(data stored in ACNUC7421 zone)

EMBL: CP001640

ID   CP001640; SV 1; circular; genomic DNA; STD; PRO; 10287 BP.
XX
AC   CP001640; ABLJ01000000-ABLJ01000076;
XX
PR   Project:PRJNA20805;
XX
DT   12-JUN-2009 (Rel. 101, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 2)
XX
DE   Geobacillus sp. WCH70 plasmid pWCH7002, complete sequence.
XX
KW   .
XX
OS   Geobacillus sp. WCH70
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Geobacillus;
OC   unclassified Geobacillus.
OG   Plasmid pWCH7002
XX
RN   [1]
RP   1-10287
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Brumm P., Mead D.A., Richardson P.;
RT   "Complete sequence of plasmid 2 of Geopacillus sp. WCH70";
RL   Unpublished.
XX
RN   [2]
RP   1-10287
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Brumm P., Mead D.A., Richardson P.;
RT   ;
RL   Submitted (05-JUN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 739f36e389add6bbac466aa8ec3e5b14.
DR   BioSample; SAMN00000635.
DR   EuropePMC; PMC4847372; 27123157.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082513
CC   Source DNA and bacteria available from David A. Mead
CC   (dmead@lucigen.com)
CC   Contacts: David A. Mead (dmead@lucigen.com)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Geobacillus sp. WCH70
CC   GOLD Stamp ID         :: Gi02009
CC   Oxygen Requirement    :: Facultative
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Sporulating
CC   Temperature Range     :: Thermophile
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Energy Source         :: Chemoorganotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..10287
FT                   /organism="Geobacillus sp. WCH70"
FT                   /plasmid="pWCH7002"
FT                   /strain="WCH70"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:471223"
FT   gene            62..214
FT                   /locus_tag="GWCH70_3469"
FT   CDS_pept        62..214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GWCH70_3469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GWCH70_3469"
FT                   /db_xref="EnsemblGenomes-Tr:ACS26102"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS26102.1"
FT                   /translation="MQRGNWNTGQGGKEDISEGGDGTNTTQSNCVVLRIRGKTLFLQRF
FT                   SFFLK"
FT   gene            276..824
FT                   /locus_tag="GWCH70_3470"
FT   CDS_pept        276..824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GWCH70_3470"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   bay:RBAM_018520 phage integrase family site specific
FT                   recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:GWCH70_3470"
FT                   /db_xref="EnsemblGenomes-Tr:ACS26103"
FT                   /db_xref="GOA:C5DB39"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB39"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACS26103.1"
FT                   /translation="MNRTQPIKDLAVIEKLGRYLKKTNTRDYMLFRCMLYFALRTQDIL
FT                   SLKVKDVRGKYQIYFKEQKTGKTKIIEIHPDLRPELEEYTQNMADDDWLFPSRIKGRPL
FT                   SREQAFRRLQAAGKKCGLPSLSGHVLRKTFCYHAYKNGVPLHILSELLNHSSEAVTRRY
FT                   IGLQQEDIKRAYFSVQFNC"
FT   gene            858..2204
FT                   /locus_tag="GWCH70_3471"
FT   CDS_pept        858..2204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GWCH70_3471"
FT                   /product="replication protein"
FT                   /note="KEGG: gka:GKP04 replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:GWCH70_3471"
FT                   /db_xref="EnsemblGenomes-Tr:ACS26104"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB40"
FT                   /inference="similar to AA sequence:KEGG:GKP04"
FT                   /protein_id="ACS26104.1"
FT                   /translation="MALQEYKYSQNPCEFRFEMDLYTYLKKLYKTKLKNAYFFICENEN
FT                   KNWVQKTYKSTEIDKAFADIVHSNAIDVYGSTCLHSSAKRVTENVIQIPALLVDLDYYK
FT                   TPYRDLTPKELVKKLEEVYFKPQKIPYPNAIISSGNGVYLIWFLKFTPGTDGTLLKRRV
FT                   IVKILYEMLKEFGADAKALDAAHVFRLPNTYNSKVTDRHKREVKAFVNELDDYTLSKLS
FT                   KKLPSLWEVWKKKHGIRTEQEKRRKGKIISVPQFKTRTLAYDHIKSILQLIELRKGECT
FT                   GYREMMLFFLRDRYHTMHAKRFYQQDETLFAESYAFIKEVNQKFTKPLSDKEIRTNTLN
FT                   KTKLYKFKTKTIIEWFDITLEEQIQLKVKTREAKNEKSKRQMRELRRKRGALTRREYLK
FT                   QQHSITDDKLFKLKELLERYPNAKRKELAEMLGVSVYRVDQLKRELKSL"
FT   gene            2912..4024
FT                   /locus_tag="GWCH70_3472"
FT   CDS_pept        2912..4024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GWCH70_3472"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: bca:BCE_4605
FT                   DNA-cytosine methyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:GWCH70_3472"
FT                   /db_xref="EnsemblGenomes-Tr:ACS26105"
FT                   /db_xref="GOA:C5DB32"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB32"
FT                   /inference="protein motif:TFAM:TIGR00675"
FT                   /protein_id="ACS26105.1"
FT                   /translation="MANAISFFAGAGGLDLGIKRAGFNILLSVEIEETYCQTLRQNFEG
FT                   LNVVCGDIMEYSRERVYQEAGLAEHEEVDLMIGGSPCQSFSTAGKRQAFADPRGQAMLK
FT                   YADLVNEVRPRFFLLENVKGLLSAALKHRPLNQRGPGHPPLTEEEQPGSALEYLLERFG
FT                   DYDVKIKLINAADYGVPQKRERVFIIGVRNDLNIQYEFPEPTHNEDGSDGKLPWVTVGE
FT                   VLENLQVEEHHFIPYSKERLRFMKLIPKGGGNWRDLRAYGEEVVREAMGGAYYSGGGKV
FT                   GFFRRIDSNKPSPTLLTSPAQKSTNLGHPFEDRPLSIEEYLAIQGFPPGFRVAGTLMQQ
FT                   YTQIGNAVPVPLAEILGASILERLRTLQTV"
FT   gene            4105..4911
FT                   /locus_tag="GWCH70_3473"
FT   CDS_pept        4105..4911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GWCH70_3473"
FT                   /product="type II restriction endonuclease, putative"
FT                   /note="KEGG: bca:BCE_4604 type II restriction endonuclease,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:GWCH70_3473"
FT                   /db_xref="EnsemblGenomes-Tr:ACS26106"
FT                   /db_xref="GOA:C5DB33"
FT                   /db_xref="InterPro:IPR019045"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB33"
FT                   /inference="similar to AA sequence:KEGG:BCE_4604"
FT                   /protein_id="ACS26106.1"
FT                   /translation="MDEKTKERVRQHVKAVMERLIAKRTVEEPFSAKEIEEKNPFGYLL
FT                   VPIEVWKGSKMERSFVTTLGQGIFEQLGKIIAEGTGAFAANQYDKTLTINTFRTEKIDS
FT                   IIKKQRSKPKKGEKRVPPDLSKELDDIARLENEKYEIITVKSDLYIRRPDGKEEYYSLK
FT                   TVKPNLDQTAEAKKNLLLLRTGDPNCEAYFALPYNPAGEGNPYSKAGHSIPNRLFNMDD
FT                   ERFVLIGSALWNKIGNDENTYEELLEIFREVGKESAERIRKEYFGL"
FT   gene            5834..6202
FT                   /locus_tag="GWCH70_3474"
FT   CDS_pept        5834..6202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GWCH70_3474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GWCH70_3474"
FT                   /db_xref="EnsemblGenomes-Tr:ACS26107"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS26107.1"
FT                   /translation="MYFVNAEHKRNYDYLMGLYRLEPGQNVEYEASIYIAAYPSVFACF
FT                   GKTISTEFGPLAYLSDEELAEEFGHNFGALTGTTRRMVACGMSLYNGLEVSLSDVFSSL
FT                   GEEEFNVLIQAIKIRAKR"
FT   gene            7609..8322
FT                   /locus_tag="GWCH70_3475"
FT   CDS_pept        7609..8322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GWCH70_3475"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GWCH70_3475"
FT                   /db_xref="EnsemblGenomes-Tr:ACS26108"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS26108.1"
FT                   /translation="MCTKYLCKRWQGLLEAIINFAGQGYVYYHVTYLPAKKLNKADKID
FT                   QKILQKYNLINDTKDKRYHRKKRGLANFRYLRWEHIIVILHTEGTIIQRGQEEKHLTRF
FT                   KLEQAKKHAVTYDDSFSDIRVKPMVLAISEQLELEVRYLPKKNVGQKLTVRLTKKMFRD
FT                   KKAELAALAEKRAKDKIVYVFNALNNLPAWRGIIIQKRQLYRFVMTQARKHNFTFQKGE
FT                   LMVGDYRPKEKDIFV"
FT   gene            9118..9528
FT                   /locus_tag="GWCH70_3476"
FT   CDS_pept        9118..9528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GWCH70_3476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:GWCH70_3476"
FT                   /db_xref="EnsemblGenomes-Tr:ACS26109"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS26109.1"
FT                   /translation="MIRMEEISISIPKEVLEKVEKSMGGWDDRNRVITNHLVYFYRLLE
FT                   TEKRTLTKIFSEEELLCIYAAFNGTIVDFRMTPGMFKATVRDALKYGELDFLISEHRID
FT                   AGAFLQKIDGLSDLQTFVLLVDAQEYWAEKSR"
FT   gene            9673..10224
FT                   /locus_tag="GWCH70_3477"
FT   CDS_pept        9673..10224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="GWCH70_3477"
FT                   /product="putative DNA binding protein"
FT                   /note="KEGG: gtn:GTNG_3462 putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:GWCH70_3477"
FT                   /db_xref="EnsemblGenomes-Tr:ACS26110"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C5DB37"
FT                   /inference="similar to AA sequence:KEGG:GTNG_3462"
FT                   /protein_id="ACS26110.1"
FT                   /translation="MNGNIGEFGALAKEVSLFLDINPNTLRRWSIELEKCGYVFQRDEK
FT                   DRRIYYKRDILALTEFKKFLEKTQSLENAAKAVVESVKDRENAEKTLSVIVQNSDKITF
FT                   TKEELEAYTKRIVEETAQKTAEQILHKFNQTLEQRDRQLVQSLQQTMEQRRLELAAATE
FT                   EKQSFWSRLFGKKTKALDKL"
XX
SQ   Sequence 10287 BP; 3236 A; 1670 C; 2399 G; 2982 T; 0 other;
     gtcagggtgt tttttccctg gcgggttcgt ccttcggggt gccagggggc aggggttccc        60
     aatgcaaaga ggaaattgga ataccggaca agggggaaaa gaggatattt cggaaggagg       120
     agacgggacc aatacaacac aatctaattg tgttgtgtta cgtattcgcg gaaaaacgtt       180
     gtttttacag cgtttttcat tttttttaaa ataaaaaaag gttaatgcaa cattttatag       240
     aatagagtga tagaatcagg atggaggtgt taggtttgaa tagaacacaa ccaataaaag       300
     atttggctgt cattgaaaaa ctagggagat acctaaaaaa gacaaatacg cgtgattata       360
     tgttgttccg ttgtatgttg tattttgcat tgcggacaca ggatatatta tcacttaaag       420
     taaaagatgt tcgggggaaa taccaaattt actttaagga acaaaaaaca gggaaaacaa       480
     aaatcatcga aattcaccca gatttgcggc cggaattgga ggaatacacg caaaacatgg       540
     cggatgatga ttggttgttt ccttctcgca tcaaagggcg tccgttgtcg cgagaacaag       600
     catttagacg gttacaggct gcaggaaaaa aatgtgggct tccgtctttg tctgggcacg       660
     ttttgagaaa aaccttttgc tatcatgcct ataaaaatgg cgttccattg catatcctgt       720
     cggaattact aaaccactcg tctgaggcgg ttacgcgccg ttatattggt ttgcaacaag       780
     aagatattaa aagggcttat ttttctgttc aattcaactg ttaaaactct agtaatcttt       840
     ttataggggg tgaaaaagtg gcactacaag aatataaata cagtcaaaat ccgtgcgaat       900
     ttcgctttga aatggatttg tatacctatc tcaaaaagtt atataaaaca aaattaaaaa       960
     acgcttattt tttcatttgc gaaaatgaaa ataaaaattg ggtgcaaaaa acttataaat      1020
     ctacagaaat cgacaaagct tttgcggata tagtacatag caatgcaata gatgtgtatg      1080
     gctctacttg cttacatagt tctgccaaac gtgtaactga aaatgtaatt cagattcctg      1140
     cacttctggt tgacttggat tactataaaa caccttatcg cgatttaact ccaaaagaat      1200
     tagtaaaaaa actagaagaa gtgtatttta aaccgcaaaa aataccttat cccaatgcca      1260
     ttattagttc tgggaatggc gtttatttga tttggttttt aaaatttacg cctggaacag      1320
     acggaaccct gttaaaacga agagtgattg taaaaatact ttatgaaatg ctgaaagaat      1380
     ttggggcgga tgcgaaagcg ttggatgcag cgcatgtgtt tcggttgccg aatacataca      1440
     atagcaaggt tactgataga cacaaacgcg aggtaaaagc gtttgttaat gagctagatg      1500
     actatactct ttcgaagttg tctaaaaagc tgccgagttt gtgggaggta tggaagaaaa      1560
     aacatggtat cagaacggaa caagaaaaaa ggcggaaagg aaaaatcatt tccgttccgc      1620
     aattcaaaac tcgaacacta gcttatgacc atattaaaag tatactgcaa ttaatcgagc      1680
     tacgtaaagg agaatgtaca gggtatcggg aaatgatgtt gttctttttg cgtgacagat      1740
     accatacgat gcacgcaaaa cgtttttatc agcaggatga aacattgttc gcagaaagct      1800
     acgccttcat aaaagaagtt aatcaaaaat ttacaaaacc cttgtcggat aaagaaattc      1860
     gcacaaatac gctcaataaa acaaaactgt ataaatttaa aaccaaaacg attatcgagt      1920
     ggtttgatat tacgctggaa gaacaaattc aactcaaagt gaaaacaaga gaagcgaaaa      1980
     atgagaaatc caaacggcaa atgagagaac tgagaagaaa acgtggagct ttaacacgac      2040
     gtgaatatct taaacaacag cattctataa cagatgataa attgtttaaa ttaaaagagt      2100
     tgctagaacg ttatccaaac gccaaacgca aagaattagc agaaatgctt ggcgtttcag      2160
     tttatagagt agaccaactc aaaagggaat taaaaagttt gtagtggttc gttacttatg      2220
     tattattaat aaataatatg acttgtgtcc ctgtggcatt agctctgcta atgccttttt      2280
     tattttgaat taaaaagttt gtagtggttc gttacttatg tattattaat aaataatatg      2340
     acttgtgtcc ctgtggcatt agctctgcta atgccttttt tattttgaat taaaaagttt      2400
     gtagtggttc gttacttatg tattattaat aaataatatg acttgtgtcc ctgtggcatt      2460
     agctctgcta atgccttttt tattttgaat taaaaagttt gtagtggttc gttacttatg      2520
     tattattaat aaataatatg acttgtgtcc ctgtggcatt agctctgcta atgccttttt      2580
     tattttgaat taaaaagttt gtagtggttc gttacttatg tattattaat aaataatatg      2640
     acttgtgtcc ctgtggcatt agctctgcta atgccttttt tattttgaat taaaaagttt      2700
     gtagtggttc gttacttatg tattattaat aaataatatg acttgtgtcc ctgtggcatt      2760
     agctctgcta atgcctccgt atttcttttt tatttgttga tttgtctgtg aggggattgg      2820
     ttctatccat tccctctctc tttttgtaaa aaccttccca gtggacctgg tgtaagattc      2880
     atgctatatt tagtgttagt gaggtgttat tatggctaat gcgatatcgt tttttgcagg      2940
     agctggcggt ttggatttag gaataaaaag agctggcttt aatatattat tgagtgttga      3000
     aatagaggaa acttactgtc agacattgcg ccaaaatttt gaaggcttga atgtggtttg      3060
     tggagatatt atggaatata gtcgtgaacg tgtttatcaa gaagcgggat tagcagaaca      3120
     tgaagaagtg gatttgatga taggaggaag tccttgccag tctttcagta cagcaggaaa      3180
     gaggcaggca tttgcagacc ctaggggaca agcaatgtta aagtatgcgg atttggttaa      3240
     tgaggttcga ccacgtttct ttttattgga gaatgtgaaa ggattgcttt cggctgcttt      3300
     aaaacatcgt ccactgaatc aaagagggcc ggggcatccg cctttgacgg aggaggagca      3360
     accgggtagt gctttagaat acttattgga acggtttggg gattatgatg taaaaatcaa      3420
     attgattaat gcagctgatt atggcgttcc tcaaaaaagg gaacgtgtct tcattattgg      3480
     tgttcgtaat gatttaaata ttcaatatga atttccagaa ccaacgcata atgaagatgg      3540
     ttcggatgga aaacttcctt gggtgacagt aggggaggtt ttggagaact tacaggtgga      3600
     agagcatcat tttatacctt actcaaaaga acgactccgt ttcatgaaac tgattcccaa      3660
     aggtgggggc aattggagag atttaagagc atatggggaa gaagtggttc gagaagcgat      3720
     gggcggtgct tactattctg ggggtggaaa agtaggtttc ttccgtcgta ttgacagtaa      3780
     taagccatct cctactcttt tgacatcacc agcacaaaag agtacaaatt tagggcatcc      3840
     atttgaggat agaccgttaa gtattgaaga atatttagcc attcagggat ttcctcctgg      3900
     ttttcgggtg gctggaacgt taatgcaaca atatacccaa ataggaaatg cggttccggt      3960
     tcctcttgct gaaatactag gagcatccat tttagagcga ttacgcaccc ttcaaacggt      4020
     ataagactta ttgtaaaaaa ctagattctc tcgtaaactg ggatgtagag aatctagttt      4080
     ttttattgag ggagttgttg ggggttggat gaaaagacaa aagaaagagt tcgccagcat      4140
     gtaaaggctg tcatggagcg attgattgca aaaaggactg tggaagagcc gttctctgcg      4200
     aaagaaattg aagaaaaaaa tccatttggt tatctattgg ttcccatcga agtgtggaaa      4260
     gggtctaaaa tggagcgttc gtttgtaacg acattaggac agggaatctt tgaacagtta      4320
     ggaaaaatta ttgcggaggg aacgggagct tttgctgcca atcagtacga taaaacgttg      4380
     acgattaata catttcgtac tgaaaagatt gattcgatta ttaagaaaca gcgttcgaaa      4440
     ccgaaaaaag gcgagaaaag agtgcctcct gatttatcaa aagaattaga cgatattgct      4500
     aggctggaga atgagaagta tgaaattata actgtaaaat ctgatttata catccgcaga      4560
     ccagatggaa aagaagaata ttattctctt aaaacggtca agccgaacct agaccaaacg      4620
     gcggaagcta agaaaaatct attgctttta agaactgggg accctaattg tgaggcatat      4680
     tttgctttac catataatcc tgctggtgaa ggaaatcctt attccaaagc aggacactcc      4740
     attcctaata ggctgtttaa tatggatgat gagcgatttg tattaattgg ctcggcgtta      4800
     tggaataaaa tcggaaacga tgaaaataca tatgaagagc tgctagagat tttccgagaa      4860
     gttgggaaag agtctgctga aagaatacga aaagaatatt ttggattata gaaaaagcgt      4920
     tttttaacat aaattagcca gaagtccccc acctctacag gtgggggatg aatggctttt      4980
     gttgatgcga aaaacatttt ttgcattctt ctcttgcttt tggatttggg acggagtaca      5040
     ctaaaaataa aaaagcaaac atgacctgtt tgcaagaaga agaatgattc ttcttctaga      5100
     aatgaggttt ttacgtatcg acggactgcg taagcaggaa gtcgtagatg gcgagttccc      5160
     gcccttccgc atccaagatg cggatgttgc ctgtcgttcc caacgggacc gatgccaggc      5220
     ttgcctgcag ataggctgcc aaccagccta tcatgcatcc accccgaagg gaaaacagga      5280
     aactcccact tcgataagtg ggagaggttc atttttagtt tagaagacaa tgaatgatag      5340
     attcattgtc tttttttgtt tgttcatcat acgaacagac cgcaatgttc caattcagaa      5400
     cattttattt tttgttcata acttgaacat taaggtgcct aaaagattaa atctcccgtt      5460
     ttggatggga gattttttat tttttgaccg ctagaaatgg gtctattttt tatttttttg      5520
     tgtgggggag tatttttata ctctcttttt ttggaacgaa ttttgacggt tttttttggt      5580
     cctaatgata ggaatattaa aaagtttgta gtggttcgtt acttatgtat tattaataaa      5640
     taatatgact tgtgtccctg tggcattagc tttgctaatg ccttttttat tttgtttgat      5700
     tttctttctc ttggtggggg gacggttctc tccttcattg gaggaggggg atgtccttgg      5760
     tatttttatg ttttttgttc ttgtgggaag aaattgagtt ataattaagg aaacctttct      5820
     aggaggggaa attatgtatt ttgtgaatgc tgagcataag aggaactatg attatctgat      5880
     ggggttgtat cgattggaac caggtcagaa tgtggagtat gaagctagta tttatattgc      5940
     tgcttatcca agtgtttttg cttgttttgg gaaaacgata agcactgaat ttggtcctct      6000
     tgcttatttg agcgatgaag aacttgcgga ggagttcgga cacaattttg gggctttgac      6060
     gggaacgacg cgacgtatgg ttgcttgtgg gatgagtttg tacaacggat tggaagtatc      6120
     tctttcggat gttttttcgt ctttggggga agaagaattt aatgtgttga ttcaagcgat      6180
     taaaattcgt gcaaaaagat aaaaagagct aatctcccat tttggatggg agatttttta      6240
     ttttttgacc gctagaaatg ggtctatttt ttattttttt gtgtggggga gtatttttat      6300
     actctctttt tttggaacga attttgacgg ttttttttgg tcctaatgat aggaatgcaa      6360
     acatagattg atagtcgaaa aaaaatacac ttttttcacc acttttccag aaattggatt      6420
     acgataataa tgggttttgc gaaccctagt caatgaatat gggcggggaa ggtttggaaa      6480
     cgagtgcaac ggcgtttcca gcacttccga aggaagtgag ttgggaaaat gataagcaac      6540
     gtaatttgaa taaaaaaatt ggaaggaggg gttcgtgaaa cgagatatgt tacgtttctg      6600
     ttctgcggaa atttgcttct aaaaatttaa tattgccttt gccgagatgg tggctgccaa      6660
     ccacctgcac gactgccaag tttttaaatt agtttgtgta gggatggctg ccaaccatct      6720
     cctacacaaa tatttaactt atgccctatt ttttgcggct caccatatcg ccttgccaga      6780
     ggtgatagag gtgggtggag tggcgtgaaa acaggaccgc caatcctgga accatagcca      6840
     cttcggagga cgctgcgtgc atcgagaggt gctggcgcgg tgtcaacggg ggctgcgagt      6900
     aacatcgctt ctacccgatg ggttatgcgt atatgggcga cacagaaata gtgattccga      6960
     ccatactcgg aattgctcgt cacattcgaa gtgggtgcaa atcccaccta gggggagttg      7020
     ggaaaccgct caacctagcg cggcggggga ggttgcggca gtaatgcttg caactaaata      7080
     gctcaacccg ttaaggctca caggtggctg tgagtaaagc gccctacccg tttaggcggg      7140
     cgcaaccgcg taagagattg caaagacgcg aggctaaacc gcgtagaagg cgtagcgtag      7200
     ccgaaagtct tgccataagg caagatgagt aaggggatgc ttccatattc ggtcccgtgc      7260
     ctattttggc acacaagcta cggctggagc gacgtcagtg caatctcgtc gaatgtgact      7320
     aatgtggcaa ggaccgaacg gtctgggtgg caccagatgc gaggtctgag agcttaactg      7380
     agtaggttcc ctgtgggggc attagagctg cagggcagtg gctcttgtgt tagcggaatc      7440
     gggtggcgcc gattcaataa cgctagaccg aaaggttaac tcccatgcaa aaaagggcat      7500
     aagcagtacc tttggcaaag gtgctggact tggcagtcgt gcagaaggtt ggcggaaaac      7560
     ctttactttt aaagaaaccg ccatataatc accgggaggt gatggaatat gtgcactaaa      7620
     tatttgtgta aacgttggca agggttacta gaagcaatta ttaatttcgc agggcaggga      7680
     tatgtgtatt atcacgtaac atatctacca gcaaaaaaac taaataaagc agacaaaata      7740
     gaccaaaaaa tactgcaaaa atataatcta ataaacgata caaaagataa acgttaccat      7800
     cgcaaaaaac ggggtctggc aaacttccgt tatttgcgct gggagcatat tattgtcatc      7860
     ctccacacag aaggaacaat tattcaacga ggacaagaag aaaaacatct aacacgtttt      7920
     aaactagaac aagcaaaaaa acatgctgtg acttatgatg attcgtttag tgatattcgt      7980
     gtgaagccaa tggtgcttgc tatttcggag cagctggaac tagaagtgcg ttatttaccc      8040
     aaaaaaaatg tcggacaaaa attaacagtt cgtttaacca aaaaaatgtt tcgcgacaaa      8100
     aaagccgaat tggccgcatt ggcagaaaaa cgcgcgaaag acaaaattgt gtatgtcttt      8160
     aatgccctta ataacctccc tgcgtggcgt ggcattatca ttcaaaaacg gcagttgtat      8220
     cgttttgtga tgacgcaagc cagaaaacac aattttacgt ttcaaaaagg tgaattaatg      8280
     gttggcgatt atcgcccaaa agagaaggac attttcgttt aacataaatt agccagaagt      8340
     cccccacctc tacaggtggg ggatgaatgg cttttgttga tgcgaaaaac attttttgca      8400
     ttcttctctt gcttttggat ttgggacgga gtacactaaa aataaaaaag caaacatgac      8460
     ctgtttgcaa gaagaagaat gattcttctt ctagaaatga ggtttttacg tatcgacgga      8520
     ctgcgtaagc aggaagtcgt agatggcgag ttcccgccct tccgcatcca agatgcggat      8580
     gttgcctgtc gttcccaacg ggaccgatgc caggcttgcc tgcagatagg ctgccaacca      8640
     gcctatcatg catccacccc gaagggaaaa caggaaactc ccacttcgat aagtgggaga      8700
     ggttcatacc aagacaataa agagcaaaaa agcccattat gtgggctttt ttatttgtct      8760
     taaaaggaaa tgaacgcgac acaccttgtc gcgttatatg tgcaattaga ggacacatgc      8820
     gacatgtgac gcggttatgg gaactttttt gattggttta cgaaacgatg tcggcagatg      8880
     cgatatatta gcgttatcgg attttaaaca gtggctaaga aaaacatata gtttggaaaa      8940
     cgcaataaaa acagttgtat caacgtttaa agaaaaagaa aacgcagtaa aaacgctaag      9000
     cgttatcacg caatataacg ttcaaaaaag gagaatttga aaaacacacg aaaaaaatta      9060
     tagaactaat ttccaaaaag gcgatggaag caagggatta gagaggggtg gatttttgtg      9120
     atacgtatgg aagaaatctc aatttcaatt cccaaagagg ttttagaaaa agtcgagaaa      9180
     agtatgggtg gttgggacga ccgtaatcga gtcattacga atcacttggt gtacttttat      9240
     cgtttgttag aaactgaaaa aaggacgctt accaaaatct tttcggaaga agagctgttg      9300
     tgtatttatg ctgcctttaa cgggacaatc gtcgattttc ggatgactcc aggaatgttt      9360
     aaagccactg ttagagatgc tttaaaatac ggcgaattgg attttcttat aagcgaacat      9420
     cgcattgacg cgggtgcttt tctacaaaaa attgatggtt tatccgattt gcaaactttc      9480
     gttctcttgg tggatgccca agaatattgg gcagagaaat ctagataaaa ttaatatggg      9540
     gatagtgtgg tacataaagg tagatggaat aaaaaagccc gcataatggg ctttttttta      9600
     ttttttttat tggataatag gatttatata tgtcacgata gaaaagaata aaataaaggt      9660
     ggtgaacgcg ttgtgaacgg taatataggc gaatttggtg ctttggcaaa agaagtgtcg      9720
     ctgtttttag atattaatcc aaatacgctc cgtagatggt ctattgagtt agaaaaatgc      9780
     ggttatgtgt ttcaacgtga tgaaaaggac cgtcgaattt actataaacg agatattttg      9840
     gcgttaacgg agtttaaaaa gtttttggaa aaaacacaaa gcctagaaaa cgcagcaaaa      9900
     gctgttgtag aaagtgttaa agacagagaa aacgcggaaa aaacgctaag cgttatcgtg      9960
     caaaatagcg ataaaattac gttcacgaaa gaggaactag aagcgtatac gaaacgcatt     10020
     gtagaagaaa cggcacaaaa aacggcagaa cagattttgc ataaatttaa tcaaacgcta     10080
     gagcaacgcg acagacagct tgtccaaagt ttacaacaaa ccatggagca aagacgcctg     10140
     gaactcgctg ctgcaacaga agaaaaacag tctttttggt cccgtctctt tgggaaaaag     10200
     acaaaagcgt tggacaagct ctgaggatat gccgagaaaa ctctttgcgt tggggtaagc     10260
     cccctgggta tgctagaagg cggaccc                                         10287
//

If you have problems or comments...

PBIL Back to PBIL home page