQALLVAVQLRPAAGVRHERPSAMPRI
FT                   AALQIGLLVASVLVIAASEFLSAMAWQAAGVALGLALGVAATRIDRHAAVRLLPAGAYA
FT                   LRTPMGAIYACVVLLLIGTTTEIFVPYFLQLLHGHSPLSAGYLTAAMAGGWSAGSLLSS
FT                   GRSGAGADRMLRAGPVACTLGLAALALLLPAPGRFAPGLEMLLAAIALAALGLGVGIGW
FT                   PHLVTRVMSLAPAEQEGLASASITTVQLYGMAVGAAVAGLVANAAGLSEPGGAAGARSA
FT                   AAWLFASFAIAPALAAWLVARFVAARGR"
FT   gene            526724..527473
FT                   /locus_tag="Vapar_0486"
FT   CDS_pept        526724..527473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0486"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: psp:PSPPH_2654 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17149"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJE9"
FT                   /inference="similar to AA sequence:KEGG:PSPPH_2654"
FT                   /protein_id="ACS17149.1"
FT                   /translation="MLGGSSKREGICIMKRTRVRFNALWLCLAFSFLLAACGSKEAEQR
FT                   TAFIGFLQARVLDKPGLRVPTPTADEKASFGDYAQHYAVIADFNEGMNKSVSQPMGQVM
FT                   AKGALRSIADLASRRDDLKAAKDGLGGLRTALDQELAKADAAHAKLKQPDDLKQVYDKA
FT                   YEKTVSAPAATFKEVFPALDKVFDGALAVGDYLEQNKSKIQVSGSSVSVSDPAVQAQLN
FT                   KMLQELNGQSAAINAAQAKMQAMVRGS"
FT   sig_peptide     526724..526834
FT                   /locus_tag="Vapar_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.852) with cleavage site probability 0.380 at
FT                   residue 37"
FT   gene            complement(527474..528433)
FT                   /locus_tag="Vapar_0487"
FT   CDS_pept        complement(527474..528433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0487"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="KEGG: dia:Dtpsy_0345 thiamine-monophosphate kinase;
FT                   TIGRFAM: thiamine-monophosphate kinase; PFAM: AIR synthase
FT                   related protein; AIR synthase related protein domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17150"
FT                   /db_xref="GOA:C5CJF0"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJF0"
FT                   /inference="protein motif:TFAM:TIGR01379"
FT                   /protein_id="ACS17150.1"
FT                   /translation="MGEFDLITRYFQRPAKRSPLGVGDDCALLAPAPGMQLAVSCDMLV
FT                   EGRHFLSTVDPARLGHKALAVNLSDLAACGAKPLAFTLALALPGVDEPWLEAFSRGLFA
FT                   LADEHGCELVGGDTTRGPLNICITVFGEVPAGAALLRSGAHAGDDIWVSGTLGDARLAL
FT                   EAFRGTLSLPADVFAQARMRMEQPTPRVALGQALRGKASAAVDVSDGLVGDLGHILASS
FT                   KVGATLNADAATGVIAAAASCGLGTEILRTCALSGGDDYELVFTAPPAARAAVEQAGRE
FT                   STTRVTRIGRIDAEAGLRIVDAGGAPVAQRFGSFDHFV"
FT   gene            complement(528459..529088)
FT                   /locus_tag="Vapar_0488"
FT   CDS_pept        complement(528459..529088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0488"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: bxe:Bxe_A0706
FT                   putative isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17151"
FT                   /db_xref="GOA:C5CJF1"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJF1"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACS17151.1"
FT                   /translation="MSNHPAPRRALVVIDVQNEYFEGGGLPIEYPPVESSLPKIAQAMD
FT                   AARAAGTPVVVVQHHAPKGAPVFQADTHNGQLHPEIARRPRDHLVTKTLPSVFTGTDFA
FT                   DWIARHQIDTLSVVGYMTQNCDASTVFEAMHRGLNVEFLSDASGALPYSNAAGQVSAEE
FT                   IHRVFSVVFHSNFAAVASTEAWIAAMQAGQPIEKDNVVMSNRRARG"
FT   gene            529192..530169
FT                   /locus_tag="Vapar_0489"
FT   CDS_pept        529192..530169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0489"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: ThiJ/PfpI domain protein; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: pol:Bpro_4080 transcriptional regulator, AraC family
FT                   with amidase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17152"
FT                   /db_xref="GOA:C5CJF2"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJF2"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACS17152.1"
FT                   /translation="MDRKTLETIAVVAFDGISPFHLSVPCMVFGEDRTEAGDPRFRLQV
FT                   CGTEPGPLHTNAGFTLGVPHGLEAIRRAQIVIVPSWCDDGRPAPPALIRALQAAHRRGA
FT                   IVVGLCLGAFVLAEAGLLDGRPATTHWNLAEAFARQYPKVRLQPEVLYVDDGDVLTSAG
FT                   TAAGIDCCLHLLRVRHGAEAANRAARRMVVAPHRQGGQAQYIRQPMPAAAEGDRLAPLL
FT                   EWLGRHLQSPHELDSLARRALMSRRTFTRRFREATGTTVGQWLQNQRLALAQRLLETTD
FT                   RPVERVATDVGFGSAVSLRKHFAAAFKVSPTAYRRQFSQEAVAA"
FT   gene            complement(530166..531350)
FT                   /locus_tag="Vapar_0490"
FT   CDS_pept        complement(530166..531350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0490"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   pna:Pnap_3664 carboxylate-amine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17153"
FT                   /db_xref="GOA:C5CJF3"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJF3"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ACS17153.1"
FT                   /translation="MPDSDDFRSAALPADPASRVVKLEPFNRSEALSLGVELELQLVNT
FT                   HDYDLAPYAEDMLRLMSQTPLPGSVVPEMTSSMIEISTDICHSAQDVITQLSPIREALI
FT                   KNADKLNIAVVGGGTHAFQQWHERRIYDKPRFRELSELYGYLSKQFTIFGQHVHIGCPD
FT                   ADSALLMLHRMSRYIPHFIALSASSPFVQGQDTQFDSARLNSVFAFPLSGRAPFTLSWK
FT                   EFEAYFERMTRTGVVRSMKDFYWDIRPKPEFGTIEIRVFDTPLTVERAAALAGYVQSLA
FT                   AWFLQEQPFEPTEDDYLVYTYNRFQACRFGLDAVYVDPASGQHMPLRDHILMTMTQLEW
FT                   HSEALNATQALGELRTSVEANRNDARWLREKQGKERLLAEVVRQAALRFRGGGA"
FT   gene            complement(531365..532636)
FT                   /locus_tag="Vapar_0491"
FT   CDS_pept        complement(531365..532636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0491"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: aav:Aave_0435
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17154"
FT                   /db_xref="GOA:C5CJF4"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJF4"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACS17154.1"
FT                   /translation="MNLTNLINDLLGFWSEWLRPSAGLPTVLWSLLLAAAAASGHLVQR
FT                   YLGLPKVVGYSMVGAVAGLAGFEGAIWPLRGISLFLLELGAAVVLFEAGGRLPLRWFRH
FT                   NPMVLVQSLLEATLTYFGVFWMLQLLGLPDPVANPIALMAIVASPAVLSRVIIDTRASG
FT                   PVTERAMTLATLNTFYALALGYAQAGLIERAPQTLLQKLYPVAVVLGLSFVVGAILALA
FT                   LRTALRFMSPTSENTSILLLALIAAASALTAHVGGSAPLAALIGGVLLKTLNPKPWAWQ
FT                   RQLGTASSLLTMLMFVLVSIVAAQADWTLPVASVVLAVIGIRLFAKIAGVAIANPGSGA
FT                   SWNQAFWVGCAMSPLSSIALLIASNFTTASPLLGTMITQVALPSILLMEVMGAVLATVA
FT                   IHAVGESSVPWTPQAFSTTEDTQR"
FT   sig_peptide     complement(532514..532636)
FT                   /locus_tag="Vapar_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.629) with cleavage site probability 0.285 at
FT                   residue 41"
FT   gene            complement(532633..534603)
FT                   /locus_tag="Vapar_0492"
FT   CDS_pept        complement(532633..534603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0492"
FT                   /product="putative site-specific recombinase transmembrane
FT                   protein"
FT                   /note="KEGG: dia:Dtpsy_0348 putative site-specific
FT                   recombinase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17155"
FT                   /db_xref="GOA:C5CJF5"
FT                   /db_xref="InterPro:IPR011385"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJF5"
FT                   /inference="similar to AA sequence:KEGG:Dtpsy_0348"
FT                   /protein_id="ACS17155.1"
FT                   /translation="MAAASLDLQGLLARLDPTADVAQRHIWLIDVFDWLRGDRASPQAA
FT                   VGRMSLLLDAVEARPELRGRLRAWWRAFTQAVDLTTLLADYGFAPRTAFVSELTERLRR
FT                   KILPGTPETTDASDLFRMVLPGAFDAGWIALLDDAQLARIGNLLADAALDDDGAPRGRH
FT                   TVMDAVTYCSSQVVAAGFSPELRLRMSAASESRAFHALMSDLDALREQMFRAPRNEDAL
FT                   QAAFLAFRDRLDACRASASSVYTHLEDNGISVGLVFRLRQLRERVLRIRELLDCLISPA
FT                   PAPSVARLVGRLVLAGGERNSIRALIASNSSMLAAKVTERSAETGEHYITRDRASYLQM
FT                   VRKAAGGGALTALTVLLKFGIYSLALSAFWSGLWSGLMYAASFVAIQLLHLTLATKQPA
FT                   MTAPAMAARLRDIKTDAAVADFVDEVANLVRSQVAAVLGNVGLVVPAMLALALLVQFAL
FT                   GRPLLDAAHAAATLQSLSLAGPTALFAALTGVLLFAASIVAGWTENAFVLHRLDSAMRY
FT                   NPRIGAFLGAARARRWATFMRTHISGFASNISLGLMLGLLPAFAGFFGLGLDVRHVTLS
FT                   AGQIAAAAASTGMAVLQQPALWWAVAAIPVIGALNVSVSFYFAFRLALRAHSVSLGDRA
FT                   RIRSAIWARWRSRPISFFLPA"
FT   gene            complement(534730..535125)
FT                   /locus_tag="Vapar_0493"
FT   CDS_pept        complement(534730..535125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0493"
FT                   /product="ApaG domain protein"
FT                   /note="PFAM: ApaG domain protein; KEGG: aav:Aave_0437 ApaG"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17156"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJF6"
FT                   /inference="protein motif:PFAM:PF04379"
FT                   /protein_id="ACS17156.1"
FT                   /translation="MPHSPIRVQVEPRYLADQSSPKDKIYTFAYTVTVTNEGETSAQLI
FT                   ARHWLINDASGHAQEVKGLGVIGQQPLLAPGESFRYTSGCRLQAPSGTMHGSYFMVTED
FT                   GERFDVPIPMFVLEADIGGAPVSRVLH"
FT   gene            535197..535895
FT                   /locus_tag="Vapar_0494"
FT   CDS_pept        535197..535895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0494"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="KEGG: pna:Pnap_3660 ribulose-phosphate 3-epimerase;
FT                   TIGRFAM: ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17157"
FT                   /db_xref="GOA:C5CJF7"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJF7"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ACS17157.1"
FT                   /translation="MSSTPFRIAPSILSADFAHLGDELAKVIAAGADWIHFDVMDNHYV
FT                   PNLTFGPMICKALKPYARTADGEAVPIDVHLMIQPVDALAASFAEAGADYISFHPDASP
FT                   HVNRSIQAIKGAGCKAGLVFNPGLGLEALDWAIDDIDLILIMSVNPGFGGQSFIDSALR
FT                   KIELARKRIEQSGRDIRLEVDGGIKVDNIARVASAGADTFVAGSAIFNAKDYAAVISSM
FT                   RDQLAGVGGK"
FT   gene            complement(535905..536177)
FT                   /locus_tag="Vapar_0495"
FT   CDS_pept        complement(535905..536177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_4156 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17158"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17158.1"
FT                   /translation="MSSTKPRTKDPADPNDPLRDAGGGNTKTQQGGDSAPRLPHERDES
FT                   SDSQQTPNGKPPEIGRKGHEDIERGSVDTDRGPVTDRVYNDKVKR"
FT   gene            536350..537357
FT                   /locus_tag="Vapar_0496"
FT   CDS_pept        536350..537357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0496"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: bbr:BB2668 putative
FT                   succinylglutamate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17159"
FT                   /db_xref="GOA:C5CJF9"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJF9"
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /protein_id="ACS17159.1"
FT                   /translation="MSSDPLAAATTDNLRIHTFAALEPGPRLLVMGGVHGDETCGTAGI
FT                   ERVLAELDGGTFRLRRGQLTLVPVANPLARRRLQREGERNLNRLFKPSAAPADYEDRVT
FT                   NVLCPIIERHDVLLDLHSFQSEGEAFAMIGPRDNTGTLEPFARASEEGLLALHLGTPIV
FT                   VEGWLDIYAAGLAQRAAGIAVGEDAIDFGRGTNEYIRNCGGYGVTLECGQHRDPKAPEV
FT                   AWRAIRRALALLGMAALPQGLAGTPPAPPRLLRLASVTDRLHEDDSFVRDWATFDAVQR
FT                   GEPIGMRHDGTLVSAPDDGFIVFPNALALPGAEWFYFARPSERVLGSVAAVRAA"
FT   gene            537437..538462
FT                   /locus_tag="Vapar_0497"
FT   CDS_pept        537437..538462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0497"
FT                   /product="Ku protein"
FT                   /note="KEGG: pol:Bpro_3002 hypothetical protein; TIGRFAM:
FT                   Ku protein; PFAM: Ku domain protein; SMART: Ku domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17160"
FT                   /db_xref="GOA:C5CJG0"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJG0"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ACS17160.1"
FT                   /translation="MAVSKKAPAPRVLWKGAISFGLVHIPVALYSATTDHAIDFDWLDK
FT                   RTMDPVGYKRINKKTGKEIARENIVKGIEYEDGEYVVLSDKEIADAYPKTTQTIEIESF
FT                   VPANGIPFVYLERPYYVAPINRGTKVYALLRETLQRTQRIGVARVVIQTKQHLAALVPV
FT                   GPGLVLNLLRWGADIRPWTELPLPSEDAKKAGLREHEIKMAEQLVEDMSAEWDPDDYKD
FT                   EFKDEILRLVDRKVAAGQTETVTQIEPEEGQALESRGAKIIDLTELLQRSLRKGGGGGK
FT                   AAAAGEDSGDEEEEAPAATKPRSKAKPRAPGKAAAKSSSSSSAARKRSAAKSATARRRA
FT                   A"
FT   gene            538471..539367
FT                   /locus_tag="Vapar_0498"
FT   CDS_pept        538471..539367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0498"
FT                   /product="DNA polymerase LigD, polymerase domain protein"
FT                   /note="TIGRFAM: DNA polymerase LigD, polymerase domain
FT                   protein; PFAM: DNA primase small subunit; KEGG:
FT                   pol:Bpro_3003 ATP-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17161"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJG1"
FT                   /inference="protein motif:TFAM:TIGR02778"
FT                   /protein_id="ACS17161.1"
FT                   /translation="MATAQKAPRITHAERLIDAASGLTKGDLAAYYARVAPLMLPHLEG
FT                   RPVALVRAPDGVGGELFFQKHAQHSDIAGIKLLDPALDPGHDPLLQIDTAEALVGAAQF
FT                   NTVELHTWNATSRALGKPDRMTFDLDPGEGIDWQQMQEAALLVRVLLDELGLPSFLKTS
FT                   GGKGLHVVVPLRRQFGWDEVRGFSRAIVEHLARTVPERFVAKSGPRNRVGRIFADYLRN
FT                   GFGATTVSAWSARARPGMGVSVPLAWEELPDLDSAAHWTVANIGPRLATGNTPWDAMER
FT                   SRTGLRAAMQMLGFLPA"
FT   gene            complement(539378..540196)
FT                   /locus_tag="Vapar_0499"
FT   CDS_pept        complement(539378..540196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0499"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; SMART:
FT                   transglutaminase domain protein; KEGG: mpt:Mpe_A0053
FT                   transglutaminase-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17162"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJG2"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ACS17162.1"
FT                   /translation="MQIKIGFDIELAVTAPTALVYMLHVHPSRAADLQDGEHVTLTPPL
FT                   HTDYYVDGFDNHCARVRIPAGVASVRLRNHAVVFDPGWADPVDFGAVEHAAADLPVATL
FT                   PFLLPSRYCEVDSELLAFAWSNFSSVAPGWHRVQSICDFVHEHLRFDYQSARATRTALE
FT                   GFRERTGVCRDFAHLAITLCRCMNIPARYATGYLGDIGIPPVPSPMDFSAWFEVYLGER
FT                   WYTFDARHNVPRIGRIVIARGRDAADVPITMVFGANSLKRFEVTTEEVPQ"
FT   gene            540533..540700
FT                   /locus_tag="Vapar_0500"
FT   CDS_pept        540533..540700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17163"
FT                   /db_xref="GOA:C5CJG3"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJG3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17163.1"
FT                   /translation="MDLSSLFDSLTGAWGDEILFWVVAAVAGFICLIALVNVLDLFLDN
FT                   EADPPMKDPR"
FT   gene            540697..542883
FT                   /locus_tag="Vapar_0501"
FT   CDS_pept        540697..542883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0501"
FT                   /product="Catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="PFAM: Catalase domain protein; ThiJ/PfpI domain
FT                   protein; KEGG: pol:Bpro_2453 catalase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17164"
FT                   /db_xref="GOA:C5CJG4"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJG4"
FT                   /inference="protein motif:PRIAM:1.11.1.6"
FT                   /protein_id="ACS17164.1"
FT                   /translation="MTPQNKAAAGRRSKATDGSNAKQQQLDGFATDHAPNLTTNQGLQI
FT                   PDNHNSLKAGVRGPTLLEDFILREKITHFDHERIPERAVHARGSAAHGYFQVYKSMSQF
FT                   TCADFLQDPDAKTPVFVRFSTVAGSRGSADTVRDVRGFAVKFYTREGNYDLVGNNIPVF
FT                   FIQDAMKFPDLIHAVKPEPHHEMPQAASAHDTFWDFVSLMPESTHMLMWAMSDRAIPRS
FT                   LRMMEGFGVHTFRFVNLRGESHFVKFHWKPKLGIHGLAWDEAQKVAGKDPDFHRRDLWE
FT                   AIEQGDFPEWELGVQLVPPDKADSLGFDLLDPTKLIPEEMVPVQRIGRLVLNRNPENFF
FT                   AETEQVAFHPGHVVPGIDFSNDPLLQGRLFSYTDTQISRLGGANFHELPINKSVCPFHN
FT                   FQRDGMHRQTIARGQVAYEPNSLGDGKEFRVDGGSVGFQPHPDELESPKVRRRSPSFDD
FT                   HFTQARLFFNSQSAAEKEHIVAAFRFELSKVDVPAIRQRMVDNLAHVDEKLARRVAEPL
FT                   GIGAPDAKAAAGRAGYREHRMTLPIEESPALSMADSGDGSIRTRKIAILAADGIDSASL
FT                   KPIRDALEQAGGKCKVVGARLGTIASASKRQIDVDMTFANGPSVVFDAVLIPGGAQGVA
FT                   ALAGMGDAVHFVLEAYKHCKAICTVGDGVQLLSTLGIGANAQQGDAPAGIIVAATPVTN
FT                   LGDTSEATQIAQAFIAAIARHRHWDRANIDAIPA"
FT   gene            543043..545196
FT                   /locus_tag="Vapar_0502"
FT   CDS_pept        543043..545196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0502"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   lch:Lcho_4095 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17165"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJG5"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ACS17165.1"
FT                   /translation="MTWFSRRTERERSARRAGAAGALGLAAILLLGHGSPASAQQPQQA
FT                   PNAEAAAGRAEQARLADTDTLLALTSEGAVLYGQDAVKLSGYQYCSQAVALAEAGEFRQ
FT                   SVRAASKALHLANATSDPNLLAMANRDLAIVYSYSGQLEKAEEFAREALKHPARDPKLV
FT                   VGPVQKVIGDVRTRRGDYAGAVISYDEALANSSSRYAPLVQASLVNALIESGDAARARE
FT                   VLGGMAPPRDAPLTAQLDRTRARLLLAENKPAEARDLYRALTARQVGTDTEYYRLWAWD
FT                   GVARSELALGQKQAAAEAVARALGGIDQVRARFRSEEFKMGLFSDLQSVFERGVSIYSD
FT                   AGDARQAFEVSERSRSRALLDAVRGRAKINERAATTVDLAALQGMLAPDERVVQFHSLP
FT                   DRLLVWVVGPAGIEARTVPVRREELTELVEVFRNSIVRGRRAAITNADKLGAALLGPLG
FT                   LAPGQRLIVVPHGPLHYLPFQALRLDGRYVIETHPVAVAPSISIAVQLAQRSPRVGASL
FT                   TAFGNPRIEDKYDLPGAEVEVKQLAQLFPRNAVYMGAAATKTQFRDVAARSPLMHVAAH
FT                   AEADAVDPLYSRILLANEGGKQNFLEAHEILGLPMDGTALVTLSACESGLGRIAQGDEV
FT                   LGFTRSFLSAGSSSLIASLWPVSDDATAVLMGTLYGELAKGRDIQKAMQAGQLAVLKDP
FT                   KMSHPFFWAPFNLIGNWRLTVGS"
FT   sig_peptide     543043..543162
FT                   /locus_tag="Vapar_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 40"
FT   gene            545565..547283
FT                   /locus_tag="Vapar_0503"
FT   CDS_pept        545565..547283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0503"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein ShlB-type; surface antigen variable number repeat
FT                   protein; KEGG: cak:Caul_4107
FT                   polypeptide-transport-associated domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17166"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJG6"
FT                   /inference="protein motif:PFAM:PF08479"
FT                   /protein_id="ACS17166.1"
FT                   /translation="MQMRAIQRSTPIALAVAALVSATLLVAAQRTHAAEADANALLPTK
FT                   DPCGSCDRPLAQATGTVAPQSLPAPPQPPAARFKLNDLRLNGVKALSNEELQGITAPYI
FT                   GRDVTLGDLESLAQAITARYKERGYFLAQAVVPVQTVRDGIVEISVIEGRLGKVEVIVA
FT                   PDAAISEARVRGFLAPLQPGEAVNAPAYERSMLLLSDQPGIKVSSALQEGTQPGTTDLS
FT                   VEVAPAPRWAFAAEADNHGTKESGRYRLGGTMRWASPLGIGDNLDVRAMVSNGNALQFG
FT                   RVAYEAPIGSSGLRAGLGLARVNYELGGEFSELGAQGKADVFDVSLSYPVIRQRQHNLF
FT                   LRLSADSKKLTDEYTAVDFSARKRVRGFGLGWTWERRDDWLGGGYWASTGNLYHGRLSI
FT                   RDADSLQTDQGLGGHRTEGGFTKATFQLSRLQAVLPRHSLYLALGGQWASKNLDASEKL
FT                   SLGGARAVRAYPSGELLVDQGVIGTVEWRWSLDAEFTPFLFYDAAHGRQTKNPTIFDSG
FT                   AHSRSLRGAGIGLSWTRPGNFTINATLAWRAGTDPARTDGGGRNPRLYVQAQKTF"
FT   sig_peptide     545565..545666
FT                   /locus_tag="Vapar_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 34"
FT   gene            547291..552825
FT                   /locus_tag="Vapar_0504"
FT   CDS_pept        547291..552825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0504"
FT                   /product="filamentous hemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; PFAM: filamentous haemagglutinin domain
FT                   protein; KEGG: mgm:Mmc1_2695 filamentous haemagglutinin
FT                   family outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17167"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR041286"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJG7"
FT                   /inference="protein motif:TFAM:TIGR01901"
FT                   /protein_id="ACS17167.1"
FT                   /translation="MRNHDLSAKALPRHWRVRPLVLSLACMGMVPAWAQLNLPAGFPQS
FT                   GNVVFGNVSVAPLGTAAVQRLNQSTMNAIVNWNAFSLDGGKTLNIVQQMGAASVMLNRV
FT                   VGSGGVIEQSVINGTLSANGHVFVVNPSGVLFGGSAQVNVGGLVASTLDISDSQIAKEG
FT                   SVVGKGGQLLFGGGINDANSTARVTVQPGAVISVGEGGTLGLIGALVRNEGNINVARGS
FT                   AGLVSGARVTLDFEGDGLTKFTVPLEGGLMNTSVAGVQATDPTTKALVMNTGTITADGG
FT                   RVVLVGASGLVQQVVNQSGTVRARSLVERGGEIVLEAIGAQVDSGAGLEVSGPLDARGN
FT                   APGVAGGSIRTTAGNLNVLAGTQIDAGGNAGANGSWTAEAGRNLSIVADADSGNIAASV
FT                   IGKALSQGTDVTLTTRSSSKVAQINDAVVFQPGAQVIKDGGGAATLRVNSVGNIDMRWA
FT                   VEGGGATIASTSGALNVDFNADAQGLAAAEAGQANGIAAAIRLDRARIDANGGNIRFFG
FT                   QGDSDNGRAIGGQVKGPGADGAGEIRSGVWLGGSALSTLGAGSILLRGEGGTGEVGSGF
FT                   LSATDGVRIDGDSTLGTQAGGITLAGRGAAGGSGVRLNGDDYSVALSSASGNIALTGTV
FT                   RDWTSGGPVGEPPDGAGVQITGSILTTGGDVRITGQGGDLSGMAAGLRTQAVELSTSYT
FT                   VGASNGVAIDGTRIEAGAGRSIAITGTAGSAGFGYDGTGAALGFAPLDATVTPFGVRLS
FT                   SSQQADGLHAAGGSIRIAAGTGDVSLVAGAFEGTLLDAASATGMGGSIGVTGRNILAQS
FT                   TADSSGLADASGAGGGGSIEIRGSTAAGAGNENTGVVSVGPNLTLLANALGSGNGGSIT
FT                   LVGERSVRAFGDLQARGGSAGGNGGTIETSGGSFDVSGIRIDASAPAGLAGRWIVDPYD
FT                   VTIVHGVAGGGSLPTNPFDPVATSTIQDGDINGALNTGTSVSITTGSGGTDAGDIRFGS
FT                   GMVIERTVGSAPLVFELNAAHSIGDRVFSSSYLAPIIRSTTGPMDVIFNAGSAGALDGY
FT                   VHYFGNTGADQAVISTNGGSVLAHATGTGYAEVVFNSASIDAGGGNLSLVTDGPSSTQF
FT                   VAFSGDVHTRGGSVTLDSGFVGASPAFSDINIDVDGTIDTGGGAVSIHAHGVGGIYDSV
FT                   TSRFNNQIITDGGAVSILNGQTGAPSGFVLLQGTRIDTRVGQSDAGAGGDVSIAGGGVS
FT                   INGARIDSATGDVAITGTGGTGQSGSAVQLDSLFLRAVGVPVPTAISTTSGNVLVRGVQ
FT                   DFNRGSSAFNATHGVLVTGGSSITTGSGNIALQGLFASAVVDGTDSGVRLENGARLATT
FT                   GGGSIELTGSSLQGTPGVSIQTGLLSTGAPGAAPQVQSSGNLVLRASNDGSAPALAIDV
FT                   PVSAAGTINLRPGGMDAALNAFDATAAGITVGGAAGGGFTLSDALMSRLNAPSVVVGSN
FT                   THAGTITVAGALTSAGALTLQNEGVGAGAGGIVLNGAVTADRLGLLSAGDITQTVKAPI
FT                   TAQHLLARSSRGSVLLDRAANNVSENTLGGGAAGAFRYQDVDGVRIGALSVTGFDAGSN
FT                   QPQLVSATSMAADTVFVRTLSGDLTLDTAVTSSSGTDLVAAARFQNAGGGSIGGAPWRI
FT                   WADTWVGESRGGLAGSGATPNLFHCAYLGLCTVTITPGDNHFIYAQQPRATVVIGDASR
FT                   PFGTANPPFGFTIGGLILGDGTAGFLGTPTSAAGIFSPAGRYGINGSFTSAAGYAVDVV
FT                   PGTLTVTASLRRPDFPGSDLVRELPNTNTYTFDRNLGAPPICFATGPLEGDRAQQDGDL
FT                   LAREWSRVRSRPNLTSCVATDRKNGCADF"
FT   sig_peptide     547291..547395
FT                   /locus_tag="Vapar_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            552840..553940
FT                   /locus_tag="Vapar_0505"
FT   CDS_pept        552840..553940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0505"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   xau:Xaut_1935 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17168"
FT                   /db_xref="GOA:C5CJG8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C5CJG8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACS17168.1"
FT                   /translation="MELPPPLFLFIQTNKRCNLRCEHCDFWKLDDADRARYLGPARRHE
FT                   VLAEFAAMNPQGSVVICGGESMLDLEDYFHISRTCRELGLACLSVINGTRVRDEATAER
FT                   MIREGPHGISVSLNSHRPALHDRTRGVKGAFGKAVAALRLLLAARPPGGDTRINVMGLV
FT                   FDENYLELEDFYAFVLDDLGADKLKLNFLQPSFGQMGLVDPFFATHRNVDPDRLVEVIR
FT                   RCDQRFGLGLNPLWLHQVHMYFSTLRACPDAARGWGSHTRTTEHICNTYERNIMVDHYG
FT                   VARLCFSGSFPGMRLDKPGDLRLFWREAEFVRTAMRGCNQFCGISHSVRRETSTCASRR
FT                   PAALFPAARPAAGVARTIPLHVDRGG"
FT   gene            553942..554721
FT                   /locus_tag="Vapar_0506"
FT   CDS_pept        553942..554721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0506"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bid:Bind_0088 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17169"
FT                   /db_xref="GOA:C5CK71"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK71"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACS17169.1"
FT                   /translation="MNGAALKVAVVTPYHREPAAVLRRCMQSVHAQSHPQVVHYMVADG
FT                   LPQAGLLAEWPQVRHIVLPQVNANFGCTPRGIGALCALADGADVVCFLDADNLFLPGHV
FT                   ASVVQAYAEARERGRPVDAVFSSRYMFLPGHEHLRIVPPDEAPGSDFVDTNCISLARSA
FT                   GFLWGAWSQLPRSLTPVCDRAMCWLMQHHGLRVRWTRQCTVLYESRWRATYLQAGLPPP
FT                   EGLHDELLRSAGVGLTPEELWGLLRVQWSFDPPARRA"
FT   gene            complement(554740..555543)
FT                   /locus_tag="Vapar_0507"
FT   CDS_pept        complement(554740..555543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_3168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17170"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK72"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_3168"
FT                   /protein_id="ACS17170.1"
FT                   /translation="MLDTAALKGIRPFVATPSYSGAMASLYVRSLLGLVNAAWTHGFAM
FT                   QTRFLDGDSLLTRARNRLVAEFMADAQWTHLFWIDADVGFAPDAALRLLLSGRDVVAGV
FT                   YPHKNDGWPAQGLARPLPAGATQADFDALHARYPLNLRHTPTEADADGFVEVLDAPTGF
FT                   MLIARGVFERMAAAMPELRYTPEAGDHANAHLPHWRFFDTQFEPATGRYLSEDFAFCRR
FT                   WQQLGGQVFVDLQSRLSHQGLKTWHGDLPRALGALDATGGHGLAR"
FT   gene            complement(555613..557604)
FT                   /locus_tag="Vapar_0508"
FT   CDS_pept        complement(555613..557604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0508"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; response
FT                   regulator receiver; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   azo:azo3438 putative virulence regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17171"
FT                   /db_xref="GOA:C5CK73"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK73"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS17171.1"
FT                   /translation="MSETLPSAGGRADAAPPPSAPTPTLLVRGNLQRDLFRLGVVPCAA
FT                   VALALTGWFTHSRLQTLEAAFDAEGQAVARQVAAMSDLSLYAGDLPALQNVANAALRGG
FT                   QVMRVEISNSAGVYVTAGPKASSLAQLRMFTSPVTLREASRASAFAPAGSTAAGDAPIG
FT                   LVQTFRDTTAYARERSRSLIASIGIALVALLAAWASVRHMARTVARPLRRISRTVAALE
FT                   AGHFEARCDVAEGDSRASAGGAGKGRAHELTVLAHDIDRLAERLQRNRQISEERVREAT
FT                   AVALQRMAEAEQAALSRARFLAAASHDLRQPLHAMGLFIDGLLPGASAAQRPAMLRLQE
FT                   STEFMGVLLDDLLEISRLDAQVLTPAITKVPLAALFDQLDAQHAATAVETHVRLRWSDR
FT                   GLAVRSDAALLQRIVGNLVANALRHAPAGGTVLVAARRARGRNGDSVRIEVRDNGIGIA
FT                   PIHQGRIFEEFYQVANTERDRRRGFGLGLAICARIAALLGTRITLRSALQAGSTFALTL
FT                   PAAHAADATAPEPAPLALTPLAGLHCMVVDDDPAILDGSRALLEQWGCQVECVATGAEA
FT                   IARLGTGDVHFDAVLCDLQLAGDADGMEVIDAARRLQPDALAVLVSGATGPEVLQRLRH
FT                   GGVMLLTKPVAPAKLRALLTTRRHAHAA"
FT   gene            complement(557601..558578)
FT                   /locus_tag="Vapar_0509"
FT   CDS_pept        complement(557601..558578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0509"
FT                   /product="ABC-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: azo:azo1878 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17172"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK74"
FT                   /inference="protein motif:COG:COG2984"
FT                   /protein_id="ACS17172.1"
FT                   /translation="MAQPAASASATELTVLMGDELPAHAEFVQHLRASQEPGSRFELVR
FT                   LAPGGAEAAQPVETARAEAESERGANAGVRTRSLRTAPANAALTLAVGAPAARAALERP
FT                   GQQPLVLAMLSRLDYESLRASSPALRRGDRRVGVLLRDPAMADQLALIGAVLPQKHRIG
FT                   VVATPESEPLVRELQRAAQNGNPPWDIQVEYAPDDRSLAGALRSVVPRSDALLVLPDLI
FT                   GDNQAATLSVLRAGAGAGLPVFGASEGLVRSGGLAAAVSTPAQLAQQARLLGQKLSSGA
FT                   GGSGNPLVESAAPATVRVNATVARGLGLRLPEERELTERLTVVR"
FT   gene            complement(558821..560710)
FT                   /locus_tag="Vapar_0510"
FT   CDS_pept        complement(558821..560710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0510"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; response
FT                   regulator receiver; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   azo:azo3438 putative virulence regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17173"
FT                   /db_xref="GOA:C5CK75"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK75"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS17173.1"
FT                   /translation="MNWNFRVLRGLARLTFAQQLILLALVPATAATLAAIAVLTRQHLD
FT                   NLTALMRANAQTVAMQVATAAQTPLLRMDRRMLQRTAQSGTYQPHVQQVQIWSEDGEIV
FT                   ANSETVDRARGDGLQVVVPIVSDEGRQSGKVMVEMSLDAVQDARRSVWLNVVLVLAISL
FT                   VGVGLAGWWAARRISEPIRALGRAVDRLGAGEAASVAIEGTSEIRHLQHGFNQAARALA
FT                   ESHRLLQSRISEATAELARKNQQLEVASQAKTRLLAAASHDLRQPLHALTLFSDGLANG
FT                   ETDPLRLQRIGHIRECVDSLDRLFSELLNLSQLDAGVLQPQWADFPLDRLFDEISRNFR
FT                   PVAEQQGLRLVARKTELWVRCDYVMLSRILNNLVSNSLRHTLEGGVLIGARRRGKGVRI
FT                   DVVDTGVGIAPQHQARVFEEFYQVETTGRQAPRGARGMGLGLATVQRLAELLNTRVDLT
FT                   SRPHKGTCVRVLVRSAPAALPQPAAAPAAGGTEEEASLENLRILVIDDERTILEGLTVV
FT                   LTHWGAEVLAAQTRAEALALADTWEQPPDVVVSDLLLQGGDNGLDVIAALERHPRGIGP
FT                   GTARLLVTGETKPDRLREVASAGIAVLYKPVSPRVLRQAIQAQRAAALSNADA"
FT   sig_peptide     complement(560606..560710)
FT                   /locus_tag="Vapar_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.545 at
FT                   residue 35"
FT   gene            complement(560778..560870)
FT                   /locus_tag="Vapar_0511"
FT   CDS_pept        complement(560778..560870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17174"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17174.1"
FT                   /translation="MEHEDMGPLRTSGSNMGNATQLDTKYKLIS"
FT   gene            560987..561997
FT                   /locus_tag="Vapar_0512"
FT   CDS_pept        560987..561997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0512"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: mpt:Mpe_A1250 putative
FT                   phosphonates-binding periplasmic protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17175"
FT                   /db_xref="GOA:C5CK77"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK77"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ACS17175.1"
FT                   /translation="MVRRGAASAILMLLAGLPQIAIAQPAPQPDAPVRFGILPLGGAFE
FT                   SRSDWDPLLAELSRAIARPVSVLSVNSYEALDQAIRRDEVDMAFLSGKMALDAVTQRRM
FT                   KVVAQVVRHDGLPGYRALLLARKAPPFNSMKSLLAEPERWRLARGERQSVSGFIVPQLQ
FT                   LFLPNHIAMETRFLSEIVGTHQTTALAVANSEADVATNNTADFERFRQRFPAEAERLQV
FT                   LWESELIPHAQIVVRREYPPELRSRVQAFLVGYGRAKGPKGDAERVVLKSLHDLAGFVA
FT                   ADNSSLQPAAKLAYQLARQNAMGAQWVNDAARQARLSRIESGYAEQTAVLRDLSP"
FT   sig_peptide     560987..561058
FT                   /locus_tag="Vapar_0512"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            562012..563070
FT                   /locus_tag="Vapar_0513"
FT   CDS_pept        562012..563070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0513"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: pzu:PHZ_c3317
FT                   phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17176"
FT                   /db_xref="GOA:C5CK78"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK78"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ACS17176.1"
FT                   /translation="MSMSMLRLLRSVAAALALLAVAAACLAQGGAATADKAVAAPVKSI
FT                   RFGVLPLGGAVESRALWTPLLAGLSQAMGVPVSAYSVASYEELDRAIKRDEIDMAFLSA
FT                   KMALDAVMQRRMKVVAQIARRPGMPTHRAVLLTRKAGLPSTLEAVLAEPERWRLARGDS
FT                   RSVTGFLIPQSQLFLPRGIAMETRFRGEIVGTHQATALAVANGDADVATNNTTDFERFR
FT                   EQFPVEAARLHIVWESEPPPGAQMVVRRSYPPEFQARLQAFLVGYGQGKGPGADAEREV
FT                   LKTLRAAYGYAPADDSALLAEAMLEYQLGKQSAMAAAWVNDAAREKRLQRIEKNYREQV
FT                   EALSAAASSGAR"
FT   sig_peptide     562012..562095
FT                   /locus_tag="Vapar_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.522 at
FT                   residue 28"
FT   gene            563214..564545
FT                   /locus_tag="Vapar_0514"
FT   CDS_pept        563214..564545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0514"
FT                   /product="type VI secretion protein, VC_A0114 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0114 family;
FT                   PFAM: protein of unknown function DUF876; KEGG: bpa:BPP0728
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17177"
FT                   /db_xref="InterPro:IPR010263"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK79"
FT                   /inference="protein motif:TFAM:TIGR03353"
FT                   /protein_id="ACS17177.1"
FT                   /translation="MSWRTKVVWSEGMLLQPQHLQQSERHADHARHVLLRSTTPYAWGF
FT                   AEIEIDQAALTLGKLALVRAVGLFGDGTVFDMPAVDPLPEPIDIPPAMRDEAVVLALPL
FT                   RRAGAREADAEDYEELVRHRVLESEVPDSNTAGERTAVLQLGQLHTRLMRASEATDAWT
FT                   TLGVARVLERRVDNQVQLDRAMLPPLLDVAGHAVIRSWLDELLGLLRQRGEALAGRMTQ
FT                   GGTGGVAEIADFMLLQTVNRNEAVFAHLAQSAMLHPQHFFEHALGLAGDLASFRDSRRV
FT                   TRFGPYVHDDLALSFRPLMDDLRRSLSMVLEQSAIRIDLHDRKHGVRVAVVTDVELQRK
FT                   ATFVLAVNANMPSEALRARFPTQVKIGPVERIRDLVNLALPGVTLTPMPVAPRQIPFHT
FT                   GANYFELETRNSDLWRQLEQSGGIAMHIAGDFPGLDLAFWAIRS"
FT   gene            564578..565906
FT                   /locus_tag="Vapar_0515"
FT   CDS_pept        564578..565906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0515"
FT                   /product="type IV / VI secretion system protein, DotU
FT                   family"
FT                   /note="TIGRFAM: type IV / VI secretion system protein, DotU
FT                   family; type VI secretion system OmpA/MotB family protein;
FT                   PFAM: OmpA/MotB domain protein; KEGG: bpt:Bpet4103
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17178"
FT                   /db_xref="GOA:C5CK80"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR017733"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK80"
FT                   /inference="protein motif:TFAM:TIGR03349"
FT                   /protein_id="ACS17178.1"
FT                   /translation="MTTPDPFAAFESERTVIKPKPRTPAGTPPAPAPAPFFGGADPTPA
FT                   VDVGEIGLLNPLVSAAGKLLVLIGKLRNLVQPPNVPALRASTADAVNQFDAAARRAGAS
FT                   NESVLAARYVLCTALDEAVANTPWGVQAGWNKQSLLVQFHNETWGGEKVFQLLAKLAQD
FT                   VPTHRQLLELIYSVLALGFEGRYRVVDNGRAQLDSVRQRLADLIAKDRPPLEAELSPHW
FT                   RGQGAGTVRLRESLPLWVFAAGFALLLALAWFGLRLTLNYRSDTTYAAVSGLRVPNLQI
FT                   APPAAPAKSPRLARFLEPEIKQGLVTVTDEADRSVVRLRGDSFFGSGSAEPMAASLPVL
FT                   RRIGQALAEVKGEVLITGHSDNQPIRSLRYPSNWHLSAARADAVKGALTTLVEPARMRS
FT                   DGKADAEPVAANDTPANRARNRRVDIVLLSEPDRVAAAAGVTK"
FT   gene            565903..569502
FT                   /locus_tag="Vapar_0516"
FT   CDS_pept        565903..569502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0516"
FT                   /product="type VI secretion protein IcmF"
FT                   /note="TIGRFAM: type VI secretion protein IcmF; PFAM: ImcF
FT                   domain protein; protein of unknown function DUF1215; KEGG:
FT                   azo:azo3890 ImcF-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17179"
FT                   /db_xref="GOA:C5CK81"
FT                   /db_xref="InterPro:IPR009612"
FT                   /db_xref="InterPro:IPR010623"
FT                   /db_xref="InterPro:IPR017731"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK81"
FT                   /inference="protein motif:TFAM:TIGR03348"
FT                   /protein_id="ACS17179.1"
FT                   /translation="MIKKIFGFLFSPLLLTLLALVIVALLIWWIGPLVKIGAWVPLESE
FT                   LARALLIGAIVLVVVLRAIYRRWRARRASQHLTDGLMKAPAAKADAPVNGEQKILDTRF
FT                   SEAVATLKQMRLHAAGKKPGWRDWLSISGGSYLYDLPWYVFIGAPGAGKTTALVNSGLS
FT                   FPLAEKFGPGAIRGVGGTRNCDWWFTDEAVLIDTAGRYTTQDSHQSEDKSAWEGFLGLL
FT                   KKARPRRPLNGVFLTVSVADLLSQGPEQRTQLAASIRARLLELDAKLTTRLPVYVLVTK
FT                   SDLLYGFTDYFDDLGKEQRAQVFGFTLAADENVQADEKGLSTAFHREFALLHNRVNDGL
FT                   IARMQRETDGTRRAAIFGFPAQFGSIGSMLSDLLDQVFTGSRFAQPPWVRGVYFTSGTQ
FT                   EGSPIDRVMGSLARSFGIERAMLAPQKSSGRSYFLTALLREVVFPEQRLAGANVKLERR
FT                   RHALRMAGVAAMTLVTLALLAGWGYSTLQNLNYLKSVEARVEPARQTLAALPSRVQNLV
FT                   EVAPVLQGLRDIWKTPDNRQGDEPLSMTLGLYQGDKLDAAAMLTHQRALNDAFLPQIAK
FT                   RIEDQLRTAQKDNLEYTYEALKSYLMLYQPEHFDAEALKAWITLDWARSLDRGIPEDQR
FT                   QALEDQLDVLIAQGPPRSPLKMDENLVRSVRAVLASYPLEQRVFSRLKRQRATKDIPAF
FT                   SIATAAGPSAPLVFERISGKPLTEGVPGMFTYDGYHKRFQNEVTVLTGLLAQEDPWVLG
FT                   QDRSAADRMRDVAALGALTDRVRRLYLAEYVKVWEALLADVRLIRASGLEKNIEAARIL
FT                   SGVGSPLANFLRAVVKETTLIPADQPKDVVSKATATVASTRKGLEDLFGGDPNKAVASG
FT                   KRIESIVDDRFEPLRRLVTAAGPNQPAPIDDALKLFNEVYVYLTAVDTAVKGRTSPPPG
FT                   DVAGKLKSDAGRLPEPVRTMVENLSQSGAAQAQVAERGNLSQDLRPVTDFCNRAIAGRY
FT                   PFVGSSKRDVLPEDFGQMFGAGGLMDEFFQKRLAALVDTSTKPWRYKPVAERGAVTTQA
FT                   LAQFERAARIKDIFFRGGGRGPSMRLDFKPVEMDAGITQFILDVDGQLVKYAHGPVVPM
FT                   AVQWPGPKGSYQVRIQVSPPSATGSSGAAVDGPWALFRALDDGQLEAGDAPEKFFITFQ
FT                   IGARKTRFEVTTNSVQHPIRLKELREFSCPEGL"
FT   sig_peptide     565903..565977
FT                   /locus_tag="Vapar_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.611 at
FT                   residue 25"
FT   gene            569499..570125
FT                   /locus_tag="Vapar_0517"
FT   CDS_pept        569499..570125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0517"
FT                   /product="type VI secretion-associated protein, BMA_A0400
FT                   family"
FT                   /note="TIGRFAM: type VI secretion-associated protein,
FT                   BMA_A0400 family; KEGG: azo:azo3889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17180"
FT                   /db_xref="InterPro:IPR017748"
FT                   /db_xref="InterPro:IPR038225"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK82"
FT                   /inference="protein motif:TFAM:TIGR03373"
FT                   /protein_id="ACS17180.1"
FT                   /translation="MSDDAAVFSALPGWFGKLPGMGDFAHRRLPESFRSVWDPWLQRGL
FT                   ARLRDRHADWTSHYLEAPVWCFALGPQVVGEGAWIGVLMPSVDGVGRYFPFTLAVGLDA
FT                   SAGGALQGDALQDALRWWARGTRAALEGLEGDLDALRFDAVLERVFAAAGDLEVREMAV
FT                   ESLALPGVGESLWLGDPGAGDGARMLVAGLPLDGRFEALFLGGGE"
FT   gene            570122..570748
FT                   /locus_tag="Vapar_0518"
FT   CDS_pept        570122..570748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pna:Pnap_1001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17181"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK83"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17181.1"
FT                   /translation="MTVVGRFPSGGRDVRPAADLLSFASPKESKQRKGDPTVCVPPLRY
FT                   GQPAVLDSGGGPQNSLRSNSCGPDPASICAPRRIQKGWERAAFASLGPNIQQPITTAQP
FT                   LRRCAPRWLGGRAKQRPVRFPIPSVCAEERRVSRIRARSCLSEASSARPRETRAPQVAR
FT                   SEAEGRRQWGRLFFAYFLLAKQKKVSPPPGGHPGSGKQTNKGASQ"
FT   gene            570745..572664
FT                   /locus_tag="Vapar_0519"
FT   CDS_pept        570745..572664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0519"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: tyrosine protein kinase; SMART:
FT                   serine/threonine protein kinase; tyrosine protein kinase;
FT                   KEGG: azo:azo3888 putative serine/threonine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17182"
FT                   /db_xref="GOA:C5CK84"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR025493"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK84"
FT                   /inference="protein motif:PFAM:PF07714"
FT                   /protein_id="ACS17182.1"
FT                   /translation="MTEAPNPNMPPEDDRTRVMSRPAQQPADSESDTSATVITSGSTSL
FT                   SNAPPAAAAAAETSEAGLLPVGSRLAEFEITRVVGQGGFGVVYEAWDHTLERVVAIKEY
FT                   LPTSLSTRQHDGTVVPLSERHRETFDLGMRSFINEARLLAQFDHPSLLKVYRFWQERGT
FT                   TYMVMPFYRGDTLRQALVSIPAGVDEAWLIRIMDGVTQALAVMHGANCYHRDIAPDNII
FT                   LLEGSGRPVVLDFGAARRVITDKTQAITVILKPGYAPIEQYAEMPDMSQGAWTDVYALA
FT                   AVMHVAVCGRAPPPSVARLLSDSYVPLAGNDILRQRYSLRLLQAIDAGLGVRPESRPQS
FT                   MAEFRAALDLEVGHSIAPPLRTTPGGPGARNNTGNADLPTTIGRGKAPPAPAPAPGVGE
FT                   KNSGKTVAAIASVAVLAAVAGGGWWWYQGRTSAGVEEGSGGKQVAVAPPPPPESRVVQA
FT                   PPPPPPPPPAPRMPLESLQSLAAGAAPGFDVTAVPKKAEVSIGKDKLAFEVRSKREGFV
FT                   YVFLLSSGGEMFLLFPNLLDKYNKITAGSPLSLPRASWPMDAGGPAGTNQFAVLVSERE
FT                   RDFSASGVQNDGVFPQFPLPVLAALEASRGAAGPSPLLGKPVCAPNTPCNDVYGVANFK
FT                   IVEK"
FT   gene            572719..574323
FT                   /locus_tag="Vapar_0520"
FT   CDS_pept        572719..574323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0520"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; MltA domain protein; KEGG:
FT                   dar:Daro_3704 MltA:3D"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17183"
FT                   /db_xref="GOA:C5CK85"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK85"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ACS17183.1"
FT                   /translation="MNTTLSPVLFISALRWAATAAAMLAAGCANTPPTASAGASDTAAS
FT                   AAAAGSTTATLPPPRPAGSSTAGQARTFSTQLATYTSVSFDAVPGWARDDFSESWPAFL
FT                   GSCKVLTGRGAEWKDVCARALRVDSKNNSAIRAFFEQEFSAYQIRDDDRKPDGVVTGYF
FT                   EPEIPGSRQYAAPFIYPVYGQPEDMLFADARKLPAGNGTVAAKVEGRNVVVQTGLSTRD
FT                   MGAPGLYALDLSAITRDTLDRKVRLRIEGKQLLPYYTREEIETKGAPNAKVLAFVSSAT
FT                   ALYEMQIQGSGRIKLANGDIIRVAYAEQNGQPFRPTLAQAANGKPRSPVKVRGSSIELQ
FT                   LDDGDEDDDVGGPATGTIRTRGFTLAQPTASGAVLVPGRRTAGPVVGSGIKDPSYVFFK
FT                   ESPSPSGGPVGAFGVPLSAGRSIAVDPRSTPLGYPVFVSTRAPGTGAPMQRLTIAQDTG
FT                   GAIRGAVRADYFFGNGQQAATNARRMKERGQLWILLPRGLAVATAAVSSAIRTRGGPAG
FT                   AGLPQCLVPTEGVCVDD"
FT   sig_peptide     572719..572832
FT                   /locus_tag="Vapar_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.646 at
FT                   residue 38"
FT   gene            574429..575178
FT                   /locus_tag="Vapar_0521"
FT   CDS_pept        574429..575178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bph:Bphy_5114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17184"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK86"
FT                   /inference="similar to AA sequence:KEGG:Bphy_5114"
FT                   /protein_id="ACS17184.1"
FT                   /translation="MQETLSSAESTELVRLWQRRQTLSPGDMGTMYRIVGDALVACNPP
FT                   ELQVLGEGRQELVAQFIYVKVLRLDADPDEADERAGHSAPSTAFALCAYFRRYLIDCTR
FT                   ASAFRRKLSIGEQVSEAQLEDALGAGEDLEGCLAEHGLSAGAVQLAARAFIAELPEPER
FT                   ILLCEGFGKEAEGGLSGIASRHAIASYHYRAGRLGLVHKREGLTADYAKTRLGGWIQQT
FT                   LGIAIEPGNMAAILQVFKILGAEASYA"
FT   gene            575207..576355
FT                   /locus_tag="Vapar_0522"
FT   CDS_pept        575207..576355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0522"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_2029 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17185"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK87"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17185.1"
FT                   /translation="MNTDLWPPLSVIRSAFQAAGAAPAGPGAPGQETAVAMPGAAQQGT
FT                   AAAPPRTVLDLVLPLTELARRREAVAQRAFSARWAPGRLVSVVHEGRLLGVLLDRCIHG
FT                   NLWQGWMAAGEADWAGPFDVLLEPGDEPFEPAFGLVQAWNMLTLEPSPQLCARVLGEVS
FT                   ATRLAAIRAVHDEWAAQAPLAIAPEPGRIALRTVGGVFSVLSGTPLAAQDPRADYQALY
FT                   RSAASQLGTALQPASSRASAPPSVPRARPQPRPEGGWWGSIRHWFGSGGWLRPAFAVLA
FT                   LFAVVQNTGLLGSRDAEQDDVRFRAVPAVPVATQANLVVRWKDGVRIDEAGRLLRSMPA
FT                   EVVGGPDANGVWRLRAADPVGGRAVLAASPLVESAGPVSGRP"
FT   gene            576526..578472
FT                   /locus_tag="Vapar_0523"
FT   CDS_pept        576526..578472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0523"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   KEGG: mlo:mlr3300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17186"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK88"
FT                   /inference="protein motif:PFAM:PF00656"
FT                   /protein_id="ACS17186.1"
FT                   /translation="MAWLLACSSFSFATQRALLVGVSELVNQPQALWLQAPRNDVMLMR
FT                   DALLKQGFAPSDITVLADGVGGAVLPESQAIHDALGRLLAQSRSGDFVLLYFSGHGTRL
FT                   RDSSKLYQEPDGLSENFLARDVRGTLGSDSALTGDLRDADFDAWIQALLARNVFVASIF
FT                   DTCSANSMTRSGTAESPLIADGPADDEVRWRGLRIGQLLGAPAPAARAPVARPVAAEPV
FT                   PRARYVALFASESHQITPELRLPRKSRNARPQGLLTWAVVEALSRRPATWRELFDGVLA
FT                   AYPPVIDELAQRFPTRELPSPVAEGNLDAPIFANRAQPVSTRPVWRAQRSGDALVLQAG
FT                   QLDGLVAQQPLRVLATMEDGTVRSAEGLLLQAYTDKARMAVPPALRELSGAALWNITPL
FT                   GEPASVALRVRAEQGLPPGLSLDYPASVVAVAAADGADVHWSASRLDVLSPALGAGARP
FT                   VPADAAAARRHLEMLARLKWLNQLYAIARDAQFEGFDALFEVWNGDRLVRSGPVRQAGA
FT                   GLLPLRAGERAVLNVRNATGRSVDLVVVGIDPQGGARQVYPGDPGETNRFKRGTRDAPA
FT                   VKRFELPWFNAEGGRLLVLAAPATPYSAPRLFGAGTADGVAQVRVRGALQQDSERQSFA
FT                   AMVHWAGEALSAR"
FT   gene            578507..579064
FT                   /locus_tag="Vapar_0524"
FT   CDS_pept        578507..579064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17187"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK89"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17187.1"
FT                   /translation="MSWTYDGKLDPDEALRLLDYLSGESGNDFAMMIESKGSPIEGESK
FT                   RTYEDGKQRMDIGGYSYKSDVVVPPGSTKGKLRNHAFIVIRDCDAATASIASLLKSQDS
FT                   DLKVTISVFKAGGDSSKDQQSHLEFVLEGARVNCHAIVTGGTPKRPCDLIFFDYTKLEI
FT                   RSAPQQQTGARGAVRTCTFAGN"
FT   gene            579066..579902
FT                   /locus_tag="Vapar_0525"
FT   CDS_pept        579066..579902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0525"
FT                   /product="virulence protein SciE type"
FT                   /note="PFAM: virulence protein SciE type; KEGG: azo:azo3899
FT                   putative cytoplasmic protein,SciE"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17188"
FT                   /db_xref="InterPro:IPR009211"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK90"
FT                   /inference="protein motif:PFAM:PF07024"
FT                   /protein_id="ACS17188.1"
FT                   /translation="MASSAELLKSADPVAALKALSDEVRAKPADSKHRVFMAQLLCVLG
FT                   QWERALNQLTVAAELDALAVPMKQVYGDAVRCEGLRAEVFAGTRTPMIFGQPDEWLALL
FT                   IESLLRQGRGESELAEDLRQRAFDGAPAIAGTIDGVPFEWLADADMRLGPVLEAFVNGK
FT                   YYWIPYARLAHIKIEPPEDLRDCVWMPAHLQFENGGETLALIPTRYEGTEQSEDGELRL
FT                   ARKTEWRELRPEVWAGRGQRVLGSDAGEYALMDVREILFTPTASAAAQDGPGDAGG"
FT   gene            579905..580420
FT                   /locus_tag="Vapar_0526"
FT   CDS_pept        579905..580420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0526"
FT                   /product="type VI secretion system lysozyme-related
FT                   protein"
FT                   /note="TIGRFAM: type VI secretion system lysozyme-related
FT                   protein; PFAM: GPW/gp25 family protein; KEGG: lch:Lcho_4087
FT                   type VI secretion system lysozyme-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17189"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR017737"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK91"
FT                   /inference="protein motif:TFAM:TIGR03357"
FT                   /protein_id="ACS17189.1"
FT                   /translation="MAELTAQERLQPSLLDRLVDDAPTEKRESDDKRTLTKQALRSAVL
FT                   RDLSWLFNATGFGLAMDDKQYPNAARSVINYGLPMLSGQFTSSVQRVSMEQALKNAILQ
FT                   FEPRILSRTLEVELVMEGSALDSHNSIGLQIRGMLWAQPVPLEFLMRSRVDLEEGRIEI
FT                   VDMAQNPR"
FT   gene            580428..582320
FT                   /locus_tag="Vapar_0527"
FT   CDS_pept        580428..582320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0527"
FT                   /product="type VI secretion protein, VC_A0110 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0110 family;
FT                   PFAM: protein of unknown function DUF879; KEGG: azo:azo3901
FT                   putative cytoplasmic protein, SciC"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17190"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK92"
FT                   /inference="protein motif:TFAM:TIGR03359"
FT                   /protein_id="ACS17190.1"
FT                   /translation="MDPRLLNLYEQELRYFRESSSEFARAFPKIAHRLGIEGQEVADPY
FT                   VERLIEATAFLSARVNLKLDAEYPRFTGHLLDIVYPNFLAPTPAMAVVSFSPDLDDANL
FT                   ATGPRLPRGAGLRARQAVGQNTHCEFRTSSALRIWPIEIQRAQYFTYAPDLPLATHPQS
FT                   RAIRGGLRITLHATAGLNFSQIQLDDLVLHLGGAEDVAWQLQECALGQPIGVMVRPLSP
FT                   TGALQGAAQSLPATAIQPVGFEDDEALLPVTATGFSGFRLLQEYFAFPQRFQFLRIAGL
FT                   QSVLAAMPVAEVELVLLFSRGDAALEKLVSADNVQLHCVPVVNLFNKRLDRVPLTEGVS
FT                   QFHLVPDRTRPQDFEVHTVTEVIGHGAPGADAAAAEQVFRPFYSAFHGTRHSHPAYFTT
FT                   TREPRMLSVRQRTEGHRSSHIGSEVYMQIVDPQQAPYAATLRQLAVAALCTNRDLPLLM
FT                   PLGRDNDFDCVDSFPVQRVRMVRGPSRPVSPVVSQGLGWRVVDHLALNYLSISDSTPEQ
FT                   GAAALRETLMLYATHADEMRQGQVRGLLSVKAKPVARRLPLKGPIAFGRGLEVTLEVDK
FT                   DAFHGHSVFLFGAVMARFLARHVEVNHFVETVLRVAGRGETMRWRPLCGTRQIL"
FT   gene            582296..583375
FT                   /locus_tag="Vapar_0528"
FT   CDS_pept        582296..583375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0528"
FT                   /product="type VI secretion protein, VC_A0111 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0111 family;
FT                   PFAM: protein of unknown function DUF1305; KEGG:
FT                   azo:azo3902 putative cytoplasmic protein, SciB"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17191"
FT                   /db_xref="InterPro:IPR010732"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK93"
FT                   /inference="protein motif:TFAM:TIGR03347"
FT                   /protein_id="ACS17191.1"
FT                   /translation="MRDPADSVAGRVDTALRAWSAEPWSFDYFAVLRRLESVAATTPRW
FT                   GRALLPSAEPVRVGQEPSLSFAPASFSRFEPASAHSPPRLRQHFFSYVGPNGPLPVHLS
FT                   DFIRERSLNHGDPTWLAFLDSFLHRFSLHFYRAWAQARPAVALDRPGEDRFRLQVGAFV
FT                   GIGTPGRIERDEVHDDARLHFSGWLARRVHNAESVEAVLCSYFGVPVKLERWVGHWMSL
FT                   PAGELTRLGQGESSRSMGMGAMLGTRAWDRQHRVRLHIGPLTLAQYRMFLPTGNAQPVL
FT                   QRWMQQLLGDELEWDAELVLETTQVPATRLGQAKGNAPRLGWVSWLGQRTRAKDAADVR
FT                   IGNRPMTARSAQATVGAAA"
FT   gene            583372..584706
FT                   /locus_tag="Vapar_0529"
FT   CDS_pept        583372..584706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0529"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; TPR
FT                   repeat-containing protein; Methyltransferase type 12;
FT                   SMART: Tetratricopeptide domain protein; KEGG:
FT                   lch:Lcho_4081 methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17192"
FT                   /db_xref="GOA:C5CK94"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK94"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACS17192.1"
FT                   /translation="MTTTPAQPDTTAHAAALAQAAALVKAQKLEAAGELLDRLLEAAPA
FT                   DPDALHYQGLLRHAQGRSNESIALIGRSLTLQPAQSGAWNNLGNLLVETGRIDDAMLAY
FT                   GNSVSFAKGGDEGADALSNIASLERRKGHWQAAERVSRQAIELRPEFSEAWYNLSIALM
FT                   EQGRIHESVIANSRAVLLQPRNLSARSQVIRALELLGEHDQALGMYREWLAEDPGNPVV
FT                   THLLAACEGQAPARASDGYVETVFDSYAGSFDASLEKLHYRAPELVAQAVQQMHGAPAA
FT                   SLAVVDAGCGTGLCAPLLRPWAAHLAGCDLSVGMLQRAEQRGGYDVLHKAELTHYLHTQ
FT                   PGRFDLVISADTLCYFGDLHEVLAAAARALRPAGGVVFTVEAMPGGQHDFRLEGSGRYR
FT                   HAAAHVEACLAAAGFGAVRIEPIVPRREAGQDVQGWLASARLSAH"
FT   gene            584776..587505
FT                   /locus_tag="Vapar_0530"
FT   CDS_pept        584776..587505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0530"
FT                   /product="type VI secretion ATPase, ClpV1 family"
FT                   /note="KEGG: azo:azo3903 putative ATP-dependent Clp
FT                   protease, ATP-binding subunit ClpB; TIGRFAM: type VI
FT                   secretion ATPase, ClpV1 family; PFAM: ATPase AAA-2 domain
FT                   protein; AAA ATPase central domain protein; Clp domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17193"
FT                   /db_xref="GOA:C5CK95"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK95"
FT                   /inference="protein motif:TFAM:TIGR03345"
FT                   /protein_id="ACS17193.1"
FT                   /translation="MSEISRTALFGKLNSLAYKAIEGATVFCKMRGNPYVELEHWFAQL
FT                   LQAQDSDLHRVIQHYGLDVSVIAKDMTAALDRLPRGATAISDFSPHIENAIERAWTYAT
FT                   LQFGEAQVRTGYILVGMLKTQSLRNPLFGLSKQFEKVKVEDLADNFAKICDASPESQMR
FT                   AQDGTGMGSGAPGEDSGAMAPAAMGKGDALKKFAVDLTEKAKKGEMDPITGRDEEIRQI
FT                   VDILMRRRQNNPLLTGEAGVGKTAVVEGFAQRLARGDVPPQLKDVKLLTLDIGLLQAGA
FT                   SMKGEFEQRLRQVIDEVQASPTPIILFIDEIHTLVGAGGAAGTGDAANLLKPALARGNL
FT                   RTIGATTWAEYKKYIEKDPALTRRFQVVQVPEPDEVKAILMLRGVASVLEKHHRVQLLD
FT                   EAIEAAVKLSHRYIPARQLPDKAVSLLDTACARVAVSQHATPPEVEDCMRRIEGLTVEQ
FT                   EIIGREEAIGIDVTKRAAQVSALLLESNGQLETLSARWKEEKGLVDRLLELRSKLRAGS
FT                   KPVDTASAEGDAKADVPPPQPSPGGGGSEDRAALLEELHALQAKIHAVQGESPLILPSV
FT                   DEQAVASVVADWTGIPVGRMVKNEVEAVLKLADTLNQRVIGQKHGLEMIARRIQTSRAR
FT                   LDNPQKPIGVFMLCGTSGVGKTETALALAEALYGGEQNIITINMSEFQEAHTVSTLKGA
FT                   PPGYVGYGEGGILTEAVRRRPYSVVLLDEVEKAHPDVHEIFFQVFDKGWMEDGEGRMID
FT                   FKNTIILLTTNAGSELVMSMCRDPELLPDSNALADALKAPLMKVFPPALLGRIVTIPYY
FT                   PLSPDMMKKIVRLQLGRIKKRVETNHGVPFEYSDAVVDQVVARCQDPESGGRVIDAILT
FT                   NTVLPTISVEYLQRLASGGEIRRVALDVKDADFTYAFD"
FT   gene            587530..590541
FT                   /locus_tag="Vapar_0531"
FT   CDS_pept        587530..590541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0531"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; Rhs element Vgr protein; PFAM: Rhs element Vgr
FT                   protein; KEGG: pae:PA0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17194"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK96"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ACS17194.1"
FT                   /translation="MADHEFRIETDSPAKDDLMFWRIVGHEALARPSAYELTVLSKNKA
FT                   LDAKDILGRAFDVVIQFQDKDGGVHERHCQGHAVRFVRAGHVGRHFEYRVTLRSWFWLL
FT                   TKRTNSRILQDKKVLEVLDAVFEDSPIKRFKKTKAGNVIGTHTPRRYCVQHQENDYQFL
FT                   SRLLEDEGIYYWFDAHDAPGTMHLSDASDLAHEKLPVEGTLRYMSSDASEARHNEISRW
FT                   VSARQFDTGKQASRDSDFKAIKKKLAATIDVKDDHELADFEEFEFPGGYFTGDDGENRT
FT                   KLRGDELNARRDRHWALTTWPDVAAGRSFKFEGDPDGTRNGDYVIAACTFMASHPGYES
FT                   VGAGTAVPQDLRTALAGVLRDDAVNADTLQVLEDLIASTPMLSTSQPGTSAFLITAIPM
FT                   ERAYRPPRLTPRVTMPGPQTAIVVGPAGDELHVDEHGRVKVHFHWDRYDESNEKSTCWV
FT                   RVSQPWSGKGWGGYFIPRIGQEVIVDFINGDPDRPIVVGRVYNDDQPIPYKSPTQSGFK
FT                   TRSTPGGGPANYNEIMFEDKKGEENINIHAERNMSRSVERDDSTTVGRDQSLVVERDQS
FT                   GIVQRDQSLAVTRNRSIHVKNNESHIVDVNQSLKVIGNQENKIVGNQVTTVDGVHQVEA
FT                   KGDIRTKTSGNRIDHTTGNETRKVSGNQTFTVSGNMGFKAATIVMETPHFEWKITGANS
FT                   AVMAVPSGPYSIMANKFSVLSNTDASILAVGKINQTSIENNVTVMGNNNSGYVGMASET
FT                   NMGLARSTFLGVAIDTFMGASISNTLALQFEAVAAAKLSIAVGPHIEMNSMKMYVPGGG
FT                   AAGGGATVLSEGAEFLAIVGVLEGVNVGFMSSVIGFAELSDQYSDAKAELAQAARDAAA
FT                   AGHPGLAARLNRLATDGAGTMDKDAPTSTQNTRGDAFSSDYDPFAVPDGGSSSDPSAGG
FT                   DGPTSSEPSSSEPSSSGPSSSEPTSSEPSSSEPSSSEPSSSEPSSSEPSSSGPSSSGPS
FT                   SSEPNSSEPNSSGF"
FT   gene            590557..593169
FT                   /locus_tag="Vapar_0532"
FT   CDS_pept        590557..593169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0532"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: scl:sce4933
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17195"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK97"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ACS17195.1"
FT                   /translation="MQIIKPQTLGLSFRPMAFRKRFGLSVSGYLHVPFAQPAQGCLWGE
FT                   QSMWNFLGAEMGVPLIDEGIAKLTPEFLVHGKAFAAPERPEAVAVRARLGGTSKTLLAF
FT                   GERYWDGDAPSAPAPMQPLALDWPNAYGGADFAENPSGRGRQATDRIRWLPALEYPGDR
FT                   LRRPDQAVAPAAFTPLDVLHPQRAALRGTYDANWLKEHAPGYAPDLNWQHFNMAPRDQW
FT                   IDAPLRGDETYELDHMHPERPHIEGRLPGLRVRAFAHYRMGEGDSAVFKLREIPMRLTT
FT                   VWFFPAAQRMVLVFHGLAETAEDDASDIHDLLGAVERIDPAEARTGAHYLSVLEKRTRG
FT                   RDAALEALNDGDLQPEGLDTADPSLEALQAVMKSQGLQEAAQYRRAQVEVQLARDFLQS
FT                   KGRDPDALGVRLAPREKPPTAAEMPAYLKKLREQMDAQRWAALDDAATHAETAIAFVKK
FT                   HKPAAEKLQHRGPPLFSAKQQLAELESAHRTAGKPFDRARIGTALWRMQNSLHVDYLQT
FT                   AHLQAAAVPLAGEAAAASRREVAFLLRSHLKRWPGIDLTGADLSNLDLRGVDFTGAWLE
FT                   SANLRNANLSGAKLQATVLAHADLRGAIAIGADFRAANLGGAECAQAVFDNANLQGAIL
FT                   GGTRLGLAQLRGARLAQAQWLDSVWAGADASAIVAPGMLFYKLDMSGARFVEAVLANCS
FT                   FIECNLQGADFSGADLGAASLVGCNAANARFVGARMAGAVVVKTTRLAGADFTGAMLVN
FT                   ANLGECDLSGARLARANLAGANFGMGLLSDSDLRLANAKGALFRKAGLQRARLAGANFH
FT                   DAILQSADLRGADLREANLFGADLSRVRLDGDAKFDGALLERARIHPRLTPEQHAGGR"
FT   gene            593171..594238
FT                   /locus_tag="Vapar_0533"
FT   CDS_pept        593171..594238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0533"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG: bbr:BB0796
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17196"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK98"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ACS17196.1"
FT                   /translation="MPSALLTPKLLALAVTLGEPMEDKDFGAGAYARAYLAGGVFSRCR
FT                   FDEADLRGADLRETLFDQCSFKGALMDGASLRRAVLNRCTFDHAALRSADLHGAVLTDC
FT                   ALPHAQLTQAVLSMATVSNCDFAHAALIGADLESSTFTRSNLVDVNADDSRWVHTSMLA
FT                   CGLAQMTWARARMQRVVFHEVDLQGKSFAGLSLDGCQFANCNLGGASFRNAPMRQCNFQ
FT                   GARLDRVDFSGAQGPMAVFCDARGEAVNFAGAGLRQALFTRSMLPGARFDGADLHQCHF
FT                   ADAKLAAASLRDCDLSYADFSRADLQKVDGRGATLLRTVLHRADTEDALWTDRPRALET
FT                   DAALARAELWRGPAP"
FT   gene            594306..594992
FT                   /locus_tag="Vapar_0534"
FT   CDS_pept        594306..594992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0534"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce8472 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17197"
FT                   /db_xref="InterPro:IPR021927"
FT                   /db_xref="UniProtKB/TrEMBL:C5CK99"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17197.1"
FT                   /translation="MTHATAAPLDASRPKAQPRTHKQAPPRRPSPIAAESCVGVVVAGA
FT                   ADELRVVAGDFGARARLAASCLLVPQPGDTVACFRVAPDEIWILAVLEREAGAPRVLRS
FT                   HGPTRFEVTDGALELHAPAIALSSRRFALDSARTDIASDDLEFAGGQVRIVAGAMRLIG
FT                   SALSTVFDRVTHFSKHHARTTEGLDRVHAAHLEMEAQQLVHISAEHALVNGSKLVKARG
FT                   GQIHFG"
FT   gene            595005..595400
FT                   /locus_tag="Vapar_0535"
FT   CDS_pept        595005..595400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0535"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spe:Spro_4188 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17198"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKA0"
FT                   /inference="similar to AA sequence:KEGG:Spro_4188"
FT                   /protein_id="ACS17198.1"
FT                   /translation="MFANCQMMGTDMGFPDVCLTPTPAGPVPIPYPNVAMGPMAVPNCP
FT                   NILIMGMPVHNLATTIPMTNGDNAGVNMGVASGTVMGPSRHLTGAFTVLYLGMPATRLT
FT                   SMSLQNSTNCPGVRIVPSQTMVLLLAP"
FT   gene            595488..597866
FT                   /locus_tag="Vapar_0536"
FT   CDS_pept        595488..597866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0536"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; Rhs element Vgr protein; PFAM: Rhs element Vgr
FT                   protein; Gp5 domain protein; KEGG: pfl:PFL_3004 rhs-family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17199"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR010609"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKA1"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ACS17199.1"
FT                   /translation="MADHEFRIESDSPANGELMFWRIVGHEALARSSSYELTVLSKNHA
FT                   LDAKDILGRAFDVVIQFQDKDGGMHERHCQGHAVRFERTGHVGRHFEYRIGLRSWFWLL
FT                   TKRINSRILQEKKVLEVLDAVLEDSPIRRFKKTRTSNVIGTHNPRRYCVQHQESDYQFL
FT                   SRLLEDEGIYYWFDAHDAPGTMHLSDASDIAHDKLPVEGTLRHMATDTTEARHNEISRW
FT                   VSARQFDTGTYASRDSDFKAIKKKLEAAGGQPDKHELAEFEAFEFAGGYFTGADADDKG
FT                   KLRGEEIAARRQRHWALTTWPDVAAGRSFTFEGDPDGTRDGDYVIAACIFAASHPGYES
FT                   IPHATPRMPIEQALREALDDDAVNAQARPALEALIADAPALRTDLQGTSAFLITAIPVD
FT                   VPFRPPRLTPRVVMPGPQSAIVVGPAGEEIHADDFGRVKVHFHWDRYDKSDEKSTCWVR
FT                   VSQPWAGKGWGGYFIPRIGQEVIVDFLNGDPDRPIIVGRVYNDDQPIPFGSHTQSGFRT
FT                   RSTPKGSASNCNEFRFEDKKGSEQVYLHAEKNQDIEVENNETHWVGHDRTKTIDHDETT
FT                   HVKHDRTETVDNNETITVHGQRTETVDKNETITIHQNRTETVDLNETISIGQNRSITVG
FT                   ASETATVALQRTHSVGINETITVGAAQEITVGAMQAVTVGASQTINVGANQSSSIGANR
FT                   SVDVGADLSTTVGKNESRSVGEGRTSSVGKDDALTVGKNLVIDAGDSISIKTGSASITM
FT                   KKDGTIVIKGKDITIDGSGKINVKASSDVVIKGSKILQN"
FT   gene            597893..598375
FT                   /locus_tag="Vapar_0537"
FT   CDS_pept        597893..598375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0537"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_2333 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17200"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKA2"
FT                   /inference="similar to AA sequence:KEGG:Pmen_2333"
FT                   /protein_id="ACS17200.1"
FT                   /translation="MSGRDLIEAQLQVATATMTWNAVATGELVAITDEGCTPLVVFPGQ
FT                   PGTAAVRARSVVDLHGVHIGRQVVLMFEAADPARPVVMGVLRSGDGSPLPAMPPQVDVE
FT                   ADGSRIAVSAKEQLVLRCGKASITLTKAGKVLIQGSYVSSRSTGVNRIKGGSVQLN"
FT   gene            598395..599516
FT                   /locus_tag="Vapar_0538"
FT   CDS_pept        598395..599516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_3002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17201"
FT                   /db_xref="InterPro:IPR018683"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKA3"
FT                   /inference="similar to AA sequence:KEGG:PFL_3002"
FT                   /protein_id="ACS17201.1"
FT                   /translation="MELINATRMVASYNMGLEPSGRESLVVVIKGTFRMPPPDAPAGHF
FT                   ALHEEQVPLVMADTFTGEPGLSAPVYEVDFAPHKQRCDILLLGSAYAPQGRPATRIEAG
FT                   VRAGNWSKSLAVVGPRHWECGPLGATASPPGVFVQQPLSYDVAFGGADLRHEDLSEHAA
FT                   FMPNPVGLGFHKHIRMDWVDGTPLPRTEEIGHAVHDPGGNYRPMAFGPVGRGWSTRSCF
FT                   AGTYDDEWLDKHFPFLPPDFDPQYFQAAPMDQQVPLELFQQAPIDVVLGNLTPEGITRF
FT                   TIPHLVAPVHVFPRHGAREDYTATLDTVVIEPDAQRFTLSWRVTRPLKKSLFEIAQVLV
FT                   GKKGREWWQQREQVPFPIPVVMIPMTSDEVETE"
FT   gene            599513..600544
FT                   /locus_tag="Vapar_0539"
FT   CDS_pept        599513..600544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0539"
FT                   /product="3-oxoacyl-(acyl carrier protein) synthase"
FT                   /note="KEGG: pae:PA0098 3-oxoacyl-(acyl carrier protein)
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17202"
FT                   /db_xref="GOA:C5CKA4"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKA4"
FT                   /inference="similar to AA sequence:KEGG:PA0098"
FT                   /protein_id="ACS17202.1"
FT                   /translation="MNSRAIAILRSGLVTPVGLDAESSCAAFRAKLTNPVETRFIDAGG
FT                   EWIMAHEVPLTPLCRGLPKLTRMAAMAIEEALGEVPRSQWGQLPLILCVAEPMRPGRTP
FT                   GLDDELFLQIQEELGTAFAPQSQIVAQGRVGVAVAFAQARALLIESGMPQVLVAATDSL
FT                   LSWSTLSHYEQSDRLLTARNSNGFMPGEAAGAMLLGEPEGNAGELLCTGVGFGLEEAHV
FT                   ESEVPLRAEGLSQAVKAALADAGCQMHQMDFRITDLSGEQYYFKEAALALSRTLHVRKK
FT                   EFDIWHPAECTGEIGAAVGLAIVSAAQAACEKQYAKGPNILAHLANDAGQRAALCLQYR
FT                   MPV"
FT   gene            600541..601710
FT                   /locus_tag="Vapar_0540"
FT   CDS_pept        600541..601710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pau:PA14_01200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17203"
FT                   /db_xref="InterPro:IPR025425"
FT                   /db_xref="InterPro:IPR028917"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKA5"
FT                   /inference="similar to AA sequence:KEGG:PA14_01200"
FT                   /protein_id="ACS17203.1"
FT                   /translation="MSNQVYANNMEISCKQAAGKSVCAFPDVCFTPPQTPATPPGVPIP
FT                   YPNTGMATDTSDGSTTVQISGQEVMLKNKSYFKKSTGDEAGCAPKKGVVTSKNMGKVYF
FT                   NAWSMDVKVEGENVVRNVDLTTHNHASSPGNAPPWPYIDEAAFAGTGPCKDVAKALTDK
FT                   CGPPPKPHQRKGWVKKMCDNPDSSCRDAMKCVLSPYAPSAKHSDGKNSQGNCCPGKTPH
FT                   HLIEVHCFTPIGGREGGHVMSEFKNASGEGYNQGAAPCMCVDGPREAKQHGEFHAVQQQ
FT                   IETAYNKRLFAPKTVMSDGKGISNWTYGEARDAGVAAQTIVMPECDPECTKAQLDDYHK
FT                   KPPPDGPGCDEHTPVRSDMGSDGRSTGTLNSGQEAKLGRRLLTVLAKGF"
FT   gene            601887..602639
FT                   /locus_tag="Vapar_0541"
FT   CDS_pept        601887..602639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0541"
FT                   /product="Beta-propeller repeat TECPR"
FT                   /note="SMART: Beta-propeller repeat TECPR; KEGG:
FT                   pau:PA14_01220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17204"
FT                   /db_xref="InterPro:IPR006624"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKA6"
FT                   /inference="protein motif:SMART:SM00706"
FT                   /protein_id="ACS17204.1"
FT                   /translation="MQWMPVRLAQLELPQPCVFALGGDGTVGLGYGGYSEESINTTDTG
FT                   PRGRGPLRVLRAIAGRLYAAGMGRQVYRRADAGVWEVLDPPKVPVPGEIDICGFTSIDG
FT                   VDEDEIWAVGYRGEIWRASGLQWSEMASPTNLTLHVVRTFKKHLVFAAGKMGLVLGFVD
FT                   DAWRVLAQIPGGEDIWDLEWFGGQLFAATSTRLFKLLPDATFEEVAVPGLTSFGYLHAN
FT                   DGVLWSFGTLQLAWTTDAIVWTAQTPTL"
FT   gene            602654..603916
FT                   /locus_tag="Vapar_0542"
FT   CDS_pept        602654..603916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0542"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pau:PA14_01230 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17205"
FT                   /db_xref="InterPro:IPR011959"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKA7"
FT                   /inference="similar to AA sequence:KEGG:PA14_01230"
FT                   /protein_id="ACS17205.1"
FT                   /translation="MFAAARPPIPFVVQQHLDNASVLRSTRAVLVRAPHVQLHRLSRLD
FT                   ERLAASLDGLAIAGDFARGLCMAALETPGRGAMFANAIGAIDTRDPALLERLLSLAEAV
FT                   PEARVGLVSAFGWVPAPELRGITRALLDSPHAFRRDIGLAACAMHHADPQTVLETAMAD
FT                   EEHSAQAFVVAGKLGRIDLLPGCLGGLMHEDAQHRFESARAALLLGDRQGALRMLVAFT
FT                   GEGGPCQAAAAMLALKVLPAEQAHALLQSIARKEDSVRILIRGIGAAGDPHYVPWLIAQ
FT                   MGDLKLARLAGESFSTITGLDLAAEDLELKPPENPVAGPNDNPDDEDVAMDEDEGLPWP
FT                   DAEKIDAWWQADGHRFPHGIRCFVGEPVTQGHCLAVLKTGFQRQRIAAAEHLSLMAPGR
FT                   PLFNAAAPAWRQQWLLSQMEA"
FT   gene            603919..604089
FT                   /locus_tag="Vapar_0543"
FT   CDS_pept        603919..604089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17206"
FT                   /db_xref="GOA:C5CKA8"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKA8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17206.1"
FT                   /translation="MQARYILAALAAAFLVAAAMRRVRNTRRRPDPATRTWLLIALIFT
FT                   AVAAWLQWHTS"
FT   sig_peptide     603919..603975
FT                   /locus_tag="Vapar_0543"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.973) with cleavage site probability 0.517 at
FT                   residue 19"
FT   gene            604203..605867
FT                   /locus_tag="Vapar_0544"
FT   CDS_pept        604203..605867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0544"
FT                   /product="FHA domain containing protein"
FT                   /note="KEGG: azo:azo3884 regulatory protein; TIGRFAM: type
FT                   VI secretion system FHA domain protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17207"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR017735"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKA9"
FT                   /inference="protein motif:TFAM:TIGR03354"
FT                   /protein_id="ACS17207.1"
FT                   /translation="MIHIAVITRQGAPAGQPIAADFGPNGGTIGRADTNTLVLDDPDRT
FT                   VSRVHAQVLCRDGQYFVIDRGSNPMQCNGVSLGSGKEAPLADGARLIVGSFELSVRMSA
FT                   AAPPALAIPNTVMSAPLGAAPAASTSDDPFADLLAGLGSPAPAAARASGARAAAPASAD
FT                   PLLFPDPMESGSRNAQAAQVDPFANLLGPTPSAAPAAGFGALDDFSDLGAPPAHGKAAG
FT                   IDELFGGMGGGGGIGGDPLALSPLADPLLQPNTASSADPLAALQSAAPPTPTPRSDHLP
FT                   IDQFGFTPPKAITPVPAAAPVEALPRFDDITGQPIRISGPEVASRPFEPLPPPPPPAPA
FT                   PAPAPVQRAPAAAPRTASDDELLAAFLRGLASTHQPPEMLTPGLMERIGSILRSATEGT
FT                   LQLLLTRQEFKREVRAEVTMIAAQANNPLKFSPTVEVALAHLLGPGVRGFMPPEAAMRD
FT                   AFNDLRAHQFGVMVGMRAALAHVIARFEPEELEKKISAKSALDTLFSANRKAKLWDQFV
FT                   ALYGGIASEAEDDFHSLFGKAFLEAYEEQMARLKSDT"
FT   gene            605923..606762
FT                   /locus_tag="Vapar_0545"
FT   CDS_pept        605923..606762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0545"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: dac:Daci_3842
FT                   protein serine/threonine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17208"
FT                   /db_xref="GOA:C5CKB0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKB0"
FT                   /inference="protein motif:PFAM:PF07228"
FT                   /protein_id="ACS17208.1"
FT                   /translation="MEIEIVTLSRQGGRNYNEDVHGHWHDERYVACLVADGAGGHGGGD
FT                   VAAATTRSSVLGGFSAAPGLDEFTLRTLVEQANRDVVARQSEGGKLAGMRSTVVFAAID
FT                   LESQALAWVHSGDSRAYLFRGGAIVARTTDHSLVQQMVAGGMLDEEGARLHPQRNMLLS
FT                   ALGSIEEAPDITVSDRMRLMPGDVLLLCSDGVWEPLGDECLVDTLHASRTPSQWTEQLD
FT                   AQIKAHAKPGYDNYTALTLWVIPDDVDDATRLMPAAEEETMPASIEEPSAAPGKLPD"
FT   gene            complement(606789..607328)
FT                   /locus_tag="Vapar_0546"
FT   CDS_pept        complement(606789..607328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0546"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hch:HCH_04102 negative regulator of
FT                   beta-lactamase expression"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17209"
FT                   /db_xref="GOA:C5CKB1"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17209.1"
FT                   /translation="MSSKWNDNDYHPYADAYYPLSKHYGGPGAAGLMKKTGIKGLIVHI
FT                   TDGNSLLSSLKTTWENRAASAHFAVDKGGTIAQYIPLSQRSWAVDGWKVDNLWYSVENV
FT                   AVHGETLTDMQIRMNGYLLAWLNGEYGVPLKLAATPDDSGLSYHAMFTKSKPCPGKPVI
FT                   AQLQDIVDAAVGLNGG"
FT   gene            complement(607356..607916)
FT                   /locus_tag="Vapar_0547"
FT   CDS_pept        complement(607356..607916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0547"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: similar to extensin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17210"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKB2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17210.1"
FT                   /translation="MATLNTTVLQWASAQLGKQIGAGECWDLANSALGQAGAGTSSDFG
FT                   PMGDDDDYIWGNEVALKDALPGDILQYRDYEMTTTTTTDVTFADGTGWTDSPYVTVGHP
FT                   HHTSILSKNPGTGAITVLEQNHQGNKEPVRASTIRWKGSSTSTTTRKPMKRQDNGKTES
FT                   ALVVVTVDVTVSGKLKAYRPKKP"
FT   gene            complement(607989..608471)
FT                   /locus_tag="Vapar_0548"
FT   CDS_pept        complement(607989..608471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0548"
FT                   /product="protein of unknown function DUF796"
FT                   /note="PFAM: protein of unknown function DUF796; KEGG:
FT                   lch:Lcho_4089 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17211"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKB3"
FT                   /inference="protein motif:PFAM:PF05638"
FT                   /protein_id="ACS17211.1"
FT                   /translation="MAADMFLKLEGVDGESKDDSHKKEIDVLSWSWGASQSGTGHVGGG
FT                   SGAGKVSVQDLSVTKYVDSSSHLLLLDCCNGQHIKKGTLVVRKAGATPLEYIKLTMEDI
FT                   IVSNIHTGGSGGEDRLTETITLNFSKFKYEYTPQKADGSGDGTKETGWDIAANKKV"
FT   gene            complement(608618..610111)
FT                   /locus_tag="Vapar_0549"
FT   CDS_pept        complement(608618..610111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0549"
FT                   /product="type VI secretion protein, EvpB/VC_A0108 family"
FT                   /note="TIGRFAM: type VI secretion protein, EvpB/VC_A0108
FT                   family; PFAM: protein of unknown function DUF877; KEGG:
FT                   azo:azo3896 putative cytoplasmic protein, SciI"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17212"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKB4"
FT                   /inference="protein motif:TFAM:TIGR03355"
FT                   /protein_id="ACS17212.1"
FT                   /translation="MAEALEQSALKDVAYAGSDFSSLLQKEFKPRSDEAKSAVEAAVLT
FT                   LAQQALSNSTVIGKDVTKSIQSMIAAIDAKLTDQVNKIIHHPDYQKLESAWRGLHYMVN
FT                   NTETDEHLKIRVMDISKTDLAKSLKKFKGAAWDQSPMFKKIYEQEYGQFGGEPFGALVG
FT                   DYHFDQSPPDIELLGEMSKIAASAHAPFITGASPNLMQMESWQELANPRDLTKIFLTPE
FT                   YAGWRSLRDSDDAKYLGLCMPRFLARTPYGANTNPVEEFDFEEDTVGADHSKYAWANAA
FT                   YAMATNINRSYKLYGWGSRIRGIESGGAVENLPLHTFPSDDGGVDQKCPTEIAISDRRE
FT                   AELSKAGLLSLIHRKNSDFAAFIGAQSLHKPAEYDDPDATANANLAARLPYLFACNRFA
FT                   HYLKCIVRDKVGSFKERDDMQRWLNKWIMNYVDGDPVNSSEETKARKPLAAAEVVVEEV
FT                   EGNPGYYTSKFFLRPHYQLEGLTVSLRLVSKLPSAKGGK"
FT   gene            complement(610153..610671)
FT                   /locus_tag="Vapar_0550"
FT   CDS_pept        complement(610153..610671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0550"
FT                   /product="type VI secretion protein, VC_A0107 family"
FT                   /note="TIGRFAM: type VI secretion protein, VC_A0107 family;
FT                   PFAM: conserved hypothetical protein; KEGG: azo:azo3895
FT                   putative cytoplasmic protein,SciH"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17213"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKB5"
FT                   /inference="protein motif:TFAM:TIGR03358"
FT                   /protein_id="ACS17213.1"
FT                   /translation="MAKSSQKFIARNRAPRVQIEYDVELYGAEKKIQLPFVMGVLADLS
FT                   GKPADPLAPVADRKFLEFDVDNFDSRMKAMKPRAAFAVENSLTGEGELKVELTFENMED
FT                   FSPAAVARKVGALDKLLEARTQLSNLVTYMDGKNGAEELLAKVLEDPALLQSLAATAKP
FT                   DDEAAKPAA"
FT   gene            complement(610742..611773)
FT                   /locus_tag="Vapar_0551"
FT   CDS_pept        complement(610742..611773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0551"
FT                   /product="type VI secretion-associated protein, ImpA
FT                   family"
FT                   /note="TIGRFAM: type VI secretion-associated protein, ImpA
FT                   family; PFAM: ImpA domain protein; KEGG: lch:Lcho_4092 ImpA
FT                   family type VI secretion-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17214"
FT                   /db_xref="InterPro:IPR010657"
FT                   /db_xref="InterPro:IPR017740"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKB6"
FT                   /inference="protein motif:TFAM:TIGR03363"
FT                   /protein_id="ACS17214.1"
FT                   /translation="MLTTELVEALLTPIGEASPCGDDLEYDAAFTALTTAAQGKPEQQF
FT                   GDTVIPAVEPEWREVAEQSDAILRRSKDVRAAVLLLRASTRLQGLAGFVAGLELLTRLL
FT                   DNFWDGIHPKLDAEDDNDPTMRLNALAPLGDETMVLRDLYDAQVGVAPGVGAIRVRDIA
FT                   VANNALNAVGGEATYSPAQIQGGLEALHAERPELIQAAIGVPGGVEKLQALLVERTGRS
FT                   DAIDLSPLRAIGRMLQKACSAAIGAPEEAGTAEEAQGDAPQAGGAPRPAAMRGEIQSRQ
FT                   DALQMLDRVIRFLEQTEPGNPAPLLIERAKKLIGVSFLEIMANLAPGALDTIETVTGKR
FT                   PSE"
FT   gene            611845..612360
FT                   /locus_tag="Vapar_0552"
FT   CDS_pept        611845..612360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0552"
FT                   /product="type VI secretion lipoprotein, VC_A0113 family"
FT                   /note="TIGRFAM: type VI secretion lipoprotein, VC_A0113
FT                   family; KEGG: pae:PA0080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17215"
FT                   /db_xref="InterPro:IPR017734"
FT                   /db_xref="InterPro:IPR038706"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKB7"
FT                   /inference="protein motif:TFAM:TIGR03352"
FT                   /protein_id="ACS17215.1"
FT                   /translation="MRTLGTHHSSYGRSFAAVSRRVALASGLALTGALIAGCASKPVVT
FT                   PVSITLAAGADANPDARGRASPLTVRIYALKSPGPFEGADFFSLFEKDQATLGAELVQR
FT                   EEMLLRPGESRKLDLTLPADAKAIGVMAAFRDLDRARWREVRAVEPGKPQTLTVTFGAR
FT                   QIRIDSSK"
FT   gene            complement(612383..613513)
FT                   /locus_tag="Vapar_0553"
FT   CDS_pept        complement(612383..613513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0553"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_3846 type VI secretion protein IcmF"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17216"
FT                   /db_xref="InterPro:IPR025743"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKB8"
FT                   /inference="protein motif:COG:COG3523"
FT                   /protein_id="ACS17216.1"
FT                   /translation="MPAALLPAHFFWLLLALCLAGFALLYAAVHDAGRGARRRALRRRI
FT                   AALGPPAAEADEAAIESMREAMRKAMSHARQLLRQPSCQQAAPVPWFLFLGDAAANLPG
FT                   LLAAAHAEHLAPSGSEPFGEPYWRWWLTGSMTAIELHPSAVSDVAAAPHTRALWLQALL
FT                   ALAERRDRVPINGVVACVAASELLHPSSAGMKPLAGRMRRLLDEAADTLRLQLPVYLVV
FT                   TGLEQLAGYATLRGALPPEVLAQVIGHRLAGPAAHGETAAERLDALFDPMARQLHALRM
FT                   ALLREQPGASGRLAIHEFIEALRALQPALREVAEALFESHGRGSRGPRWRGLYVTAAAS
FT                   GAAGGAFVTDLFERFLPADQPLARPGRAPNASAAKA"
FT   sig_peptide     complement(613430..613513)
FT                   /locus_tag="Vapar_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.667 at
FT                   residue 28"
FT   gene            complement(613524..614849)
FT                   /locus_tag="Vapar_0554"
FT   CDS_pept        complement(613524..614849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0554"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:ebA1686 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17217"
FT                   /db_xref="InterPro:IPR017732"
FT                   /db_xref="InterPro:IPR038522"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS17217.1"
FT                   /translation="MLRLLDCFSAFVSFGLALDASIAAGRAAPPSHAAAQQQARRLLDA
FT                   ARACASGQPAAQVESAVFAMVAWIDEILARHPGAAAGAAPLQVQLFNSNNAHSEFFHHL
FT                   SALGAEDDELREVYWHALVHGFKGQYYFESDDRGELGKLKELHGHQLRQRPLALGSLVQ
FT                   DRITPQPYGVADPPGPHDLHRRDRSLLRALGALALLLPLLYLLWWQWPAGLHAGEPGPA
FT                   QRIEQHLQGYACADLSASADRGGKLHVSGFVSLPADLERVEREVAGLLPDGGSPTFDVR
FT                   LRVWPHCEVFAILKPYQLRNREKALGLDVTAVTARNGRLREGDDVRMQVAAPRHDSYLW
FT                   VDYYTADGSVMHLNTGQPMRLRAGEKLELGRDIPASWLVGPPFGTVLVTALSSPTPLDG
FT                   AADRPPYELASAYLLRLREVLAANKGNERLLADFEFLETTAR"
FT   sig_peptide     complement(614748..614849)
FT                   /locus_tag="Vapar_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.826 at
FT                   residue 34"
FT   gene            615112..615795
FT                   /locus_tag="Vapar_0555"
FT   CDS_pept        615112..615795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0555"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; SMART: regulatory protein LuxR; response
FT                   regulator receiver; KEGG: tbd:Tbd_2570 two component LuxR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17218"
FT                   /db_xref="GOA:C5CKC0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKC0"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACS17218.1"
FT                   /translation="MKILIADDHRLVIEAVKAKLSELGPGIEFVLAMSVDELLAGATDE
FT                   LDLALIDLNMPGADGQAHIDEIRRRHPAVPVIVLSGYEDPAIMRSALERGVLGFIPKAY
FT                   SPEVMLSAVRLVLAGGVYVPPMMLTALPPGIVAGVAPTQNGDARSAGASSQTLEHLRSV
FT                   LTERQVEVLQLLSQGKPNKLIGRSLGISEGTVKIHLAAIFRALNVRNRTEAVVAAQALT
FT                   EAQQA"
FT   gene            complement(615810..617141)
FT                   /locus_tag="Vapar_0556"
FT   CDS_pept        complement(615810..617141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0556"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   mpt:Mpe_A3472 putative flavoprotein involved in K+
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17219"
FT                   /db_xref="InterPro:IPR024000"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKC1"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACS17219.1"
FT                   /translation="MSYPFGGRSHYSVIVVGGGQAGLSLSHCLQQRGIDHLVIEKRSLV
FT                   HSWRTQRWDSFCLVTPNWQCQLPGWAYRGGDPHGFMVKDQINEWLAGFVAQVKAPAIEG
FT                   VTVERVARVPGTGERDRFMVQTDAGLYTADQVVVASGGYHRPIVPRLAEKLPPHVVQYH
FT                   SAQYRNPAQLPEGAVLVVGCGQSGSQIAEDLHLAGRKVYLATGDAPRCARFYRGREVVD
FT                   WLADMKYYDMPVTEHPLREGVRDNTNHYVTGRDGGRDIDLRRFALEGMELYGLLTGLGG
FT                   DGTLEFQPNLREHLDSADATYNRINASIDKFIASRGIEAPPPSVYTPVWEPPEERTRLS
FT                   LAEAGIASVLWCIGFSPDFDWVDAPVFNGRGAPVHQRGVTGVPGLYFLGLPWLHTWGSG
FT                   RFSGVARDAEFLAEAIEERKKAAAAGRADVQEEEPAGTGLRAAA"
FT   gene            complement(617178..617462)
FT                   /locus_tag="Vapar_0557"
FT   CDS_pept        complement(617178..617462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0557"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17220"
FT                   /db_xref="InterPro:IPR023846"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKC2"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A1413"
FT                   /protein_id="ACS17220.1"
FT                   /translation="MPVMHFQVRWPDASETRCYSPSSVVQDFFAPGERYALEDFLQRSR
FT                   EALGIASERVRAKYGFACSQAMDQLAEIERIASRFTGADDAQVTVVAFD"
FT   gene            complement(617453..618451)
FT                   /locus_tag="Vapar_0558"
FT   CDS_pept        complement(617453..618451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0558"
FT                   /product="AIR synthase related protein"
FT                   /note="PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: mpt:Mpe_A3475
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17221"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011413"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR024030"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKC3"
FT                   /inference="protein motif:PFAM:PF00586"
FT                   /protein_id="ACS17221.1"
FT                   /translation="MTDVRAIAEALRATRGFAHKRDISDVVSALGRSLPGGHAALAQAV
FT                   PIGDDCAAIPDGHGGYLLFAIEGMVEDFIVRMPWFAGYCGVMVNVSDIYAMGGRPTAVV
FT                   DALWSTGMHPADEVLRGMAEASVRYGVPVVGGHSNNRSERPQLAVAILGHARKLLTSFD
FT                   ARPGDLLVMAADLRGAYEEPFPYWNASTTAPAARLRADLELLPSIAEEGLCRAAKDISM
FT                   AGAVGTAMMLLECSGVGARIDLDALPRPGGVPLLRWLSSFPSYGFVLSVAPSQVAPVLG
FT                   RFAARDIACAVVGEVDATRQVRLQAGGDEALLWDFGRDAFIQPPQEALACP"
FT   gene            complement(618448..619008)
FT                   /locus_tag="Vapar_0559"
FT   CDS_pept        complement(618448..619008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0559"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bph:Bphy_4563 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17222"
FT                   /db_xref="GOA:C5CKC4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024035"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKC4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS17222.1"
FT                   /translation="MLCIDDLSELDPHYAPVEYLVREAAQQWERDEAMALRRAVFCIEQ
FT                   GIFARDDRDAIDSHARLLVAMSCNGGMPEQVVGTVRIHRGEAPGEWWGSRLAVHPAFRS
FT                   QGHLGATLIRLAVSRANALGCDAFFAQVQMQNVPLFQKLGWQLLDESAIHGRPHARMQA
FT                   GLAFYPPCHDPVSGFVTRAKGLS"
FT   gene            complement(619011..620093)
FT                   /locus_tag="Vapar_0560"
FT   CDS_pept        complement(619011..620093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0560"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: mpt:Mpe_A3477 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17223"
FT                   /db_xref="GOA:C5CKC5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016779"
FT                   /db_xref="InterPro:IPR034405"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKC5"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACS17223.1"
FT                   /translation="MTELQSFGLRLVDPSAGVASRRGGAGPSDHKAVTVDGHTIMVPVH
FT                   TSSAWHSPFTAEAPDARGVSRVMRGSIPIASISFPKQPRFYAMQTFDGVPYSHIATLHG
FT                   SDVLATTVLQSCIRYESRKKSCKFCAIGQSLAAGRTIARKTPEQLAEVARAAVLLDGVK
FT                   HMVMTTGTPNATDRGAAILCESAFAIKAAVDLPIQGQCEPPDDDQWFHRMKAAGIDTLG
FT                   MHLEVVTPEVRERIMPGKASVPVSRYMSAFEAAVRVFGRGQVSTYILAGLGDTREAILD
FT                   TCDQLLARGVYPFVVPFVPISGTPLEDHPAPSPEFMKSLLAPLGERVVAAGLRSADIKA
FT                   GCGKCGACSSLSIYEKESES"
FT   gene            complement(620056..621108)
FT                   /locus_tag="Vapar_0561"
FT   CDS_pept        complement(620056..621108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0561"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: pna:Pnap_2104 nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17224"
FT                   /db_xref="GOA:C5CKC6"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR023919"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKC6"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACS17224.1"
FT                   /translation="MASPPRIVRAAAIQIAPDFDRPDGTLERVCSAIDEAAAKGVQLAV
FT                   FPETFVPYYPYFSFVLPPVLQGAPHLRLAERAVVVPGPVTQAVAERARHHGMVVVLGVN
FT                   ERDHGSLYNTQLVFDADGTLVLKRRKITPTYHERMVWGQGDGAGLKVVDTAVGRVGALA
FT                   CWEHYNPLARYALMAQHEEIHCAQFPGSLVGPIFAEQMEVTIRHHALESGCFVVNATGW
FT                   LSDEQIRSVTPDANLQKALRGGCHTAIVSPEGKHLAPPLIEGEGMVVADLDMALIAKRK
FT                   RMMDSVGHYARPELLSLAINDRPAQTTVPMHPTQPLAQRSPDHDHHHHDDPAGQPAADD
FT                   RAPVLRVAAG"
FT   gene            complement(621124..621606)
FT                   /locus_tag="Vapar_0562"
FT   CDS_pept        complement(621124..621606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A3479 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Vapar_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACS17225"
FT                   /db_xref="InterPro:IPR023847"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C5CKC7"
FT                   /inference="similar to AA sequence:KEGG:Mpe_A3479"
FT                   /protein_id="ACS17225.1"
FT                   /translation="MPKVTRPRNEKGEFLVDYEEKVFEDVKAEPGEKALVTFHTVAFEG
FT                   SIGFVNLLQATRLRRKGYETSVLLYGPGVTLGVQRGFPTLGDEAFPGHQNFNKQIGKFM
FT                   EEGGKVYACRFALQALYGHGEGALIEGITPINPLDVLDLVLLHKKAGAVILDTWTL"
FT   gene            621957..623354
FT                   /locus_tag="Vapar_0563"
FT   CDS_pept        621957..623354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Vapar_0563"
FT                   /product="transcriptional regulator, GntR family with
FT