(data stored in ACNUC7421 zone)

EMBL: CP001644

ID   CP001644; SV 1; circular; genomic DNA; STD; PRO; 3647724 BP.
XX
AC   CP001644; ABDZ01000000-ABDZ01000044;
XX
PR   Project:PRJNA18937;
XX
DT   24-JUN-2009 (Rel. 101, Created)
DT   02-JAN-2014 (Rel. 119, Last updated, Version 4)
XX
DE   Ralstonia pickettii 12D chromosome 1, complete sequence.
XX
KW   .
XX
OS   Ralstonia pickettii 12D
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Ralstonia.
XX
RN   [1]
RP   1-3647724
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Meincke L., Brettin T.,
RA   Detter J.C., Han C., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Ovchinnikova G., Marsh T., Richardson P.;
RT   "Complete sequence chromosome 1 of Ralstonia pickettii 12D";
RL   Unpublished.
XX
RN   [2]
RP   1-3647724
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Meinche L., Brettin T.,
RA   Detter J.C., Han C., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Ovchinnikova G., Marsh T., Richardson P.;
RT   ;
RL   Submitted (17-JUN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 8c2390dc0b36d980f4dc9d86d3fbdec4.
DR   BioSample; SAMN00000034.
DR   EnsemblGenomes-Gn; EBG00001008017.
DR   EnsemblGenomes-Gn; EBG00001008018.
DR   EnsemblGenomes-Gn; EBG00001008019.
DR   EnsemblGenomes-Gn; EBG00001008020.
DR   EnsemblGenomes-Gn; EBG00001008021.
DR   EnsemblGenomes-Gn; EBG00001008022.
DR   EnsemblGenomes-Gn; EBG00001008023.
DR   EnsemblGenomes-Gn; EBG00001008024.
DR   EnsemblGenomes-Gn; EBG00001008025.
DR   EnsemblGenomes-Gn; EBG00001008026.
DR   EnsemblGenomes-Gn; EBG00001008027.
DR   EnsemblGenomes-Gn; EBG00001008028.
DR   EnsemblGenomes-Gn; EBG00001008029.
DR   EnsemblGenomes-Gn; EBG00001008030.
DR   EnsemblGenomes-Gn; EBG00001008031.
DR   EnsemblGenomes-Gn; EBG00001008032.
DR   EnsemblGenomes-Gn; EBG00001008033.
DR   EnsemblGenomes-Gn; EBG00001008034.
DR   EnsemblGenomes-Gn; EBG00001008035.
DR   EnsemblGenomes-Gn; EBG00001008036.
DR   EnsemblGenomes-Gn; EBG00001008037.
DR   EnsemblGenomes-Gn; EBG00001008038.
DR   EnsemblGenomes-Gn; EBG00001008039.
DR   EnsemblGenomes-Gn; EBG00001008040.
DR   EnsemblGenomes-Gn; EBG00001008041.
DR   EnsemblGenomes-Gn; EBG00001008042.
DR   EnsemblGenomes-Gn; EBG00001008043.
DR   EnsemblGenomes-Gn; EBG00001008044.
DR   EnsemblGenomes-Gn; EBG00001008045.
DR   EnsemblGenomes-Gn; EBG00001008046.
DR   EnsemblGenomes-Gn; EBG00001008048.
DR   EnsemblGenomes-Gn; EBG00001008049.
DR   EnsemblGenomes-Gn; EBG00001008050.
DR   EnsemblGenomes-Gn; EBG00001008051.
DR   EnsemblGenomes-Gn; EBG00001008052.
DR   EnsemblGenomes-Gn; EBG00001008053.
DR   EnsemblGenomes-Gn; EBG00001008054.
DR   EnsemblGenomes-Gn; EBG00001008055.
DR   EnsemblGenomes-Gn; EBG00001008056.
DR   EnsemblGenomes-Gn; EBG00001008057.
DR   EnsemblGenomes-Gn; EBG00001008058.
DR   EnsemblGenomes-Gn; EBG00001008059.
DR   EnsemblGenomes-Gn; EBG00001008060.
DR   EnsemblGenomes-Gn; EBG00001008061.
DR   EnsemblGenomes-Gn; EBG00001008062.
DR   EnsemblGenomes-Gn; EBG00001008063.
DR   EnsemblGenomes-Gn; EBG00001008064.
DR   EnsemblGenomes-Gn; EBG00001008065.
DR   EnsemblGenomes-Gn; EBG00001008066.
DR   EnsemblGenomes-Gn; EBG00001008067.
DR   EnsemblGenomes-Gn; EBG00001008068.
DR   EnsemblGenomes-Gn; EBG00001008069.
DR   EnsemblGenomes-Gn; EBG00001008070.
DR   EnsemblGenomes-Gn; EBG00001008071.
DR   EnsemblGenomes-Gn; EBG00001008072.
DR   EnsemblGenomes-Gn; EBG00001008073.
DR   EnsemblGenomes-Gn; EBG00001008074.
DR   EnsemblGenomes-Gn; EBG00001008075.
DR   EnsemblGenomes-Gn; EBG00001008076.
DR   EnsemblGenomes-Gn; EBG00001008077.
DR   EnsemblGenomes-Gn; EBG00001008078.
DR   EnsemblGenomes-Gn; EBG00001008079.
DR   EnsemblGenomes-Gn; EBG00001008080.
DR   EnsemblGenomes-Gn; EBG00001008081.
DR   EnsemblGenomes-Gn; EBG00001008082.
DR   EnsemblGenomes-Gn; EBG00001008083.
DR   EnsemblGenomes-Gn; EBG00001008084.
DR   EnsemblGenomes-Gn; EBG00001008085.
DR   EnsemblGenomes-Gn; EBG00001008086.
DR   EnsemblGenomes-Gn; EBG00001008087.
DR   EnsemblGenomes-Gn; EBG00001008088.
DR   EnsemblGenomes-Gn; EBG00001008089.
DR   EnsemblGenomes-Gn; EBG00001008090.
DR   EnsemblGenomes-Gn; EBG00001008091.
DR   EnsemblGenomes-Gn; EBG00001008092.
DR   EnsemblGenomes-Gn; Rpic12D_R0001.
DR   EnsemblGenomes-Gn; Rpic12D_R0002.
DR   EnsemblGenomes-Gn; Rpic12D_R0003.
DR   EnsemblGenomes-Gn; Rpic12D_R0004.
DR   EnsemblGenomes-Gn; Rpic12D_R0005.
DR   EnsemblGenomes-Gn; Rpic12D_R0006.
DR   EnsemblGenomes-Gn; Rpic12D_R0007.
DR   EnsemblGenomes-Gn; Rpic12D_R0008.
DR   EnsemblGenomes-Gn; Rpic12D_R0009.
DR   EnsemblGenomes-Gn; Rpic12D_R0010.
DR   EnsemblGenomes-Gn; Rpic12D_R0011.
DR   EnsemblGenomes-Gn; Rpic12D_R0012.
DR   EnsemblGenomes-Gn; Rpic12D_R0013.
DR   EnsemblGenomes-Gn; Rpic12D_R0014.
DR   EnsemblGenomes-Gn; Rpic12D_R0015.
DR   EnsemblGenomes-Gn; Rpic12D_R0016.
DR   EnsemblGenomes-Gn; Rpic12D_R0017.
DR   EnsemblGenomes-Gn; Rpic12D_R0018.
DR   EnsemblGenomes-Gn; Rpic12D_R0019.
DR   EnsemblGenomes-Gn; Rpic12D_R0020.
DR   EnsemblGenomes-Gn; Rpic12D_R0021.
DR   EnsemblGenomes-Gn; Rpic12D_R0022.
DR   EnsemblGenomes-Gn; Rpic12D_R0023.
DR   EnsemblGenomes-Gn; Rpic12D_R0024.
DR   EnsemblGenomes-Gn; Rpic12D_R0025.
DR   EnsemblGenomes-Gn; Rpic12D_R0026.
DR   EnsemblGenomes-Gn; Rpic12D_R0027.
DR   EnsemblGenomes-Gn; Rpic12D_R0028.
DR   EnsemblGenomes-Gn; Rpic12D_R0029.
DR   EnsemblGenomes-Gn; Rpic12D_R0030.
DR   EnsemblGenomes-Gn; Rpic12D_R0031.
DR   EnsemblGenomes-Gn; Rpic12D_R0032.
DR   EnsemblGenomes-Gn; Rpic12D_R0033.
DR   EnsemblGenomes-Gn; Rpic12D_R0034.
DR   EnsemblGenomes-Gn; Rpic12D_R0035.
DR   EnsemblGenomes-Gn; Rpic12D_R0036.
DR   EnsemblGenomes-Gn; Rpic12D_R0037.
DR   EnsemblGenomes-Gn; Rpic12D_R0038.
DR   EnsemblGenomes-Gn; Rpic12D_R0039.
DR   EnsemblGenomes-Gn; Rpic12D_R0040.
DR   EnsemblGenomes-Gn; Rpic12D_R0041.
DR   EnsemblGenomes-Gn; Rpic12D_R0042.
DR   EnsemblGenomes-Gn; Rpic12D_R0043.
DR   EnsemblGenomes-Gn; Rpic12D_R0044.
DR   EnsemblGenomes-Gn; Rpic12D_R0045.
DR   EnsemblGenomes-Gn; Rpic12D_R0046.
DR   EnsemblGenomes-Gn; Rpic12D_R0047.
DR   EnsemblGenomes-Gn; Rpic12D_R0048.
DR   EnsemblGenomes-Gn; Rpic12D_R0049.
DR   EnsemblGenomes-Gn; Rpic12D_R0050.
DR   EnsemblGenomes-Gn; Rpic12D_R0051.
DR   EnsemblGenomes-Gn; Rpic12D_R0052.
DR   EnsemblGenomes-Gn; Rpic12D_R0053.
DR   EnsemblGenomes-Gn; Rpic12D_R0054.
DR   EnsemblGenomes-Gn; Rpic12D_R0055.
DR   EnsemblGenomes-Gn; Rpic12D_R0056.
DR   EnsemblGenomes-Gn; Rpic12D_R0057.
DR   EnsemblGenomes-Gn; Rpic12D_R0058.
DR   EnsemblGenomes-Gn; Rpic12D_R0059.
DR   EnsemblGenomes-Gn; Rpic12D_R0060.
DR   EnsemblGenomes-Gn; Rpic12D_R0061.
DR   EnsemblGenomes-Gn; Rpic12D_R0062.
DR   EnsemblGenomes-Tr; EBT00001532142.
DR   EnsemblGenomes-Tr; EBT00001532143.
DR   EnsemblGenomes-Tr; EBT00001532144.
DR   EnsemblGenomes-Tr; EBT00001532145.
DR   EnsemblGenomes-Tr; EBT00001532146.
DR   EnsemblGenomes-Tr; EBT00001532147.
DR   EnsemblGenomes-Tr; EBT00001532148.
DR   EnsemblGenomes-Tr; EBT00001532149.
DR   EnsemblGenomes-Tr; EBT00001532150.
DR   EnsemblGenomes-Tr; EBT00001532151.
DR   EnsemblGenomes-Tr; EBT00001532152.
DR   EnsemblGenomes-Tr; EBT00001532153.
DR   EnsemblGenomes-Tr; EBT00001532154.
DR   EnsemblGenomes-Tr; EBT00001532155.
DR   EnsemblGenomes-Tr; EBT00001532156.
DR   EnsemblGenomes-Tr; EBT00001532157.
DR   EnsemblGenomes-Tr; EBT00001532158.
DR   EnsemblGenomes-Tr; EBT00001532159.
DR   EnsemblGenomes-Tr; EBT00001532160.
DR   EnsemblGenomes-Tr; EBT00001532161.
DR   EnsemblGenomes-Tr; EBT00001532162.
DR   EnsemblGenomes-Tr; EBT00001532163.
DR   EnsemblGenomes-Tr; EBT00001532164.
DR   EnsemblGenomes-Tr; EBT00001532165.
DR   EnsemblGenomes-Tr; EBT00001532166.
DR   EnsemblGenomes-Tr; EBT00001532167.
DR   EnsemblGenomes-Tr; EBT00001532168.
DR   EnsemblGenomes-Tr; EBT00001532169.
DR   EnsemblGenomes-Tr; EBT00001532170.
DR   EnsemblGenomes-Tr; EBT00001532171.
DR   EnsemblGenomes-Tr; EBT00001532172.
DR   EnsemblGenomes-Tr; EBT00001532173.
DR   EnsemblGenomes-Tr; EBT00001532174.
DR   EnsemblGenomes-Tr; EBT00001532175.
DR   EnsemblGenomes-Tr; EBT00001532176.
DR   EnsemblGenomes-Tr; EBT00001532177.
DR   EnsemblGenomes-Tr; EBT00001532178.
DR   EnsemblGenomes-Tr; EBT00001532179.
DR   EnsemblGenomes-Tr; EBT00001532180.
DR   EnsemblGenomes-Tr; EBT00001532181.
DR   EnsemblGenomes-Tr; EBT00001532182.
DR   EnsemblGenomes-Tr; EBT00001532183.
DR   EnsemblGenomes-Tr; EBT00001532184.
DR   EnsemblGenomes-Tr; EBT00001532185.
DR   EnsemblGenomes-Tr; EBT00001532186.
DR   EnsemblGenomes-Tr; EBT00001532187.
DR   EnsemblGenomes-Tr; EBT00001532188.
DR   EnsemblGenomes-Tr; EBT00001532189.
DR   EnsemblGenomes-Tr; EBT00001532190.
DR   EnsemblGenomes-Tr; EBT00001532191.
DR   EnsemblGenomes-Tr; EBT00001532192.
DR   EnsemblGenomes-Tr; EBT00001532193.
DR   EnsemblGenomes-Tr; EBT00001532194.
DR   EnsemblGenomes-Tr; EBT00001532195.
DR   EnsemblGenomes-Tr; EBT00001532196.
DR   EnsemblGenomes-Tr; EBT00001532197.
DR   EnsemblGenomes-Tr; EBT00001532198.
DR   EnsemblGenomes-Tr; EBT00001532199.
DR   EnsemblGenomes-Tr; EBT00001532200.
DR   EnsemblGenomes-Tr; EBT00001532201.
DR   EnsemblGenomes-Tr; EBT00001532202.
DR   EnsemblGenomes-Tr; EBT00001532203.
DR   EnsemblGenomes-Tr; EBT00001532204.
DR   EnsemblGenomes-Tr; EBT00001532205.
DR   EnsemblGenomes-Tr; EBT00001532206.
DR   EnsemblGenomes-Tr; EBT00001532207.
DR   EnsemblGenomes-Tr; EBT00001532208.
DR   EnsemblGenomes-Tr; EBT00001532209.
DR   EnsemblGenomes-Tr; EBT00001532210.
DR   EnsemblGenomes-Tr; EBT00001532211.
DR   EnsemblGenomes-Tr; EBT00001532212.
DR   EnsemblGenomes-Tr; EBT00001532213.
DR   EnsemblGenomes-Tr; EBT00001532214.
DR   EnsemblGenomes-Tr; EBT00001532215.
DR   EnsemblGenomes-Tr; EBT00001532216.
DR   EnsemblGenomes-Tr; Rpic12D_R0001-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0002-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0003-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0004-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0005-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0006-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0007-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0008-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0009-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0010-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0011-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0012-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0013-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0014-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0015-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0016-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0017-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0018-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0019-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0020-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0021-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0022-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0023-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0024-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0025-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0026-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0027-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0028-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0029-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0030-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0031-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0032-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0033-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0034-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0035-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0036-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0037-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0038-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0039-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0040-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0041-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0042-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0043-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0044-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0045-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0046-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0047-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0048-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0049-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0050-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0051-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0052-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0053-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0054-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0055-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0056-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0057-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0058-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0059-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0060-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0061-1.
DR   EnsemblGenomes-Tr; Rpic12D_R0062-1.
DR   EuropePMC; PMC2918799; 20730112.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP001644.
DR   SILVA-SSU; CP001644.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003027
CC   Source DNA and organism available from Terry Marsh (marsht@msu.edu)
CC   Contacts: Terry Marsh (marsht@msu.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Ralstonia pickettii 12D
CC   GOLD Stamp ID         :: Gi01352
CC   Greengenes ID         :: 243860
CC   Isolation Site        :: Copper-contaminated sediment from a lake
CC                            in Michigan
CC   Isolation Country     :: USA
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: Nosocomial infection
CC   Habitat               :: Fresh water, Host, Soil
CC   Phenotypes            :: Pathogen
CC   Energy Source         :: Heterotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3647724
FT                   /organism="Ralstonia pickettii 12D"
FT                   /chromosome="1"
FT                   /strain="12D"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:428406"
FT   gene            613..2202
FT                   /locus_tag="Rpic12D_0001"
FT   CDS_pept        613..2202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: rso:RSc3442 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61314"
FT                   /db_xref="GOA:C6BJS5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJS5"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACS61314.1"
FT                   /translation="MQDFWHAASAQLESELTPQQFKTWIKPLTPLSFDEQACTLRIAAP
FT                   NRFKLDWVKSQFSGRIQSLACDYWEATVDVQFVLDPTAGQRQAALQPALAPVPMQPLGA
FT                   QAGQQRQAMPAGNGVSHDAATLRPAPSVYRETALATASHAAADIDVPVMDAAEVSAQSY
FT                   RMPPQAPAVVTSLAAPPQAPVDDSVHERSRLNQILTFDNFVTGKANQLARAAAIQVANN
FT                   PGKSYNPLYLYGGVGLGKTHLIHAIGNFMLMENPRARIRYIHAEQYVSDVVKAYQRKAF
FT                   DDFKRYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGI
FT                   DDRLISRFDSGLTVAIEPPELEMRVAILMKKAQAENVTVPEEVAFFVAKHLRSNVRELE
FT                   GALRKILAYSNFHGKEITIEVTREALKDLLTVQNRQISVENIQKTCADFYNIKVADMYS
FT                   KKRPANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERTKDAQLN
FT                   HELHVLEQTLKG"
FT   gene            2479..3594
FT                   /locus_tag="Rpic12D_0002"
FT   CDS_pept        2479..3594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: rso:RSc3441 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61315"
FT                   /db_xref="GOA:C6BJS6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJS6"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACS61315.1"
FT                   /translation="MQLVKTSRDNLLRPLQIVSGIVERRHTLPILANLLITKQGERVSF
FT                   LSTDIEIQITTHADCGAGAGDIATTVAARKLVDILRAMPDGEVALTLNDKRMTVQSGKS
FT                   RFALQTLAAEEFPTVAEATDFGARITLPQKTLKHLLAMVHFAMAQQDIRYYLNGMLLVV
FT                   DGKQVMAVATDGHRLAYCGVETGEQPAGAGGRQEVIIPRKTILELQRLLEDVDDPVSVQ
FT                   LASNQVKFTFGNIELISKLVEGKFPDFQRVIPKGYRNSFTIDRAFLQQALQRTAILTTD
FT                   KFKGVRCMLDTNVLKISSTNADQEEAQEELEIDYQGDALDIGFNVTYLLDVLANLKAEK
FT                   VQVSLGDSNSSALITLPDDDTFKYVVMPMRI"
FT   gene            3723..6251
FT                   /locus_tag="Rpic12D_0003"
FT   CDS_pept        3723..6251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: rso:RSc3440 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61316"
FT                   /db_xref="GOA:C6BJS7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJS7"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACS61316.1"
FT                   /translation="MTEEQKPQSTPAEANSYDAASIQILEGLEAVRKRPGMYIGDTSDG
FT                   TGLHHLVFEVLDNSIDEALAGHCTEIQVTIHTDNSISVIDNGRGIPTGIKFDDKHEPKR
FT                   SATEIAMTELHAGGKFNQNSYKVSGGLHGVGVSCVNGLSKWMKVTVRQGGKVHYIEFAQ
FT                   GVPQNRLIETVQGPDGQMVEVSPLRVLGTTDKRGTEVHFLADEEIFTNVEYHYEILSKR
FT                   IRELSFLNNGVHIRLTDQRTGKEEDFAFSGGVKGFVEYINKNKTVLHPTIFFAAGEKDG
FT                   VAVEVSMQWNDAYNEQVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIADNEIAKKAKV
FT                   DTSGDDMREGLTCVLSVKVPEPKFSSQTKDKLVSSEVRLPVEEVVAKALSDFLLETPVD
FT                   AKIICGKIVEAARAREAARKAREMTRRKGVLDGMGLPGKLADCQEKDPALSELFIVEGD
FT                   SAGGSAKQGRDRKFQAILPLKGKILNVERARFDKMLSSQEVLTLITAMGTGIGKDDYNL
FT                   DKLRYHRIIIMTDADVDGSHIRTLLLTFFYRQMPEIIERGHVYIAQPPLYKIKHGKEER
FT                   YIKDDVEMAAYLVRQALDTAVLVRPDGTEIAGDALAELARQYQLSRGVIERLSRVIDAD
FT                   ALRAIAEGVSLDLSNEAAAEASARTLKARLLEMQGNASSANGGATADAFMQYDEKTEKY
FT                   RIMVVRRQHGNQRLSHIDADFVAGADYTALSSTAATFQGLIGDGAKVRRGTGDKVREQN
FT                   VADFHAAMTWLLSEAERGVSRQRYKGLGEMNPEQLWETTMDVTQRRLLRVQIEDAIAAD
FT                   QIFTTLMGDDVEPRRNFIESNALVARNIDV"
FT   gene            6417..7163
FT                   /locus_tag="Rpic12D_0004"
FT   CDS_pept        6417..7163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0004"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hip:CGSHiEE_08925 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61317"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJS8"
FT                   /inference="similar to AA sequence:KEGG:CGSHiEE_08925"
FT                   /protein_id="ACS61317.1"
FT                   /translation="MDESGDHGLQTLDPNYPVFVLAFCVFYKRHYSEKVVPALHKLKFN
FT                   HFGHDLVVLHEHEIRKEKGAFKFANRQHKQQFLSELTDIIEISNFILISCVIDKKKLRD
FT                   QGKTDGNPYHLALGFCLETLYELLQEKNQDGALTHVIVECRGKKEDNELELEFRRICDG
FT                   ANRLGITLPFDIVFADKKVDSPGLQLADLVARPVGMHVLRPEQENRAFEVLKRKFFCSG
FT                   GREKLGEGFEDWGLKMFPPPESEKPR"
FT   gene            7331..7546
FT                   /pseudo
FT                   /locus_tag="Rpic12D_0005"
FT   gene            7604..9472
FT                   /locus_tag="Rpic12D_0006"
FT   CDS_pept        7604..9472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0006"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecp:ECP_1910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61318"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61318.1"
FT                   /translation="MESLDEDKDHPLMALHRRWAVYALQQLALNDLSLKPSLFECGFKF
FT                   LISIGDVGARVSEISAHFDHEIRPITADISIVENAPVGFTPVVTVTTHQEDMWSAHRPL
FT                   SAGDMNRMLALISGKVPKGGIDYIHQTRRWQFQHFGIDDAGRKAVQDACATLGISDEIQ
FT                   FVEITPSVPSTPEQSVSHIASDPLGIGTRHSVVSANNKIRNLVECDEDAWRTFVSTRGY
FT                   KRDHDESALGGRRRFACLYDTRDESPVQLAELLTLYDVVNIVPSEDLQWMDRHRLTLTD
FT                   LEVMAASGRVRLVLPASINRYPESVVLAATSQSHEGVVLSRNLAMQVVRSGERKDPLLY
FT                   GPFTMSERTAFLRLLRQSAGENFNIPLSIYSSSVARQGLEYAMRGANAVYGIGFGPFLG
FT                   EMFYRLRGIDARIEMSTIGAAVEWAMGLGAAYVPRQMGGFDETRNASIVASYVSRSRCI
FT                   PREPLANRMHTVVDGLLAVTDVPPIEVAKNFTSSAVSRFRQAAMGLINGPADPDEITGM
FT                   MEKLNEEVRAFESRRKFLAKWKADAIAISLATKLATDTLDAEFGPWTSWFASVGAGYLY
FT                   SMMKNTKAFATASEVSQELIDTFVGLAMAPSNDAVVMWRARERLKR"
FT   gene            complement(9627..10877)
FT                   /locus_tag="Rpic12D_0007"
FT   CDS_pept        complement(9627..10877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0007"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: rso:RSp0478
FT                   ISRSO7-transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61319"
FT                   /db_xref="GOA:C6BJT0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJT0"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ACS61319.1"
FT                   /translation="MPRKPRAKPADLPAIPAELLEQFGSGPMTAEAINAATLALKKALI
FT                   ERALGGEMNHHLGYPPGASKPATVSNQRNGTGAKTVLTEGGPIRIEVPRDRDGSFAPLL
FT                   IPKHERRFKGFDDKIVAMYARGMTVREIQGFLLEQYATDVSPEFISSVTDEVMAEVTAW
FT                   QARPLDPMYPVVFFDALRVKIREDAVVRNKAVYLALGVLPDGTRDILGLWIENTEGAKF
FT                   WMKVFNDLKTRGVNDILIAVTDGLKGMPEALAAVFPATTLQTCIVHLIRNSLDYASWKD
FT                   RRELAAAIRPIYTAPSAEAAQAELEAFADGPWGQRYPTVSAAWRNAWDRVIPFFAFPPA
FT                   VRKVIYTTNAIENINAQLRKIIKTRGHFPSDEAATKLIWLALRNITAGWSRAAHDWKQA
FT                   MNQFAILYADRFVRPSV"
FT   gene            complement(10937..12040)
FT                   /locus_tag="Rpic12D_0008"
FT   CDS_pept        complement(10937..12040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61320"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61320.1"
FT                   /translation="MGNALMIDNWTLQDVEALMQNGIKPENASEIAISEDRQTHRFDPV
FT                   PSGTIQIDALISLLTNIVCFDHLQVDSGFVETWQRDGGFLAPLESLGVVRPDDYTALGQ
FT                   DLDDIREMILSELCVTESLRTAMQKIKLEWELTRSTSSPHLSALVWGGAGLLARSDLTS
FT                   TPYFGHPFRRRLVAETQMFYHQANAAQQFEKFIETERAKMFRYRNERFGGAMAKVVLPP
FT                   IPAYIIEESNSIHDLIPVAVQMRDKYVGLRQWLADYQRAIEEEDEGKQLRFEQTLTAVG
FT                   KSIQVKYGAEKAGSLGISLSAAFFKADVSRRLVDGTLNRFGVRSTLAKLIMAPRGQQAL
FT                   TKLIGMLGESKSSLGRTVLLSCQKRFS"
FT   gene            12433..12801
FT                   /locus_tag="Rpic12D_0009"
FT   CDS_pept        12433..12801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc3434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61321"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61321.1"
FT                   /translation="MTANHSGHRPASYPSPPEPPTHASTSSDTGRLTKNRTYLNGAIAA
FT                   QAYLKRTRTAMRSHGQCRPGMLREQLQHLSAHAFPPAFIKGFVDAIDAYVSMSLGGRDV
FT                   DPQTWDVLAAIERRGYSQ"
FT   gene            13272..14231
FT                   /locus_tag="Rpic12D_0010"
FT   CDS_pept        13272..14231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0010"
FT                   /product="Fimbrial protein"
FT                   /note="PFAM: Fimbrial protein; KEGG: pae:PA5284
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61322"
FT                   /db_xref="GOA:C6BJT3"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJT3"
FT                   /inference="protein motif:PFAM:PF00419"
FT                   /protein_id="ACS61322.1"
FT                   /translation="MKMQRLGLKAMRVVERAVATTLGLTAATSAFGADFRPFPTALSLP
FT                   RDVAANTVVARAYLTPQTLCGEGTCRLVNFRPISHVNVASGDVPGFVSNGPTVITEIKG
FT                   LRMQVLVNGEPQTKLDENQPSIKFSSPIEIQLLRDASPELGNGTTADSIQFWFFTKTTS
FT                   GTNRIDNYIRLNTRLTRIEGSCSVPSQTVELQPTRARTLAGIGTTAAERSFQISINNCP
FT                   KGYNKILYRLKPLGDTVETSAGVLPLSAQSTAKGVRIRVTDSAGAAVVFDTSNRIDAYS
FT                   KDTGGSFSIPMRVSYVQTEANVTPGTVNGAMSVLMEYQ"
FT   sig_peptide     13272..13370
FT                   /locus_tag="Rpic12D_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            14723..15487
FT                   /locus_tag="Rpic12D_0011"
FT   CDS_pept        14723..15487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0011"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG: rso:RSc2102
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61323"
FT                   /db_xref="GOA:C6BJT4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJT4"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACS61323.1"
FT                   /translation="MHSIPSSVAQALQQRILSGEYPSGSRLPPQRELAESLGVSRASLR
FT                   EALTVLETLGLVDILPSRGVVVRGQKFGAEGASAERMHRPFATPALGTLSPRQLIELRL
FT                   VLEPGWTALAAARMHAAGLRHLQWLQRQLAHALERNDLLSAAEADLHFHLLLAQLSGNP
FT                   GLMAMAGQLEHAIGHSLRLPFARNGADDHPAHEHDAIVQAIAAGDTAASAEAMRAHLLS
FT                   AARRSGIDLTAPPATPEPMQHESVSFRLASIS"
FT   gene            15515..16342
FT                   /locus_tag="Rpic12D_0012"
FT   CDS_pept        15515..16342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0012"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   rso:RSc2103 amino-acid-binding periplasmic (PBP) ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61324"
FT                   /db_xref="GOA:C6BJT5"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJT5"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS61324.1"
FT                   /translation="MTRITARHASRPTSRRFFLHAVMAASAVAALLPGRPAHADALANI
FT                   QKAGVIRVAIPNDFPPFGSLGPDLKLQGYDIDMANLVAKELGVKAELVPVTSTNRIPFL
FT                   TTGKVDVVISSLGKNAERAKVIDFTQAYAPFPKSVYGPKDVSIKAPADLAGKTIGVTRG
FT                   STEDLALSAVAPASATIKRYEDNNATAQSYLIGQVQLVTVGNIVANAVNERTKLRQLDL
FT                   KFPVEDTPCYVGVAKGEPALLDKVNAVITKLKTDGRLNDLSQRWIKMPLPAKL"
FT   sig_peptide     15515..15634
FT                   /locus_tag="Rpic12D_0012"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 40"
FT   gene            16501..17235
FT                   /locus_tag="Rpic12D_0013"
FT   CDS_pept        16501..17235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0013"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rso:RSc2104
FT                   amino-acid transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61325"
FT                   /db_xref="GOA:C6BJT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJT6"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS61325.1"
FT                   /translation="MAYQFDFGAVFSYSGQLAQGAAFTLALTAAGAVLGGAIGIVGGVC
FT                   RAWRIAPFNALFKVYVEGIRNTPFLVQLMFMFFGLPSLGVQINEWQAALLTAVVNLGAY
FT                   ITEIVRAGIQETPRGQLEAANALAMSRWAIFRHVVLRPALQKVWPALSSQIVIVMLGTS
FT                   VVSQIAAQDLTFAANFIQSRNFRAFETYLVVTALYFALALLLRQLLAWIGQRFIVGRRA
FT                   PAVSAAPLATPANAAASVGDAA"
FT   gene            17232..17885
FT                   /locus_tag="Rpic12D_0014"
FT   CDS_pept        17232..17885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0014"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rso:RSc2105
FT                   amino-acid transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61326"
FT                   /db_xref="GOA:C6BJT7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJT7"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS61326.1"
FT                   /translation="MIADIPLLPILLKLREGLLATLMLSLMAFALGGTAGLVVLFARVG
FT                   RNATLQRVSKAYIQLFQNTPLLMQMFIVFFGASMAGFEMSPWTAAAIGLTLYTSAYLAE
FT                   VWRGCVEAIPRGQWEASSSLAMGYFQQMRHVVLPQAVRLSIAPTVGFSVQIVKGTAVAS
FT                   IIGFEDLSKLGSVLANATFQPFLIYGLVAIGYFALCWPLSLYASHLEKKLYAAR"
FT   sig_peptide     17232..17330
FT                   /locus_tag="Rpic12D_0014"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.523 at
FT                   residue 33"
FT   gene            17872..18609
FT                   /locus_tag="Rpic12D_0015"
FT   CDS_pept        17872..18609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0015"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RSc2106 amino-acid ATP-binding ABC transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61327"
FT                   /db_xref="GOA:C6BJT8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJT8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61327.1"
FT                   /translation="MPLVDLCAVHKHYGNNHVLKGVDLRVEAGQVVAIIGRSGSGKSTL
FT                   LRSINGLEAIDDGQIVVDNAVLQGSQATPARLRALRLNVGMVFQQFNLFPHLTAGQNVA
FT                   LSPVVVKGMKKADANDLARQMLVKVGLADKFDAYPDQLSGGQQQRVAIARALAMQPKVL
FT                   LCDEITSALDPELVNEVLAVVKQLAAEGMTLIMVTHEMRFARDVGDQLVFMHQGLIHES
FT                   GPAKEVFASPKTAELAAFIGAVQ"
FT   gene            18693..19640
FT                   /locus_tag="Rpic12D_0016"
FT   CDS_pept        18693..19640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0016"
FT                   /product="protein of unknown function UPF0187"
FT                   /note="PFAM: protein of unknown function UPF0187; KEGG:
FT                   rso:RSc3414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61328"
FT                   /db_xref="GOA:C6BJT9"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJT9"
FT                   /inference="protein motif:PFAM:PF05249"
FT                   /protein_id="ACS61328.1"
FT                   /translation="MVVRPHLHWFRMLLAWRGSVLPQLLPRLFLIFFVSLVAIAVHAHL
FT                   LPVSVNLSTTPFSLVGIALAVFLGFRNNASYDRYWEARKLWGQLLNTARSLTRQALTLP
FT                   RGDGPHDTSGPAADADVREFAQVLGALPHALRHQLRHTDARDDLAARLPVPLLERVMAS
FT                   RYRPIAIVQWLGEWVQRRAQAGTVDGYAALAFDRNLNELSNSIGGCERIAGTPLPFAYS
FT                   VMIHRTVYFFCAALPFGLVESIGSFTPVFAVFVAYTFMAHEAIASQLEDPFGTEDNDLA
FT                   LNALSNTIEDAVLDILGEPSPLPRAGVRRGVIFD"
FT   sig_peptide     18693..18824
FT                   /locus_tag="Rpic12D_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.715) with cleavage site probability 0.709 at
FT                   residue 44"
FT   gene            complement(19663..20334)
FT                   /locus_tag="Rpic12D_0017"
FT   CDS_pept        complement(19663..20334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reu:Reut_B4310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61329"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJU0"
FT                   /inference="similar to AA sequence:KEGG:Reut_B4310"
FT                   /protein_id="ACS61329.1"
FT                   /translation="MPLISRAHVRLSRLRFPFAVRVQSEQGTVCLRDANGRREVRPGNP
FT                   FVVPAFAHFGCEIPGTLWQPCAITFNAVPDAGCPRMAAIQHDKPWARAFATLVFEHPVQ
FT                   AWNAAMLSHCWQACPRQVRARLFAEGEALHALVREQRAAWVLYRLAHTCGNDEPEAEAL
FT                   HALARRAGLRNARTLNETCASLFGVELGALLAGSADSASGSVHGSTAPLERWAQPLAMA
FT                   L"
FT   gene            complement(20437..21135)
FT                   /locus_tag="Rpic12D_0018"
FT   CDS_pept        complement(20437..21135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0018"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: regulatory protein Crp; KEGG: reh:H16_B1147
FT                   cNMP regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61330"
FT                   /db_xref="GOA:C6BJU1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJU1"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACS61330.1"
FT                   /translation="MTTPRAPTPATQLEGHAWFTALAPEHQALAARETLLQAFEPGAFI
FT                   ARRGEPSRYWIGVDTGLIKLAVYTADGRGCTFSGVPAGGWCGEGSVIKREDRRYDVIAI
FT                   RASHVLLVPEPVFNTLLAQSLPFASFVVRQLNERMGQFIATVQNDRLLSADARVAQAIA
FT                   QLFHPALYPRTSTVLELSQEEIGLLTGLSRQRVNRALQRLAEGGMIALSYQTIRVTDLE
FT                   RLRLFGLSEL"
FT   gene            21329..22963
FT                   /locus_tag="Rpic12D_0019"
FT   CDS_pept        21329..22963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0019"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   cti:RALTA_B1051 putative AMP-dependent synthetase and
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61331"
FT                   /db_xref="GOA:C6BJU2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJU2"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACS61331.1"
FT                   /translation="MPTDFDSGLARNAANFVPLTPIEFLARAADVYGDRLAIVHGPVRQ
FT                   NWRDTYERARRLASALSLAGVGRGDTVAALLPNTPAMVEAHFGVPMAGGVLNALNIRLD
FT                   AANLVFMLRHGEARVLLADTEFAELARQMALEIPGLKVIAVNDALGPQAEPFGDTDYES
FT                   FLASGDPHYDWQMPADEWDAIALNYTSGTTGDPKGVVYHHRGAAINAVSNILEWDLPKH
FT                   PVYLWTLPMFHCNGWCFPWTIAARAGVNVCLRKFEPKLVFDLMRDEGVTHYCAAPIVHT
FT                   ALVNAPPSWREGLRGPVRGMVAGAPPPAAVLAQMEAMGFELTHVYGLTEVYGPAAVCAE
FT                   QDEWRTLPEHDRATMKARQGVRYHLQSQVAVLNPETMQPVPADGETIGEIMFRGNICMK
FT                   GYLKNEKATREAFAGGWFHTGDLGVCMPDGYIKIKDRSKDIIISGGENISSVEVEDALY
FT                   RHPAVLAAAVVAQPDAKWGETPCAFVELKDGATATAEDLIAHCKTLLAGFKVPKAVFFG
FT                   PLPKTSTGKIQKYELRRKVKSTSAIDV"
FT   gene            complement(23072..24637)
FT                   /locus_tag="Rpic12D_0020"
FT   CDS_pept        complement(23072..24637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0020"
FT                   /product="40-residue YVTN family beta-propeller repeat
FT                   protein"
FT                   /note="TIGRFAM: 40-residue YVTN family beta-propeller
FT                   repeat protein; KEGG: rso:RSc0127 putative
FT                   hemagglutinin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61332"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJU3"
FT                   /inference="protein motif:TFAM:TIGR02276"
FT                   /protein_id="ACS61332.1"
FT                   /translation="MAELLIAKAQGSSAHTQPTPAPIPPDAPRHARGMHGAALVMAAAL
FT                   SLGLTACGGGDDAGTTTPPTNNNTPAPTPSPAPAPAPKPTPSPSPAPTPTPAPTPAPAP
FT                   ATYSVGGTVSGLTSGKSVTLLDNGGDAVVVNANGSFNFPTKLAQGKPYAATVGTRPSGE
FT                   NCTVTNGSGTVGTSNVTTIAVACTPKPLFGYAVNSNDGTISAFTLDATTGMPTAVGTAV
FT                   AVGAGPLSLTIDPAGKFVYVANANANTVTTLSINADTGLLTVVGSATPTGVQPYSIART
FT                   PNGKFAYTANYGDNTLSAFSVNAGTGALTALAPITAGANPYTVAINSAGTFAYVVNANS
FT                   GATPGTAMAFAVNNTTGALTQVGTTVNTGNTPQFIAVNSAGTYAYVTNAADNTISVYSI
FT                   SNTGALTASGTPVAAGTNPYYIAIAPSGGFMYVTNVLANTVSVFSINPSNGALTAVATT
FT                   PTGNAPVTVLVNPAGTFAYVVSAVDNSVSAYSIDSTTGKLTAVASGSAATGNIPRGMAI
FT                   VAVP"
FT   gene            24853..25398
FT                   /locus_tag="Rpic12D_0021"
FT   CDS_pept        24853..25398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0021"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bte:BTH_II0494 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61333"
FT                   /db_xref="GOA:C6BJU4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJU4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS61333.1"
FT                   /translation="MSNANPNSNNTVLIRQLSSADANDVADYRAIRLAALKDSPDAFGS
FT                   TYEAEAGLSTEAFAERLATTIVLGAYAGTGSDVRIVGMIGFKQQTIAKLAHKGFLWGFY
FT                   VAPAARGRGVGVALVDRIVAAATDLVQQLTLSVVRGNDAALALYERCGFETYGAEPRAL
FT                   KSTTGYADEVLMVRFLHG"
FT   gene            complement(25484..25954)
FT                   /locus_tag="Rpic12D_0022"
FT   CDS_pept        complement(25484..25954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0022"
FT                   /product="alkylhydroperoxidase like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   bte:BTH_I0996 carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61334"
FT                   /db_xref="GOA:C6BJU5"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJU5"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACS61334.1"
FT                   /translation="MSQAPRIAYFQLAPKAFNNLLNLSNGLRRDLLGARLVDLVLLRVS
FT                   QINGCAFCIDMHWSDLMKMGEDPRHLNAVAGWREAPFFTERERAALRWAELVTNTPHSD
FT                   ASDEEFARLRTHFSDEEIAELSFVIVTINSWNLLNVSLRNPVPLNAPYAAAA"
FT   gene            complement(26093..27004)
FT                   /locus_tag="Rpic12D_0023"
FT   CDS_pept        complement(26093..27004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0023"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma-70 factor; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bte:BTH_I0997 ECF subfamily RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61335"
FT                   /db_xref="GOA:C6BJU6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014303"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJU6"
FT                   /inference="protein motif:TFAM:TIGR02957"
FT                   /protein_id="ACS61335.1"
FT                   /translation="MTSQPHPDRATRTDREDTAFSAARPRLFAIAYRMLGSRADAEDVL
FT                   QDAWMRWHQTDRTELQSAEAWLVTVVTRLSIDRLRAAKTEREAYVGWWLPEPLVEPESH
FT                   AHTPETAVELAGDVSMALLWVLERLSPEERAAFLMRQVFDQDYSEIAALLGKTEAACRQ
FT                   MVHRASERVQQERPRFDVAPDAHRELLARFAEASRTGQRDAIRALLADDAQLVGDGGGK
FT                   VPSFMRIIQDAGQITKIYCELVRAMGDVRYVQARVNGEPGLLRYVEGKLESAQSFVIEN
FT                   GQIVAIYVVRNPDKLAHIGIGA"
FT   gene            complement(27076..29280)
FT                   /locus_tag="Rpic12D_0024"
FT   CDS_pept        complement(27076..29280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0024"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: bvi:Bcep1808_3441 PAS/PAC sensor hybrid
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; response
FT                   regulator receiver; SMART: ATP-binding region ATPase domain
FT                   protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61336"
FT                   /db_xref="GOA:C6BJU7"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJU7"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACS61336.1"
FT                   /translation="MPFLAHHHDCLGWNGEMAQRVLAFDWASTELGPIQDWSPSLRAAV
FT                   QMVLACPVPLVMLWGRHGYMVYNDAYAVFAGGRHPYLLGCPVELGWPEVADFNRHVMDV
FT                   CLGGGTLSYRDKELVLLRNGRPEDVWMDLYYSPLPDDTGRPAGVLAIVVETTERVQTER
FT                   ERQAAEQALRQLTETLEQRVADALSARAEVEAQLRQAQKMEAIGNLTGGVAHDFNNVLQ
FT                   VIAGNLQMLAVEAPGNTRVQHRVAAATRAVQRGATLAAQLLAFARRQPLSPAVVNPTRL
FT                   IQGMSEMLHRALGEAIKVQTHLADDLWHVQADRNQLENALLNLAINARDAMRGGGVLTI
FT                   AATNVTLDSTQAQGRGQLAPGDYVVFSVTDTGVGMPPEVVEHVFEPFFTTKPDGHGTGL
FT                   GLSMVFGFVTQSGGHVAINSAVGRGTTVQLYFPRSTVAAQDDALELRDTVVTPMGGRET
FT                   ILVVEDDTDVRLTAVDMLTQLGYRVLTAANGEAALELMNSGTPIDLLFTDVIMPGPIKG
FT                   GELSIRAAQRVPPLPVLLVSGYTRDEILHDGRLPPGVTLLDKPYRRDDLARMVRNVLNS
FT                   SRTGQAQVQPTSTTSIDDAATAVADSSPPPTVLLVEDDTASREALQEVLATFGLQCLAA
FT                   ATAEDALALAHTRPVQVLLTDLTLPGRSGADLARALRPLHPHMDVLLMTGYGAHAEIGE
FT                   PIPGARVLAKPVELTLLHEALAPWLGTTVNAATRHVTNAA"
FT   gene            29521..30135
FT                   /locus_tag="Rpic12D_0025"
FT   CDS_pept        29521..30135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0025"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   rso:RSc0129 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61337"
FT                   /db_xref="GOA:C6BJU8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJU8"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ACS61337.1"
FT                   /translation="MKLIGMLDSPYVRRTAISLKLLGLPFEHAAVSVFRHFDQFSAINP
FT                   VVKAPTLVCDDGTVLIDSTLIIDYAETLAGRSLMPAAIAERQHALRVIGLALAACEKAV
FT                   QIVYEHNLRPSEKVHGPWVERVHSQLLAAVEALESEWKDAPLPVDQNELSQAGVTVAVA
FT                   WAFIQLMVPDRVPAADYPRLVAYSVAAEQLSAFRELPMEAV"
FT   gene            complement(30143..31291)
FT                   /locus_tag="Rpic12D_0026"
FT   CDS_pept        complement(30143..31291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0026"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: HPP family protein; CBS domain containing
FT                   protein; SMART: CBS domain containing protein; KEGG:
FT                   rso:RSc0130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61338"
FT                   /db_xref="GOA:C6BJU9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJU9"
FT                   /inference="protein motif:PFAM:PF04982"
FT                   /protein_id="ACS61338.1"
FT                   /translation="MSSSSLHPALRRWLHSFIPAPVTVRWSERVRSAVGALAGILFTGT
FT                   MMKMVPGASTLIPLLVAPMGASAVLLFAVPASPLAQPWSIIGGNLVAATVGVTFALLVN
FT                   DPVIASALAISAAIAGMFALRCVHPPSGAVALTAVIGGPAVHALGYRFVLEPILIQSAL
FT                   LLVGALVYHAATGHRYPHAQRLPAAERPPTAAGFTRADIVAALRRQSELLDIDPEDIEA
FT                   VLREMQLQAYTRTFQALTCADIMTAPVVTVSAGTSIPRALQLLRQHGFKALPVVDEGRR
FT                   VVGIVTRVDLLGLAPADLRQTLRRWFSIGALTPPRVADHMKTRVQTIAASAPMSDLVPM
FT                   FASAGHHHIPVLDADGRLAGIVTESDLVGGLYRQANIEPQAA"
FT   gene            31524..33509
FT                   /locus_tag="Rpic12D_0027"
FT   CDS_pept        31524..33509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0027"
FT                   /product="autotransporter-associated beta strand repeat
FT                   protein"
FT                   /note="KEGG: rso:RSc0131 lipoprotein; TIGRFAM:
FT                   autotransporter-associated beta strand repeat protein;
FT                   PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61339"
FT                   /db_xref="GOA:C6BJV0"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001011"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR013425"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJV0"
FT                   /inference="protein motif:TFAM:TIGR02601"
FT                   /protein_id="ACS61339.1"
FT                   /translation="MSFTARPAFSRPRLWFSLVALFGALALTACGGDDTTSSTPVATTQ
FT                   AIPAPPADPGFVDTAAVATGVPAFVDNIATNQRGDARYATLGTNAGVRLFTRFLDLWQP
FT                   LTEIVDAGVSAPANGSFPAVVASTWTGLPNDGTAGGTQLNLPVLNANVQYVVNATTNRT
FT                   QAQADAAYFDDRRGKGYSVSDGMGPLTTAWRTLAQQTTSITTVPADATTVLYNDSGNNT
FT                   GVGTSAGNTAFGKVVDLINTVGNNASTEPSKRFYKYARPYRWSSSVVVVPTLVPAESPT
FT                   PTTDGGFISGHSAEAVRDTVAMAYLVPERFQQILARGMELGENRILAGMHSPLDVMSGR
FT                   MIGIAAAAANLVDPANAALKAAAFTQAHTALMAQTGTDATTFPALAQSGTLATDRFADY
FT                   ATNQANFTRRMTFGFTQIGATTLAPVVPKGAEVLLETRFPYLSADQRRVVLKTTELASG
FT                   YPVLDDAEGWGRLNLFAAADGYGAFNGNVIVSMDATQGGFNAADSWRNAISGPGKLTLQ
FT                   GTGRLRLAGVNTYTGGTQVAGGVLEADSANAFGAGDVYVGAGTLAVNAPAAVAIAGKFT
FT                   QLQGTTLDLAIGPNGQGKLSVAGLTTIAGGTLHVKFVNGYTPKVGDTIAVLDGAGSNRQ
FT                   FTSVVVDGFQATAIYTATGIQIHLDA"
FT   sig_peptide     31524..31619
FT                   /locus_tag="Rpic12D_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.859 at
FT                   residue 32"
FT   gene            complement(33530..34369)
FT                   /locus_tag="Rpic12D_0028"
FT   CDS_pept        complement(33530..34369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0028"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: transcription activator effector binding;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: rso:RSc0132 transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61340"
FT                   /db_xref="GOA:C6BJV1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJV1"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ACS61340.1"
FT                   /translation="MLAHIDAHLEDALDVDVLAEVAAFSRYHFHRQFSLLFGMNVGRYL
FT                   QLLRLKRAAHQLAYRDDVRITDIALACGYEGPEAFARAFRRQAGQSPSAFRAAPQWASW
FT                   ATDLQALRDLRSQHMPAQPQIQSVEIVEREAVAVAAIEHRGDPARLGETLRRFIAWRRE
FT                   HRLHPSVSATYNVVYDNPDDVPPEAFRMDICAATFAPIAPNAAGVAGKTLAGGRYAVLR
FT                   HTGSDDTLAQSVAYLYADWLPASGEELRDAPLLFQRVRFYPDVPEHEAETDVLLPLR"
FT   gene            34681..34974
FT                   /locus_tag="Rpic12D_0029"
FT   CDS_pept        34681..34974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0029"
FT                   /product="GYD family protein"
FT                   /note="PFAM: GYD family protein; KEGG: rso:RSc0133
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61341"
FT                   /db_xref="InterPro:IPR014845"
FT                   /db_xref="UniProtKB/TrEMBL:C6BJV2"
FT                   /inference="protein motif:PFAM:PF08734"
FT                   /protein_id="ACS61341.1"
FT                   /translation="MATFLALLNFTDQGIRSVKDTTKRAAAARELAKAAGIDMKAIYWT
FT                   LGQYDLAVICEGPDDAAMTAFGLALAAAGNVRSQTLRAFSADEMNGILSKMP"
FT   gene            complement(35045..36235)
FT                   /locus_tag="Rpic12D_0030"
FT   CDS_pept        complement(35045..36235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0030"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="KEGG: rso:RSc0134 S-adenosylmethionine synthetase;
FT                   TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61342"
FT                   /db_xref="GOA:C6BK73"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK73"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ACS61342.1"
FT                   /translation="MSNDFLFTSESVSEGHPDKVADQISDAILDAILAQDKYARVAAET
FT                   LCNTGLVVLAGEITTTANVDYIQVARETIKRIGYDNTDYGIDYKGCAVLVAYDKQSPDI
FT                   AQGVDRASDDYLNQGAGDQGLMFGYACDETPELMPFPIYYAHRLVERQSQLRRDGRLPW
FT                   LRPDAKSQVTVRYVDGKPHSVDTVVLSTQHAPEMSQEAIREAVIEEIIKPVLPSHMLAD
FT                   TKYLVNPTGRFVIGGPQGDCGLTGRKIIVDTYGGAAPHGGGAFSGKDPSKVDRSAAYAA
FT                   RYVAKNVVAAGLARQCQVQVSYAIGVARPINITVYTEGTGVIPDDQIAKLVHEHFDLRP
FT                   KGIVQMLDLLRPVYEKTAAYGHFGREEPEFSWEATDKALLLREAAGLTGQPAKAFA"
FT   gene            36475..37323
FT                   /locus_tag="Rpic12D_0031"
FT   CDS_pept        36475..37323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0031"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   rso:RSc0135 lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61343"
FT                   /db_xref="GOA:C6BK74"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK74"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="ACS61343.1"
FT                   /translation="MTFLFWLFSRLPLSALQALGGWLGALAAKVPGRYHDRLIANFRHA
FT                   YPDVTPAMLKEAGRSAGRMVFEMPYFWVRKNGAQVAPHLFDVCRTVIERALADGRGLIF
FT                   LTPHLGCFEVLPQAYANEHPVTSLFKPPRKESLRAWIEHMRTGPNMHMAPADPRGVRML
FT                   VRALKRGEAIGILPDQTPTAGEGVWAPFFGKPAYTMTLVHRLHRLTGAPVVALFAERLP
FT                   RGAGYRLHLEEIGDLPEDATQAATRINAAVERLIAVAPTQYLWGYNRYKHPKGADAPPA
FT                   A"
FT   sig_peptide     36475..36558
FT                   /locus_tag="Rpic12D_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.800 at
FT                   residue 28"
FT   gene            37337..38230
FT                   /locus_tag="Rpic12D_0032"
FT   CDS_pept        37337..38230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0032"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   rso:RSc0136 lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61344"
FT                   /db_xref="GOA:C6BK75"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK75"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="ACS61344.1"
FT                   /translation="MERLSAKLGLGFLWLLSFLPYGFVARFGEGLGGLLYRIPNGRRRV
FT                   VLANLRACFPEKSEAEREAMAHEVFRKVFRSFAERSFAWFASEKRLMRVVKIDDQANLP
FT                   ALHGQPHILVTLHLSGVEIGALALTDYLRKHVGNAGCSLYTRMANPVLDDAIKALRSRF
FT                   GATMVSRNENIRQIMRTIKRGEALQLISDMDFGERDSEFVPFFGVPALTLNAIPRMASM
FT                   TGAKVVPMYTEILPNYEGYALRILPAWENYPTGDLTADTRRMNAFFEDAIRPRITEYYW
FT                   VHKRFKHRPEGMPGIY"
FT   gene            38320..39198
FT                   /locus_tag="Rpic12D_0033"
FT   CDS_pept        38320..39198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0033"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="KEGG: rso:RSc0137 diaminopimelate epimerase;
FT                   TIGRFAM: diaminopimelate epimerase; PFAM: diaminopimelate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61345"
FT                   /db_xref="GOA:C6BK76"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK76"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ACS61345.1"
FT                   /translation="MKLHFTKMHGAGNDFVVLDGIQTPIDFTPEQWAAIADRHFGVGAD
FT                   QLLLVERSTRPDVDFRYRIFNHDGGEVEHCGNGARCFVKFVTDRGLTDKRTVRVEVMNG
FT                   IATLTMQDDGQVTVDMGAPVFEAARLPFLPEGLPTRVEGDDTQHALQINGRTEWLSTVS
FT                   MGNPHAVQIVDDTEAFPVLEDGPLIESHAVFPRRVNAGFMQIVDRHSVRLRVYERGAGE
FT                   TLACGTGACAAVVAGIRRGVLDSPVKVTTHGGDLTIAWAGGGQPVMMTGPATTVFEGTL
FT                   DLDALKLTVAH"
FT   gene            39246..40073
FT                   /locus_tag="Rpic12D_0034"
FT   CDS_pept        39246..40073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0034"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   rso:RSc0138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61346"
FT                   /db_xref="GOA:C6BK77"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK77"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="ACS61346.1"
FT                   /translation="MASNGKNPIDDWYFDGSSKFKIAKFDPAAKPCTTGSKAGDLARLA
FT                   ELSARIEALQDIFYAEHRRKLLVVLQGMDTAGKDGTVRTVFRALDPLGLRVVGFKVPTP
FT                   LELAHDFLWRIHAEVPAAGEIVIFNRSHYEDVLVTRVHGDIDAAECKRRYAHINAFEQM
FT                   LTETGTTIVKCFLHISKEEQRDRLQMRIDDPQKHWKLGMADIEERKFWEDYMAAYEDAI
FT                   NATATPHAPWHIIPANSKSHRSLMVAEILLQVMERLQPEYPVGNPAFLGLKIE"
FT   gene            complement(40199..40876)
FT                   /locus_tag="Rpic12D_0035"
FT   CDS_pept        complement(40199..40876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0035"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: rso:RSc0139 orotate phosphoribosyltransferase;
FT                   TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61347"
FT                   /db_xref="GOA:C6BK78"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK78"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ACS61347.1"
FT                   /translation="MSQNSELRQSFIRFAVEAGVLSFGEFVTKAGRTSPYFFNAGKFAD
FT                   GALLGQVAQFYAKTLLDSGVEFDMLFGPAYKGITLASATAVALAGLGRNVGFAYNRKEA
FT                   KDHGEGGSLVGAKLQGRVVIVDDVISAGTSVRESVELIRAAGATPAAVLILMDRMERSG
FT                   NAVDIGERSAVQDVQAQYGMPVVSIANLDDLLGYLDNAGDPALAGYREKAAAYRDKYGV
FT                   SAI"
FT   gene            40910..41695
FT                   /locus_tag="Rpic12D_0036"
FT   CDS_pept        40910..41695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0036"
FT                   /product="exodeoxyribonuclease III Xth"
FT                   /EC_number="4.2.99.18"
FT                   /note="KEGG: rso:RSc0140 putative exodeoxyribonuclease III
FT                   protein; TIGRFAM: exodeoxyribonuclease III Xth;
FT                   exodeoxyribonuclease III; PFAM:
FT                   Endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61348"
FT                   /db_xref="GOA:C6BK79"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK79"
FT                   /inference="protein motif:TFAM:TIGR00633"
FT                   /protein_id="ACS61348.1"
FT                   /translation="MLRIISANLNGVRSAASKGFFDWMGKQDADFVCVQELKCAQDDMT
FT                   PEFLAPHGYHGVFQHAVKKGYSGAGLYTRHKPDEVIVGFDNGEFDAEGRYVEARYGKLS
FT                   VISVYVPSGSSGEERQQAKFRFMDLFMEHLKDLRHEKGREVVLCGDVNIVHKEIDIKNW
FT                   KGNQKNSGCLPEERAWLTKLFDEVGYVDVFRTLDQRPEQYTWWSNRGQAYAKNVGWRID
FT                   YQIATPGIAATARRASIFKDIKFSDHAPLTIDYDTKPHW"
FT   gene            41823..42836
FT                   /locus_tag="Rpic12D_0037"
FT   CDS_pept        41823..42836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0037"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: rso:RSc0142 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase NAD - binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61349"
FT                   /db_xref="GOA:C6BK80"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK80"
FT                   /inference="protein motif:TFAM:TIGR01851"
FT                   /protein_id="ACS61349.1"
FT                   /translation="MAFKVFVDGQEGTTGLRLLDYLSQRDDIELLRIAEDKRKDSAERA
FT                   KFLNAADVAFLCLPDVASREAVSLVNNPNTCIIDASTAFRTSDDWVYGLPELAQGQRER
FT                   LRNTKRIAVPGCHASAFVLLMRPLVDAGIVPADYPVTAFSLTGYSGGGKAMIADYLAAN
FT                   NPKLDSPRPYALALAHKHLPEMRVQSRLSLAPIFTPVVGNFLKGLAVTIGLHPQHLARK
FT                   VSPTDIARVLADYYQGEQFIRVAPADNVATLDNGFFDVQGANDTNRADLFVFGSDERMV
FT                   VTARLDNLGKGAAGAAVQCMNVHLGVDEATSLHVEAPIPAAGAEHAVREAAPGFAS"
FT   gene            complement(42908..43816)
FT                   /locus_tag="Rpic12D_0038"
FT   CDS_pept        complement(42908..43816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0038"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: rso:RSc0145 putative
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61350"
FT                   /db_xref="GOA:C6BK81"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK81"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACS61350.1"
FT                   /translation="MPQVTASKLPVKLLALVFGAVAALVIGRTFLLNWQIIPPGYTGIK
FT                   INRLVDRGITHENVVTGFVFYNPVQTAIIQYPTYVQRVIWTQDVNEGRALNEELTFNTK
FT                   DAVPVNVDVAVSYQLDREKVPAFYTNFRADRIETFTHGYLRDTARNVIVAMGSEYNFDD
FT                   VNGGKKEEFVARLTKELDTRLAPLGVSIKQFGIVGSLRPPRALLDAVSAKTKAIQDAIR
FT                   TENEVRSAQAEAKKKVAIAEGEAAANHALASSLDDRLLAWERLKLERAAIEKWNGVTPS
FT                   VMAGGNGGGMLFNIPAGAQSK"
FT   gene            complement(44125..44880)
FT                   /locus_tag="Rpic12D_0039"
FT   CDS_pept        complement(44125..44880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0039"
FT                   /product="protein of unknown function DUF218"
FT                   /note="PFAM: protein of unknown function DUF218; KEGG:
FT                   rso:RSc0146 lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61351"
FT                   /db_xref="GOA:C6BK82"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK82"
FT                   /inference="protein motif:PFAM:PF02698"
FT                   /protein_id="ACS61351.1"
FT                   /translation="MSLTILCVLVIVATVCAARGRRRAARGLAVLCGVLVIAIGCGPMP
FT                   AWLLDSLEKPFENEPHIQWGTRNAIVLLGAGTFRVGDSVEPGLFSYPRLVETTQLYQAC
FT                   RKSDGDCKILVSGGDARHHGSPEATVYQRELVRLGVAKDDVLIEPQSMNTWQNAQFSRT
FT                   VLAQYAPDRTVLVSSAIHLRRSLLYFTHFGMAPIPVRADDLQAAASPLPMAYNFALTDF
FT                   ALHEWIGIARYHMYNALGWNPARINPGDA"
FT   sig_peptide     complement(44806..44880)
FT                   /locus_tag="Rpic12D_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.785) with cleavage site probability 0.350 at
FT                   residue 25"
FT   gene            complement(45002..45607)
FT                   /locus_tag="Rpic12D_0040"
FT   CDS_pept        complement(45002..45607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61352"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK83"
FT                   /inference="similar to AA sequence:KEGG:RSc0148"
FT                   /protein_id="ACS61352.1"
FT                   /translation="MLKRFKHLFSRPASTPVSEDPLRDDDILRDDFSPSAETLDALAEF
FT                   VRLVGGPCGQAEADQIADSVRTGDLPGDDIAGLLTWSLARNLGDGAPWTLAISVDWKAW
FT                   DEIEWQTEKLLDTLGIEARWEWTRAEAERTVADGLLDFGAWLRPHGYELLHVDTGGDDY
FT                   FAFPIRADLLQEARLYAERAGLKIEQADDFRASQGLSL"
FT   gene            complement(45633..46145)
FT                   /locus_tag="Rpic12D_0041"
FT   CDS_pept        complement(45633..46145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0041"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: rso:RSc0149 transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61353"
FT                   /db_xref="GOA:C6BK84"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK84"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACS61353.1"
FT                   /translation="MGQGDSTSPQGAPMDNILAQWRRERPDIDPSPMAVCGDVWRAGER
FT                   LRSGVVANVAGADLDMAGFDVLLTLRRNGRDQALSPSALAKDMMLSTSAMTNRLDRLEK
FT                   RGLIARKTDPDDRRGLQIVLTDEGFALVDSLVASHVQTEERMLAALSPAERAMLRELLG
FT                   KIGGVGG"
FT   gene            46363..47271
FT                   /locus_tag="Rpic12D_0042"
FT   CDS_pept        46363..47271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0042"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rso:RSc0151 putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61354"
FT                   /db_xref="GOA:C6BK85"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK85"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS61354.1"
FT                   /translation="MQFNRLALMLATAAAPVLWGTTYLVFTQTLPVGHPLLVGALRALP
FT                   AGVLLMLLGPGLPPRSKLLPLLFLGLANIGVFFALLFLAAQRLPGGVAATIMSAQPLVV
FT                   ALLAWPLLARKPRPAQLAAALAGSMGVGLLILGPAARLDAIGVAAALAAAFSMAMGTVL
FT                   IERWGRIGTPLAVAAWQLALGGLVLLPVALCVEGLPPMLTARNAVGFAYLIVIGTALGY
FT                   WLWVRGIGVLGADVTFLSLLSPLTATVLGALVLGEWFSPMQTGGAVLILGATVAGMALS
FT                   RRARREPAVQRPGSSEQLQPH"
FT   sig_peptide     46363..46425
FT                   /locus_tag="Rpic12D_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.909 at
FT                   residue 21"
FT   gene            complement(47280..48224)
FT                   /locus_tag="Rpic12D_0043"
FT   CDS_pept        complement(47280..48224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0043"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: rso:RSc0153
FT                   putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61355"
FT                   /db_xref="GOA:C6BK86"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK86"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACS61355.1"
FT                   /translation="MPRVTRSLLTAIGLALSAWATAMDGPLPVPADGVKLEAPTTTSPN
FT                   IRLVIPAEEIDKRALAEYQGIIDNAAHEGALAPDNVPDLIRIRSIVRRLTPQAPRWNPD
FT                   AAHWQWEVNLIGSSQVNAFCMPGGKIAVFSGLLEQFKLTDDELAMALGHEIAHALREHA
FT                   RARAGQREITNLGANVISQLFGFGNRGDTDLGEGAKMHLLAFSRAEETEADLVGMDIAS
FT                   RAGYDPRAALTLWQKMGSIGGTEQKQFLSTHPSGRTRMAVLSRHLPETLTLFADARHMT
FT                   MAKLPEYRSNMQYLGAAPVDNGDEAPMRPMVRR"
FT   sig_peptide     complement(48162..48224)
FT                   /locus_tag="Rpic12D_0043"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.536 at
FT                   residue 21"
FT   gene            48322..49611
FT                   /locus_tag="Rpic12D_0044"
FT   CDS_pept        48322..49611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0044"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RSc0154 muropeptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61356"
FT                   /db_xref="GOA:C6BK87"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK87"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS61356.1"
FT                   /translation="MTFHDYLDIFRNRRIGAMLLLGFASGLPLALTSGTLQAWMTVEGL
FT                   DIRTIGLFSLVGQAYIFKFLWAPLMDRFTPPLMGRRRGWLVLTQAGLVVSIAAMAFTPP
FT                   HAALWALAGLAVLVAFLSASQDIVFDAYSTDVLHTSERGVGAAVKVLGYRLAMLVSGGL
FT                   ALYLADRVMGWSNMYLLMAGLMALGIFTTLWSPEPEVSARPPRSLQEAVVGPLRDFFSR
FT                   RGAWALLALIVLYKLGDAFAGSLSTTFLIRGVGFSAGEVGIVNKTLGLAATIVGALYGG
FT                   TLMVRLGLVRALLIFGVLQAVSNLGYWVLAVTPQHLWTMAVAIGIENICGGMGTAAFVA
FT                   LLMALCNRSFSATQYALLSALASIGRVYVGPTSGYLVEAYGWPAFYLMTVVFAFPGLAL
FT                   LWWMRGTIGRYEAEQNERALEAKTAKAASA"
FT   sig_peptide     48322..48438
FT                   /locus_tag="Rpic12D_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.786 at
FT                   residue 39"
FT   gene            complement(49616..50809)
FT                   /locus_tag="Rpic12D_0045"
FT   CDS_pept        complement(49616..50809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0045"
FT                   /product="protein of unknown function DUF185"
FT                   /note="PFAM: protein of unknown function DUF185; KEGG:
FT                   rso:RSc0155 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61357"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK88"
FT                   /inference="protein motif:PFAM:PF02636"
FT                   /protein_id="ACS61357.1"
FT                   /translation="MSKTVSLPLPNEAAQAQSAHLFAVIADAIAGAGGWLPFDRYMELA
FT                   LYAPGLGYYSGGAAKFGRRVEDGGDFVTAPELTPFFGRTVAHQIAQVLQALPEGQRHVL
FT                   EFGAGTGKLAADILTELDALGARPDSYGIVELSGELRQRQQERLTALGPQLAALARWHD
FT                   TLPAPFTGVMIGNEVLDAMPVSLWARRGGVWHQRGVMLDADNGLQWEDRLVSPSEVPAK
FT                   LAALPGTDDFVTESHEAAEGFIRSAGAALERGLLLLIDYGFPAAEYYHAHRANGTLMCH
FT                   YRQHAHDDPFWLPGLQDITAHVDFSGIAQAGQEAGLELLGYTSQARFLLSAGVGELLMR
FT                   LDPSDPMQFLPAANAVQKLLSEAEMGELFKAIALGKGIDAALPLAGFADADRSNRLG"
FT   gene            50826..51644
FT                   /locus_tag="Rpic12D_0046"
FT   CDS_pept        50826..51644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0046"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rso:RSc0156 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61358"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK89"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS61358.1"
FT                   /translation="MAQTPNQSTAESTAESATQRRIALVTGAGRRVGRVIALALARHGW
FT                   DVAVHCHRSRTEADAVAAEITAMGRRAVVLQADLSDEAAAGRLIADCSAALGTPTCLVN
FT                   NASLFQYDVATSFSYASLDTHMRTNVAAPLLLSRELHRALTADGAEHRGVVINLLDQKL
FT                   DNLNPDFLSYTLSKAALSTATMQLAQALAPALRVVGVAPGITMVSGDQSQGGFARAHQM
FT                   TPLGQSSTPEDIAEAVCYLATARAVTGTTLFVDGGQHLMPLARDVMFLTE"
FT   gene            51664..52062
FT                   /locus_tag="Rpic12D_0047"
FT   CDS_pept        51664..52062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0047"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="PFAM: dihydroneopterin aldolase; KEGG: rso:RSc0157
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61359"
FT                   /db_xref="GOA:C6BK90"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK90"
FT                   /inference="protein motif:PFAM:PF02152"
FT                   /protein_id="ACS61359.1"
FT                   /translation="MLSLLSHPRLSHCRRMFLRNYEVQINIGVHEFEKKGEQRVLINIE
FT                   LYVPLEHSSPTEDKLHEVVDYDFMRETVARRMAQGHIHLQETLCDDVLTAMLKHPHVLA
FT                   ARVSTEKPDVYPDCESVGVEVFRIKESG"
FT   gene            complement(52342..53271)
FT                   /locus_tag="Rpic12D_0048"
FT   CDS_pept        complement(52342..53271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0048"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /note="PFAM: Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   rso:RSc0158 arginase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61360"
FT                   /db_xref="GOA:C6BK91"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK91"
FT                   /inference="protein motif:PFAM:PF00491"
FT                   /protein_id="ACS61360.1"
FT                   /translation="MTIIDLIGAAIGCGAQDDGCKDGPRVLLEAGALARLQTPDTQATL
FT                   VHDIELATSAGHSRSARLAALPGVAGFSRALGDATAHSVHQGHVPVVIGGDHSCAIGTW
FT                   SGVANALRPKGPLGLIWIDAHLDSHTPQTSDSGAIHGMPLAALLGHGAAALTQIGDAAP
FT                   KLLPEHVVVIGARSYEPAERALLDLLGVRVIDAAEVARNGLRAVMADAIRQVKSGTAAF
FT                   GVTLDLDAFDPAVAPGVGTPETDGLTAQGMAQALAACARDARFAAFELVEYNPRHDKDG
FT                   ITAHLALDLLASVAGALHAQRREYATAA"
FT   gene            complement(53297..54523)
FT                   /locus_tag="Rpic12D_0049"
FT   CDS_pept        complement(53297..54523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0049"
FT                   /product="ornithine aminotransferase"
FT                   /note="TIGRFAM: ornithine aminotransferase; PFAM:
FT                   aminotransferase class-III; KEGG: rso:RSc0159
FT                   acetylornithine aminotransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61361"
FT                   /db_xref="GOA:C6BK92"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR010164"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR034757"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK92"
FT                   /inference="protein motif:TFAM:TIGR01885"
FT                   /protein_id="ACS61361.1"
FT                   /translation="MTTAMQHPSYALEDRYGAHNYAPLPVMLERGEGVWLFDTDGRRYL
FT                   DMMSAYSAVSFGHSHPKLVAALTEQAGRLTLTSRAFHNTELGPFLADVCRITRMDRALP
FT                   MNTGAEAVETAIKAARKWARDVKGLPPEAAEIIVFDNNFHGRTTTIVGFSSHDQYRYGF
FT                   GPFAAGFRRIPFGDADALRAAIGPNTGAILMEPVQGEGGIVEPPAGYLKLARELATRHN
FT                   VLLVCDEVQTGLGRTGDVLASWHEGVDADLVVLGKALGGGMVPVSAIAGREAVIGVFHP
FT                   GDHGSTFGGNPLAAHIGRAALGLLIEEQLPQRAARVGAAFVNELKTLVGHGVRQVRGRG
FT                   LMIGLQLDADIDAHDFAFALAERGVLTKDTYGNVVRLTPPLVIGEAELALALEAIRQTL
FT                   AGWPRREVA"
FT   gene            54653..55576
FT                   /locus_tag="Rpic12D_0050"
FT   CDS_pept        54653..55576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0050"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RSc0160 transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61362"
FT                   /db_xref="GOA:C6BK93"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK93"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACS61362.1"
FT                   /translation="MSHSPLRYLHSFLTVANEGSFVRAADRLAVSQPALSYQMRQLEQW
FT                   LGVPLFERSGRKLVLTRAGTSVRAWCRDAFAGLDELRAALHSGEMERVSLKLASGSSFG
FT                   RYVLMPALLTPSPESDAPLLDDVRLELAFGSDEEVFSHIESGRADLGFVYTPRTSRLFE
FT                   HHAVYTEEFVLACSARALRERTAPRTLADCAALPFVTYDESDAVYGLWFKALFRRMPET
FT                   TVSAHHVSDLEEVSTLVEADMGWSVLPLHAIQDAVERGRLEVVRPIVARRCLNTVFAVR
FT                   RTSSFPSEAQDRLLVRLAQLDAAARV"
FT   gene            55663..56415
FT                   /locus_tag="Rpic12D_0051"
FT   CDS_pept        55663..56415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0051"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rso:RSc0162
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61363"
FT                   /db_xref="GOA:C6BK94"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK94"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS61363.1"
FT                   /translation="MATSEPTSRGPGRPRRQDGVTQDGLRDRLLDIAVTLFARDGVGPT
FT                   TLAAIAREAGVTAPMVHYHFKSRDQLLDAVVEGRIRPLVDQVTRPALAIIADDAHLPDL
FT                   AQTLAGVAQRMVTVATATPWFPTLWIREIASEGGQLRERVFARIALERATLLVDRIARA
FT                   QAAGAVNAALQPPLVMVSVIGLAMLPLATRALWGRLPLADQVSDEAIGQHVAALLLHGI
FT                   GPVAAPEEAGGKQAKPKRKPKPKSKGRK"
FT   gene            56464..57438
FT                   /locus_tag="Rpic12D_0052"
FT   CDS_pept        56464..57438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0052"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   rso:RSc0163 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61364"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK95"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACS61364.1"
FT                   /translation="MRQALCMGRAGCWAAASAAAIVLAGCAKHDDRTYQGYVEGEFVYV
FT                   ASPVGGRLDHLGVQRGQTVNAGAPLFVLESVDETAARQQAAAQLQGAEAQLADLNVGKR
FT                   VPEVDAVRAQLAQAVAADKLSSTQLARDEAQFRAGGIAQSQLDASRSSAQTNAQRVREL
FT                   TNQLRIAQLPARNDQIRAQSAQVEAARAAVAQAQWRLDQKAQKATQGGLVFDTLYREGE
FT                   WVGAGSPVVRMLPPANVKVRFFVPQGVLGALKPGQAARLHCDGCAADINATVTYIATEA
FT                   EYTPPVIYSNATRDKLVFMVEARPAAADGPKLRPGQPVEVTLP"
FT   sig_peptide     56464..56523
FT                   /locus_tag="Rpic12D_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.467 at
FT                   residue 20"
FT   gene            57435..58415
FT                   /locus_tag="Rpic12D_0053"
FT   CDS_pept        57435..58415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0053"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RSc0164 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61365"
FT                   /db_xref="GOA:C6BK96"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK96"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61365.1"
FT                   /translation="MSANSPDSPDSRPHAGNGDYAIDVHGLNKHFGDKHVVKDLSMRVA
FT                   RGEIFGFLGPNGSGKTTSIRMMCGLLTPDSGSGSCLGYDILKESAQIKRRVGYMTQRFS
FT                   YWDDLSIRENLDFVARLYEMSNRREAVDHALEHLGLASRAKQLAGSLSGGWKQRLALAA
FT                   CMLHKPELLLLDEPTAGVDPKARRDFWEELHRLAAEGISVLVSTHYMDEAERCHKLAYI
FT                   AYGELLAQGTADEVIAAQRLSTWSVSGGNLVELGRKLEGQPGVDQTVAFGSVLHVTGAD
FT                   AQALEGTLRKLAAESGARTAPIDTGLEDVFIHMMKRSSDNYGAQP"
FT   gene            58412..59578
FT                   /locus_tag="Rpic12D_0054"
FT   CDS_pept        58412..59578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0054"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: rso:RSc0165
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61366"
FT                   /db_xref="GOA:C6BK97"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK97"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACS61366.1"
FT                   /translation="MKPEGNRFSLVRWWSVVLKEFLQLRRDRVTFAMMIGIPIMQLFLF
FT                   GFAINADPKHLLTGVIAADQSEFTRSFLASMRNSDYFDLATTLPDETSGREALAKGQLQ
FT                   FVVTIPPDFTRKLVRGEKPSLLVEADATDPAATGLAVASLSQLVQGVVSKDMKGALSPL
FT                   AGGAGGSASTAPPFDVRIHKLYNPEGITQYNIIPGLMGTILTMTMVMMTGLAMTRERER
FT                   GTMENLLATPVHPLEVMTGKIVPYIFIGLVQVTIILLMAFFVFQVPFVGSVWMVYVSAL
FT                   LFIVASLTVGITLSSLAQNQLQATQLTFFYFLPNILLSGFMFPFVGMPKWAQVIGNLLP
FT                   MTYFNRLTRGILLKGNGWFELWPSIWPLMVFTVVVLGVALRFYRKTLD"
FT   gene            59586..61325
FT                   /locus_tag="Rpic12D_0055"
FT   CDS_pept        59586..61325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0055"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: rso:RSc0166 outer membrane channel
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61367"
FT                   /db_xref="GOA:C6BK98"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK98"
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /protein_id="ACS61367.1"
FT                   /translation="MWTLWIRRADGGGASLVSSPAGADLLSLSCQRKVSKERRARDGDF
FT                   PLNLCNRAETGKTRSAQTVPRLFSARLQKFKAPSKAGYGQTVRRYVLTLRRALADRECL
FT                   LGVVIVAALSLSGCAVGPDFKAPAGPAATGYSAQPVSRETASAPVVGGEAQHLVDANVP
FT                   ADWWHLFRSPALDALVDEALRASPSVMQAEARLRQAQAEAQAQFGYALPSVDGTVSAVR
FT                   QQINPEAFGFNTPKPGPFTLYSASVSVSYALDIFGGVRRALEASQAQVDTQRYELEAAR
FT                   LSLAGNVVTTAVRIAALEAQIATTQRLAAKQRKQLEITERRLSVGGVAQVDAFSQRTLV
FT                   AQTDATMPPLMQQAAQQRHRLSVLLGREPGAGLPELPSLDALHLPDPLPVSLPSTLAQR
FT                   RPDIRAAEAMWHEASANVGVATANLFPRITLSAGLGSETTSFRNLLGAGSSIWNLGAGL
FT                   TQPIFHGGTLRAKKREAEAAYDAAGAAYKQAVLQGLQEVADALHAVNNDAQTLQARALA
FT                   TDQAHQTLRAAQARHAAGGISTLTLLDAQRQVDQATLQQVQSQADRLLDSAALMQALGG
FT                   GWQ"
FT   sig_peptide     59586..59657
FT                   /locus_tag="Rpic12D_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.743) with cleavage site probability 0.740 at
FT                   residue 24"
FT   gene            complement(61347..61613)
FT                   /locus_tag="Rpic12D_0056"
FT   CDS_pept        complement(61347..61613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0056"
FT                   /product="PAAR repeat-containing protein"
FT                   /note="PFAM: PAAR repeat-containing protein; KEGG:
FT                   bam:Bamb_0211 PaaR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61368"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:C6BK99"
FT                   /inference="protein motif:PFAM:PF05488"
FT                   /protein_id="ACS61368.1"
FT                   /translation="MDELQGSMITVGCQHSHGGHVTTGSSESLLDGKPIARLHDMVDCP
FT                   LHGPNSISKVSSDMLIDGQPAALHGDMTECGATLIGDGSAVVI"
FT   gene            complement(61619..62281)
FT                   /locus_tag="Rpic12D_0057"
FT   CDS_pept        complement(61619..62281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B0856 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61369"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61369.1"
FT                   /translation="MTTITTTPVLYVVLARDRGPSGTSTTSLLIRALNDDGGAVLGCYL
FT                   SPFDAMMDMVRKDNPDCEYRSIRLDSLRPQDLRAAFPAGVSLEVLCGFRAKDAQLLDSQ
FT                   QSPLVSYRLQRDIRLQLNQDELCIDFPDDVLREINHLHEGVGLFAWQETAQRISTTWKQ
FT                   AQITHTMHSAFHKANHVRGLVPSDADQIGLFDPEAENWHFVPYIPLEILKRPPNRRR"
FT   gene            complement(62278..63408)
FT                   /locus_tag="Rpic12D_0058"
FT   CDS_pept        complement(62278..63408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B0855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61370"
FT                   /db_xref="GOA:C6BKA1"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKA1"
FT                   /inference="similar to AA sequence:KEGG:H16_B0855"
FT                   /protein_id="ACS61370.1"
FT                   /translation="MIKISFPSKDERLPQSIYAKQKGKPLGEWEMQHRLRIDRPVLETV
FT                   EEMGNVYRIDSTCLEIIDDAQDQIQIMGLGSVICIAATAFSLGWCGMWVAGPFVDSPQT
FT                   MAQDGYWFWTILGVVTFVAFTAFFSTVGYDILRRNLFTLKRRPIRLNRKTRRIYAIRTK
FT                   DPDGIWEVPWSNDEFFCIGKRKVSGFKRAYDMYDVRHYTLDEQGNVVRAFVLGQMVFTL
FT                   EQAQLQWEYFRRYMQDGPANLPEPYRFWAPRETFAEGYRICWGPRFTDLFFASMRYVML
FT                   PFTLLEATCRWLTLITCSDPGWPAEIEAACKPEPNDPYARPYADDFIGFSSGPNGHPSR
FT                   DDIDRMLALEKYRRREGVLTRAEAEALIQKLAEAST"
FT   gene            complement(63405..63587)
FT                   /locus_tag="Rpic12D_0059"
FT   CDS_pept        complement(63405..63587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0059"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B0854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61371"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKA2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61371.1"
FT                   /translation="MRPMPSMNVGVRIVGDPATLKWAQRCRFSAPGGEPKFPSMEDESF
FT                   AFSQLGIRVEEEQPR"
FT   gene            complement(63584..64723)
FT                   /locus_tag="Rpic12D_0060"
FT   CDS_pept        complement(63584..64723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0060"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B0855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61372"
FT                   /db_xref="GOA:C6BKA3"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKA3"
FT                   /inference="similar to AA sequence:KEGG:H16_B0855"
FT                   /protein_id="ACS61372.1"
FT                   /translation="MMKISFPSKDERLPRPIATCTKQKGKPLGDWERQHRLHIDKPAYR
FT                   EEIEEMGNVYSINSTYLEIVDDAHDRIQAIGFAWITGIATSAIAGFMGKFFITLPSIHS
FT                   PEIKAQDGYWPLVIIFASVFSAMALLFFLLGLDMMRRNLFTLKRRPIRLNRRTRRIYAI
FT                   RTKDPGGIWEVPWSNDEFFCIGKRKVGGLKRAYDMYDVRHYTLDEQGNVVRAFVLGQMV
FT                   FTLEQAQLQWEYFRRYMQDGPANLPEPHRFWALRESFAESFRICQLSKSSNPLVSLFDL
FT                   IFLPFALLDTVCRWLTLITCSDPVWPPEIEAACKPEPNDPYARPYADDFVGFASGPYGQ
FT                   PSRSDIDRMLALEKYRRREGVLTRAEAEALIRKQAEAGA"
FT   gene            complement(64720..64902)
FT                   /locus_tag="Rpic12D_0061"
FT   CDS_pept        complement(64720..64902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0061"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B0854 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61373"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61373.1"
FT                   /translation="MRPMPSMNVSVRIVDAPATLKWAQCCRFRAPGGKPKFPSMESESF
FT                   AFSQLGIRVEEAQAK"
FT   gene            complement(64899..66029)
FT                   /locus_tag="Rpic12D_0062"
FT   CDS_pept        complement(64899..66029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B0855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61374"
FT                   /db_xref="GOA:C6BKA5"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKA5"
FT                   /inference="similar to AA sequence:KEGG:H16_B0855"
FT                   /protein_id="ACS61374.1"
FT                   /translation="MIKISFPSKDERLPQSIYAKQKGKPLGEWEMQNRLYIDQPALEKA
FT                   EELGNVYRIDSTYLEIIDDAQDQIQIIGLGGIFFLAFASLALAWSGMWISGPFTQSAEV
FT                   VAQSGYWFWTILGATTGLAVAAVFGTFDYQVMRRNLFTLKRRSIRLNRKTRRIYAIRTK
FT                   NPDGIWEVPWSNDEFFCIGKRKVGGLKRAYDMYDVRHYTLDAQGNVVRAFVLGQMVFTV
FT                   KQAQLQWEYFRRYMQDGPANLPEPRRFWAPRESFWEGYRICRRDKFPELFEQLSDLILW
FT                   PFGLLEATCRWLILVTCSDPVWPAEIEAVCKPEPNDPYARPYADDFVGFASGPYGQPSR
FT                   RDIDRMLALEKYRRREGALTRAEAEALIRKQAEAGA"
FT   gene            complement(66026..68614)
FT                   /locus_tag="Rpic12D_0063"
FT   CDS_pept        complement(66026..68614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0063"
FT                   /product="conserved hypothetical membrane anchored protein"
FT                   /note="KEGG: reh:H16_A0029 hypothetical membrane anchored
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61375"
FT                   /db_xref="GOA:C6BKA6"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKA6"
FT                   /inference="similar to AA sequence:KEGG:H16_A0029"
FT                   /protein_id="ACS61375.1"
FT                   /translation="MTNIQSTVDRFTPPVHGCSFCDRPPGLAVLPVRYAVVGPEDKEGA
FT                   PPLAGNFHIEHAPTQLGGGAQYTLRTMRPGFLYVFHEATLHWDCYLVVNGGHLWKIIPE
FT                   RPTPPRVSTEFSCSVGIGHGYMSMYFTIPDPKRATRVWYAYSHVAWTPAQLDENKFKPE
FT                   VRSQHMQMLNVQAWLASANQPHAARSTELGKHVASFAMPPKDQDEAFRHLSAPPRIKAG
FT                   DRLDLIGEAAGAILSLAMERASPGHALMLACNDPLAMTEDLALLSNDVLHPKAHDGVVW
FT                   DKKTDLLLNALEANIRENAVRNMTKEAEDAAVENERNGVTLEGYPTYEFLSAVFSPEKT
FT                   AARWKREDAEREADRQTKQEDVAEAAWKPYAKVLDKSMRHRDHGPRLKALNETILAPIA
FT                   RSHAQWLMSGQLEQYMSYRHDSRDIAHGCVYNEAMARCLEHGVGNAECLGVVKRWCDEA
FT                   NPLNPSNLLARGLHLNHDELIKTAAGYTDQGLAAMLETFKAILDKFDQTSKAMALPDQL
FT                   SKIGLMPRLTWVLGNQIIPALAHSLHTKTAKMFLNGLSLAGGVRLVGVSRDIMSVRHTV
FT                   LHDLNTTNPALYKHLGRSRRREEAVVVSRRAKRMAANSNLVWYDKRDLAAAKDLASLQL
FT                   RDQHDVPGLKQVRAVLGSRHVNIGAVSVILQGLAVFHATQSFRAAGEFDEEETGMKLMG
FT                   GLVAMTGTLMEQAGILVEKAPTHPFVARVMRAMPDADWAERGQRWARKGRLVGFLGALV
FT                   GIGWDAVHSREEFAKGNQTLGYLYGGSTVSGAMAAAIAVGWISLPSWPFLVVLFGANVG
FT                   ISIVDDPATLKWAQRCRFSAPSGKPKFSSMEDESFAFSQLGIRVEEEQPK"
FT   gene            complement(68619..69515)
FT                   /locus_tag="Rpic12D_0064"
FT   CDS_pept        complement(68619..69515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_A0028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61376"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKA7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61376.1"
FT                   /translation="MTQFSTSHIRPKDWPQTWDSGILILDLLNHDPALLDLSELPLLEC
FT                   LPAGIGDNAHLMPVLLNLSETPVHIQQALLVQAWQSAQRGDPPFVCARLQGPAPANEVA
FT                   DHLAACLTGTDHTGGHALWRFYDPRVFIHMAWLLRPAQLQALFGPCQQWGFAWAGDWYE
FT                   LERPLASEPTDADPRPWWPDAKQWRTVQNAVCIECALARVAFNAKPSVSQAPAVDRALR
FT                   HAAETLHLSLDSDRQTYATHAVAFGRPFEDQPKLQAVWPAVASGELSLRQALAVLTRDD
FT                   WKLMTIMARTAKQFTGS"
FT   gene            complement(69524..71992)
FT                   /locus_tag="Rpic12D_0065"
FT   CDS_pept        complement(69524..71992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0065"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; Rhs element Vgr protein; PFAM: Rhs element Vgr
FT                   protein; KEGG: reh:H16_A0626 VgrG protein, uncharacterized
FT                   protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61377"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKA8"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ACS61377.1"
FT                   /translation="MGSHLPVSARTVSVSGPALPDVMGKPLFTFVRLQGTENLCSLYEY
FT                   EVELKTPDKDYNFGGPEGNFDLRAMNGRELTVRVELDGMGTGLDGGVGAGSREISGIVD
FT                   RARYLRAEGRHFVYGLTLRPWLWIASQNRNSRIFENKTDIEVIEEVLSAYNFPVERRLD
FT                   TAKYPRRIYRTQADESDYAFIARLMEHWGISWFFEHVEGKHRLILADMPGAYRRPASEA
FT                   YHTLEVYPPDFKPDQEHLDTFAVVDAVVAGKYTTSAYSFTQPRGDLTASSSDPRDTGMN
FT                   SGNVHQEVYDFPSEHAQPATDNRPWNEGDMIARIRMEAVRSRGLRCFGTGNLRAVIPGH
FT                   TFVLQGHPQKAANREYVVIGANLTLEDVAAASGEGQRWHCRVEFECHPTHEIFRPARDT
FT                   PWPVITGPQSATVVGPDGHVTHADQYGRVRVEFPWDRFKKMACWMRVSTSWAGSQYGQI
FT                   SIPRIGTEVLVSFLDGGNPDKPIITGAVANSLNMPPWRLPDQHVLTGIRTREHEGSRSN
FT                   HLVFDDTKGQIQAQLSSDHLTSQISMGYLTGIPNHAGRQDKRGEGLEARTDGHASLRAA
FT                   LGLLLTTHRRDKADGGAMSIEDVIALMQEALTLADSLAQSAVNAQAQAGQQKEVAKALR
FT                   LQAEAIQGGGKLAEFREPHIAIASQAGIATSAPGSTHVASGEHIALTSGQHLSFSSGGG
FT                   LYATATERFSLFVQRDGIKLFSAKGKVEVQAQSDAMNLVAQKVLRLLSTTDWVEISGKK
FT                   GIRLNVGGNEIRITPEGIENLSAGKWAVYSGSKLLTGPKAAPYAMPTTKLCTHLAEGAA
FT                   ASGAGAVPLH"
FT   gene            72152..72316
FT                   /locus_tag="Rpic12D_0066"
FT   CDS_pept        72152..72316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0066"
FT                   /product="outer membrane channel lipoprotein"
FT                   /note="KEGG: rso:RSc0166 outer membrane channel
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61378"
FT                   /db_xref="GOA:C6BKA9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKA9"
FT                   /inference="similar to AA sequence:KEGG:RSc0166"
FT                   /protein_id="ACS61378.1"
FT                   /translation="MQKMGGYAAGGVTTLALLDAQRQADQATLEQVQSRADRLLNCAAL
FT                   MQALGGGWQ"
FT   gene            complement(72598..73563)
FT                   /locus_tag="Rpic12D_0067"
FT   CDS_pept        complement(72598..73563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0067"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number="1.1.1.169"
FT                   /note="KEGG: rso:RSc0174 2-dehydropantoate 2-reductase;
FT                   TIGRFAM: 2-dehydropantoate 2-reductase; PFAM: Ketopantoate
FT                   reductase ApbA/PanE domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61379"
FT                   /db_xref="GOA:C6BKB0"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKB0"
FT                   /inference="protein motif:TFAM:TIGR00745"
FT                   /protein_id="ACS61379.1"
FT                   /translation="MTTAMRILVLGAGGTGGYFGGRLAQAGADVTFLVRPARAARLRQH
FT                   GLVIRSPHGDAQLPVQTITADQATAWGRADLVLLSCKAYDLEDAITAIRPVVGERTVVL
FT                   PVLNGLAHLERLDAAFGESRVLGGLCHISATSTPDGAVLHLSNGQGAAVHSITFGERTP
FT                   HAPRERTEAIRDVFATANFDSVLAENVMQDMWEKFTFLTSLAAMTCLMRATVGEIVATD
FT                   EGAALNEAMFLACERVAAASGYPNRQAARERGLNVLTQAGSPLTASMLRDLESGGRVEA
FT                   DHIVGDMLRRGRALGVDVSLLRVAFAHLQAYQQRLLRAAI"
FT   sig_peptide     complement(73483..73563)
FT                   /locus_tag="Rpic12D_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.759 at
FT                   residue 27"
FT   gene            73718..74665
FT                   /locus_tag="Rpic12D_0068"
FT   CDS_pept        73718..74665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0068"
FT                   /product="PP-loop domain protein"
FT                   /note="PFAM: PP-loop domain protein; KEGG: rso:RSc0175
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61380"
FT                   /db_xref="GOA:C6BKB1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKB1"
FT                   /inference="protein motif:PFAM:PF01171"
FT                   /protein_id="ACS61380.1"
FT                   /translation="MTFSNNFHRLETRLQSQVGRAIGDFNMIEDGDTILVCLSGGKDSY
FT                   TMLSVLMALQKRAPVDFKLIAMNLDQKQPGFPEEVLPNYLKKVGVEYVIVEADTYSIVK
FT                   EKVPEGKTTCSLCSRLRRGVIYRTAKELGANKIALGHHRDDIVNTFFLNMFFGGKMKSM
FT                   PPKLATDNGDHIVIRPLAYCAEKDIASYARAMEFPIIPCNLCGSQENLQRKKVKEMLLE
FT                   WERQTPGRIDNIFASLQNVVPSHLADTDLFDFNGLTTGLAKIGEDALFGQTAYDQAPLV
FT                   FAGSHDDRIEFVRFERKPGDKSAEQAVPGEAAAN"
FT   gene            75003..76370
FT                   /locus_tag="Rpic12D_0069"
FT   CDS_pept        75003..76370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0069"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine pyrophosphorylase;
FT                   PFAM: Nucleotidyl transferase; transferase hexapeptide
FT                   repeat containing protein;
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   rso:RSc0177 UDP-N-acetylglucosamine pyrophosphorylase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61381"
FT                   /db_xref="GOA:C6BKB2"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKB2"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ACS61381.1"
FT                   /translation="MNIVILAAGMGKRMRSALPKVLHPLAGKPLLAHVIETARTMSPTR
FT                   LVVVVGHGGDRVREMVGATDIAFATQDKQLGTGHAVMQAVDQLDESVPTLVLYGDVPLT
FT                   RAETLSALVSAAGNDHLGVLTVHLGDPTGYGRIVRDAAGRITRIVEQKDANETQLAIHE
FT                   VNTGILVCPTAKLKNWLATLSNDNAQGEYYLTDVIERAASEGVPITSAHPLAEWETLGV
FT                   NSKVQLAELERIHQRNLAQQLVEDGVTLIDPARIDVRGKLTCGRDVVIDVNCIFEGDVT
FT                   LADGVRIGAHTVIRDAVIEAGAEILPFCHIERAKVGADSRIGPYARLRPGTELAQDVHI
FT                   GNFVEVKNSQIAAHSKANHLAYVGDATVGSRVNIGAGTITCNYDGANKFRTVIEDDAFI
FT                   GSDTQLVAPVRVGKGATLGAGTTLTKDAPEGKLTVSRARQVTIDSWQRPVKQKKEG"
FT   gene            76487..78325
FT                   /locus_tag="Rpic12D_0070"
FT   CDS_pept        76487..78325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0070"
FT                   /product="glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /note="TIGRFAM: glucosamine/fructose-6-phosphate
FT                   aminotransferase, isomerizing; PFAM: glutamine
FT                   amidotransferase class-II; sugar isomerase (SIS); KEGG:
FT                   rso:RSc0178 D-fructose-6-phosphate amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61382"
FT                   /db_xref="GOA:C6BKB3"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKB3"
FT                   /inference="protein motif:TFAM:TIGR01135"
FT                   /protein_id="ACS61382.1"
FT                   /translation="MCGIVGAVSTRNIVPVLIEGLRRLEYRGYDSCGVAIQRDGQLERA
FT                   RTVSRVADLDAQAQTSHLDGAIGIAHTRWATHGRPDTVNAHPHFSGDTIALVHNGIIEN
FT                   YEALREELKAVGYGFESQTDTEVVAHLIHQAYTYPSSKTRGDLFASVRASVKRLHGAYA
FT                   IAVFARDNPDVVVGARAGSPLVVAIGENESFLASDALAVAGTASRMAYLEEGDVVELTR
FT                   DGFTVADASDKIVEREVKEVGTYAAAVELGPFRHFMQKEIFEQPRALGDTLEGVQGFAP
FT                   DLFGPEAAQVLPKVDSVLILACGTSYYSGCTAKYWLESIAKIPTQVEVASEYRYRETVP
FT                   NPNALVVVISQSGETADTLAALRHARELGHTHTLAICNVATSAMVRETQLKFLTRAGTE
FT                   IGVASTKAFTTQLAALYMLALTFAKLRGHLNTEQEEDALRHLRHLPSALNAVLALEPQI
FT                   IAWSDEFARRENALFLGRGLHYPIALEGALKLKEISYIHAEAYPAGELKHGPLALVTEQ
FT                   MPVVTVAPNDALLEKLKSNIQEVRARGGKLYVFADADTHIQSSDGIQVIRMPEHYGQLS
FT                   PILHVVPLQLLAYHTALARGTDVDKPRNLAKSVTVE"
FT   gene            78451..78756
FT                   /pseudo
FT                   /locus_tag="Rpic12D_0071"
FT   gene            78884..79156
FT                   /locus_tag="Rpic12D_0072"
FT   CDS_pept        78884..79156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0072"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61383"
FT                   /db_xref="GOA:C6BKB4"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKB4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61383.1"
FT                   /translation="MFNVLSKIVLLAVYGLALLSYATPLPLSTDAIGWLRIGALVLLAA
FT                   HLLEVVLCFRKVALHKGPLFDSVLLTLLFGFLHWKPLADAARQAR"
FT   sig_peptide     78884..78952
FT                   /locus_tag="Rpic12D_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.936 at
FT                   residue 23"
FT   gene            79265..80185
FT                   /locus_tag="Rpic12D_0073"
FT   CDS_pept        79265..80185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0073"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: rso:RSc0221 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61384"
FT                   /db_xref="GOA:C6BKB5"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKB5"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACS61384.1"
FT                   /translation="MDRVERTAFVFAGGGSLGAIEAGMLRELVASGVVPDMVVGASAGA
FT                   INAAFFACNPHAAGTAQLEALWRGVRRADVMPWSWRAMFSMLGILGGRREHLVDASGLQ
FT                   RLLTRHFAQTLLEAATLPLHVVATDMRTGAEVVLSSGAIVPAVLASAAIPGVFPPVRIG
FT                   DRLLIDGGVANNTPISAAIRLGATRVVVLPAGFACADRRAPRSAIEHALNALSLLVARQ
FT                   LVQDLERWAGQLPIAVVPPLCPLDVSPYDYARCGELIDRAAAATAAWLAADGLAGTGIP
FT                   GALREHDHNEDHPNCNADLHGVHAA"
FT   gene            80300..81313
FT                   /locus_tag="Rpic12D_0074"
FT   CDS_pept        80300..81313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0074"
FT                   /product="zinc-binding alcohol dehydrogenase family
FT                   protein"
FT                   /note="TIGRFAM: zinc-binding alcohol dehydrogenase family
FT                   protein; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bte:BTH_II1160 alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61385"
FT                   /db_xref="GOA:C6BKB6"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKB6"
FT                   /inference="protein motif:TFAM:TIGR02817"
FT                   /protein_id="ACS61385.1"
FT                   /translation="MKAVAYYQSLPIDRPEALVDLTLPEPTPGPRDVLVEVRAISVNPV
FT                   DVKVRLGMPPVDGQPRVLGWDAAGVVRAVGAEVSLFKPGDAVWYAGALQRPGTNSELHV
FT                   VDERVVGAMPATLGFAQAAALPLTAITAWELLFDRLQVPEPAAPSGKTVLIVGAAGGVG
FT                   SVLVQLARRLTGLTVIGTASRPETAAWVRELGAHHVINHAQPLAAELHRIGVPAVDYVA
FT                   SLNQTEHHFEQIVEALKPQGRLALIDDPAQLDVRKLKAKSLSLHWEFMYTRSMFGTDDQ
FT                   IEQHRLLNRVAALIDEGMLRSTMNEHFGTINAANLKRAHAFIESNQARGKIVLEGF"
FT   gene            complement(81315..82229)
FT                   /locus_tag="Rpic12D_0075"
FT   CDS_pept        complement(81315..82229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0075"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bte:BTH_II1158 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61386"
FT                   /db_xref="GOA:C6BKB7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKB7"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS61386.1"
FT                   /translation="MIRFDDLTILVLAVDNGSLSAAARVLNIAPAAASAAVKRLEAELG
FT                   VRLLARSTRSLALTHEGERYLQHARRALADLQAGQDALALGRQAIGGDVSLSIPSDLGR
FT                   NVLIGWLDDFLAEHPAVALQVRIGDRLVDMFRQRVDAAVRYGEPEDSSLVALPLAPDNR
FT                   RVLCAAPAYFARHGVPKTPDDLRQHNCLMLALSDTTHDQWTFHGASDDGQAHVVRVTGN
FT                   RIADDGELVRRWAVAGHGIAYKSRLDVLADLRAGRLQAALTDWRGEAAPLHLICTHRLA
FT                   LSPTLMRLRDFLQERIAGYLADA"
FT   gene            complement(82396..84186)
FT                   /locus_tag="Rpic12D_0076"
FT   CDS_pept        complement(82396..84186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0076"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate protein TPP binding
FT                   domain protein; thiamine pyrophosphate protein central
FT                   region; thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: bcm:Bcenmc03_6147 thiamine pyrophosphate
FT                   binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61387"
FT                   /db_xref="GOA:C6BKB8"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKB8"
FT                   /inference="protein motif:PFAM:PF02776"
FT                   /protein_id="ACS61387.1"
FT                   /translation="MQATVSDFLVARLSEWGVRRIFGYPGDGINGMFGALQRAGGKIEF
FT                   VQVRHEEMAAFMASAHAKFTGELGVCMATSGPGAAHLITGLYDARLDHMPVLAITGQQA
FT                   RTAVGGHYQQEVDLAAMFRDVAGAFVHQASMPAQVRHLLDRAVRIAIGQRRVTALVLPN
FT                   DLQEMPYTEPPRAHGTVHSGVGYSAPSVIPQAADLERAADILNSGRRVAMLVGAGALGA
FT                   SAEVAAVAETLGAGVAKALLGKAVLPDDLPYVTGAIGLLGTEPSWELMNHCDTLLMVGS
FT                   GFPYAEFLPKEGQARGVQIDLDPGMLGLRYPMEVNLVGDSAQTLRALLPLLQRKTDPYW
FT                   PDRIARWNESWWKTLEDRALQPAYPVNPQHVFWELSPKLPDNVIVTSDSGTCANWYARD
FT                   LKFKPGMMGSLSGGLASMGAAVPYAIAAKFAHPERPVIALVGDGAMQMNNMAELITVSK
FT                   YWKRWRSSKWICMVLNNQDLNAVTWEQRVMEGDPKFPAAQDIPNVPYHRFAELIGLKGI
FT                   YVDNPDQLAGAWDEALNADRPVVLEVKTDPDVPPLPPHVMLQQARNFATALAYGDPDAS
FT                   GVLRGTARQVLSALFPVHRE"
FT   gene            complement(84239..84715)
FT                   /locus_tag="Rpic12D_0077"
FT   CDS_pept        complement(84239..84715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0077"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: azo:azo0331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61388"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKB9"
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /protein_id="ACS61388.1"
FT                   /translation="MNKAEIPVAQRAVLSMLLDDHREVKKLFKTFQQEKDEAAREQIVR
FT                   DACEKLTVHTQLEEEVFYPYVRDNGGEAFKDLVDEAVVEHATAKDLIQQLNGMHAGDDL
FT                   FAAKFTVLAEYVSHHVEEEETELFPKLIRQHVDLTPLQETMAARKEALLAETAS"
FT   gene            84912..85382
FT                   /locus_tag="Rpic12D_0078"
FT   CDS_pept        84912..85382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0078"
FT                   /product="PRC-barrel domain protein"
FT                   /note="PFAM: PRC-barrel domain protein; KEGG:
FT                   bac:BamMC406_6353 PRC-barrel domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61389"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKC0"
FT                   /inference="protein motif:PFAM:PF05239"
FT                   /protein_id="ACS61389.1"
FT                   /translation="MQTTTTGTALGTGTGTGVGTTAGVRMRIIGRADSDSAGPGPELMA
FT                   ADTLEGDRVVNLNGEDLGKITDIMLDVQRGRIAYAVMSVGGFLGIGDKLFAVPWSAMSL
FT                   DVDRKCFVLDANKDRLEAAPGFDKDSWPTMADPTWAQSVHEYYGSRPYREEY"
FT   gene            85444..85632
FT                   /locus_tag="Rpic12D_0079"
FT   CDS_pept        85444..85632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0079"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B1328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61390.1"
FT                   /translation="MEKGKKEKHPHAHKREELVEKAVEDTFPASDPPATGGITRVVDKD
FT                   KDADAHQDKRTHNGNHR"
FT   gene            complement(85700..86053)
FT                   /locus_tag="Rpic12D_0080"
FT   CDS_pept        complement(85700..86053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0080"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sme:SMc01667 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61391"
FT                   /db_xref="GOA:C6BKC2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKC2"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS61391.1"
FT                   /translation="MAVRRIVPNLHAADPAPARAFYAELLDLEAVMDHGWIVIFADTAA
FT                   TMTPQVSIASEGGNGTPVPALSVEVDDVDAVHTRAVSLGLEIVYPLVDEPWGVRRFYVR
FT                   DPFGNVVNILAHR"
FT   gene            86180..87388
FT                   /locus_tag="Rpic12D_0081"
FT   CDS_pept        86180..87388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0081"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   rso:RSc0229 putative amino transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61392"
FT                   /db_xref="GOA:C6BKC3"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKC3"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACS61392.1"
FT                   /translation="MEFLQSLLAPRLQNVETSAIRELFKVLGKPGLISFAGGFPDSALF
FT                   DVEGLKAAADSALTTDAARALQYGATEGFEPLREAIVTLMKARGANVANTDILVTTGSQ
FT                   QGLDLLGKVLIGEGDTVLTEAPTFLAAIQAFKLYGAKVAGVPTDGDGLDVDALEKVLST
FT                   ARPKFLYVIPNFGNPSGALMSLERRKHLLDVAVRHNLLIVEDDPYGDLYFDAPPPPSLY
FT                   ALSQQTDGAQGRVIYLGSLSKVVAPGLRVGWMIASQPVLGNAVMVKQFADAHTSTFAQA
FT                   TAAAYLRSNRLETVLPRTRAAYAERAHAMANGLRALLPDTELTFNRPRGGMFLWCTLPG
FT                   RNAGDVAKVAIERGVAFVPGAAFYPVDPDRSTLRLSYATSSLAQVEEGVRKLAHAIGEF
FT                   KLG"
FT   gene            87407..87913
FT                   /locus_tag="Rpic12D_0082"
FT   CDS_pept        87407..87913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0082"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: bpy:Bphyt_0841 transcriptional
FT                   regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61393"
FT                   /db_xref="GOA:C6BKC4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKC4"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS61393.1"
FT                   /translation="MAQAHTDAQQDPALLRRLLRAKDRMDAASHEAWPVKRLAEVSGVS
FT                   AAHFARSFKQAFGIPPHRYLLTRRIEQATTLLRDTDLPIIEIAYATGWESLGTFGRIFR
FT                   DITGQSPSALRRHAQATAPLQQLDRVPACVLKAAQRPDLVTAVSEKRRQLAAGTNPSPT
FT                   NNKER"
FT   gene            87913..88329
FT                   /locus_tag="Rpic12D_0083"
FT   CDS_pept        87913..88329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0083"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bxe:Bxe_A1507 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61394"
FT                   /db_xref="GOA:C6BKC5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKC5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS61394.1"
FT                   /translation="MSQGINVVGLYVDDQDAALAFYVDKLGFRVHTDVRNGPYRWLTVQ
FT                   HPEQPSFQLGLFQPGPPIHDEATAQTLRAMVAKGAMPPLVLTVADCRAAYAQLRERGVE
FT                   FTQEPIERFGSVDAGFRDPAGNGWKMIQAAGGAK"
FT   gene            88326..88580
FT                   /locus_tag="Rpic12D_0084"
FT   CDS_pept        88326..88580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0084"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_0629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61395"
FT                   /db_xref="GOA:C6BKC6"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKC6"
FT                   /inference="similar to AA sequence:KEGG:Meso_0629"
FT                   /protein_id="ACS61395.1"
FT                   /translation="MSARNAIRQFHRWVSMAFTLTVIANFVALGLGKGAQPPAWITYAP
FT                   LLPLALLLFTGLYMFALPYRDRRGARRSAGERDTPTAAV"
FT   gene            complement(89056..90252)
FT                   /locus_tag="Rpic12D_0085"
FT   CDS_pept        complement(89056..90252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0085"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpy:Bphyt_6200 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61396"
FT                   /db_xref="GOA:C6BKC7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKC7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS61396.1"
FT                   /translation="MPASLWWLCLGAFAIGTEGFMIAGLLPVLAADLGVSVPAAGQLVT
FT                   VFAITYAVGSPAMATLLGNFDRRRVLIGALAIFAAGNLLAATAHGFGQLMAARVLLALA
FT                   AGVFLPTANAVATSLVPASRSGSALAVITGGGTVAVALGVPLGAWIAAQGDWRSTFIAC
FT                   GVLSALATAGLAFGLPRDLPHSVTTLAQRLSVARRPGMLGALAVSTLWAAGGFTFYTYV
FT                   APFFVQGLGFVPQHVGIVLFLVGSFAALGTGLGGHMTDRAGVARVLAVSSAGIVLAFSV
FT                   LSLSAQVLHGTAASAVAIGAVVLWGMAGWGFGPAQATRLIRLAPDVSPITLSLHASAVY
FT                   VGIALGSGVGALALAHGGPGMLGWAAAACHVVAVVLWRRGGRHEAALAEEPAATSVAH"
FT   sig_peptide     complement(90160..90252)
FT                   /locus_tag="Rpic12D_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.797) with cleavage site probability 0.790 at
FT                   residue 31"
FT   gene            complement(90315..90740)
FT                   /locus_tag="Rpic12D_0086"
FT   CDS_pept        complement(90315..90740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0086"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bbr:BB2888 putative glutathione transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61397"
FT                   /db_xref="GOA:C6BKC8"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKC8"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ACS61397.1"
FT                   /translation="MEVLKWLFWQVGGLGPMAGQIGHFNVYAPERVPYAIERYTKETNR
FT                   LYGVLDRRLADRPYIAGNDYTIADIAAYPWIVPHAGHGQDLNDFPNLQRWFEGVGARPA
FT                   TQRAYAGVERAYSRRREDISDDERNVLLGQTASSTAR"
FT   gene            complement(90745..91575)
FT                   /pseudo
FT                   /locus_tag="Rpic12D_0087"
FT   gene            complement(91610..92257)
FT                   /locus_tag="Rpic12D_0088"
FT   CDS_pept        complement(91610..92257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0088"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rso:RSc0231 putative (homoserine/homoserine lactone) efflux
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61398"
FT                   /db_xref="GOA:C6BKC9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKC9"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACS61398.1"
FT                   /translation="MTLQTWLAFIGASIIILLIPGPTILLVIGDSLANRGRSAWSTVAG
FT                   VAAGDTTAMAVSLAGAGALLAASATAFTALKLIGGSYLVYLGIKSILSARRLQDDVQAD
FT                   APEATLPVQQKSAGRRFLSAWTVTALNPKSIVFFVAFVPQFMSAKQTFLSQSAILLPTF
FT                   VILAAANASMYALAAKLLAKRLTSVAAQRRFGYAGGAVMVGAGTLTLGMHSA"
FT   gene            complement(92560..93810)
FT                   /locus_tag="Rpic12D_0089"
FT   CDS_pept        complement(92560..93810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0089"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: rso:RSp0478
FT                   ISRSO7-transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61399"
FT                   /db_xref="GOA:C6BBF0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBF0"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ACS61399.1"
FT                   /translation="MPRKPKAKPADLPAIPAELLEQFGSGPMTAEAINAATLALKKALI
FT                   ERALGGEMNHHLGYPPGASKPATVSNQRNGTGAKTVLTEGGPIRIEVPRDRDGSFAPLL
FT                   IPKHERRFKGFDDKIVAMYARGMTVREIQGFLLEQYATDVSPEFISSVTDEVMAEVTAW
FT                   QARPLDPMYPVVFFDALRVKIREDAVVRNKAVYLALGVLPDGTRDILGLWIENTEGAKF
FT                   WMKVFNDLKTRGVNDILIAVTDGLKGMPEALAAVFPATTLQTCIVHLIRNSLDYASWKD
FT                   RRALAAAIRPIYTAPSAEAAQAELEAFADGPWGQRYPTVSAAWRNAWDRVIPFFAFPPA
FT                   VRKVIYTTNAIENINAQLRKIIKTRGHFPSDEAATKLIWLALRNITAGWSRAAHDWKQA
FT                   MNQFAILYADRFVRPSV"
FT   gene            complement(94253..95233)
FT                   /locus_tag="Rpic12D_0090"
FT   CDS_pept        complement(94253..95233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0090"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rso:RSc0233 putative integral membrane
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61400"
FT                   /db_xref="GOA:C6BKD1"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKD1"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS61400.1"
FT                   /translation="MAVGDTSTATQLHHGQHDARRDHLTGIGYGVAAGALWGVIFVAPK
FT                   MLPQFSPLALSAARYVLYGVLSLVLALPVWRTLWRKTTRRDWVALLLLSLPGNILYYLC
FT                   VAGGVQRAGVAPVSLIVGLLPVTVTLAGAAERGSLPLRQLALPLLMAVAGVVCIYLDAP
FT                   DVHSNAGGRTYFIGLLMAAGALACWTVYAVCNARYLRARPQFTSREWSLLTGVATGVLS
FT                   LALAVPAFLLPGMATASAQPASTWGMFWLVNMGVALGASVLGNSLWNAASRKLPLTLSG
FT                   QLIVFETVFALLYGFIYEARWPHGLEVAAAVLLVSGVGLAARRHG"
FT   gene            complement(95340..96062)
FT                   /locus_tag="Rpic12D_0091"
FT   CDS_pept        complement(95340..96062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0091"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: rso:RSc0234 transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61401"
FT                   /db_xref="GOA:C6BKD2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKD2"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS61401.1"
FT                   /translation="MLDFRTYGLAAPPHSHDFMQVVMPARGILEMDVDGRGGRVDTHHA
FT                   ALIPAGATHAFEATGANRFIVFDIPGQTADAPSLGGLADRVFFPLTPGLRALTTWLQDA
FT                   PIVDTVLATAWSSLALATLAAHPANQSTQIRARPDARAERAWHAIEHRYAEPLTVDALA
FT                   AEAGVSARHLATLFRAAYGTTLHAHLAQVRLRHALTLLETTALPIAEIAARTGYYDQSA
FT                   LTRHLKAAHGITPAAVRR"
FT   gene            complement(96226..96582)
FT                   /locus_tag="Rpic12D_0092"
FT   CDS_pept        complement(96226..96582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0092"
FT                   /product="protein of unknown function DUF427"
FT                   /note="PFAM: protein of unknown function DUF427; KEGG:
FT                   rso:RSc0235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61402"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKD3"
FT                   /inference="protein motif:PFAM:PF04248"
FT                   /protein_id="ACS61402.1"
FT                   /translation="MPDIDPNHPITVESNPRRVTVTLNGFTIASTHLARTLREASYPPV
FT                   QYIPRDDVQMNLLERTQHHTHCPYKGDASYYTIVAGDVRADNAVWTYEQPKPVAREVAG
FT                   YLAFYPNKVTIQEE"
FT   gene            complement(96662..97864)
FT                   /locus_tag="Rpic12D_0093"
FT   CDS_pept        complement(96662..97864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0093"
FT                   /product="Rh family protein/ammonium transporter"
FT                   /note="PFAM: Rh family protein/ammonium transporter; KEGG:
FT                   rme:Rmet_4750 Rh-like protein/ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61403"
FT                   /db_xref="GOA:C6BKD4"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKD4"
FT                   /inference="protein motif:PFAM:PF00909"
FT                   /protein_id="ACS61403.1"
FT                   /translation="MNSIKTGGDALFILLGAIMVLAMHAGFAFLELGTVRKKNQVNALV
FT                   KILVDFAVSTIAYFFIGYSIAYGVNFFTGADVLAQQNGYELVKFFFLLTFAAAIPAIIS
FT                   GGIAERSRFEPQLAATFVLVGFVYPFFEGIAWNERFGIQHWLQSVTGAEFHDFAGSVVV
FT                   HAVGGWIALPAVLLLGARHGRYKDDGRIAAHPPSNIPFLAAGAWVLAVGWFGFNVMSAQ
FT                   TLDKMSGLVAINSLMAMVGGTLTAWWMGKNDPGFSYNGPLAGLVAVCAGSDVMHPLGAL
FT                   AVGGIAGVLFVWMFTRVQNVWRIDDVLGVWPLHGLCGAWGGIAAGIFGLKALGGLGGVS
FT                   FWAQLAGTAGGIAIALIGGTVVYGTLRKLVGLRLDREAEFMGADLAIHRISSTPESETH
FT                   W"
FT   sig_peptide     complement(97778..97864)
FT                   /locus_tag="Rpic12D_0093"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.545 at
FT                   residue 29"
FT   gene            complement(98122..99135)
FT                   /locus_tag="Rpic12D_0094"
FT   CDS_pept        complement(98122..99135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61404"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKD5"
FT                   /inference="similar to AA sequence:KEGG:RSc0236"
FT                   /protein_id="ACS61404.1"
FT                   /translation="MPSRATMRWCLTALLAWSGHALAWDYTPGAIPGLISVLGFLTALD
FT                   RAIQRFPGQREELIRARTQFDNTFPQALARTRRLIAGIPLSDDERQLLIERALDLHQPS
FT                   VGVATQTAETAHSLAERVVARAQGSQDRATLQTLLAVVYDDRPADELSSRFTQAVTLSD
FT                   WPNARGASVNLRLPFSWERVPPTPPRKPDPARVAIGAWANQGGSGLSRMELIVRPAEGD
FT                   LEAVPDSREPRWMRDAVKQAVAGPCRLLGWGTQSFGGRSGVWTSYIGESPGPHVPRATG
FT                   STLVGRVFMIPTDGALLMLHMQSPATSPEQASAVRLRYEPLWNAVAASLSVSGAKP"
FT   sig_peptide     complement(99064..99135)
FT                   /locus_tag="Rpic12D_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            99477..102764
FT                   /locus_tag="Rpic12D_0095"
FT   CDS_pept        99477..102764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0095"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: rso:RSc0237 putative methylmalonyl-CoA mutase
FT                   protein; TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase; cobalamin B12-binding
FT                   domain protein; ArgK protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61405"
FT                   /db_xref="GOA:C6BKD6"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033669"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKD6"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ACS61405.1"
FT                   /translation="MTDLSAARAADPTPASEPGPARNKVRFVTAASLFDGHDASINIMR
FT                   RILQSMGCEVIHLGHNRSVDEVVNAALQEDVQGIAVSSYQGGHVEYFKYMIDALRARGG
FT                   EHIQVFGGGGGVIVPAEIRELQDYGVARIYSPEDGQRMGLAGMIADMVQRCDIDLSVYA
FT                   PTTLEPVANGDRRALAQLITALESGRIDPALRDAVRAAAMGAPTPVLGITGTGGAGKSS
FT                   LTDELIRRFRLDQQDALRIAVISIDPSRRKSGGALLGDRIRMNAINHPNIFVRSLATRE
FT                   ASREISDALPDVIAACRAGGFDLIIVETSGIGQGDAAIVPHVDLSLYVMTPEFGAASQL
FT                   EKIDMLDFADLVAINKFDRKGAQDAWRDVAKQVQRNREQWHARPEDMPVFGTQASHFND
FT                   DGVTALYHALADRLSERGMALAERTLPRTAGKCSTSHDAIVPPARVRYLAELADTVRGY
FT                   HRRVDAQSRLARERQQLRASHRMLEQAGATVQTLSALDKQAAERDAQLGAAERKLLAMW
FT                   PDLRRAYSGDEYVVKIRDKEIRTQLTHTTLSGTTIRKVVLPPYEDDGEVLRWLMRENVP
FT                   GSFPYTAGVFAFKRENEDPTRMFAGEGDAFRTNRRFKLVSEGMEAKRLSTAFDSVTLYG
FT                   EDPALRPDIYGKVGNSGVSIATLDDMEVLYDGFDLTSPATSVSMTINGPAPTILAMFMN
FT                   TAIDQNLARFRSDNRREPTQDEEAKIRAWVLQNVRGTVQADILKEDQGQNTCIFSTEFS
FT                   LKVMGDIQEYFVHHQVRNFYSVSISGYHIAEAGANPISQLAFTLANGFTYVEAYLARGM
FT                   HIDDFAPNLSFFFSNGMDPEYSVLGRVARRIWAVTLRDKYGANERSQKLKYHVQTSGRS
FT                   LHAQEITFNDIRTTLQALIAIYDNCNSLHTNAYDEAITTPTAESVRRALAIQLIINREW
FT                   GLAKCENPNQGSFVIDELTDLVEEAVLREFERIAERGGVLGAMETGYQRGKIQEESMLY
FT                   EQRKHDGSLPIIGVNTFRNPDAESVVPPHIELARSSEEEKQSQLARLQDFHARHAGEAP
FT                   AMLQRLQRAVIDDQNVFAVLMDAVRVCSLGQITHALFEVGGQYRRNM"
FT   gene            103472..104326
FT                   /locus_tag="Rpic12D_0096"
FT   CDS_pept        103472..104326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0096"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein; KEGG:
FT                   rso:RSc0244 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61406"
FT                   /db_xref="GOA:C6BKD7"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKD7"
FT                   /inference="protein motif:PRIAM:1.1.1.157"
FT                   /protein_id="ACS61406.1"
FT                   /translation="MAIQVVGIVGAGTMGNGIAQACAVVGLDVVMVDISDAAVQKGIAT
FT                   VAGSLDRLIKKEKLTEADKAAALARIQGSTSYDDLKRADLVIEAATENFDLKVKILKQL
FT                   EAAAAPHAIVASNTSSISITKLAAVLQDASRFIGMHFFNPVPMMALVEVIRGLQTSDAT
FT                   HAAVEALAKQLGKTPITVKNSPGFVVNRILCPMINEAFCVLGEGLASPEEIDEGMKLGC
FT                   NHPIGPLALADMIGLDTMLAVMEVLYTEFGDPKYRPAMLMREMVAAGYLGRKTGRGVYD
FT                   YRK"
FT   sig_peptide     103472..103537
FT                   /locus_tag="Rpic12D_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.737 at
FT                   residue 22"
FT   gene            104482..105339
FT                   /locus_tag="Rpic12D_0097"
FT   CDS_pept        104482..105339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0097"
FT                   /product="phenazine biosynthesis protein PhzF family"
FT                   /note="TIGRFAM: phenazine biosynthesis protein PhzF family;
FT                   PFAM: Phenazine biosynthesis PhzC/PhzF protein; KEGG:
FT                   rso:RSc0253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61407"
FT                   /db_xref="GOA:C6BKD8"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKD8"
FT                   /inference="protein motif:TFAM:TIGR00654"
FT                   /protein_id="ACS61407.1"
FT                   /translation="MSRYAFRLLNVFAESTFGGNQLAVFEDGRGLDDATMQAIGRQFNL
FT                   SEITFIFPDEADGATARFRIFTPDYEMPFAGHPSLGTAQVVRELYGPGNELTLRCQSGI
FT                   VSLTAQDEGWSLVPPRSGALNTREADPGIAKMLGLDADALAGPPLWIDAGIEQLMVPVK
FT                   TRADVERARPDPSAFDAWPRSRNDGRNAYVFTMPAPGSDGPVVSRFFFEYGAGLWEDPG
FT                   TGSACANLGGWLRATGHALPATYRIEQGAAVGRPCHLTLRVDADGTIHVGGRVIEIGRG
FT                   TLTI"
FT   gene            complement(105348..105896)
FT                   /locus_tag="Rpic12D_0098"
FT   CDS_pept        complement(105348..105896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0098"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bpl:BURPS1106A_3175 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61408"
FT                   /db_xref="GOA:C6BKD9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKD9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS61408.1"
FT                   /translation="MSDTLTIRRVGANEASACVDALADLLIDCVEGGASVSFMSPLSRD
FT                   KAQAFWRDVAEGVTGGERALLIAEDAAGDILGTVQLVLAQPENQPHRADVAKMLVHRRA
FT                   RRQGVAQRLMAAIEDEARAERKTVLVLDTVTGGDAERLYARAGWQRVGVVPNYALMPDG
FT                   ALCGTTFFCKQLTPSASAA"
FT   gene            complement(105896..106480)
FT                   /locus_tag="Rpic12D_0099"
FT   CDS_pept        complement(105896..106480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0099"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bph:Bphy_4180 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61409"
FT                   /db_xref="GOA:C6BKE0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKE0"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACS61409.1"
FT                   /translation="MDIHQRIAQRLRELRDAQGLSLDALAERSQVSRSAISLIERGQSS
FT                   PTAAVLDRLSSALGVTLASLFEDSAAPAAEPSPVSRAAEQPEWTDPASGYVRRNLSPAA
FT                   RSPLQLVEVHFPPGERVAYDTGARDAEIHQQVWIIEGTMEMTVGDAHWRLNAGDCLTMR
FT                   LDCPIVYYNPTRRPARYLVALTTVSAGHWRP"
FT   gene            complement(106648..107550)
FT                   /locus_tag="Rpic12D_0100"
FT   CDS_pept        complement(106648..107550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0100"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bur:Bcep18194_B0171 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61410"
FT                   /db_xref="GOA:C6BKE1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKE1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS61410.1"
FT                   /translation="MRRLPPLNALRSFEAAGRLKSLTLAARELNVTQSAIAQQIRVLET
FT                   FFGQKLFERDGRSLRLTLRARHYLVDVASCIGRLTEATEHMFEAPDRRQIRVNTSSSFA
FT                   HGWLLGHLAHFHAQHPGIDIELISTPDAEVDRIDESSDAVIRRYTPELRRRGFVSKPLV
FT                   PNVAVPVCAPHHPALAAVHAPSDLRHAPLLHYSGLPQAWQYWFHQAGIPIGETLRGPFY
FT                   DEFALLVKAAISGLGICLAPRVVIQDDVNRGRLVMLFPEVRLEGPPFHCLYRQAADDQP
FT                   LNLFIAWLFERAGSTHGSA"
FT   gene            107783..108325
FT                   /locus_tag="Rpic12D_0101"
FT   CDS_pept        107783..108325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B0172 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61411"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKE2"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_B0172"
FT                   /protein_id="ACS61411.1"
FT                   /translation="MLIACSGPPANERVTGRGGTLVRYSSRQVSVDLTNTEQQSLRTMR
FT                   DRTYANHPSDVLHAVGKALSDMGYAPVSVDNETGLVEAGHSETLVPKWRQLMRGLLKNY
FT                   SGMFPAKPDHERISAVVAVKAGADGQTTLVRARFDSTVWDSNGDARTKTVLQRDVYEGF
FT                   FTVVDAALCASACKGQP"
FT   gene            complement(108395..109858)
FT                   /locus_tag="Rpic12D_0102"
FT   CDS_pept        complement(108395..109858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0102"
FT                   /product="protein of unknown function DUF1254"
FT                   /note="PFAM: protein of unknown function DUF1254; protein
FT                   of unknown function DUF1214; KEGG: rso:RSc0254 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61412"
FT                   /db_xref="InterPro:IPR010621"
FT                   /db_xref="InterPro:IPR010679"
FT                   /db_xref="InterPro:IPR023289"
FT                   /db_xref="InterPro:IPR037049"
FT                   /db_xref="InterPro:IPR037050"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKE3"
FT                   /inference="protein motif:PFAM:PF06863"
FT                   /protein_id="ACS61412.1"
FT                   /translation="MTHCPAPARPLTQLAAVALSVVAWAITLGLAGCSTQNTATTAPIE
FT                   QRLPQPNEALVRSAYVYAFPLMMTDALLQTTSALAPAGTFMHQRTLEDETLPTGVRARV
FT                   DVLASSAFVDLRNGPVVLSLPDTGRRHIWVALHDAWSDVFESLGNRTTGPRAAHYALTP
FT                   PGWEGTLPAGVKQIAAPTNLVWVVARTQVAGPRDLAAARRVQDRYRINPLDAFGKTSLR
FT                   EAEAEAKVNTDKATDLDVSVEAARRRVTALDANSYFTRFAELLKDNPPHAADSTMLQSL
FT                   RDLGIVPGAPFDAKAVSAANLKVMDGGVAAARETLSLAVKQPSITQNGWFIPRMVGAYG
FT                   LDYAQRAIVAWNGGGTDLPQDMLVATAKTDTNGMALDSTHRYVLHFERNQLPPENAGWA
FT                   IAALSAGGQPRSAAERPSLRNMLSEADHPRLNRDGSLDILIQRAPPKGMRNNWLPPPTG
FT                   PFLLRMQLTWPKEAALDGSWLPPTVQLRY"
FT   sig_peptide     complement(109781..109858)
FT                   /locus_tag="Rpic12D_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.886) with cleavage site probability 0.565 at
FT                   residue 26"
FT   gene            complement(110070..111053)
FT                   /locus_tag="Rpic12D_0103"
FT   CDS_pept        complement(110070..111053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0103"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   rso:RSc0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61413"
FT                   /db_xref="GOA:C6BKE4"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKE4"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ACS61413.1"
FT                   /translation="MPAAKHLPPALQHLTLPVIGSPMFIVSYPELVLAQCKAGIVGAFP
FT                   ALNARPAEVLDDWLTRMNEELATYRTAHPHEVVGPIAVNQIVHHSNARLEQDVATCVKH
FT                   KVPIFITSLRAPVKEILDAVHSYGGIVLHDVINLRHAEKALEAGVNGLILVAAGAGGHA
FT                   GTLSPFALVGEVRRIFDGPIALSGAIATGDAILAAQAMGADLAYIGTRFIASQEAHAAE
FT                   SYKQAILRAAASDIIYTNLFTGVHGNYIRESIELAGLDPAALPEADKSKMNFGDSSSRA
FT                   KAWKDIWGAGQGVGQIADLPPAAEIVARMKAEYDAAKLRLALHLRL"
FT   gene            complement(111154..111702)
FT                   /locus_tag="Rpic12D_0104"
FT   CDS_pept        complement(111154..111702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0104"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: bxe:Bxe_B1164 peptidase
FT                   C56, PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61414"
FT                   /db_xref="GOA:C6BKE5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKE5"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ACS61414.1"
FT                   /translation="MTQLHDLRIAILVDDLFEQAELASPRQALEGAGATVSIIAPKGPS
FT                   VTGLHHADKGDTFKVDLTLDQAKAEDFDGLVLPGGVFNADALRVVPAAQAFVKAFEDAQ
FT                   KPIAVICHGPWLMVSAGLVRGRTLTSWPTLQDDIRNAGGTWVDREVVTDRNWVSSRKPD
FT                   DLPAFNRTFIELLAQHAHV"
FT   gene            111839..112765
FT                   /locus_tag="Rpic12D_0105"
FT   CDS_pept        111839..112765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0105"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rso:RSc0256
FT                   haloacetate dehalogenase H-1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61415"
FT                   /db_xref="GOA:C6BKE6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKE6"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACS61415.1"
FT                   /translation="MTTPLSIDAATAAADAALFPGFRPFRQVANGVEIAGVIGGSGPPL
FT                   LLLHGHPQSHVIWHKVAQELAHDYTVVATDLRGYGASSKPAGSARHAEYSKRTMAQDQV
FT                   EVMRALGFGRFRLCAHDRGARVAHRLCVDHPVHVERAMLLDIAPTLAMYENTDMAFASA
FT                   YWHWFFLIQPSPFPETLINATPDFYIGKLMGLRHAGLEPFAPEAMATYAAAMREPACVH
FT                   AMCEDYRAAATIDLEHDRADRDAGKRVSVPLRVLWGEHGVIQRCFKPLELWKAVADDVS
FT                   GGTVPCGHYVPEEAPEALLEEMRAYFA"
FT   gene            complement(112775..113458)
FT                   /locus_tag="Rpic12D_0106"
FT   CDS_pept        complement(112775..113458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0106"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase alpha subunit; KEGG: bpm:BURPS1710b_A0200
FT                   putative hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61416"
FT                   /db_xref="GOA:C6BKE7"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKE7"
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /protein_id="ACS61416.1"
FT                   /translation="MLLKIPNVLTKEQVAQCRATIDAAEWVDGKVTAGAQSGQVKHNMQ
FT                   LPERSPAAREAGTLIQDALSANTLFFSAALPLKVFPPLFNRYAGGQTFGNHVDNAVRHL
FT                   RGTAFRIRSDLSCTLFLTEPEDYDGGELVIDDTFGEHRAKLAAGDMVLYPSSSLHRVTP
FT                   VTRGARVCSFFWLQSMVRSDAHRTLLFQMDTELQRLMGLLGQDDPSVIALTGTYHNLLR
FT                   EWADA"
FT   gene            complement(113449..114210)
FT                   /locus_tag="Rpic12D_0107"
FT   CDS_pept        complement(113449..114210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0107"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   SMART: Sel1 domain protein repeat-containing protein; KEGG:
FT                   bxe:Bxe_B0793 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61417"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKE8"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ACS61417.1"
FT                   /translation="MPADAATAAAAGADPAMVDAIHAVLTGPADRAARWLAAAARRGHA
FT                   EAQAVFGQWLLDGRGVERNPAEALFWFKTAALSGHAMAANMLGRCYEHGWGAPACDKTA
FT                   THWYARAADAGLDWGQYNYATQLLLGRGIAADRARAFARFQAAAAQGHAKSINVLGGFY
FT                   EDGWEVDADTAMALRCYLLAAEGGDFRGQFNAARLLALTNRADDALAWMQAVPRTATPA
FT                   FLAKAHDFLAGHPDARLRALACVLNTPSPCC"
FT   gene            complement(114210..116489)
FT                   /locus_tag="Rpic12D_0108"
FT   CDS_pept        complement(114210..116489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0108"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: bxe:Bxe_B0794 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61418"
FT                   /db_xref="GOA:C6BKE9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030148"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKE9"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ACS61418.1"
FT                   /translation="MSAAQIERKRTEHSVVGYLTGAMSFAVVSAPALADTKKDAVSATL
FT                   PEQTVTGTNGFKADAASGGKFTAPLLDTPKSVTVIPAEVLQGTGSVTLTEALRTVPGIA
FT                   FGAGEGGNPVGDRPFIRGYDAQASTFLDGLRDIGAQSREMFNVESVEVIKGPSGAYEGR
FT                   GAAGGAVNIVTKTPKLEHFTEGTLSVGNAAYKRATADGNYQIGEHAAFRLNAMAHDAAV
FT                   AGRDVTSFSRWGIAPSIAFGLGTPTRATLSYYHLQSNDTPDTGIPYNNGTFNRRTDGRP
FT                   QLFGPGDGAPVNVDRNVYYGLSRDFRRDRVDMGTFTLEHDVSSALKLRNTTRVARTSQD
FT                   TVWTQPDDSQGNIFYGMVWRRANSRYSVANTVANRTEATGKFITGGLKHSYAAGLEFSR
FT                   ERSRNDTYNVATGSNRCPNGIGAAGGYNCADLFNPNPNDPWAGSIKLSNNPAETTVRTQ
FT                   SAYVFDTIELSPRWQVNGGLRFDRYSASATTSANAQGVRSSFSRDDNLLNYQLGLVFKP
FT                   AQNGSIYLAYGTSSTPSGSVAGQGADTSALTPDRSGNRGDVLAPEKNRAYELGTKWNVL
FT                   DSKLALTAAIFRVETTNARIVLQDGTAAMAGNKRVDGFELGWSGALTNRWQVFGGYTYL
FT                   KSELRNNGGAGAAFGGTNGTAFPNTPKNSFSLWTTYQPMPKLTLGGGAYYVSKVWGSAN
FT                   PANPKWVPAYWRFDAMAAYRIDKHTTLQLNVQNVFDKVYFNQAYASHYASLAPGRTAIL
FT                   TLGIRY"
FT   sig_peptide     complement(116385..116489)
FT                   /locus_tag="Rpic12D_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.967 at
FT                   residue 35"
FT   gene            116763..117542
FT                   /locus_tag="Rpic12D_0109"
FT   CDS_pept        116763..117542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0109"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   cti:RALTA_B0800 putative enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61419"
FT                   /db_xref="GOA:C6BKF0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKF0"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACS61419.1"
FT                   /translation="MSTDPELLIERRGQALWLTIQREDRRNAISAAVLEALTAALADAS
FT                   RNTSVRAVVLTGTGTRAFCAGADLQTGQSFRFDYSQPYQALADLFRQARRCTVPLIARV
FT                   NGACMAGGMGLLAMCDLAVASRSATFGLPEVKVGVFPAQVLAVLQHHLPRRVLNELCLT
FT                   GEPMSAERALAAGLVNEVAEPAALDGAVDALLARLLDKSPSAIRRGLYTLKQVESLSFE
FT                   QAIAFTESQIGLFALTEDAQEGQAAFREKRAPNWTGR"
FT   gene            117544..119316
FT                   /locus_tag="Rpic12D_0110"
FT   CDS_pept        117544..119316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0110"
FT                   /product="protein of unknown function DUF1446"
FT                   /note="PFAM: protein of unknown function DUF1446; KEGG:
FT                   cti:RALTA_B0801 conserved hypothetical protein; DUF1446"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61420"
FT                   /db_xref="InterPro:IPR010839"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKF1"
FT                   /inference="protein motif:PFAM:PF07287"
FT                   /protein_id="ACS61420.1"
FT                   /translation="MRKDTISIGGASGFWGDSITGPMQLVASGRLDFLVFDYLAELTMS
FT                   LLASARMKNPESGYATDFVSVAMRAVLKDALAQNIRIIANAGGVNPRGCAAALQALADE
FT                   LGVSVRIAVVEGDDVMPLLPTLRDEAVRELQSGRPLPDKVVSANAYLGALPIKAALDAG
FT                   AQVVITGRCVDSAVTLGALMHHFGWAIDDYDRLAAGSLAGHILECGCQGAGGLHTDWEA
FT                   VPDWAHSGYPIAECRADGSFIVTKPDGTGGLVTPATVGEQLLYEIGDPARYVLPDVVCD
FT                   FTQVTMTQAGEHRVEVRGARGRAPTPDYKVSATYADGYRATGQLTIVGIDADRKARRTA
FT                   EAILERTRGLFRQLGLPDYSATHIETLGSAYLFGPHQPIVPRFESVMWLAVTHPNKQAL
FT                   ELFAREIAPAGTSWAPGTTGAGGRPSVVPAIKQYAFLIDKARVQPRVTLLGEESFDIAV
FT                   PTGGAALEPSAAVQASVALPPGPTREVPLIELAYARSGDKGDTSNIGVIARRPEDLPLL
FT                   RAQLTAEAVAAYLAHVVKGRVTRYDLPGIHALNFVCEQALGGGGMASLRNDPLGKGMAQ
FT                   LLLTMPVRVPVDHP"
FT   gene            119331..120485
FT                   /locus_tag="Rpic12D_0111"
FT   CDS_pept        119331..120485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0111"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: reu:Reut_B5206
FT                   acyl-CoA dehydrogenase, C-terminal:acyl-CoA dehydrogenase,
FT                   central region:acyl-CoA dehydrogenase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61421"
FT                   /db_xref="GOA:C6BKF2"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKF2"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS61421.1"
FT                   /translation="MYPGLLPSDCFDAEHETFRETVRRFVDNAVLPHIEAWEEAETFPR
FT                   ALYREAADLGLLGIGFPEEYGGTPGDLFLELAMIEELTRAASGGLLASLFSHSIGAPPI
FT                   VAGGSAELKARVLPAILSGEKISALAITEPSGGSDVANLTTRAVRDGDHYVVNGSKIFI
FT                   TSGMRADYITVAVRTGGAGAGGISVLLVEGDTPGLTRTPLKKMGWWCSDTAQLHFDDCR
FT                   VPLGNLLGKENHGFELVMRNFNHERLALAMQAYGLARTCLTEAVEWATQRETFGKRLVQ
FT                   HQVARQKLVAMATRIEATRALLEDLMRRMQAGDAPLAQLCMLKNFATQSLQFCADTAVQ
FT                   LLGGMGFMRGTKAERIYREVKVYMIGGGAEEVLSDLAARQLGWT"
FT   gene            120507..121394
FT                   /locus_tag="Rpic12D_0112"
FT   CDS_pept        120507..121394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0112"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rfr:Rfer_3507 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61422"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKF3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS61422.1"
FT                   /translation="MYRSVFRPGLFQGQVAVVTGGGSGIGRCTAHELASLGAAVALVGR
FT                   NAEKLAAVRTEIVEAGGTAHTYVCNIRDEAAVQATVAQIYGAHGRIDALVNNAGGQFPA
FT                   PLKGISAKGWEAVVQTNLTGGFLMARECLNQAMQQRGGAIVNIVADMWGGMPNMGHSGA
FT                   ARAGMVNFTETAAFEWAQYGVRVNAVAPGYVASSGMDAYPPWMAETIRSMPSTVPLGRF
FT                   ATEAEVSSAIVYLLSEAAAFITGTTLRVDGGRPNVRPGSPMPAPRHGAEPFNGFHLAVT
FT                   PKVLQGEEDRNAGA"
FT   gene            121381..123000
FT                   /locus_tag="Rpic12D_0113"
FT   CDS_pept        121381..123000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0113"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: bps:BPSS2031
FT                   acetyl-CoA carboxylase carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61423"
FT                   /db_xref="GOA:C6BKF4"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKF4"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ACS61423.1"
FT                   /translation="MPALESRIVPQSDAYRQNHAALTELVGRLRTLEDRTRDKSEASRA
FT                   RFAQRGQLLPRDRLGRLLDAGAPFLELSTLAGFCLDHADPARSIPGGGFIAGIGWVSGV
FT                   RAMIIVDDAGIDAGAVQPMGIEKFQRAQAIALEQKLPFIHLVESAGANLLTYRVETFIH
FT                   GGSGFYWLARLSAAGIPVISVVHGSSTAGGAYMPGLSDYVVMVRDRARAFLAGPPLLKA
FT                   ATGEIATEEELGGAEMHATTSGLAEYLAEDDADALRIAREVVAALDWNRDVPAPDRPYA
FT                   PPRFDAEELLGIALTDHRKPLDMREVIARIADGSDFLEFKRDYGSGTVTGHAAICGMRV
FT                   GVITNNGPLDPAGATKVVHFIQACCQSDTPLLYLQNTTGFIVGKASEQAGMIKHGSKMI
FT                   QAMANATVPRITVHCGASFGAGNYGMSGRGFFPDFCFGWPNAKTAVMGAEQAAGTMATV
FT                   MAASMQRKTQTVDHDAIEAMRAKVIDTFERQSDAFTISGRLLDDGVIDPRDTRKVLACV
FT                   LGVCDEARRRTLHPIQFGVARP"
FT   gene            123061..124218
FT                   /locus_tag="Rpic12D_0114"
FT   CDS_pept        123061..124218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0114"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: vei:Veis_1896
FT                   acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61424"
FT                   /db_xref="GOA:C6BKF5"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKF5"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS61424.1"
FT                   /translation="MHFTHEHQELQRNLKRFIDSDINPYVDEWEAAEMFPAKQLFKKMG
FT                   ELGFLGIAKPTEFGGLGLDYSYAMAMAETLGHIHCGGVPMAIGVQTDMATPALARFGSD
FT                   ELRAQFLAPAISGDAVACVGVSEPSAGSDVASIKTTARKDGDDYIINGSKMWITNSLQA
FT                   DWMCLLANTSDDPAHRNKSLIIVPMNTKGVSVGKKIRKIGMNSSDTGLIYFDDVRVPQR
FT                   YRIGEEGKGFTYQMLQFQEERLWAAASSLATMTMCIETTAEYARERKLFGASLLDNQWV
FT                   HFKLAELKTEVEALRALTYRACDLYIQGQDVTELASMAKLKAGRLARIVPDACLQFWGG
FT                   MGFTWDNPVSRYYRDGRLGSIGGGADEVMLGIICKYMNTLPGKKG"
FT   gene            124222..126216
FT                   /locus_tag="Rpic12D_0115"
FT   CDS_pept        124222..126216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0115"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; biotin carboxylase domain protein;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; biotin/lipoyl attachment domain-containing
FT                   protein; Carbamoyl-phosphate synthetase large chain domain
FT                   protein; KEGG: reu:Reut_B4460 carbamoyl-phosphate synthase
FT                   subunit L"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61425"
FT                   /db_xref="GOA:C6BKF6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKF6"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ACS61425.1"
FT                   /translation="MAAPHAAFRSVLIANRGEIALRIMRTARRLGMRTVAVYSDADRDA
FT                   PHCRAADLALPIGASQPQASYLNVAALLEAARKSGAQAVHPGYGFLAESDAFAGACADA
FT                   GLVFIGPPAGAIRAMGNKAGAKRLMEAAGVPCVPGYQGEDQSATRMADEAARIGYPVMI
FT                   KAAAGGGGRGMRRVDRPEALAAALQSARSEAENAFGSGELILEKAIVEPRHIEIQVFAD
FT                   THGNVVHLGERDCSVQRRHQKVIEESPSPAVSPELRARMGAVSVAAARAIGYVGAGTLE
FT                   FLLAPDGAFYFMEMNARLQVEHAVTEAIVGVDLVEWQLRVALGEPLPLAQDAIDARRAQ
FT                   GGHAIEVRLCAEDPQQNFLPQSGTVARWRAPGDVRTDHALADGLVVSPYYDSMLAKIVA
FT                   HGTDRADACRRLAHALDDCLLLGLPTNRAFLRDCLAHPAFLAGDVSTAFIDRHFPAATR
FT                   QAPVPDAAVCQAAAVLITYLRQDAARRYPAELHGWASSRTYPTLCRFTLDGEVIDMRVR
FT                   ALGAQQWEVTWDGGATQVALVSGGEGRITLVLGDTFHAVDYAVTAGACHFVLNGIEHTA
FT                   IDTTYAKAERSGAQTGSGRISAPMNGRVVAVHVAEGEAVSAGQVLLVVEAMKMEHSIAA
FT                   PLAGEVKGLFTQVGAQVAPGGLLMEIAAA"
FT   gene            126302..127888
FT                   /locus_tag="Rpic12D_0116"
FT   CDS_pept        126302..127888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0116"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rpb:RPB_3261 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61426"
FT                   /db_xref="GOA:C6BKF7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKF7"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACS61426.1"
FT                   /translation="MSEATPDTALEANLLNRVTLGDTLHRSARKFGAKVALVDGARRMT
FT                   HGELNADSNRYAHALLASGLKPGDKVAMVCGNSAQFLVAAYGILKAGLVWVPINAMLGP
FT                   EDVRYILEHAEARHVVIDAALYPALRDTLATLGLPAHQCFGEPVADGPQPVEQALQGHA
FT                   DTQPAVVIDDRDLALIMYTSGTTGRPKGAMHSHRSVHAALMSNVAGLNLNETDVFSCLL
FT                   PMFHCAQFATAASAMMVGATLVIQRGFDPAALIDAIAGERITQLFGLPLMYAALLHHPL
FT                   RAQRDLSSLRLCLYAMAPMAKPLLERLIAEVCPNFALGSGQTEIFPMTMYFAPDQQLQR
FT                   TGNYWGQPCMVNEAAVMDDQGNLLGPNQLGEIVHRGPNVMLGYYKDPQATANACRFGWH
FT                   HTGDLGMWDADGQLQFKDRIKDMIKTGGENVPSVKVEEVLLRHPDVANAAVVGLPHAHW
FT                   VEAVAAFVCLKPDAQADAAALQAHCRAHLGSFEVPKHIAVVDKLPMTATGKIQKHVLRS
FT                   ANQTLFEGDAR"
FT   gene            complement(127895..128572)
FT                   /locus_tag="Rpic12D_0117"
FT   CDS_pept        complement(127895..128572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0117"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bpd:BURPS668_A2924 TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61427"
FT                   /db_xref="GOA:C6BKF8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKF8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS61427.1"
FT                   /translation="MPKPATSNPPESATEAAPEAETPRRKRGRPAQDANEGLRRALIEQ
FT                   SARLFREKGYGNTTVRDIAAATGVHAGSWFYYFKTKQDILQAVIEHGLTVALADIEAID
FT                   IEDLPPREAMRQLVRAHLHTLLAPNQDFIPVMLYEWRSLDAQAQERIIALKDRYEGIWT
FT                   RVIDRLHASGEWAQPTPVDRLLMFGALNWTAQWYQAGAGISIDALADQAVLFILRTPPQ
FT                   PVA"
FT   gene            complement(128634..129587)
FT                   /locus_tag="Rpic12D_0118"
FT   CDS_pept        complement(128634..129587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0118"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rso:RSc0258 putative beta lactamase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61428"
FT                   /db_xref="GOA:C6BKF9"
FT                   /db_xref="InterPro:IPR001018"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKF9"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACS61428.1"
FT                   /translation="MAEHDIVTLPDSMRVFERGWLSSNNILFFDEEAHGGCALVDTGYL
FT                   THAPQTVALVQHALQDKPLRRLLNTHLHSDHCGGNAALQALYGSHTRVPAAQIDDVRRW
FT                   DTDALSYGPTGQECARFALPDNDADAGLADGMTARLGGFDWQVISAPGHDPHAVILFSP
FT                   DTRVLISADALWERGFGVIFPELEGESGFAEQQAILERIAQLDARMVIPGHGRPFTNVN
FT                   AAIDASLGRLAYLRADPERNALHAIRVLVKFKLLEQQALSHEALFAWFTQTTLMPRLHA
FT                   RFFAAQSMETLLDAAIAALVKAGAATVEHGRILNRD"
FT   gene            complement(129600..129866)
FT                   /locus_tag="Rpic12D_0119"
FT   CDS_pept        complement(129600..129866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0119"
FT                   /product="protein of unknown function DUF1289"
FT                   /note="PFAM: protein of unknown function DUF1289; KEGG:
FT                   rso:RSc0259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61429"
FT                   /db_xref="InterPro:IPR010710"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKG0"
FT                   /inference="protein motif:PFAM:PF06945"
FT                   /protein_id="ACS61429.1"
FT                   /translation="MDACTRAQLKRSLGKLRNSRAQAERAQPVASPCISVCKMDDARGL
FT                   CIGCMRTIDEIAAWSTMDDTARQTVWKTLPERACAWLNDASCA"
FT   gene            complement(129877..130377)
FT                   /locus_tag="Rpic12D_0120"
FT   CDS_pept        complement(129877..130377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0120"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: rso:RSc0260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61430"
FT                   /db_xref="GOA:C6BKG1"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKG1"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ACS61430.1"
FT                   /translation="MTATDTNAPLPESAQRVADHLRTLGYEKAIVMLPATGKTSAEAAA
FT                   GLGCSVAEIAKSIIFRRAEDDVPVLVIASGTNRVDEAKVSAHVGALAKADAKFVREKTG
FT                   YAIGGVCPVGHAVKPVMLLDQDLFQYDSVWAAAGHPHAVFNLTPAELEAMTGAPVADIA
FT                   LRD"
FT   gene            complement(130399..131328)
FT                   /locus_tag="Rpic12D_0121"
FT   CDS_pept        complement(130399..131328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0121"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   rso:RSc0261 hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61431"
FT                   /db_xref="GOA:C6BKG2"
FT                   /db_xref="InterPro:IPR000138"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027167"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKG2"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ACS61431.1"
FT                   /translation="MSYPQYVKVVEVGPRDGLQNEKSPVSTDTKVELVNRLSEAGFVNV
FT                   EAASFVSPKWVPAMADGADVMARIQRRPGTLYSVLTPNMKGFEGAAAAGADEIVIFSAA
FT                   SEAFAQKNINCTIAESIERFVPVAKAAKDAGIRVRGSISCSLGCPYQGEVPVSSVVDVI
FT                   KRMADLGCDEIDIADTIGVGTAGQVKTVMEAAAATFPIDRLSGHFHDTYGQALANILAS
FT                   LEVGIAIFHASVAGLGGCPYAKGATGNVATEDVLYLLHGLGIRTGIDLDKVVLAGDFIS
FT                   QAIGRPTASRAGRALLLKLQDQIAQACI"
FT   gene            complement(131330..132271)
FT                   /locus_tag="Rpic12D_0122"
FT   CDS_pept        complement(131330..132271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0122"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: rso:RSc0262 putative 2-hydroxyacid
FT                   dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61432"
FT                   /db_xref="GOA:C6BKG3"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKG3"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACS61432.1"
FT                   /translation="MHIQIYTPDGKPQPWLDGFAQALPEARLSVWEQGAAQDADYAVVW
FT                   QPPADMLRDRRDLRAVFNLGAGVDAILGLRAQAPDAIPEGLPIVRLDDAGMAAQMGEYV
FT                   THAVLRFFRRLDEYERQQQAKMWRFLKPFNRDEFVVGVLGLGVLGTHIARTLAGFGFPV
FT                   RGWSRSAKHVEGVDCRAGSDALPDFLAGTRVLVNVLPLTADTENVIDAKLLAQLAPGAF
FT                   VVNVARGKHVVEEELLAAVRSGHIAGAALDVFRTEPLPADHPFWTEPRIHITPHIAALT
FT                   LREVSIAQIARKIRALEAGEPIAGIVDLQRGY"
FT   gene            complement(132358..134382)
FT                   /locus_tag="Rpic12D_0123"
FT   CDS_pept        complement(132358..134382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0123"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; biotin carboxylase domain protein;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; phosphoribosylglycinamide synthetase;
FT                   biotin/lipoyl attachment domain-containing protein;
FT                   Carbamoyl-phosphate synthetase large chain domain protein;
FT                   KEGG: rso:RSc0265 acyl-CoA carboxylase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61433"
FT                   /db_xref="GOA:C6BKG4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKG4"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ACS61433.1"
FT                   /translation="MITKLLIANRGEIACRVAATCRKLGIRTVAVYSDADANARHVAAC
FT                   DEAIHIGEPAARDSYLRADRILEAARATGAQAIHPGYGFLSENEAFAKACADAGIVFVG
FT                   PPASAIEAMGSKSAAKALMEKAGVPLVPGYHGDNQDAGFLRTQADRIGYPVLIKASAGG
FT                   GGKGMRVVESGDAFEASLASVKREASSSFGDDRVLIEKYLTRPRHIEIQVFADSFGDAV
FT                   YLFERDCSVQRRHQKVLEEAPAPGMTLDRRRAMGEAAVAAARAVGYVGAGTVEFIVDED
FT                   GTFYFMEMNTRLQVEHPVTEMITGEDLVEWQLRVASGEPLPRAQDELHIHGHALEARIY
FT                   AENPERDFLPSIGTLKVLRTPAAVEFTVGAQANGEPAAVRIDAGVREGDAISPYYDPMI
FT                   AKLIVWGRDREEALARMLQALGSFHLVGLSSNVAFLRRLVASKPFATADLDTGLIARNH
FT                   DTLFPAAPDVPLDAIALAVAALLAREARSLRTDTRDPHSPWARGSGWRLNGAAERTLRF
FT                   THGDQSIDATLIYGRDGSRLKVGGSEAPFTSQRHAETFTVTLGTHKATGQVHADGDAFH
FT                   VFTGGAHWTLERHDPLAHAGEADDEGGKLTAPMPGKVIAVLAAPGQTVAKGAPLVVMEA
FT                   MKMEHTLTAPADGVVESVLYGVGDQVTEGVQLLAFKPAE"
FT   gene            134510..135067
FT                   /locus_tag="Rpic12D_0124"
FT   CDS_pept        134510..135067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG:."
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61434"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKG5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61434.1"
FT                   /translation="MATPSLNFRNRAETGKTRCAQTVSRLFSARLRKFKAPSRAGTSTA
FT                   QPLVCVPHQALDCCCCCCCCCCCCCCFCLLPFASLRVLPRTHYCVCTAMVWPYLALDGA
FT                   LNFCCREEKERRLSERSEFASSPSLRHKFKESFAISGAPFFAYFLWQDKESESAPAGDE
FT                   READHPHKKQKPPPTKPISPQA"
FT   gene            complement(135051..136139)
FT                   /locus_tag="Rpic12D_0125"
FT   CDS_pept        complement(135051..136139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0125"
FT                   /product="biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="KEGG: rso:RSc0266 biotin synthase protein; TIGRFAM:
FT                   biotin synthase; PFAM: biotin and thiamin synthesis
FT                   associated; Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61435"
FT                   /db_xref="GOA:C6BKG6"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKG6"
FT                   /inference="protein motif:TFAM:TIGR00433"
FT                   /protein_id="ACS61435.1"
FT                   /translation="MQSTPLNFVPNAAKVPPTPGQNPNARWSREAIEALFALPFNDLLF
FT                   QAQQVHRANFDANAVQLSTLLSIKTGGCPEDCSYCPQSARYDTGVEAEKLMPIDEVLEA
FT                   ASRAKQNGASRFCMGAAWRNPKPHQLDAVADMVRGVKAMGLETCVTLGMLKQEQAAQLK
FT                   EAGLDYYNHNLDTAPEFYGEIITTRTYQDRLDTLEHVRDAGINVCCGGIVGLGESVHER
FT                   AGLIAELANMEPYPDSVPINNLVKVEGTPLAGNEELDPFDFVRTIAVARITMPKAMVRL
FT                   SAGREAMDDALQALCFMAGANSIFYGEKLLTTDNPEADADRKLLARLGMRVEVQDHLHQ
FT                   SADASHSHSHSSHCHIDITPAD"
FT   gene            complement(136183..136977)
FT                   /locus_tag="Rpic12D_0126"
FT   CDS_pept        complement(136183..136977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0126"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rso:RSc0267 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61436"
FT                   /db_xref="GOA:C6BKG7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKG7"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACS61436.1"
FT                   /translation="MNAFETLAFAQHGAVTTLTLNRPDVRNAFNETVIAELTGAFRALA
FT                   AEPSVRAIVLSGNGPAFCAGADLNWMKKMAGYSDDENRADALRLAEMLRAIYTCPKPVI
FT                   ARVQGDTYAGGVGLVAACDIVVAVDTANFCLSEAKLGLIPATISPYVIRALGEQASRRY
FT                   FITAERFSAAEAHHLGLVHELVSADALDAKVADITAALVANSPNAVRESKRLVREVSGA
FT                   AINDALLADTAERIAAIRASEEGREGVQSFLGKRMPNWLLPA"
FT   gene            complement(136974..137909)
FT                   /locus_tag="Rpic12D_0127"
FT   CDS_pept        complement(136974..137909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0127"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RSc0268 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61437"
FT                   /db_xref="GOA:C6BKG8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKG8"
FT                   /inference="similar to AA sequence:KEGG:RSc0268"
FT                   /protein_id="ACS61437.1"
FT                   /translation="MNSNTARTWRSALAAVGCALLLAAAHASETPPGISETIVEVPKSA
FT                   GIFTVKLETTVYKPAGDGPFPLIVLNHGKARGKAAFQSRARYSEQAAALVARGYVVAIP
FT                   MRQGFSKSGGAYIGSGCNVEANGIVQAEDVVAALDYMTAQPYVDRSRIVVMGQSHGGLT
FT                   TLAFGTIAYPGVRGLVNFAGGLRNDTCVDWEDNLVRAFETYGRQARYPSLWFYGDNDSY
FT                   WPKPMPDRMFAAYTAAGGKGRLVDFGNFKSDSHGMFASHAGLRIWLPQVDAFLRELGLP
FT                   AGPVQAVAPGGNAEASGADDPKADTNKDPE"
FT   sig_peptide     complement(137826..137909)
FT                   /locus_tag="Rpic12D_0127"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            complement(137939..139546)
FT                   /locus_tag="Rpic12D_0128"
FT   CDS_pept        complement(137939..139546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0128"
FT                   /product="Propionyl-CoA carboxylase"
FT                   /EC_number="6.4.1.3"
FT                   /note="PFAM: carboxyl transferase; KEGG: rso:RSc0269
FT                   putative propionyl-CoA carboxylase (beta subunit) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61438"
FT                   /db_xref="GOA:C6BKG9"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKG9"
FT                   /inference="protein motif:PRIAM:6.4.1.3"
FT                   /protein_id="ACS61438.1"
FT                   /translation="MPTLETKLNPRAEDFKANADAMRALVADLRDKVARIAQGGGDDAR
FT                   AKHLARGKLLPRDRVQQLLDPGTPFLEFSQLAAYGMYDDAAPGAGIITGIGRISGQECV
FT                   IVCNDATVKGGTYYPMTVKKHLRAQEIAEQNHLPCVYLVDSGGANLPNQDDVFPDRDHF
FT                   GRIFYNQANLSSKGIPQIAVVMGSCTAGGAYVPAMSDESIIVKEQGTIFLAGPPLVKAA
FT                   TGEVVSAEDLGGADVHTRLSGVADYFANNDSHALAQARSIVAHLNRRKPEQVQIHAPVE
FT                   PRYAAEELYGVIPTDTRKPFDVREVIARIVDDSAFDEFKARYGTTLVCGFARIWGYPVG
FT                   IIANNGILFSEAALKGAHFIELCCQRKIPLVFLQNITGFMVGRKYENEGIAKNGAKMVT
FT                   AVATAQVPKFTVIIGGSFGAGNYGMCGRAYSPRFLWMWPNARISVMGGEQAASVLATVR
FT                   RDGIEAKGGQWSADEEAAFKAPIRDQYERQGHPYYASARLWDDGVIDPADTRSVLGLGL
FT                   SASLNAPIGDMNFGVFRM"
FT   gene            complement(139575..140015)
FT                   /locus_tag="Rpic12D_0129"
FT   CDS_pept        complement(139575..140015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61439"
FT                   /db_xref="InterPro:IPR023006"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKH0"
FT                   /inference="similar to AA sequence:KEGG:RSc0270"
FT                   /protein_id="ACS61439.1"
FT                   /translation="MPAAQTQPIGAADACPCGNGAYARCCGPFHAGDAVAATAEQLMRS
FT                   RYSAYVLGDTAYLRRTWHPSTCPVDLETSEADAAATRWLGLDVKRHTPQDATHATVEFV
FT                   ARYRVGGRAHRLHETSRFVRLDASGAESAEGRWLYVDGTFPD"
FT   gene            complement(140015..140713)
FT                   /locus_tag="Rpic12D_0130"
FT   CDS_pept        complement(140015..140713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0130"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: rso:RSc0271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61440"
FT                   /db_xref="GOA:C6BKH1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKH1"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACS61440.1"
FT                   /translation="MTAVTSSVSNHPRFDAILFDCDGVLVDSEPIVNRLIWEMLIELGI
FT                   DISLEDSIQRFLGKAIREELDAIAEMRGAPLPPNWLSTFQARRNVLLEAEVEAVPHIGH
FT                   AIDVLSRLGLPMAVASGADRMKVELQLNRTGLIEHFQPTDVRIFSATEVARSKPAPDVY
FT                   LLAASSLGVSPSRCLVIEDSPTGVTAGHAAGMTVLAYAGRNAPGPLIAAGAARTFTDMR
FT                   ELPELPELLA"
FT   gene            complement(140777..141382)
FT                   /locus_tag="Rpic12D_0131"
FT   CDS_pept        complement(140777..141382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0131"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: rso:RSc0273
FT                   putative 2-hydroxychromene-2-carboxylate isomerase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61441"
FT                   /db_xref="GOA:C6BKH2"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKH2"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ACS61441.1"
FT                   /translation="MNGAIDFYFDFSSPYGYFASTRVEELAQRYNRATAWHPILLGVVF
FT                   KTTGGSPLPQVPLKGDYAWRDFERTARFNGIEYRKPTHFPLPTQYAARATLWVHDHHGG
FT                   ERAIDFARAVYRALFVDDINIGEPTEVMKIADAMGIDGAALNAGASSQQIKDQLKAEID
FT                   LAMSRGVFGSPYVIVDGEAFWGFDRFDQIEALLRDGRI"
FT   gene            complement(141425..142555)
FT                   /locus_tag="Rpic12D_0132"
FT   CDS_pept        complement(141425..142555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0132"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: rso:RSc0274
FT                   putative acyl CoA dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61442"
FT                   /db_xref="GOA:C6BKH3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKH3"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS61442.1"
FT                   /translation="MLLTQEQEMIRDAIRTFVREAITPHAAAWDRDATFPKDVHRQLGE
FT                   LGAYGVAVPEELGGAGLDYLSLALILEEIAAGDGGTSTVVSVNNCPVCSMLMAFANDAQ
FT                   KQQWLVPLARGEMLGAFCLTEPHVGSDASALRTTAVRDGDHWVLNGVKQFITSGKHADV
FT                   GIVMAVTDKAAGKRGISAFLVPTKTPGYIVARLEDKLGQHSSDTAQIVFEDCRIPADCL
FT                   LGEEGAGYKMALSGLEGGRIGIAAQSVGMARAAFEAALAYAKERESFGQPLFAHQAVQF
FT                   RLAEMATRVDVARQMVWHAASLKDAGLPCLKEAAMAKLNASEMAERVCSDAIQVFGGYG
FT                   YVSDFPVERIYRDVRVCQIYEGTSDIQKILIARALA"
FT   gene            complement(142566..143279)
FT                   /locus_tag="Rpic12D_0133"
FT   CDS_pept        complement(142566..143279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0133"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rso:RSc0275 short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61443"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKH4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS61443.1"
FT                   /translation="MTNATSRRTRTALILGASRGIGLETVKQYRTDGWRVIATVRSQAA
FT                   AEELQALGAETHVLDLTDANAVAGLAWKLDGEALDVAIYVAGIYGPRTQGATPVSQADF
FT                   DAVMHTNVWGPMNVLPAVLPMVEAGRNGVDEPGGVLAVISSRMGSIGDMESNGGWLYRA
FT                   SKAAVNAVLRAVSIDAKNATCLTFHPGWVQTDMGGAGAAITPQQSVAGIRRVIAGATRA
FT                   DNGGFRNYDGSVIEW"
FT   gene            complement(143289..144470)
FT                   /locus_tag="Rpic12D_0134"
FT   CDS_pept        complement(143289..144470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0134"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: rso:RSc0276 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61444"
FT                   /db_xref="GOA:C6BKH5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKH5"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACS61444.1"
FT                   /translation="MSDRIVIASAARTPMGAFQGELASLTAPQLGAAAIRAAVERAGLK
FT                   PEQIEEVIMGCVLPAGQGQAPARQAALGAGLPLSVGCTTVNKMCGSGMRAAMNAYDALL
FT                   AGSVDVVVAGGMESMTNAPYLIPKGRGGYRIGHGMIYDHMMLDGLEDAYEKGRAMGTFG
FT                   EDCAEKYGFTREAQDHFAMTSVRRAQEATESGAFRWEITPVTVSSKAGDTVIDTDEGPR
FT                   RIKVDKIPSLKPAFKKDGTVTAASSSSINDGAAALVMMRESTAKQLGITPLAVMLGHTT
FT                   HAQAPGWFTTAPVTAIDKLFKKLDWNSGNVDLFEINEAFAVVPMAAMHDLKIPHEKVNV
FT                   NGGACALGHPIGASGARLIATLLGALQHRGGKRGVASLCIGGGEATAVGIELY"
FT   gene            complement(145158..145838)
FT                   /locus_tag="Rpic12D_0135"
FT   CDS_pept        complement(145158..145838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0135"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: rso:RSc0277 carbonic
FT                   anhydrase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61445"
FT                   /db_xref="GOA:C6BKH6"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKH6"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ACS61445.1"
FT                   /translation="MPHRIKELFENNRKWVERVNAEDPAFFSNLANQQNPEYLWIGCSD
FT                   SRVPANQIIGLPPGEVFVHRNIANVVVHSDLNCLSVLQFAVEVLKIRHITVVGHYGCSG
FT                   VKAALTKQRFGLADNWIRHVRDVAEQHETYLGTVVREQDQHDRLCELNVIHQVNNVCLT
FT                   TIVQDAWDRGQPLTVHGWIYGVKDGMLRNLGMAASSNEELHAQLGEAWLNYGKEGSVPS
FT                   PVGF"
FT   gene            complement(145862..147697)
FT                   /locus_tag="Rpic12D_0136"
FT   CDS_pept        complement(145862..147697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0136"
FT                   /product="(Isocitrate dehydrogenase (NADP(+))) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /note="PFAM: Isocitrate dehydrogenase kinasephosphatase;
FT                   KEGG: rso:RSc0278 bifunctional isocitrate dehydrogenase
FT                   kinase/phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61446"
FT                   /db_xref="GOA:C6BKH7"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKH7"
FT                   /inference="protein motif:PRIAM:2.7.11.5"
FT                   /protein_id="ACS61446.1"
FT                   /translation="MSHFPKLLSSQIAFDVARTMLDGFDKHYRLFREVSVQAKTAFETG
FT                   DWAGLQQLQRDRIAYYDERVREASVILEDEYDAENIDDEIWRQIKLHFIGLLTNHHQPE
FT                   CAETFFNSVCTRILHRSYFNNDFIFVRPAISTEYIENEESPTKPTYRAYYPGTRDGLGA
FT                   CFERIVHNFQLNAPFEDLERDIGYVVRAVGEHFGDFRIAPNFQIHVLSSLFFRNKAAYI
FT                   IGRVINGDKTFPLAVPILRNAAGQLSLDTVLLRQEQLLILFSFTHSYFMVDMEIPSAYV
FT                   TFLRDLMPRKPRAEIYTSLGLQKQGKNLFYRDFLHHLQHSSDKFIIAPGIKGLVMLVFT
FT                   LPSYPYVFKVIKDYFPPPKETTRELIKSKYQLVKRHDRVGRMADTLEYSDVSFPLSRFD
FT                   DDLIKELEKHAPSMVEYQRSEDGSEEIVIRHVYIERRMTPLNIWLQEGTDAQVEHGIIE
FT                   YGNAIKELIAANIFPGDMLYKNFGVTRHGRVVFYDYDEIEYLTDCNIRTVPEPRTEEEE
FT                   MSGEVWYNVGPHDIFPETYRTFLLGDPRVREAFLKHHADFFEASMWQGYKERLLSGQMH
FT                   DFYAYDAAERFVNRYGASAPDNTAQDNTTLQRAAA"
FT   gene            complement(147853..149034)
FT                   /locus_tag="Rpic12D_0137"
FT   CDS_pept        complement(147853..149034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0137"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: cti:RALTA_A0110
FT                   putative acyl-CoA dehydrogenase oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61447"
FT                   /db_xref="GOA:C6BKH8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKH8"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS61447.1"
FT                   /translation="MIDLPGLKFDLGEDIEMLRSAVRDWAQGELAPRAGEIDRTDQFPM
FT                   DAWRKMGELGVLGITVAEEYGGANMGYLAHMIAMEEISRASASVGLSYGAHSNLCVNQI
FT                   HRNGTAAQKTKYLPKLVSGEWVGALAMSEPNAGSDVVSMKLRAELKGDRYVLNGTKMWI
FT                   TNGPDCDVLVVYAKTEPELGARGMTAFIVEKGMKGFSVAQKLDKLGMRGSHTGELVFEN
FT                   VEVPVENILGQENGGTKVLMSGLDYERAVLSGGPIGIMQACMDVVTPYIHDRKQFGQSI
FT                   GEFQLIQGKMADMYTTLQACRAYLYTVGKNLDSLGRDHVRQVRKDCAGVILYTAEKATW
FT                   MAGEAIQILGGNGYINEFPVGRLWRDAKLYEIGAGTSEIRRMLIGRELYAETM"
FT   gene            complement(149212..149709)
FT                   /locus_tag="Rpic12D_0138"
FT   CDS_pept        complement(149212..149709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0138"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: Transcription regulator MerR DNA binding;
FT                   regulatory protein MerR; SMART: regulatory protein MerR;
FT                   KEGG: rso:RSc0280 putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61448"
FT                   /db_xref="GOA:C6BKH9"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKH9"
FT                   /inference="protein motif:PFAM:PF09278"
FT                   /protein_id="ACS61448.1"
FT                   /translation="MSASTPSAAAALAADLESGDAGALADASFTITDLAREFDITPRAI
FT                   RFYEDQGLLAPDRQGPGGRRRVYSAGERTRLKLTLRGKRLGLSLGEIKEILDLYESPRD
FT                   TVPQLERFLASLAQHRAVLTQQLEDLNAQLAEIDQHERQCRRLLEDAQAGTVKPTKRRK
FT                   AA"
FT   gene            149894..150973
FT                   /locus_tag="Rpic12D_0139"
FT   CDS_pept        149894..150973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0139"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rso:RSc0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61449"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKI0"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACS61449.1"
FT                   /translation="MNALEHQLDYPFGDTLPEGGTRFEVAPGVYWLRMPLPFALDHINL
FT                   WLLRDRQDGQDGWTIIDCGINHEAIRGYWETIFANHLDGLPVLRVLVTHCHPDHVGLSN
FT                   WLCEGGDQKRWNVRLWMSLGDYAFARMLVGGTGASNAGGEFAARHFERHGLTDPTSIEG
FT                   IRNRKDYYSTLVPGVPSQYRRLMDGNVVTIGEHKWRVITGFGHAPEHVALYSEDANVLI
FT                   SGDMVLPRISTNVSVFDLEPEADSLTLYLDSLGKYEPLPADVLILPSHGRPFRGLHTRI
FT                   RQLRDHHADRLAETLAACKAAPQSARDIVNVIFKRQFDVHQMTFAMGEALAHLHALWHQ
FT                   GELVRETGADGIVRFQAAA"
FT   gene            151007..151393
FT                   /locus_tag="Rpic12D_0140"
FT   CDS_pept        151007..151393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0140"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   rso:RSc0282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61450"
FT                   /db_xref="GOA:C6BKI1"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKI1"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACS61450.1"
FT                   /translation="MADQHDVLDDSAVVLPFPAQTPTAPYYAVIFSSTRTDGDNGYGAM
FT                   ADRMVELGRSMPGFLGIESVRDELAGDQGRPGITVSYWSSLEAIREWKNQSDHLAAQKL
FT                   GREQWYASYHLRIAKVEYDYGFER"
FT   gene            complement(151459..152304)
FT                   /locus_tag="Rpic12D_0141"
FT   CDS_pept        complement(151459..152304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61451"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKI2"
FT                   /inference="similar to AA sequence:KEGG:RSc0283"
FT                   /protein_id="ACS61451.1"
FT                   /translation="MTYTDAAGLAHAPVDTTPRIASLVPSITDLLFSLDLGDQLVARTG
FT                   FCIHPREAVRNVPKVGGTKTVKLDKLRELAPTHVIVNIDENTRPTVDRLREFIPHIIVT
FT                   HPCSPEDNLALYQLLGGIFRREAQAQKLADALTQELEALRGRHFLPHRVLYAIWQDPWM
FT                   TVSRDTYISRMLKLVNCHTWPDDPAPVQCGTDKSGDCARPNRPDTRYPTFRWSNDVVRN
FT                   IDCVLLSTEPYSFTEEHVDALEKQIGKPVYLVDGEMVSWYGSRAIDGVRYLGQFAKTLR
FT                   "
FT   gene            complement(152301..153101)
FT                   /locus_tag="Rpic12D_0142"
FT   CDS_pept        complement(152301..153101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0142"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rso:RSc0284 short chain
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61452"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKI3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS61452.1"
FT                   /translation="MSEIVFITGASSGIGQALARQYAAQGATIGLVARRVDALQAFVQT
FT                   LPAALQSRCHCYAADVRSADSMRDAANAFIATAGLPDVVIANAGISVGTDLREPGDLKA
FT                   FAVVMDTNWMGVLNTFQPFVGPMLARAKPGQPGGTLVGIASVAGVRGLPGAAAYSASKS
FT                   AVIKLMESLRVEFGPLGLRVVTIAPGYIRTPMTEHNPYPMPFLMPVDRFALKAVNAIHR
FT                   GVRFTVLPWPMGIVAKLLHVLPRGLYDFAFARAGRKPRNPEISS"
FT   sig_peptide     complement(153042..153101)
FT                   /locus_tag="Rpic12D_0142"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.756) with cleavage site probability 0.736 at
FT                   residue 20"
FT   gene            complement(153214..153870)
FT                   /locus_tag="Rpic12D_0143"
FT   CDS_pept        complement(153214..153870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0143"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: rso:RSc0285
FT                   thiol:disulfide interchange signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61453"
FT                   /db_xref="GOA:C6BKI4"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR023205"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKI4"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ACS61453.1"
FT                   /translation="MKKLAAFLIALATGAGFLMTAPANATPTAGKEYKVLQTPQPVPAG
FT                   KIEVTEFFWYGCPHCYDFENTWTAWVAKQGKDVVIKRVPVAFNAKLEPHTRIYYTLEAL
FT                   GKLDAKDASGKTLHDRVFDQLHKNYRSMSELDDIAKFMAANGVDEKQFRDTYNSFSVNA
FT                   NTKRAAQLADQYKIEGVPTVVVQGKYTTSPADAGSNVGAAQTLDYLVDQVRNRKM"
FT   sig_peptide     complement(153793..153870)
FT                   /locus_tag="Rpic12D_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 26"
FT   gene            complement(154031..154741)
FT                   /locus_tag="Rpic12D_0144"
FT   CDS_pept        complement(154031..154741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0144"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: rso:RSc0286
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61454"
FT                   /db_xref="GOA:C6BKI5"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKI5"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ACS61454.1"
FT                   /translation="MARNTQSSRARSQRGGTFLGLVLGLIVGLAIAVVVAVYITKAPVP
FT                   FVSRGGAQPKPSEAGNVVNTLPPPVQPAPQASAPQAADPNAPLWSRVPAKPVDQPADQN
FT                   NPPPGITIRPAQPGSAPQTASAPIAKPPKPPVTASNEKPVTDPIAEIARQDAAKTGYFL
FT                   QVGAYKSAEDAERQKGNLAMQGFEAKVTQREVNGTTMYRVRLGPFNSLDEMTAVRSRLQ
FT                   STGVESSVIRFARQ"
FT   sig_peptide     complement(154643..154741)
FT                   /locus_tag="Rpic12D_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.794 at
FT                   residue 33"
FT   gene            complement(154802..156592)
FT                   /locus_tag="Rpic12D_0145"
FT   CDS_pept        complement(154802..156592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0145"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: rso:RSc0287 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61455"
FT                   /db_xref="GOA:C6BKI6"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKI6"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ACS61455.1"
FT                   /translation="MLPSHKQTIAQLLSDAVGSLLPEGQARPEIVLERPKQAAHGDIAC
FT                   NVALQLAKPLGTNPRELAGKIADAIRADARGQRLVSAVEIAGPGFINLRLSAAARADVI
FT                   AAVFAEGDRYGAANTHDGAPVLVEFVSANPTGPLHVGHGRQAALGDALASLLDWQGHKV
FT                   HREFYYNDAGVQIHNLAVSVQARARGYKPGDANWPEAAYNGDYIADIAADYLAGKTVRA
FT                   SDGEPVTGERDVENLEAIRRFAVTYLRNEQDIDLQAFGVKFDRYYLESSLYTEGKVQQT
FT                   VDALVAAGKTYEQEGALWLRTTDDGDDKDRVMRKSDGAYTYFVPDVAYHTTKWGRGFTQ
FT                   VINVQGSDHHGTIARVRAGLQGLNIGIPKGYPDYVLHKMVTVMKDGAEVKISKRAGSYV
FT                   TVRDLIEWSNGDAESEAGVDTIRACVEAGEPNWPARFTRGRDAVRFFLLSRKADTEFVF
FT                   DVDLALKQSDENPVYYVQYAHARICSVFERAGVDPASLTNADLAAVTGPDVSPQATALV
FT                   QRLAAFPDMLADAARELAPHAVAFYLRDLAGDFHAFYNADRVLVDDEAVKRARLALLAA
FT                   TRQVLRNGLTVIGVSAPQKM"
FT   gene            156767..157090
FT                   /locus_tag="Rpic12D_0146"
FT   CDS_pept        156767..157090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0146"
FT                   /product="Domain of unknown function DUF1840"
FT                   /note="PFAM: Domain of unknown function DUF1840; KEGG:
FT                   rso:RSc0288 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61456"
FT                   /db_xref="InterPro:IPR014991"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKI7"
FT                   /inference="protein motif:PFAM:PF08895"
FT                   /protein_id="ACS61456.1"
FT                   /translation="MITFTSHASQKFSMQKDLAMVLLGVIGKTLGERGVITPEEMPHAI
FT                   DRLKRAIKDDTHQAHIKVAELSASELDENGEEEPPHLGQRAYPLLHMLEESLVEQSSVL
FT                   WGV"
FT   gene            complement(157220..157777)
FT                   /locus_tag="Rpic12D_0147"
FT   CDS_pept        complement(157220..157777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0147"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; Rubrerythrin;
FT                   KEGG: cti:RALTA_A1787 putative bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61457"
FT                   /db_xref="GOA:C6BKI8"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR014490"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKI8"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACS61457.1"
FT                   /translation="MSLTNVAAPSESGFLTDIKTLRERARKHIEEGAVTEDYKADRETV
FT                   LRLLNEALATELICVLRYRRHHFMAKGINAEPIAAEFLVHANEEQAHADSIAARIVQLG
FT                   GEPNFNPEGLSTRSHSEYVEAESLVDMIKENLVAERIAIDSYLEMIRYIGDRDPTTRRV
FT                   LEQILAVEEEHADELSDMLHDQ"
FT   gene            complement(157810..158235)
FT                   /locus_tag="Rpic12D_0148"
FT   CDS_pept        complement(157810..158235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0148"
FT                   /product="protein of unknown function DUF883 ElaB"
FT                   /note="PFAM: protein of unknown function DUF883 ElaB; KEGG:
FT                   reu:Reut_A0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61458"
FT                   /db_xref="GOA:C6BKI9"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKI9"
FT                   /inference="protein motif:PFAM:PF05957"
FT                   /protein_id="ACS61458.1"
FT                   /translation="MSLFANHRVRSRIDEVNDRARRVMDSASDAVDHARSASRPAVEDV
FT                   QSLLRSLEDAIHTLTDEGSAEADRASRTLQARADQLRRAANERAHQARERMDWALGRAE
FT                   ETITAAPFRAVGVAVAIGAAIGLVVALAGSGRRDGSE"
FT   gene            complement(158381..158554)
FT                   /locus_tag="Rpic12D_0149"
FT   CDS_pept        complement(158381..158554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0149"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   cak:Caul_4145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61459"
FT                   /db_xref="GOA:C6BKJ0"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKJ0"
FT                   /inference="protein motif:PFAM:PF07043"
FT                   /protein_id="ACS61459.1"
FT                   /translation="MLKWALIFAIISLVAGVLGFTGIAAGAASIAKVLFFIFVVLFVLF
FT                   LVLGVTVFKAVD"
FT   sig_peptide     complement(158474..158554)
FT                   /locus_tag="Rpic12D_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.583 at
FT                   residue 27"
FT   gene            158738..160195
FT                   /locus_tag="Rpic12D_0150"
FT   CDS_pept        158738..160195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0150"
FT                   /product="histidine kinase"
FT                   /note="PFAM: CHASE3 domain protein; histidine kinase
FT                   dimerisation and phosphoacceptor region; ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; KEGG: rso:RSc0289 transmembrane sensor
FT                   kinase VsrA transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61460"
FT                   /db_xref="GOA:C6BKJ1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKJ1"
FT                   /inference="protein motif:PFAM:PF05227"
FT                   /protein_id="ACS61460.1"
FT                   /translation="MGLHAMRSSLRSTLLLAGGILLTLGVLIASETGNIRLSQGYRQVI
FT                   QSQQAETAINELLAELVNAEAGQRGFLLTGKDEYLDPYNKAIPHIHALMAEIRDHYAND
FT                   PDALKLFSETALQVSRKLTEMELTLIYGKRDLEVALDLVRTDFGKASMEAVRQGLDRLR
FT                   QREIATVARSLEHAERDLALSRYGIALITAVNIILLVVLGMQHAKRLAVTERERDMAEE
FT                   ESQKLDRMVRERTRQLSDLAAHLQRVTEDEKTRLARELHDELGAILTATKMDLHWLRSR
FT                   VHSSEPAVSEKITRVMAHVDQGIQIKRRLIEDLRPTILLNLGLVEALSQLTEDVGTRNG
FT                   WHTEVSLPDDMPKLTDDAAIALYRIVQESLTNASKYAHATTVSVALDVGEEGVRLRVRD
FT                   NGRGFPADIERRRMVGHHGLLGMEQRAIALGGTLVIDSMPGGGVTIIVELPPSDAVFDR
FT                   SAANEPSGMQALTGGIAPAPGHGGATV"
FT   sig_peptide     158738..158827
FT                   /locus_tag="Rpic12D_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.945 at
FT                   residue 30"
FT   gene            complement(160277..160417)
FT                   /locus_tag="Rpic12D_0151"
FT   CDS_pept        complement(160277..160417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0151"
FT                   /product="Entericidin EcnAB"
FT                   /note="PFAM: Entericidin EcnAB; KEGG: rso:RSc0290
FT                   entericidin precursor lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61461"
FT                   /db_xref="GOA:C6BKJ2"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKJ2"
FT                   /inference="protein motif:PFAM:PF08085"
FT                   /protein_id="ACS61461.1"
FT                   /translation="MKTLCAALALTCMFLAGCNTMAGAGKDIQTGGQKLENSADNVKQK
FT                   M"
FT   sig_peptide     complement(160349..160417)
FT                   /locus_tag="Rpic12D_0151"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 23"
FT   gene            complement(160490..160930)
FT                   /locus_tag="Rpic12D_0152"
FT   CDS_pept        complement(160490..160930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0152"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rso:RSc0291 putative
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61462"
FT                   /db_xref="GOA:C6BKJ3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKJ3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS61462.1"
FT                   /translation="MLDQAVTLSARGLRVLLIEDSPVLRGMVLEYLKASAFVATVEWAD
FT                   TEDLALRLLGQGNYDVVIVDLQLRQGNGFKVLQTLRDQASPSVRIVYTNHAQVPTYRQR
FT                   CFEAGANYFFDKSLELDKVFEVIEERAGVGRPRPQPAQHFHP"
FT   gene            complement(161033..161665)
FT                   /locus_tag="Rpic12D_0153"
FT   CDS_pept        complement(161033..161665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0153"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: rso:RSc0292 response
FT                   regulator transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61463"
FT                   /db_xref="GOA:C6BKJ4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKJ4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS61463.1"
FT                   /translation="MIRVLIADDHEIVRAGLRQFLSEERDIEVAGEAASGEEAMEQLRT
FT                   GAFDVVVLDISMPDRNGIDTLKLARQRHPDLPVLILSTFPEDQYAINLIRAGASGYLTK
FT                   ESAPDELVKAIRTVSQGRRYVSPTVAELLIGGLEKPTDQPLHQTLSKREFQIFCKLARG
FT                   QSVSVIAEELFLSVKTVSTYRTRILEKMGMKSNADLTYYAIKNGLVE"
FT   gene            complement(161965..162390)
FT                   /locus_tag="Rpic12D_0154"
FT   CDS_pept        complement(161965..162390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0154"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RSc0293 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61464"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKJ5"
FT                   /inference="similar to AA sequence:KEGG:RSc0293"
FT                   /protein_id="ACS61464.1"
FT                   /translation="MNKLLISLSAIAIAAASAYANAQTPSAGASLQSNGTAAVAPAQGN
FT                   AGVGLKADAKSDGGAKVDTDSTKSQLNTKAEHGAKAAHEHKAKPEAGVDKSADKAGKSV
FT                   SKTEKSAEKSGKAAKADTAAGLSADAGANAATTTQTK"
FT   sig_peptide     complement(162322..162390)
FT                   /locus_tag="Rpic12D_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.916 at
FT                   residue 23"
FT   gene            complement(162631..165348)
FT                   /locus_tag="Rpic12D_0155"
FT   CDS_pept        complement(162631..165348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0155"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /note="KEGG: rso:RSc0294
FT                   5-methyltetrahydrofolate--homocysteine methyltransferase;
FT                   TIGRFAM: methionine synthase; PFAM: dihydropteroate
FT                   synthase DHPS; Methionine synthase B12-binding module cap
FT                   domain protein; cobalamin B12-binding domain protein;
FT                   Vitamin B12 dependent methionine synthase activation
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61465"
FT                   /db_xref="GOA:C6BKJ6"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKJ6"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ACS61465.1"
FT                   /translation="MTDHPMRLSGLEPFNIGESTLFVNVGERTNVTGSKAFARMILNSQ
FT                   FDEALAVARQQVENGAQVIDINMDEAMLDSKAAMVRFLNLIASEPDIARVPIMIDSSKW
FT                   EVIEAGLKCVQGKAIVNSISLKEGEEQFAHHAKLIKRYGAAAVVMAFDEQGQADTFARK
FT                   TEICKRSYDFLVNKVGFAPEDIIFDPNIFAVATGIEEHNNYAVDFIEATRWIKQNLPYA
FT                   KVSGGVSNVSFSFRGNDVVREAIHTVFLYYAIQAGMDMGIVNAGQLGVYENLDPELRER
FT                   VEDVVLNRRPDATDRLLEIADRYKGGGTRREENLAWRQEPVEKRLAHALVHGITDYVVE
FT                   DTEEVRQKIFAAGGRPIQVIEGPLMDGMNIVGDLFGAGKMFLPQVVKSARVMKQAVAHL
FT                   IPFIEEEKRQIAAAGGDVRSRGKIVIATVKGDVHDIGKNIVTVVLQCNNFEVVNMGVMV
FT                   PCNDILAKAKVEGADIIGLSGLITPSLEEMAYVASEMQRDEYFRVKKIPLLIGGATTSR
FT                   VHTAVKIAPNYEGPVVYVPDASRSVSVASSLLSDEGAARYVEELHADYDRIRTQHANKK
FT                   ATPMVSLAAARANKTKIDWSNYTPPKPKFIGRRVFRNYDLNELAQYIDWGPFFQTWDLA
FT                   GKFPDILNDEIVGESARKVFSDGKSMLARLIAGRWLTANGVIALLPANTVNDDDIEIYT
FT                   DESRSEVALTWRNIRQQSERPIIDGVMRPNRCLADFIAPKSTGIADYIGLFAVTGGIGV
FT                   EKREKQFEADNDDYSAIMLKALADRFAEAFAECLHARVRRDLWGYAPDETLDNDALIRE
FT                   EYKGIRPAPGYPACPEHTVKRDMFRVLDAQEIGMDLTEALAMTPAASVSGFFMSHPDST
FT                   YFTLGKIGQDQVDDMIARSGEDRAFVERALAPNL"
FT   gene            complement(165399..166439)
FT                   /locus_tag="Rpic12D_0156"
FT   CDS_pept        complement(165399..166439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0156"
FT                   /product="homocysteine S-methyltransferase"
FT                   /note="PFAM: homocysteine S-methyltransferase; KEGG:
FT                   rso:RSc0295 5-methyltetrahydrofolate--homocysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61466"
FT                   /db_xref="GOA:C6BKJ7"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKJ7"
FT                   /inference="protein motif:PFAM:PF02574"
FT                   /protein_id="ACS61466.1"
FT                   /translation="MTAPLPYTRAANLPALLRERILILDGAMGTMIQRYKLNEAQYRGE
FT                   RFADHPIDVKGNNELLLLTRPDVIREIHEQYLAAGADLIETNTFGATTIAQEDYKMAEL
FT                   AYEMNVVAARLAREACDKYSTPDKPRFVAGAFGPTPKTASISPDVNDPGARNVSFDQLR
FT                   DAYYEQGKALLEGGADVFLVETIFDTLNAKAALFAIDQLFEDTGERVPVMISGTVTDAS
FT                   GRILSGQTVEAFWNSLRHAKPITFGLNCALGAALMRPYIAELAKICDAAVSCYPNAGLP
FT                   NPMSDTGFDETPEVTSSLVDEFASAGLVNLVGGCCGTTPEHIKAIAERVANRKPRAWPG
FT                   QYKEAA"
FT   gene            166591..166983
FT                   /locus_tag="Rpic12D_0157"
FT   CDS_pept        166591..166983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0157"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: rso:RSc0296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61467"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C6BKJ8"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACS61467.1"
FT                   /translation="MQLLDPTDAHAFLQRTPAALFIDCRSEMEHLFVGHPAGAHHVSWN
FT                   DGPHWEVNPEFVPTVRKLTGHGIERPIVLICRSGNRSAAAAHALEEAGFRDVYVVRHGF
FT                   EGDLDGTRHRNTLNGWRHAGLPWEQC"
FT   gene            complement(167096..167353)
FT                   /locus_tag="Rpic12D_0158"
FT   CDS_pept        complement(167096..167353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61468"
FT                   /db_xref="InterPro:IPR021951"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB56"
FT                   /inference="similar to AA sequence:KEGG:RSc0297"
FT                   /protein_id="ACS61468.1"
FT                   /translation="MQMIYNSDNYCVVEFGVDGQHAMLAAGGYEIVDKNLKREIFLGGE
FT                   LAEHFREDVKKLIASEPTVEEVDDFLGKFDTVMTQPVTMH"
FT   gene            complement(167673..168512)
FT                   /locus_tag="Rpic12D_0159"
FT   CDS_pept        complement(167673..168512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0159"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rso:RSc0298
FT                   B-ketoadipate enol-lactone hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61469"
FT                   /db_xref="GOA:C6BB57"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR026968"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB57"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACS61469.1"
FT                   /translation="MDANALSAAGTVRANDIDIHYRTDGTDGPWAVLAHALGVDHRLWD
FT                   NTAQRLAGRYRVLRYDARGHGQTSAPHGPYTLFQMADDVAGLLDALSIGQVHFVGLSMG
FT                   GMVGQVLGVRHAQRLLSLTLCDTVCHTPISAHPMWDERIGQVEAHGMSGIVEPTMQRWL
FT                   TTPFREAHPDVVERIRALLRATPPHGYVGACLAIKALDTRSALARIACPVLVMTGEQDT
FT                   GAPVEAAREIASHIPNARLKVIPHAAHLAPIEQEDAFLADLDEFLGHAGCESQGDTP"
FT   gene            complement(168514..169548)
FT                   /locus_tag="Rpic12D_0160"
FT   CDS_pept        complement(168514..169548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0160"
FT                   /product="putative prolin-rich signal peptide protein"
FT                   /note="KEGG: rso:RSc0299 putative prolin-rich signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61470"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB58"
FT                   /inference="similar to AA sequence:KEGG:RSc0299"
FT                   /protein_id="ACS61470.1"
FT                   /translation="MVLLAVLVLHVVAVEWVARSRQVTWPPAPEQIIPALLLLPEPVQP
FT                   PPPPATPTPRPAVPHVPHPAAPAPAPTPAPAPDLASMDPSEFTSAGAQASGDTGMARDL
FT                   SGDGPGGPPAPSGEGFSLPPSATLRYATYVNGVRNEDGVIRWATDGKTYTLAVEIPLPL
FT                   FFGTLAFRSAGTVGDYGLTPTRYEEVRGRRQPDVTTFHYATESAPASGVQSASTVTFTR
FT                   TPAVLPLPEGTQDRFSVFLQLTGLARGGPERIASPGLTLEIPIADTDSVEVARVQHIGE
FT                   DTIDTPNGTIRAQHFIRLPRRADDKRRVEIWLSPDRGWLPVRLRQTEPNGMQFDLVYQS
FT                   QEGG"
FT   gene            complement(169613..170485)
FT                   /locus_tag="Rpic12D_0161"
FT   CDS_pept        complement(169613..170485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0161"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   rso:RSc0300 transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61471"
FT                   /db_xref="GOA:C6BB59"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB59"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACS61471.1"
FT                   /translation="MPPLPADADLDLEPDADSELDAPARSGIQSIEVGFRLLEVLTHTN
FT                   GPMMLRDLARAAPMNPAKAHRYLVSFARLGLVTQTPEGRYDLGPFALEMGLLSLNRQDP
FT                   MRRARPAAAALRDEIDHTIGLAVWGNQGPAIVHWEEASHPVTVSLRLGDVMPMLNSATG
FT                   RVFGAYLPRAQTRSFIQREIDRIAAKGKSADSENPELPRTLEAYDAICADVRQHGASRI
FT                   HGGVLPGINAMSLPVFDANGQLCLVLIALGAQSTFDTSWSSPLERRLRLAAQQLSADLG
FT                   YVAPTAPQS"
FT   gene            170568..171560
FT                   /locus_tag="Rpic12D_0162"
FT   CDS_pept        170568..171560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0162"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rso:RSc0301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61472"
FT                   /db_xref="GOA:C6BB60"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB60"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACS61472.1"
FT                   /translation="MKLATLKDGSRDGQLAVVSRDLKTAHFATHIAGTLQRALDDWAFH
FT                   APQLQDLYDLLNAGRARHPFAFDAANCMAPLPRAYQWADGSAYVNHVELVRKARGAEMP
FT                   PEFWTDPLMYQGGSDDLAGAHDPIVCRSEAFGIDFEAEVAVITGDVPMGTEPAAAAEGI
FT                   RLIVLANDVSLRNLIPAELGKGFGFFQSKPATSFSPVAVTPDELGDAWRERKVHLPMTV
FT                   RWNNKKVGQPECGTDMVFDFGQLIAHICKTRNVRAGSIVGSGTISNVDRSKGYACIAEK
FT                   RMLETLESGAPVTEYMRYGDTVKIEMFDANGVSIFGAIDQEVVAPGTQA"
FT   gene            complement(171570..172478)
FT                   /locus_tag="Rpic12D_0163"
FT   CDS_pept        complement(171570..172478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0163"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   rso:RSc0302 transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61473"
FT                   /db_xref="GOA:C6BB61"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB61"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACS61473.1"
FT                   /translation="MPIDAPLAQDTSPDELPAEDATPERTSAGIQSAEIALSVLSAMAH
FT                   AGGAHAVSELGRQLGMPRAKVHRYLVSLERMGFVEQDPASARYRLGTQALQVGLSALSD
FT                   VDFVREGSNLLPKLAERLNESVFLSIWTARGPVIVRWEDSGRPVAVNVRVGSVMPLLNS
FT                   ATGQACAAWVPEIQIVSLIDRELRGPGAGKAGLTDWLNCRARWQAVRQEGVARIGGTLV
FT                   HGIDSVAVPVLDSQGKLAGAITALGLSSVFDSSLEGPAARLLREAGRTLSLRLGYHGQA
FT                   LTAGAAAPKRGRRPRTAPESA"
FT   gene            172585..173589
FT                   /locus_tag="Rpic12D_0164"
FT   CDS_pept        172585..173589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0164"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   sso:SSO1532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61474"
FT                   /db_xref="GOA:C6BB62"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB62"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACS61474.1"
FT                   /translation="MKLSIFSVQDHYPDRPRSLPQLYADVIAQARHAEALGYDTFWVAE
FT                   HHFHEYGAVPNPAVFLSHLAAQTQRLRLGTAISILTFHHPATVAENYAMIDALSGGRLS
FT                   LGVGSGYLKHEFEGYDVDPAVKRERFDEALMLVERLLAGERVHHAGQFHTLRDVRLNVL
FT                   PVQARVPIHVAILRREAAYHIGRQGRRMLFVPYASVDSFNDIRALMDDYRRGLAEAGIA
FT                   DTRGMAAVALHTHVGPTEAAVRATAADPFDLYVATRLYARRQTYDDVLASGLSLFGTPD
FT                   AVAEKLARLSDMGVDHVMALHNFGLMPQSAVLESMRAFVEDALPRARITALAA"
FT   gene            173674..174837
FT                   /locus_tag="Rpic12D_0165"
FT   CDS_pept        173674..174837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0165"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bxe:Bxe_A4234 branched chain amino acid ABC transporter
FT                   periplasmic ligand-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61475"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB63"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACS61475.1"
FT                   /translation="MQRPKWRHAGVLAGLALLSSAALADIRVGVTVSATGPQASLGQPE
FT                   KNATTLWPSEIGGEKVDVIVLDDASDTTRAVTNTRKLMSESNVDVIVGSSTTPNTLAMI
FT                   DAAAEGKTPVISLASSARLIEPMDAKRRWIFKTPHSDSHMASLIAEHAAAHGLKTIAYI
FT                   GFANALGEAFLTEVQRFADLKHIRVTDTERFSPTDNSVTAQVLHLLANKPDAVVIGGSG
FT                   TPAALPARALAERGYTGKIYFNHGVSNNDFVRLCGKDCEGAYVPTGPVMVAAELSDTHP
FT                   AKKQALDFARRYEAAFGKGSVSIFAAYTGDIGLLLQRAVPVALKRAKPGTPAFREALRD
FT                   ALEQVRDLPTSTGVVNMSPQDHVGLDQRARVMAQIRRGQWHLADTAK"
FT   sig_peptide     173674..173748
FT                   /locus_tag="Rpic12D_0165"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            174906..175724
FT                   /locus_tag="Rpic12D_0166"
FT   CDS_pept        174906..175724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0166"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rso:RSc0304 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61476"
FT                   /db_xref="GOA:C6BB64"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB64"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACS61476.1"
FT                   /translation="MTSLAPRFARYQALTLVQHGPILEIVMGAAQSANRKLSTADAGLH
FT                   RELAEVWRDVSAEPSVRVALIRGEGKGFSAGGDLHLVEQMADDFEVRTRVWHEARDLVY
FT                   NVINCDKPIVSAMHGPAVGAGLVAGLLADISIAAKDARIVDGHTRLGVAAGDHAAIVWP
FT                   LLCGMAKAKYYLLLCESMTGEEAERIGLISLAVPESELVNRAFEVAERLAAGSQTAIRW
FT                   TKYALNNWLRLAGPSFDTSLALEFMGFAGPDVREGIASLRQKRPPTFDGA"
FT   gene            175781..176668
FT                   /locus_tag="Rpic12D_0167"
FT   CDS_pept        175781..176668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61477"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB65"
FT                   /inference="similar to AA sequence:KEGG:RSc0305"
FT                   /protein_id="ACS61477.1"
FT                   /translation="MFTQMPNFAEGGFDFLRKLWGGGFAGMAGGGMPNMASFAAPPMDL
FT                   EEIDKRIHDLRAVESWLQLNASLLRTAIQGLEVQRATLVALQTFGSALSPEAMKSAFDG
FT                   LTPSASSSSSSSGEESKPVWPHTATTAKPDDEPPPEDEDEAEEDTDDDQAEARAEAAHA
FT                   QAQAAAQAQAAARAAAAALDPSPWWNMLQQQFNQIASSAAAAMPMPQNLMPGFPGGFPG
FT                   SGGAPGAEGLDAAPEDIEEPTAPAQPKRAAAKATPKPAAKASAGRTAKPATKKTAAKKA
FT                   PAKSAPRKPTNDTP"
FT   gene            176672..177856
FT                   /locus_tag="Rpic12D_0168"
FT   CDS_pept        176672..177856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0168"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: rso:RSc0306 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61478"
FT                   /db_xref="GOA:C6BB66"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB66"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACS61478.1"
FT                   /translation="MSTDCTALLMMGGGARAAYQVGVLRGIAGLAREYAPGVARTPFDV
FT                   ICGTSAGAINSLGLARGAQDFTLATEALTQLWGTLHADRVYRTDVGRVGSSGARWLTAL
FT                   AFGWMTGRTPRALFDNTPLRELLESQHDGQQVQAAFDAGALRALAITALSYTTGRHVTF
FT                   YQSPHVVLPWRRSQRIAVSDQIGVSHMLASSSIPFIFPAEPVPLEGNDEWFGDGTMRQM
FT                   SPLSPAIHLGANRILVVGAASRTQPGWYDTVPASGYPSLAQIAGQALASIFLDGLSADI
FT                   ERLQHVNAMVARNPEIADARDGWRKIEVLVMAPSERIELIASRHVQRLPGTVRALLKPL
FT                   GGTEARGAAFASYLLFEPEFTQELIDLGERDVQARRDELAAFLYGAIPDTMRAA"
FT   sig_peptide     176672..176725
FT                   /locus_tag="Rpic12D_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.838) with cleavage site probability 0.615 at
FT                   residue 18"
FT   gene            complement(177857..178552)
FT                   /locus_tag="Rpic12D_0169"
FT   CDS_pept        complement(177857..178552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0169"
FT                   /product="glutathione peroxidase"
FT                   /note="PFAM: glutathione peroxidase; KEGG: rso:RSc0307
FT                   putative glutathione peroxidase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61479"
FT                   /db_xref="GOA:C6BB67"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB67"
FT                   /inference="protein motif:PFAM:PF00255"
FT                   /protein_id="ACS61479.1"
FT                   /translation="MLFPTTVSPRRPRLQLHASGALRRHHVLMIIIAIAIAVIALLLPR
FT                   TGHAATAGVAPTVQAPVAAGACPASLNFRVKRLQDDAPQDLCQYAGRVVLVVNTASYCG
FT                   YTHQYEGLEALYAKYRDKGLTVLGFPSNDFQQEPGNSKQIADFCYNTYGVKFPMFSKTA
FT                   VVGAVASPLYAWLATQTGQPPKWNFHKYLLDRNGRVAAVFPSSVEPSDPALIKRIDALL
FT                   AEPSTRSSR"
FT   sig_peptide     complement(178403..178552)
FT                   /locus_tag="Rpic12D_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.976 at
FT                   residue 50"
FT   gene            178958..179812
FT                   /locus_tag="Rpic12D_0170"
FT   CDS_pept        178958..179812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0170"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61480"
FT                   /db_xref="GOA:C6BB68"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB68"
FT                   /inference="similar to AA sequence:KEGG:RSc0308"
FT                   /protein_id="ACS61480.1"
FT                   /translation="MLYPELFKSLEAVRWNMEKDIPWDTFDASLLTDAQAQTIKMNAIT
FT                   EWSALPATEMFLRDNRHDSDFSAFMSVWFFEEQKHSLVLMEYLRRFRPDLVPTEEELHN
FT                   VRFEFDPAPPLETLMLHFCGEIRLNHWYRRASEWHTEPVIKAIYKHLSQDEARHGGAYL
FT                   RYMKKYLGQFGDSARSAFAKIGVLMASARRTEKPLHPTNLHVNKALFPQDTVQSRLPNP
FT                   DWLEHWLDEQIKFDAGWEKKVIERILHNMGLLFERTFETVQDLNRYRKELNARLLGSAE
FT                   QAA"
FT   gene            179848..180384
FT                   /locus_tag="Rpic12D_0171"
FT   CDS_pept        179848..180384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0171"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: rfaE bifunctional protein;
FT                   cytidyltransferase-related domain protein; PFAM:
FT                   cytidylyltransferase; KEGG: rso:RSc0309 putative
FT                   transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61481"
FT                   /db_xref="GOA:C6BB69"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB69"
FT                   /inference="protein motif:TFAM:TIGR02199"
FT                   /protein_id="ACS61481.1"
FT                   /translation="MGRFVFHSDFAFAMTARQPAPAFEQKICDAADVEARVRDLQRPLV
FT                   FTNGVFDILHRGHATYLAQARALGASLVVGVNTDASVRMLGKGDDRPLNTQDDRLAVLA
FT                   ALEAVSLVVLFAERTPVELIQRVRPDIYVKGGDYDIDALEETRVVRSWGGTALAIPFEH
FT                   DRSTTALLKRVRATS"
FT   gene            complement(180389..181168)
FT                   /locus_tag="Rpic12D_0172"
FT   CDS_pept        complement(180389..181168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0172"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: rso:RSc0310
FT                   putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61482"
FT                   /db_xref="GOA:C6BB70"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB70"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ACS61482.1"
FT                   /translation="MTLRLALLLLLLVNGVLLAANTGVFGPEVSKAWFESEREPDRMRR
FT                   QIRTEEIRILQPAPASSPAAAVPKSAPGSPEASPPAASGTQANLEPTALTTAAAGNGGT
FT                   CTELGGLTEAQATRSIDQLRQVAGVQVERFTRQEDNRWWVHMPARDTRDDAERKVSELK
FT                   RRNVADSAIVQEGNTFVVSLGLFRDKERAQQRLDELRAKDVRTAVVTQTRRLGSQTSLR
FT                   VTASADAASGVAAQLAALKKTLGAEDLHACAAVTASR"
FT   sig_peptide     complement(181109..181168)
FT                   /locus_tag="Rpic12D_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 20"
FT   gene            complement(181270..182151)
FT                   /locus_tag="Rpic12D_0173"
FT   CDS_pept        complement(181270..182151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0173"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: rso:RSc0311 pantothenate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61483"
FT                   /db_xref="GOA:C6BB71"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB71"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACS61483.1"
FT                   /translation="MTRLKVSAAHAAPARPLLLIDAGNTRIKWAWIAGGADAELALPEE
FT                   PGGTPWQHAGARAHDRLAELVEDWRDCHASGVAPPEVWISAVAGPALRDALTARIARVF
FT                   DGARVRIAASEDATAGLRNGYRDPTQLGTDRWVGAVGARHLWPDTALLLVTAGTATTLD
FT                   IVTPGGLFAGGLILPGLTLMMRALSRNTAQLPEVDVSYLSAGDVVAPPWADNTQDAIAL
FT                   GCVIAQAGAIAQTWMALQKQHPGPARCVLSGGARAALGPHLRMPFQMHDNLVLLGLQVL
FT                   ARASRDGAATLA"
FT   gene            complement(182148..183029)
FT                   /locus_tag="Rpic12D_0174"
FT   CDS_pept        complement(182148..183029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0174"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin/lipoate A/B protein ligase; biotin protein ligase
FT                   domain protein; KEGG: rso:RSc0312 biotin--protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61484"
FT                   /db_xref="GOA:C6BB72"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB72"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACS61484.1"
FT                   /translation="MSLAEPSARWRLARERIQPSGLAAGWPVDVVEATGSTNADLMAAV
FT                   RDAAWPANPAMPAPAGTAPLLGARVLAAQRQTAGRGRQGRPWDGDHGLTFSIACAFAGE
FT                   PAQLGGLSLAVGVAVAEAVAAYAQAHGGSGQALGLKWPNDVQIAGRKLAGILVETVRKE
FT                   AGQTWAVIGIGLNLERPRVLESTLGRGLSGVEELVDAPEPNAVFSALLTSLGEHLQHFG
FT                   AQGLAPFVAPFAARDAFAGERVRLWQDGTVVLEGVAHGIDAQGRLAIESGGRVQWVHSG
FT                   EVSLRSAEADQP"
FT   gene            183216..184340
FT                   /locus_tag="Rpic12D_0175"
FT   CDS_pept        183216..184340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0175"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   rso:RSc0313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61485"
FT                   /db_xref="GOA:C6BB73"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB73"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ACS61485.1"
FT                   /translation="MITCRTPQLEVRVVDGRSVAFLSGDWTTLALAERAGVRSARQQIR
FT                   AGLDNANAWCLTEVGRIDHFGAQLLWRAWGNQWPEHLDARPDQRRMLDRVAKLDPGGWK
FT                   QRLAPRMNPVAILGEGMLDFFDHASNGIAMVGQLVFDLGRFVRAPHRGPWREISANIYS
FT                   TGYKALGITALVGFLIGIVLSYLSANQLRVFGASIFIVNILGMAIIRELGPVLAAILVA
FT                   GRSGSAITAQIGVMRVTEELDAMRVMGISHGFRLILPKVIALAIAMPLLVAWTDLLALA
FT                   GGILAAKFQLDISPTYFITSLPDAVPVANLWLGIGKGVVFGMLIALVACHFGLRIQPNT
FT                   QSLGEGTTTSVVVSITIVILADAVFAILFKDVGI"
FT   gene            184337..185215
FT                   /locus_tag="Rpic12D_0176"
FT   CDS_pept        184337..185215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0176"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RSc0314 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61486"
FT                   /db_xref="GOA:C6BB74"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB74"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61486.1"
FT                   /translation="MTRPRHPHIKPAAEPPAITPARERVIEVRNVTKRYGKVTVLDNID
FT                   LDVFRGEVLSIVGGSGSGKTTLLRQVVGLEKPTSGTIHIFGEELTCQVGNELQSMRNRW
FT                   GMQFQHGALFSALSVIDNVALPMRELRTLPDAFIQRVAMLKLQMVGLRSTDADKMPSDL
FT                   SGGMIKRVALARALSLEPELVFLDEPTAGLDPRASDDYVALIRELRQELGLTVVMVTHD
FT                   LDTLVALSDRIAVLADRKVLAAKPLEQIIQIDHPFIKEYFLGERGKRALMALGPQMTEA
FT                   VAAASLSTQED"
FT   gene            185215..186183
FT                   /locus_tag="Rpic12D_0177"
FT   CDS_pept        185215..186183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0177"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: rso:RSc0315 signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61487"
FT                   /db_xref="GOA:C6BB75"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB75"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ACS61487.1"
FT                   /translation="MENKAHAFLAGLFTIGLAIFMGLAVMWFNRDQTVRVPYEVVTRST
FT                   VNGLNPQASVKYRGLDVGKVDSIRFDDKVPGQIVVRVLVDKDAPITTTTYGRLAYQGVT
FT                   GLAYVQLDDRGFDNSQHAPSPVRLATSQKDPARIRMDAGFLDELDKRGDQMLSKLDQTL
FT                   SSLSIMFDDEHRQQVTASLQAFQKTMDAYSTLAQQAEPTMRRLPQIADNLDSTLVATRK
FT                   LTQSLSDPKGPLMTTLSGAGTDLTAATQSMQSAANVLTYETLPQLNGFAREARQAVRGF
FT                   DHAVTDFNARPQSVLFGPAPGAPGPGETGFTAPAARASAQP"
FT   gene            186193..186858
FT                   /locus_tag="Rpic12D_0178"
FT   CDS_pept        186193..186858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0178"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   rso:RSc0316 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61488"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB76"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ACS61488.1"
FT                   /translation="MPMLSAVFRRASALPALMALSLLAACSSAPVAPAALYDFGLAPAA
FT                   SAGARLPTALRVADVAGPGWMDGNAIYYRLAYAQGQRTDAYANSRWVESPVSLFDARLR
FT                   NAAAGRGQVIGYPTPDVPSLRVELVDFSQVFDRPDASRGVVRLRATVSLARGVIDQRVV
FT                   QADAPAPSPDAAGGVAALTQASDKAIGEVLDWVAALPLAASAPSTPATPGAALGSRRR"
FT   sig_peptide     186193..186279
FT                   /locus_tag="Rpic12D_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.449 at
FT                   residue 29"
FT   gene            186897..188162
FT                   /locus_tag="Rpic12D_0179"
FT   CDS_pept        186897..188162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0179"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: rso:RSc0317
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61489"
FT                   /db_xref="GOA:C6BB77"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB77"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ACS61489.1"
FT                   /translation="MRGIGRYDGRLFPATSAPFSSSLLPVTDLHAQPAAPTQHRHSPLA
FT                   RAGLGWFVLLVVYASLYPFAGWTDTGVSPFAFLSAPLPRYNTAFDMLTNVWGYMPLGML
FT                   TVLALHPRITGWRAVLLAMLAGLLLSGAMEAIQTYLPTRVSSNVDLATNTLGALLGGLV
FT                   MLPFAARLIDRGGLRRLRRRWFEPHATFAILLMLVWPFAQIFPQEFLFSMGGVIRSILL
FT                   DPSPDAFVVNLLNGWFPELFDWQDKLTAHPEALQRQELLEALITACSWIGTGLLASVAM
FT                   RRGAPMLRLLAALLAGALLVKAGATVLQFPLGGAWDWLSSGARFGLIVGSLVLVLLVRL
FT                   PRWLRGALAMTLLIALIILSNVLPPSPYSWVSAQSWRLGRFVHFNSLSQWIGWLWPFLG
FT                   LGYLAWRAEQTQLQRRAGRHAR"
FT   gene            complement(188150..189394)
FT                   /locus_tag="Rpic12D_0180"
FT   CDS_pept        complement(188150..189394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0180"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   reu:Reut_B3681 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61490"
FT                   /db_xref="GOA:C6BB78"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB78"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS61490.1"
FT                   /translation="MSPATPVDAWRGAIRWLLVIQALSMGAMEMTGPFWPLFLRELLPV
FT                   PHVPFAWVASAAYFAPMAATLVTAPWWGRLADRVGPKPMILRALIALAASQLWSVYADS
FT                   AASVLLARTVQGGLAGFLAAAQIYAMRVAPADMRRRVFADLQTVTACGSFMAPPVGAWL
FT                   VGWMGFRMANTAGAAVILACIPLAMFCLPAIKPAPKSEIHQDADARRAGRAPLGGLVIG
FT                   LLLGMVAVQAARVMPQGFLAPYITETLHGSVMLAGLAYSATAATLALSARWWAKRFASL
FT                   PVHVTLGRVCALTAVCGLTALWQGIAQGENAFIAARLAWGLCLGGLLPVLNSLVVETSP
FT                   EHRQGFALGLCSSAAKGGALIGLGVAALSTGLFGWRAGFVAMAAMYLAALAALIAVRRA
FT                   ASPHPASAAAGTQRA"
FT   gene            complement(189391..191358)
FT                   /locus_tag="Rpic12D_0181"
FT   CDS_pept        complement(189391..191358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0181"
FT                   /product="IucA/IucC family protein"
FT                   /note="PFAM: IucA/IucC family protein; KEGG: bbt:BBta_0635
FT                   putative siderophore biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61491"
FT                   /db_xref="GOA:C6BB79"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB79"
FT                   /inference="protein motif:PFAM:PF04183"
FT                   /protein_id="ACS61491.1"
FT                   /translation="MQRRSDTAAHTATASAAVAAGNLRLESIPALREAGVRTEHWSTAQ
FT                   QLARRRVLSRLLQALFREALLSADQLIADTRADVTLLPIWQQRVLLRFTGLRPGALGSW
FT                   TLTGDVAVLAHGRPPTPIERPSALLHWLAPMLDMGDAAEAHRLAAIGRLAAELDNSQDN
FT                   DTLCQAYRLAWGARLAAEHRTAAWQDALALLCGDGTPLALARTEQWGTGGHPWHPAYKT
FT                   RLGLAPDQVIALSPEFEAQVPIGVVAVAAHRLQVTSMDGVQPYANWFAATFPETMAAFR
FT                   KALLARQLAPEAWLPLPVHPWQRDTTLGETFAAEFAAGELIRLPDINIAARPTMSFRTV
FT                   AATDAPGGPMLKLPVSMRLTSVERTVSPKSAVMGPRVSALLERILANDAALASVLSIVP
FT                   ERHGIHLACTDDDRARHLSMIVRDNPTARIAGNERLLPVGALFTPDFTADMTHAAAPLL
FT                   LDTVLARQADGTRAERAARFFDAYLHVAIPAIVGLYLRYGIALEAHQQNTFVVIDAAGM
FT                   PVRLVVRDFGDVKIALPTLRGQGFSITPFRAGHTTYPDRDIPRKKLIHAFLLCHIGELA
FT                   LALFPERGSAVGLRQWHDAMQAVFEANRSALDADTWKQERHALLEAPWSFKTFVRMRLR
FT                   EQSDDMHAALPNPLADAVRT"
FT   gene            191966..194068
FT                   /locus_tag="Rpic12D_0182"
FT   CDS_pept        191966..194068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0182"
FT                   /product="phospholipase C, phosphocholine-specific"
FT                   /EC_number="3.1.4.3"
FT                   /note="KEGG: rso:RSc0319 non-hemolytic phospholipase C
FT                   signal peptide protein; TIGRFAM: phospholipase C,
FT                   phosphocholine-specific; PFAM: phosphoesterase; protein of
FT                   unknown function DUF756"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61492"
FT                   /db_xref="GOA:C6BB80"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007312"
FT                   /db_xref="InterPro:IPR008475"
FT                   /db_xref="InterPro:IPR017767"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB80"
FT                   /inference="protein motif:TFAM:TIGR03396"
FT                   /protein_id="ACS61492.1"
FT                   /translation="MTSNSRRGFLRSAAQLAAASAAMGAVPEGIRQALAIPAHNAHRNI
FT                   EDVQHIVILMQENRSFDHYFGTLRGVRGYGDTRTVTLPSGKSVWHQPVAGGVGEVLPFR
FT                   PSAPDLGLQFLQDLPHGWNDTHLAVNGGRYDGWVPHKGTTTMAYLTRQDIPFHYALADA
FT                   FTICDAYHCATPTSTDPNRYYMWTGYVGNDNVGGGPVIDNAEAGYGWSTYPEVLEAAGI
FT                   SWKIYQDIGTGLDAAGSWGWTSDAYIGNYGDNSLLYFKQYQNAQPGNPLYDKARTGTKA
FT                   AAGEGYFDILKRDVQNGTLPQVSWIAAPEAFSEHPNWPANYGAWYIDQVLQVLTSNPEV
FT                   WSKTAVFITYDENDGFFDHLVPPFAASGSNGLSTVDTTGEYFPGNSTYSAGSYGLGQRV
FT                   PMLVVSPWSKGGYVCSETFDHTSIIRFIEQRFKRTHGVRSPNISKWRRAACGDLTSAFN
FT                   FATPNEMVPALPSTAAYVPKDKLRHASYVPLPPLVQAVPKQEAGVRASRALPYELFVRG
FT                   RQDEAAGKFQLEFVNTGDVGAAFLVYTAGSTDAPRTYTVEAGKRLSDKLAVNAGGAYDF
FT                   TVHGPNGFLRRFVGKLTLSGLLRPHGHALEVKEGYDVANGNLQLRLINHGRAPTVFTIK
FT                   SAYTGESVQREVRGGDDASVYLDLRSHHAWYDLTVTASTDAGFARRLAGHVETGRVSAS
FT                   DPALSA"
FT   sig_peptide     191966..192040
FT                   /locus_tag="Rpic12D_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.979 at
FT                   residue 25"
FT   gene            194451..194912
FT                   /locus_tag="Rpic12D_0183"
FT   CDS_pept        194451..194912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61493"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB81"
FT                   /inference="similar to AA sequence:KEGG:RSc0320"
FT                   /protein_id="ACS61493.1"
FT                   /translation="MNTRLATAFSRNALLVLVATVSASAALLSAQPAAAAVQGRADPYA
FT                   QGAVAKADPYTQGAAAKYDVYTQGADRQADTYGYLSWKNDRFDPYTQGAVGKADPYTDG
FT                   AIAKADPYTDGAAAKYDVYTQGADRQADTYGYLSWNGDASYPKDAASQA"
FT   sig_peptide     194451..194558
FT                   /locus_tag="Rpic12D_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.954 at
FT                   residue 36"
FT   gene            complement(194989..195990)
FT                   /locus_tag="Rpic12D_0184"
FT   CDS_pept        complement(194989..195990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0184"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: rso:RSc0322 lipoyl synthase; TIGRFAM: lipoic
FT                   acid synthetase; PFAM: Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61494"
FT                   /db_xref="GOA:C6BB82"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB82"
FT                   /inference="protein motif:TFAM:TIGR00510"
FT                   /protein_id="ACS61494.1"
FT                   /translation="MTDSAAGATEVATPATPSNKPYDATAKQKSLDKTARIPIKIVPAE
FT                   KLKKPDWIRVRAATGNSRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGD
FT                   KCTRRCPFCDVGHGRPDPLDVNEPENLAKTIAQLKLNYVVITSVDRDDLRDGGAQHYVD
FT                   CISRTRALSPATRIEVLVPDFRGRLEKALDILQECPPDVMNHNLETVPRLYKQARPGAD
FT                   YAHSLKLLKDFKARNPNVPTKSGLMVGLGETDEEILEVMRDMREHDIDMLTIGQYLAPS
FT                   GHHLPVLRYVHPDTFKMFEEKAYEMGFTHAAVGAMVRSSYHADQQAHEAGVV"
FT   gene            complement(196033..196722)
FT                   /locus_tag="Rpic12D_0185"
FT   CDS_pept        complement(196033..196722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0185"
FT                   /product="lipoate-protein ligase B"
FT                   /note="TIGRFAM: lipoate-protein ligase B; PFAM:
FT                   biotin/lipoate A/B protein ligase; KEGG: rso:RSc0323
FT                   lipoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61495"
FT                   /db_xref="GOA:C6BB83"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB83"
FT                   /inference="protein motif:TFAM:TIGR00214"
FT                   /protein_id="ACS61495.1"
FT                   /translation="MIPIDIVERGLQDYAACFDEMQTFTAQRGPDTPDTIWLVEHPPVF
FT                   TLGLAGDPAHLLAPGNIPLVKVDRGGQITYHGPGQVVAYLLLDLRRRGLFVKALVDAIE
FT                   AAVIETLATYNVASERKAGAPGIYLSSGPHAGAKIAALGLKIRNGCSYHGVSLNLAMDL
FT                   SPFTQINPCGYAGLETVDMVTAGARDASGRAVDANDWQTVSRDLANALVAQLQQRAQAH
FT                   PAEAATA"
FT   gene            complement(196883..197242)
FT                   /locus_tag="Rpic12D_0186"
FT   CDS_pept        complement(196883..197242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0186"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61496"
FT                   /db_xref="InterPro:IPR021317"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB84"
FT                   /inference="similar to AA sequence:KEGG:RSc0324"
FT                   /protein_id="ACS61496.1"
FT                   /translation="MKAVLTKIVFTLQPGEVVALRMPGNQNLRVEEASGRDVWVTHENK
FT                   AGDEWLRAGGSVAVKRGEEIVVSVDPKALGPVALAVEATDGHMPRKPWHVTDGWRHTLA
FT                   ALGWNEHADTPIVAA"
FT   gene            197393..198355
FT                   /locus_tag="Rpic12D_0187"
FT   CDS_pept        197393..198355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0187"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rso:RSc0325 DNA-binding transcriptional
FT                   activator GcvA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61497"
FT                   /db_xref="GOA:C6BB85"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB85"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS61497.1"
FT                   /translation="MTEIREPMRLPSLGALRVFEAAARYESFSRAATELFVTHGAVSHQ
FT                   MRTLEDELGVSLFERRGKRVMLTHAGRAYADRVREALDQIAQATHQLRAGNRDNRLAIS
FT                   TMPSFAARWLTPHIGTFIERHPELEVELFSSPALVDFAREEMDVALRMGSGNYPGLYVE
FT                   KLLDDVFFPVCSPSFNGGRLPRTVAEMATMTLLRSEGEDWEPWFEAAGVSGFVEPRGGL
FT                   MFQDSSLLLQAAAAGQGIALIRPTLAFNELLAGRVVRLFETTTPCPWNYYFVCPHSALQ
FT                   TPKMQAFRAWLLPEIAAFKLKLARLMDDNTVCLGHVAKG"
FT   gene            complement(198427..198726)
FT                   /locus_tag="Rpic12D_0188"
FT   CDS_pept        complement(198427..198726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0188"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   rso:RSc0326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61498"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB86"
FT                   /inference="protein motif:PFAM:PF04359"
FT                   /protein_id="ACS61498.1"
FT                   /translation="MTSSHTPPPGHIPPEQSLIEYPSDFPIKVMGPMHDDFAATIVEVV
FT                   RLHDPEFHEGRLEKRPSSSGNYLGLTVTVRATSREQLDALYQALTSHPMVKIVL"
FT   gene            complement(198747..199949)
FT                   /locus_tag="Rpic12D_0189"
FT   CDS_pept        complement(198747..199949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0189"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; beta-lactamase; Penicillin-binding
FT                   protein 5 domain protein; KEGG: rso:RSc0327
FT                   penicillin-binding transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61499"
FT                   /db_xref="GOA:C6BB87"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB87"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ACS61499.1"
FT                   /translation="MQNRFAHFTPIAFHSAAATAVAAAVLVTALPAMAQPVPAPQVAAR
FT                   SWMLTDVTSGQVLGGANMDERIEPASLTKLMTAYLVFEAVRDGKLKYDQMITPTETVRT
FT                   VKTDESRMFLEAGKPASVREMTQGLIIQSGNDAALVLAEAVGGTETNFVMLMNREAERL
FT                   GMKNTHFANAAGLPDPNHYSTARDLSILTAALIKDFPQDYKFYSQKEFTYNNIKQSNRN
FT                   RLLWLDPTVDGGKTGHTKSAGYCLVTSANRPLPDVPGANRRLLSVIIGTKSDAIRTQES
FT                   LKVLNYGYQFFDTVRLYQAKEALQTPDVYKGQAKSVKLGVAEDKWITVPKGAGARLKPV
FT                   LERKDPLIAPIAQGQQLGTVKVMDGSTVVSEFPVVALEAVPEAGFIGRTIDAVKLWFKK
FT                   K"
FT   sig_peptide     complement(199845..199949)
FT                   /locus_tag="Rpic12D_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            complement(200040..200687)
FT                   /locus_tag="Rpic12D_0190"
FT   CDS_pept        complement(200040..200687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61500"
FT                   /db_xref="GOA:C6BB88"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB88"
FT                   /inference="similar to AA sequence:KEGG:RSc0328"
FT                   /protein_id="ACS61500.1"
FT                   /translation="MNVHTEERLIPGPVGQIDLSIDQPDTALRGLALIGHPHPLFGGTK
FT                   DNKVAQTLARTFVGLGYATVRLNFRGVGKTEGTHDNGIGEQDDMLAVLDWMRTQTEWSA
FT                   DVATLPLALGGFSFGSFVVSQVARRLAEAGTPAERLALVGTATSRWDVAPVPADTIIIH
FT                   GEQDDTVPLIDVLNWARPQELPVIVIPGADHFFHRKLHLIRQLITGAWAPKP"
FT   gene            complement(200723..201052)
FT                   /locus_tag="Rpic12D_0191"
FT   CDS_pept        complement(200723..201052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0191"
FT                   /product="putative ferredoxin 2Fe-2S protein"
FT                   /note="KEGG: rso:RSc0329 putative ferredoxin 2Fe-2S
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61501"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB89"
FT                   /inference="similar to AA sequence:KEGG:RSc0329"
FT                   /protein_id="ACS61501.1"
FT                   /translation="MSSHYQHHVFFCLNEREDGSRCCADFGAKAMQEYAKKRCKELGIN
FT                   GEGRVRINKAGCLDRCELGPVMVVYPEAVWYTFVDKEDIDEIIQSHLVEGKPVERLMVD
FT                   RPANA"
FT   gene            201505..202794
FT                   /locus_tag="Rpic12D_0192"
FT   CDS_pept        201505..202794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0192"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   rso:RSc0330 C4-dicarboxylate transporter DctA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61502"
FT                   /db_xref="GOA:C6BB90"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB90"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACS61502.1"
FT                   /translation="MKKPFYKILYVQVLAAIVIGVLLGHYSPELAVKMKPLGDGFIQLI
FT                   KMVIGPIIFCTVVSGIAGMRDMKKVGRVGGKALIYFEVVSTFALIIGLAAGHIFNPGAG
FT                   FNVDVNTIDAKAVAQYAAKAHSASTVDFLLNIIPSTVVDAFAKGDILQILLIALLFGGA
FT                   LSAMGERAQMVTDFIDQISHVFFRIVHVITRVAPIGAFGAMAFTIGKYGVISLVPLLKL
FT                   VGTFYLTAIIFVVVVLGIIARLVGFNIFRFVGYIKEELLIVLGTSSSESALPHLMEKME
FT                   KLGCSKSVVGLVVPTGYSFNLDGTNIYMTMAVIFISQALNIELTWTQQLTILAVAMLTS
FT                   KGASGITGAGFITLAATLAVVPDIPVAGMVLILGIDRFMSECRALTNITGNGVACVVIS
FT                   AWERELDRAKLARVLSGDRSDEGVPATPAA"
FT   gene            202896..204908
FT                   /locus_tag="Rpic12D_0193"
FT   CDS_pept        202896..204908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0193"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: rso:RSc0331 C4-dicarboxylate transport
FT                   sensor kinase transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61503"
FT                   /db_xref="GOA:C6BB91"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB91"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS61503.1"
FT                   /translation="MHFVKHLGDMPTAGTALEGMASPSAAQLQPMSDPDFSLTSASGPR
FT                   RGFWWLVALGLVVVMAVVCATTFVVAWNRGLAQAQQAAGGRVDRYAANLKSTLDRYEYL
FT                   PALVALHPFIHDLLANPTSANVDRANRYLREVNDRAHATATYVIAPSGKALAASNYNQP
FT                   DSFVGAEYRFRPYFQQAAEGHVGRFYGIGITREEPGYYISQPVMQDGRVIGVTVVKLNL
FT                   EWFGRASHDASEPVMVADENGVIFLSSVPAWQYRTVEPLTSKLQAQLEATRQYYRKQIT
FT                   PLPLQPEAPAFLRLTGRLPEGAELIRVGERTNATRYLQVSRDLVEPDWTLMYLTPVEPV
FT                   MGAARSATVAAAFAFAFACLLLFYWRQRRLRMMEMLRSRRLLEAAYDQLERRVEDRTAD
FT                   LMATNEQLQHEIVDRTRAEAELRATQDELVQASKLAALGQMAAGITHELNQPLAALRTF
FT                   SDNTRILLERGQHGAATDNLQAIADLTERMGKITAQLKLFAGRSRRKVVDVQVRVALDH
FT                   TLALLRPRLGDVALELHWRIPETEAVVRADELKLEQVLINLIGNALDAISANEPARAGR
FT                   IDITIGPIEGAPSNQLTIAVRDNGPGIQPDAMPHLFEPFFTTKEIGQGLGLGLAISTSI
FT                   ARDFGGSLSAANVPGGGAQFTLTLVRADVTSAATT"
FT   gene            204934..206250
FT                   /locus_tag="Rpic12D_0194"
FT   CDS_pept        204934..206250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0194"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; ATPase associated with various cellular
FT                   activities AAA_5; SMART: response regulator receiver; AAA
FT                   ATPase; KEGG: rso:RSc0332 C4-dicarboxylate transport
FT                   response regulator transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61504"
FT                   /db_xref="GOA:C6BB92"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB92"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACS61504.1"
FT                   /translation="MSEGLNVLFIEDDPPVRQATAQSLELAGFNVQAFGSAEEAVGKID
FT                   ANFPGVVVSDLRLPGASGLDVLTHCQSFGTGIPVVLVTGHGDITMAVQAMREGAFDFIE
FT                   KPFPAERLTETVRRAVERRALELENRALRRELAGPAAGTRIIGRSPAMAAVRALIENVA
FT                   TTDAPVLINGETGTGKELVARSLHMLSPRHDKPFIALNCGAVPEQIFESEMFGHEAGAF
FT                   TGAGKRRIGKLEHASGGTLFLDEIESMPIALQVKLLRVLQEGALERLGSNASVRIDVRI
FT                   VAAAKGDMEALIEAGGFRRDLYYRLNVVVIDLPPLRERREDIIPLFEHFLLEAAVRYQR
FT                   PLPMLAERQRHELMQSNWPGNVRELRNAADRLVLGVGRTPVVSDASEDGMPLKERVERY
FT                   ERTVIAETLARTGGSVHQAADILQVGRATLYDKIKRYGL"
FT   gene            complement(206319..207056)
FT                   /locus_tag="Rpic12D_0195"
FT   CDS_pept        complement(206319..207056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0195"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bph:Bphy_5207 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61505"
FT                   /db_xref="InterPro:IPR019268"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB93"
FT                   /inference="similar to AA sequence:KEGG:Bphy_5207"
FT                   /protein_id="ACS61505.1"
FT                   /translation="MANHYCMFKGKLKFGVPYLEGYNGNPHYAIVVEAPDGSEFVVLAN
FT                   VKSDSSMPGAGAAGYHVLYQWTTDLELPITADLAALAPGLHESGFPRLDYVRDAGLVDF
FT                   PHMQPIALDTATQHNDINALVDDMLSLDRTTTPIDYVYHGSSGDDDRKGWPPRTDVTVY
FT                   GFGFLFEPQHNGLHETHMNQGNPVVHTPGVKDHSRENGTRQDGAVIVEIDGRFQALLIA
FT                   FQTQRIPTDDRGYPVADAHPILG"
FT   gene            complement(207194..207751)
FT                   /locus_tag="Rpic12D_0196"
FT   CDS_pept        complement(207194..207751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0196"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; KEGG:
FT                   rso:RSc0333 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61506"
FT                   /db_xref="GOA:C6BB94"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB94"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACS61506.1"
FT                   /translation="MASTLTPSAAPVSGATSGGRRWLLPVIVLVLAVAGWFGWRAFSPS
FT                   QQVPAATFTLLDGQKLSTQDLKGKVYLVNFWATSCTTCIKEMPNMVQTYNKYKGEGLEY
FT                   VAVAMSYDAPMYVMNFSQTRQLPFKVAMDADGSAAKAFGDVQLTPTTFLVDRDGRILKR
FT                   YVGEPEWSSFDALLKQTLGKQA"
FT   gene            complement(207854..208369)
FT                   /locus_tag="Rpic12D_0197"
FT   CDS_pept        complement(207854..208369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0197"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; SMART:
FT                   Appr-1-p processing domain protein; KEGG: rso:RSc0334
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61507"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB95"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ACS61507.1"
FT                   /translation="MPTPSVALRALRGDITTLDCDAIVNAANSSLLGGGGVDGAIHRAA
FT                   GPELLEACRALHGCRTGEAKLTPGFQLTARYVIHTVGPIWRGGRQDEAALLAACYRNSL
FT                   ELACKYEVRSIAFPCISTGIYGFPPQLAAPIAVRAAREHGSRFETITFCCFSAADLILY
FT                   EAALGNRK"
FT   gene            208489..209028
FT                   /locus_tag="Rpic12D_0198"
FT   CDS_pept        208489..209028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0198"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0335 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61508"
FT                   /db_xref="GOA:C6BB96"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB96"
FT                   /inference="similar to AA sequence:KEGG:RSc0335"
FT                   /protein_id="ACS61508.1"
FT                   /translation="MGFGALACALLMACSPKYDWRTVHSSEGAYAVDYPAKPTAEARPI
FT                   VINGQRVPMTMQAASVDGTLFAVGVVELPADDPVSRQRAVEALRSGLSANLKGRVTERD
FT                   IAVQTAAQPPLSLPAVELIAQGAGGDDPAPRRLTARVVAVGKHAYQAVVLESGDAARDA
FT                   RQQEQVDQFLSSFHPY"
FT   gene            209129..209770
FT                   /locus_tag="Rpic12D_0199"
FT   CDS_pept        209129..209770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0199"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   reu:Reut_A0287 lysine exporter protein LysE/YggA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61509"
FT                   /db_xref="GOA:C6BB97"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB97"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACS61509.1"
FT                   /translation="MTLQVWLAFFLAAWVIAISPGSGAILCMSHGLTHGVRRTSVTIAG
FT                   LELGIVVILFIAGAGLGALLIASEHAFMAIKIIGAMYLIYLGIVQWRTPIQIAKPAEGE
FT                   PVKVSGSGAGRRFLVGLLTNLTNPKGILFMVAVLPQFIDPAKPLLSQLGILAATMVFVD
FT                   LIVMHGYALLASRAQRLFRNPRALRWQSRFFGGMLMSIGAALFFVKRQTA"
FT   sig_peptide     209129..209200
FT                   /locus_tag="Rpic12D_0199"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.806) with cleavage site probability 0.263 at
FT                   residue 24"
FT   gene            complement(209831..210487)
FT                   /pseudo
FT                   /locus_tag="Rpic12D_0200"
FT   gene            210636..211307
FT                   /locus_tag="Rpic12D_0201"
FT   CDS_pept        210636..211307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0201"
FT                   /product="TnsA endonuclease"
FT                   /note="PFAM: TnsA endonuclease; KEGG: afe:Lferr_2137 TnsA
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61510"
FT                   /db_xref="GOA:C6BB98"
FT                   /db_xref="InterPro:IPR014832"
FT                   /db_xref="InterPro:IPR014833"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB98"
FT                   /inference="protein motif:PFAM:PF08722"
FT                   /protein_id="ACS61510.1"
FT                   /translation="MQQVRKIGPTRRSVSGVYAFRGERSIEFESTLERDFLMRVEFSQM
FT                   VVDVAPQPVELRYRADNGREYRYTPDFLVRYRAADCPFGVGPKPLLVEVKPREKLRKHW
FT                   CEMRPKFKAALRYAREQGWDFRIYDESRIRDQVLANIFFLQRYLRLQFPTEDVRAVLEN
FT                   LSAMGQAPFHYLVGRHFSGIADRAVGVSLLWHLLSTGLMECDMTLPLNNNTVLWTPHHE
FT                   R"
FT   gene            211342..213234
FT                   /locus_tag="Rpic12D_0202"
FT   CDS_pept        211342..213234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0202"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   pst:PSPTO_0058 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61511"
FT                   /db_xref="GOA:C6BB99"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C6BB99"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACS61511.1"
FT                   /translation="MERQKLDLTPDAFVARAGTIYRLVEVLDFDTVVGVDVGTGRTQAL
FT                   RIGELKPVSSADDALQVVAARDIEEIADDDWRIAETRYAAIKPLLDKSVGRAGVADRAA
FT                   QVGVDTATLYRWLKRYQSLGVVSALIPRQRGWRTGESRISAETEAVITEVLRNKYLTEQ
FT                   RSSPQKTIREVLRLCEERGIQPPHPTTVRNRIAALSERHTLHARGFKERAKNKFLPAAG
FT                   RFPNADYPLAVVQIDHTPADIILVDDIHRKPIGRPWITLAIDVHSRMVTGYYLAFDPPS
FT                   ETSVAMCVAHSVLPKDEWLALHGVDARWDVWGMMTTIHTDNGPDFRSDNFRHACLMHGI
FT                   NLEFRPVKQPRYGGHIERLLGTLLSEIHDLPGTTFSSVKVREGYDSDKHAALTKSEFET
FT                   WLVTLICKLYHQRLHKGIGMSPARKWEIGMFGNAEIVGRGLPPRPTDRLSLLLDFMPSY
FT                   RRTVQTYGVDIEGLRYYADVLRSWINATDPDTPSAKRKFVFRRDPRDISVVWFRDPDLG
FT                   QYFRIPFANQALPPMSAWEYEQAKARAKAEGVQSVDEPQILRALTEMRSQVDEAKEKTR
FT                   RARRQSQRRREHEKGISPAAPVAANAIPVTMMRPLDPAGVGLVDGDIDAFDDIA"
FT   gene            213242..214132
FT                   /locus_tag="Rpic12D_0203"
FT   CDS_pept        213242..214132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0203"
FT                   /product="TniB family protein"
FT                   /note="PFAM: TniB family protein; KEGG: msu:MS2015
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61512"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBA0"
FT                   /inference="protein motif:PFAM:PF05621"
FT                   /protein_id="ACS61512.1"
FT                   /translation="MTQYMHVHPDFLPIMALSGEERIAAMDQPRWIGYPRAIEILDLLQ
FT                   GLLTKPKRPRMPNLLIVGDSNNGKTTLIERFRELCGTSYVDGSGDPVRPVVIAEAPTSA
FT                   DERSLYVSVLERFWTPYKPTDSIPKLRYQLIHLMRACNVQMLVLDEMHSLLTGTTTKQR
FT                   EVMNALKLLCNELRIPIVGVGTREAVRVLHTDPQHASRFDVASLPAWSPDKEFQRLLAS
FT                   FERVLPLKHPSRLHAPELASRLHAISEGNIGNLHRLLVACATQAIRAGSEQIDVAIVEK
FT                   NQWIRPTRGIRELFA"
FT   gene            214129..215235
FT                   /locus_tag="Rpic12D_0204"
FT   CDS_pept        214129..215235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afe:Lferr_2128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61513"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBA1"
FT                   /inference="similar to AA sequence:KEGG:Lferr_2128"
FT                   /protein_id="ACS61513.1"
FT                   /translation="MRPIWTIPVDLQSDELLSSWLVRVALENGCDPLALTAALWPSRRA
FT                   WSSDIDRYLPEFCQQVLVAKGGIDSNVIRGAMLVDVARCICDNVLPMHGRWPWILAVRA
FT                   RNRRRLGGLQFCPDCLAADQRPFFRRRWRFAWCAVCLRHGRLLLDHCPHCHAAIEPHRL
FT                   TAELKSVAQCATCTALLTDAGQGAPAEPFAAQLQASTELALAGNGIEYANAHLSITEWF
FT                   AILDTWLGLARRAALAKEQGLMRLVAMLGFPPLPWTETRTWESFDAAERAALLTVVGKL
FT                   ISLDASQLVASFLDAGLSRQAAFPRGVPPIPVMRDIAGALPDRLRHRRCSTRMRCDKKL
FT                   PEPRSRREVARRMERLRRAVARVQAGAH"
FT   gene            215235..216665
FT                   /locus_tag="Rpic12D_0205"
FT   CDS_pept        215235..216665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afe:Lferr_2127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61514"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBA2"
FT                   /inference="similar to AA sequence:KEGG:Lferr_2127"
FT                   /protein_id="ACS61514.1"
FT                   /translation="MLSQCDECGRQVTKLTRTYRGRGYCATCYARAFKPRACPACGTTA
FT                   RLLAGVDDAVCRSCERGHPCARCGAAEYAIGRITPYGPVCNSCSTYFREARACGICGQL
FT                   TRRLSRVSRLGIELPVCPNCQESDYATCALCRRYRQLRLDRTGRSVCRSCEEGGLVPCP
FT                   QCREMMPAGRGSQCELCYWTDLLTKRVAMALELFSRPSMQELFRQFGDWLSRRVGAHKA
FT                   AITVNRYLPFFQELAQLGDVLLNADLLLEHFTTQGLRRNLLPMQFLEDVRGLVVDGGAK
FT                   EQASERRRIADLLQRLPKDGNAQQMLLGYQTALMEKVTSTGMSLRSVRLALLPATSVLL
FT                   LMLERRCAQPTQEVLAEYIEHAPGQRAALSGFVRYLREVHEVNVHLPKRKKPSERLARS
FT                   CIEAKLATMLANGAVDMAQQRTLLELALQYFHGLSEADALTVCKASSAPVNVSGDWALI
FT                   HEGRSYWVPPEVGSMWHH"
FT   gene            216728..217924
FT                   /locus_tag="Rpic12D_0206"
FT   CDS_pept        216728..217924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0206"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: dvu:DVU1746 C-5
FT                   cytosine-specific DNA methylase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61515"
FT                   /db_xref="GOA:C6BBA3"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBA3"
FT                   /inference="protein motif:TFAM:TIGR00675"
FT                   /protein_id="ACS61515.1"
FT                   /translation="MAMEKSSRGDLQYPQVTASDGAAAPLVRAPSKSASQRKLQCVDLF
FT                   AGAGGFSLAAHKAGMRVVAAVELDKKASETYHANLIKRRKKVSDRPRLYSENIMELSPE
FT                   RFKSENFPEGASCDIVLGGPPCQGFSVHRIKGAGVNDPRNGLIHRYFEYVKCLQPKAFL
FT                   MENVPGLLWPRHKKYLNKFLAESKKVGYRIIGPLRLDARNYGVPQRRVRVFVLGVRNDI
FT                   DFDSSVWPPAPSHGDAREREENPALKKWVSAAKVFSTPARPDDENDVHMQHGPELIKVF
FT                   RATPINGGSRRDSNRQLPCHVDHDGHNDVYGRIDPSEPGPTMTTACINPSKGRFVHPTE
FT                   HHGITVRQAARFQTFPDDFVFKGGLMAAGVQIGNAVPVDLGVVLLRAVSRGLGLSQDE"
FT   gene            complement(218003..220915)
FT                   /locus_tag="Rpic12D_0207"
FT   CDS_pept        complement(218003..220915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0207"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: paa:Paes_2313
FT                   UvrD/REP helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61516"
FT                   /db_xref="GOA:C6BBA4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBA4"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACS61516.1"
FT                   /translation="MPILTEINSLVESEGLTRPQASAVVDDASAILCIACAGSGKSQTL
FT                   AYRIARLMHQGVPPNTIVAITFTEKAADSIKRRIADVLVRTGQSPNLIGQMFIGTIHAF
FT                   CQNVLADADAIFRQYDVLDGNRFMLYLISRYYDLGISDLRPRFKDRYFETLENVRNAWN
FT                   IYRDEGLSIAEIDASDAQLGKTLRSIQDGLARDQFIDFASMVREVADRSQSAGRVRERL
FT                   ASIRHLLIDEYQDVSGAQEELVAAVHSLGGSIFVVGDDDQSIYGWRGAHVANILEFEDR
FT                   YPNVSRHVLDINFRSTRAIVETSNAFAAAQLGPQRLPKQPEAYADQGPRQLLVHHFPTR
FT                   AEEAEWVADRIATLIGAEYKKRPDDPGRGLTPADFAILMRSTKSPEQDGSPRHAAFSDA
FT                   LAMRGIDFTLSAGGSVFDRPAVQALREVFSALEQGTIDRNLADALVTEHIRPAYPHVNV
FT                   RETYNVLAEWGRRIHQPAGSARQRLFPQDLLFDLLEAFGLAKSDFDEDVMRDIGLFSRM
FT                   LQDVESVYLSVDSTNRFRAVVRFLQQVADKGYDVSTKDSVSRPNAVTISTVHQVKGLEF
FT                   PVVFVVDVVPGRFPGKQSSFDSLLPANLMASAIAHGAYTNNVFAEARLFYTAMTRAERF
FT                   LHVTGAALLPNGKRSNRQSTFAAALKDIELCTDPTRLPEDLNRAPQERDAEEATLPTSF
FT                   SDVKYYLNCPKNYQFRKSYGFSPRVPELFGYGTVVHVAIEKLHEMFRDRAPTPDEAQAV
FT                   AEQNFHLKHVAPSRDPETRPGAYEQAKEKARKIAGEYVQQYGTDFVQQRQVEVRFEIPA
FT                   RGCLITGAIDLLMKCDDVGEIVEAHVLDFKTMEGGKDPLANAKLDWRELSLQVQLYAKA
FT                   AREVYSENAATGSIHLLKDNRRIEIPIDPESVNAAIKNVEWAVQGILDQDFPMRPSTQK
FT                   CEACDFHRLCPKQKQDFHPGMGKPPKINTPAGPQLTSALE"
FT   gene            complement(221352..221747)
FT                   /locus_tag="Rpic12D_0208"
FT   CDS_pept        complement(221352..221747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0208"
FT                   /product="DNA mismatch endonuclease Vsr"
FT                   /note="TIGRFAM: DNA mismatch endonuclease Vsr; PFAM: DNA
FT                   mismatch endonuclease vsr; KEGG: gdj:Gdia_2656 DNA mismatch
FT                   endonuclease Vsr"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61517"
FT                   /db_xref="GOA:C6BBA5"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBA5"
FT                   /inference="protein motif:TFAM:TIGR00632"
FT                   /protein_id="ACS61517.1"
FT                   /translation="MRRVRSADTRPEMVVRSTLHRLGYRFRLHDKRLPGSPDIVFRSRK
FT                   IAIFVHGCFWHRHPGCSRATTPRTNTEFWQCKFNKNIARDTEVCTKLHALGWTTYVVWE
FT                   CELKSGSWIDPIVAALGPRALSNRATH"
FT   gene            complement(221844..222791)
FT                   /locus_tag="Rpic12D_0209"
FT   CDS_pept        complement(221844..222791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0209"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dac:Daci_4706 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61518"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBA6"
FT                   /inference="similar to AA sequence:KEGG:Daci_4706"
FT                   /protein_id="ACS61518.1"
FT                   /translation="MRYWWVNHKQTMRQEVNGCYLWSPQREARGVRSQFYDNMRIAGPG
FT                   DPVLSFSGGLIRHAGIVQDFASPAPKPDDFDSIGPHWGEEGWLLPVAWQTLVTPIRPKE
FT                   RISEFGALLPQKYSPIHPVSGNGNQKAYLAEINQQVFELLTGLSNFGGLPTPEGVQTES
FT                   VALTRVEDALQLQVGQDAALDSTTKQQIIMARHGQGLFRERVFGLERSCRLTNIENPRL
FT                   LVASHIKPWRVCSTAAERLDGANGLLLTPHVDRLFDRGLISFGEQGNVLISPRLDRRDL
FT                   ERLGLIDACARGCAPFAGRQAAYLAFHRDKVFLP"
FT   gene            complement(222960..224780)
FT                   /locus_tag="Rpic12D_0210"
FT   CDS_pept        complement(222960..224780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61519"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBA7"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A1802"
FT                   /protein_id="ACS61519.1"
FT                   /translation="MAFERQPITQRTYHDDFDNPDDRELVTWWHCGLVKSHKAGHQPKV
FT                   LVCFRRVEAGNRLGEFVYRRIPVTELGQFDIGTIWKGKAAREELRLKVATFQLDFNAGA
FT                   WRYRSVGELQTDTTDAPLPSEKYRLPDANLLAPSQVIQFPITDDHVGVLVPCLTFFSRC
FT                   YGRSPHVKRALTTYPLVQAEDELFAPLVEPAPPNAWPINLRRRVVNADTVYLAHLRYDS
FT                   YTKAQSRPIWGQLEAAAGNGSGPAFLRIGPWFEGPARVKAKGIWLIQDKRFLALQIIGC
FT                   SEPGGVPIYRDRQNTNKTGPLAEGAEPGLAWQGSAGKVLAPRPIIHVSSEEQPDGDAAS
FT                   IEIPDRDFELLGIPRIVVDVQREHSRSSASSERGGGPEPDRFSGDDPQGRGKGVGLGSF
FT                   KASTVMESNGVLRDIWNVLLKLKTTKPDLVLTVEFYTPSDGFSTAEEPRLIALEPFDDD
FT                   ERATLESRVKNWPLLDTKAGTPRGVLLARILTPKGHVHFFEIERRVRAQKSTTTESDED
FT                   GEKKGEVKQELKEESYKGMVFNLDDPSRLEAWLDFLLNRVRYACGVLDKLAGACPGRAH
FT                   TFIHAPAKSESWPCERSVMHALEKLGIIEN"
FT   gene            225020..226780
FT                   /locus_tag="Rpic12D_0211"
FT   CDS_pept        225020..226780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0211"
FT                   /product="ATPase"
FT                   /note="KEGG: btk:BT9727_0843 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61520"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBA8"
FT                   /inference="similar to AA sequence:KEGG:BT9727_0843"
FT                   /protein_id="ACS61520.1"
FT                   /translation="MGDNEVIAKLVAALTHFKPGAPLKNYIAYAVFPKFKNLEEGTRID
FT                   FNFPLTALVGPNGIGKSSVLHALWGMPYKYSTSKFWFETALDPIGHPQTYFYGHWSDSF
FT                   GGLVETRKARVGAKRDYWEPARPRLSDGMLPIPPGKYEGKALDRWHPVRREVRYINLKA
FT                   VFGSFDRYFYFDDDRSGGDRREAMLREALRLKSVKDRNLQSYKLGRGQERLFENRDLTK
FT                   NELESVSKILGRNYDSARIIRHSLYPGNRGRDLSVVFRRGSEYSEAFAGSGEIAAVSAV
FT                   VEILKAKDYSLILLDEPETSLHPGAQRALLRFLLEQIQEKNHQIVMSTHSDEFIKNLPH
FT                   DAIKVFEENGQFRSRILPRSSPDAALLRLGKLPENVRRVLVEDPVAAALVLHAAKSLDH
FT                   GDAAALEVRVAPGGAESILTYMGPSAMVSGDNIFFMLDGDKRKVDSFSDPDMIPPAKHN
FT                   DLEDLIKKEIGCKPRYQIPGGDDKHGHSNAKVTAQLNYLRWLRKRVSYLPRLVPEHVLL
FT                   AAMEPKGGHEDKTAKQAKVALKGLLTKGSKFEPSGDELRALIKIEIGKIPFDNADIVVI
FT                   RDQLQRWLHG"
FT   gene            complement(226908..227342)
FT                   /locus_tag="Rpic12D_0212"
FT   CDS_pept        complement(226908..227342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0212"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rme:Rmet_2844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61521"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBA9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61521.1"
FT                   /translation="MRTTLRQPLIFAGHSAAVKDALAHRYPDVMRMKSCLRAAGYEVAD
FT                   ADLAAAWISHSSSESTDWSAAPDEEGALLAILLQGETPLLISPGALHHWRTTVLDTDDG
FT                   SGDQIVPLPDELMSAMGWSIGDALEIGATAAGDVRLRKVT"
FT   gene            complement(227671..228567)
FT                   /pseudo
FT                   /locus_tag="Rpic12D_0213"
FT   gene            complement(228787..229299)
FT                   /locus_tag="Rpic12D_0214"
FT   CDS_pept        complement(228787..229299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0339 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61522"
FT                   /db_xref="GOA:C6BBB0"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBB0"
FT                   /inference="similar to AA sequence:KEGG:RSc0339"
FT                   /protein_id="ACS61522.1"
FT                   /translation="MQHRLYFLMPDVSSARRVMNDLLLARITERHIHFVSKPGIDLTGL
FT                   HEANILQTSDIVHATQNGLVIGGGAGVLAGIVAALFPVIGEGPQWGMVGITTVVGALFG
FT                   AWASSMIGSSVPNSRLKPFKQAVEDGQILLMVDVPRSRVSEIRALLQKTHPEGRFSGED
FT                   AAMPAFP"
FT   gene            complement(229467..229724)
FT                   /locus_tag="Rpic12D_0215"
FT   CDS_pept        complement(229467..229724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0215"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   rso:RSc0340 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61523"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBB1"
FT                   /inference="protein motif:PFAM:PF04380"
FT                   /protein_id="ACS61523.1"
FT                   /translation="MKPTDLFSDFQNRVSEALRNSPAADIEKNVRAMMTQGFAKLDLVT
FT                   REEFDVQSQVLARTRARLEELETRVAALEAQLKSATPANQ"
FT   gene            230258..231073
FT                   /locus_tag="Rpic12D_0216"
FT   CDS_pept        230258..231073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0216"
FT                   /product="signal peptide protein"
FT                   /note="KEGG: rso:RSc0341 signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61524"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBB2"
FT                   /inference="similar to AA sequence:KEGG:RSc0341"
FT                   /protein_id="ACS61524.1"
FT                   /translation="MKKFAYAASLVLLTGAVAGVSQSAIAQSAPAADAPAAAPAPAPAA
FT                   LTANVTLASQYRYRGIMQTNNKPAIQGGFDYAIPGGVLPEGFYIGNWNSSISWLSDSNS
FT                   NVSAPIEMDFYGGYKTEIIKDVPIDVGVLQYYYPGSYPDGFTRPHTTEGYAQIGYGPVT
FT                   FKYSHAFSNLFGTADSHHSQYFDLSGNFDTGFWGLTLNLHAGYQQVPHQTVRASYADWK
FT                   VGVTKDFGNGWAASLAYIDTNASRVFYTNPRGSYMGKATALLSITKTFQ"
FT   sig_peptide     230258..230338
FT                   /locus_tag="Rpic12D_0216"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.905 at
FT                   residue 27"
FT   gene            231120..231458
FT                   /locus_tag="Rpic12D_0217"
FT   CDS_pept        231120..231458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0217"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   rso:RSc0342 nitrogen regulatory P-II transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61525"
FT                   /db_xref="GOA:C6BBB3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBB3"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ACS61525.1"
FT                   /translation="MKLIMAIIKPFKLDEVREALSEVGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYIVDFLPKVKIEVAVPDDVVERAVEAIEKSARTGKIGDGKIFVADVEQVIRIRT
FT                   GETGGDAL"
FT   gene            231489..233063
FT                   /locus_tag="Rpic12D_0218"
FT   CDS_pept        231489..233063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0218"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: reu:Reut_A0292 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61526"
FT                   /db_xref="GOA:C6BBB4"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBB4"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ACS61526.1"
FT                   /translation="MKTWFTRFLTAGAVAAVLAGAVMSAPAIAQDKPAAEASAPAAAAA
FT                   ASEPAAAAPAAAAPASAPAAAAAPAAAAAAAAAAAAAPAAATPVPNKGDTAWLLVSTAF
FT                   VILMTLPGLALFYGGLVRKKNMLSVLMQCTGIFSLIIILWAIYGYSFAFTEGNAFFGGL
FT                   DRLFLKGLTPDSVAATFSKGVVVPEYAYFAFQGAFAAITCALIIGAFAERAKFSAVLLF
FT                   VVLWFTFSYLPIAHMVWFWPGPDGFTDAKAAEVMTAKSGWLFQKGALDFAGGTVVHINA
FT                   AVAGLVGAFLFGKRIGFGREALKPHSLTLTMVGASLLWFGWFGFNAGSALEANGSAALA
FT                   FVNTLLATAAAVLSWSFGEWFGKSKPSMLGAASGAVAGLVAITPAAGFVGPMGSIALGI
FT                   IAGLLCLWGVNGLKRMLGMDDTLDVFGVHGVGGILGALLTGVFAAPSLGGTGIYDYVAN
FT                   KVADDYSIGGQLWIQFQGVATTVIWSAVVAFISYKIVDAIVGLRVPEEEEREGLDITSH
FT                   GETAYED"
FT   sig_peptide     231489..231578
FT                   /locus_tag="Rpic12D_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 30"
FT   gene            233432..234727
FT                   /locus_tag="Rpic12D_0219"
FT   CDS_pept        233432..234727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0219"
FT                   /product="glutamate/cysteine ligase"
FT                   /note="TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GshA; KEGG: rso:RSc0344
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61527"
FT                   /db_xref="GOA:C6BBB5"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBB5"
FT                   /inference="protein motif:TFAM:TIGR02049"
FT                   /protein_id="ACS61527.1"
FT                   /translation="MVPHLITALNGPLLELEQKILDATPAIERWFRLEWQEHTPPFYCS
FT                   VDLRNAGFKLAPVDTNLFPGGFNNLAPEMLPLAVQAAMAAIEKICPDAKNLLLIPERHT
FT                   RNMFYLQNVARLSQIMRQAGLNVRLGSLSEDITEPTPIDLPDGQRLVVEPIKRIGTKGR
FT                   RLGMEDFDPCSILLNNDLSAGVPPILENINEQYLLPPLHAGWSQRRKTNHFAAYDEVAK
FT                   KFAKLIDIDPWMVNPYFTKCSGLDFHERAGEEELAHAVETVLKKTAKKYKEYGVTETPY
FT                   VVVKADAGTYGMGVMTVRDPSEVKGLNRKERNKMSVVKEGLEVSEVIVQEGVHTFEKIN
FT                   EAVAEPVVYMIDRYVVGGFYRVHTGRGVDENLNAPGMHFVPLPFASNSLPDSHAKPGAG
FT                   EPNRFYMYGVVARLALLAASLELEKTDPNPLI"
FT   gene            234760..235731
FT                   /locus_tag="Rpic12D_0220"
FT   CDS_pept        234760..235731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0220"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: rso:RSc0345 glutathione synthetase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase
FT                   ATP-binding; RimK domain protein ATP-grasp; glutathione
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61528"
FT                   /db_xref="GOA:C6BBB6"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBB6"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ACS61528.1"
FT                   /translation="MRILFIVDPLSTFKTYKDSTFAMMREAAARGYAIYTCLQSQLTLA
FT                   NNVVETVATPIALTGDEDDWYRAGDARLLPLTGFDAVLMRKDPPFDMEYVTSTWLLEIA
FT                   ERQGARVFNKPQAIRDHSEKLAIAQFREFTVPTIVSRDAKRLREFHAEQGDVIFKPLDG
FT                   MGGAGIFRVGPDGLNLGAVIESLTDNGARTIMAQQYIPAIREGDKRILLIGGSPVPHSL
FT                   ARVPMAGEVRGNLAAGGTGRAQPLSERDQVIAHALAPVLWQRGLLLVGLDVIGDYLTEV
FT                   NVTSPTCFQEITQQTGFNVAGMFIDALERAAGKTTGMGRKPA"
FT   gene            235850..236305
FT                   /locus_tag="Rpic12D_0221"
FT   CDS_pept        235850..236305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0221"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: rso:RSc0346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61529"
FT                   /db_xref="GOA:C6BBB7"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBB7"
FT                   /inference="protein motif:PFAM:PF03610"
FT                   /protein_id="ACS61529.1"
FT                   /translation="MAGILIIAHAPLASALRDCAAHVYCGQPERLDAIDVLPDAEPATV
FT                   LAQARDKLAELIEANGALVLTDIFGATPANIASRLADPGRVRVLAGVNLPMLVRAICYR
FT                   SEKLEQLAAKALAGGAQGVLQVGSTAVQNQVANHPDKYAAEGYHHHQ"
FT   gene            236274..236543
FT                   /locus_tag="Rpic12D_0222"
FT   CDS_pept        236274..236543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0222"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphoryl transfer system HPr; KEGG: rso:RSc0347
FT                   phosphohistidinoprotein-hexose phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61530"
FT                   /db_xref="GOA:C6BBB8"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBB8"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ACS61530.1"
FT                   /translation="MLQRDITIINKLGLHARASAKLTQLASKFDSQIKMSRNGRQVDAK
FT                   SIMGVMMLAAGIGSTVTLEIEGPDEHDAMDGLVALINDRFGEGE"
FT   gene            236588..238339
FT                   /locus_tag="Rpic12D_0223"
FT   CDS_pept        236588..238339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0223"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein domain protein; PEP-utilising protein
FT                   mobile region; KEGG: rso:RSc0348
FT                   phosphoenolpyruvate-protein phosphotransferase
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61531"
FT                   /db_xref="GOA:C6BBB9"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBB9"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ACS61531.1"
FT                   /translation="MPFTLHGIPVSRGICIGRAHMLARAALDVSHYLVDEDKLDAEVER
FT                   LRSARATVRAELAALKRDLPTDVPEEMGAFLDVHAMILDDALLSQVPETLIRQRRYNAE
FT                   WALTTQLEELIRQFGEIEDEYLRERKADIEQVVERILKVLAGAPALAPAPVAVGCDPDA
FT                   GMIVVAHDIAPADMLQFRGQTFAGFVTDLGGRTSHTAIVARSLDIPAAVGVHNASTLIR
FT                   QDDIVVIDGDNGIVIVDPSTSILEEYRHRRSEGELQKKRLERLRHTPTVTLDGTQIDLQ
FT                   ANIEMPEDAAAAVKAGAVGVGLFRSEFLFMNRRGALPDEEEQFRAYRTAVESMMGLPVT
FT                   IRTIDIGADKPLDIRDDVFETAPNPALGLRAIRWSLSEPAMFLTQLRALLRASAFGPIK
FT                   ILVPMLAHAREIDQTLELLARAKASLDADGLAYDPGIKVGAMIEIPAAVLILPVFLRRM
FT                   DFLSIGTNDLIQYTLAIDRADNAVAHLYDPLHPAVLQLIARTIREAHQAGKPVSVCGEM
FT                   AGDASMTRLLLGMGLTEFSMHPSQLLSVKQQILRSDRPRLMREADRLLHACEPAEIEEA
FT                   LGALARA"
FT   gene            238571..238846
FT                   /locus_tag="Rpic12D_0224"
FT   CDS_pept        238571..238846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0224"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: rso:RSc0349 putative
FT                   bacterioferritin-associated ferredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61532"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBC0"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="ACS61532.1"
FT                   /translation="MYVCICNQVTDREIHGAARLGVASMDELAETLGVGTCCGQCRDCA
FT                   KQVLAEAVSCIPVDQTLGRASTHAIIERRDEPVANDQAIVAGALAA"
FT   gene            238996..239475
FT                   /locus_tag="Rpic12D_0225"
FT   CDS_pept        238996..239475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0225"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Ferritin Dps family
FT                   protein; KEGG: rso:RSc0350 bacterioferritin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61533"
FT                   /db_xref="GOA:C6BBC1"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBC1"
FT                   /inference="protein motif:TFAM:TIGR00754"
FT                   /protein_id="ACS61533.1"
FT                   /translation="MKGDKKVIQYLNAQLKNELTAINQYFLHARMYGHWGLKRIGDHEY
FT                   KESIGEMKHADRLIERILMLDGLPNLQDLGKIFIGQDTKEIIECDLKLERAAHGTVVEG
FT                   IAYCESVKDYVSREILVDILDDTEEHIDWLETQLELIDKVGIQNYLQSQMEPEGE"
FT   gene            complement(239541..240290)
FT                   /locus_tag="Rpic12D_0226"
FT   CDS_pept        complement(239541..240290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0226"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: rso:RSc0351 molybdopterin
FT                   biosynthesis protein MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61534"
FT                   /db_xref="GOA:C6BBC2"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBC2"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ACS61534.1"
FT                   /translation="MNDDQLLRYSRHILLDEIGIEGQTRLLESHVLVIGAGGLGAAALP
FT                   YLAAAGVGTLTIVDDDTVDLTNLQRQIIHTTESVGQPKVASAQAAIARLNPDVRVNALQ
FT                   RRLDADAIGALLQGVSVVLDCSDNFDTRQAINLACVRAGLPLVSGAAIRFDGQISVFDS
FT                   RTGGPCYACLFPPDEPAPEVACATMGVFSPLVGMVGTVQATEALKLIVGIGHSLAGRLL
FT                   MLDGLTMEWTTMRIARQPSCPVCGGKH"
FT   gene            complement(240361..242013)
FT                   /locus_tag="Rpic12D_0227"
FT   CDS_pept        complement(240361..242013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0227"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number="3.4.21.102"
FT                   /note="KEGG: rso:RSc0352 putative carboxy-terminal
FT                   processing protease transmembrane protein; TIGRFAM:
FT                   carboxyl-terminal protease; PFAM: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein; SMART: peptidase S41;
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61535"
FT                   /db_xref="GOA:C6BBC3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBC3"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ACS61535.1"
FT                   /translation="MFIYCSHVHARHMRTSLKNISLIAIGLVTGVLATLQLSATAQNAT
FT                   VGPLPLEKLRLMADIFGQIKREYVEPVDDDKLLTEAIKGMVASLDPHSAYLDKKDFQEL
FT                   QEGTQGRFAGLGIEISQEEGLVKVINPIEDTPAFRAGVQPGDLITRIDDKPVRGMPLEQ
FT                   AVKRMRGAPGTKVTLTIYRKKEERTFPLTITRAEIQVQSVKAKMLDNGIAWVRITSFQE
FT                   RTVPDLAKKLNDLAKQDAHLKGLILDLRNNGGGVLQAAVGVSAAFLPPDVTVVSTNGQV
FT                   PDAKRTYKATFANYRLSNLDSDPLTGLDPEFKTVPIIVLTNAYTASASEIVAGALQDHH
FT                   RAKTMGKTTFGKGSVQTVRPLSNDTGIKLTIAYYYTPSGKSIQAKGIRPDIPVDQNPDG
FT                   DPDDALITREIDTERHLHNKQESEEAEMTEREKRRVEELRRLEEENAKKTPEQREKERN
FT                   KKPIEFGSAEDFMLQQAIADLKGQPVKRSKSVLEAAAAAVPDKAVKSPATKESSARAKL
FT                   PKGKAAPASEPTAPKPNVPASGVQPAPEPTGAR"
FT   sig_peptide     complement(241888..242013)
FT                   /locus_tag="Rpic12D_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.873 at
FT                   residue 42"
FT   gene            complement(242096..242851)
FT                   /locus_tag="Rpic12D_0228"
FT   CDS_pept        complement(242096..242851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0228"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /note="KEGG: rso:RSc0353 phosphoglyceromutase; TIGRFAM:
FT                   phosphoglycerate mutase 1 family; PFAM: Phosphoglycerate
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61536"
FT                   /db_xref="GOA:C6BBC4"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBC4"
FT                   /inference="protein motif:TFAM:TIGR01258"
FT                   /protein_id="ACS61536.1"
FT                   /translation="MAVMHKLVLIRHGESTWNLENRFTGWVDVDLTDTGVAQARQGGKL
FT                   LREAGFTFDLAYTSVLKRAIRTLWHVQDEMDLMWIPTRNEWRLNERHYGALSGLNKAET
FT                   AAQYGDEQVLVWRRSYDTPPPALEPGADNDAFGNPRYAGLTREQVPLTECLKDTVARVM
FT                   PLWEESIAPAIKSGKRVVIAAHGNSIRALVKYLDGISDADIVGLNIPNGTPLVYELDAN
FT                   LKPIRHYYLGDQEAIAASLAAVASQGKSK"
FT   gene            243020..243442
FT                   /locus_tag="Rpic12D_0229"
FT   CDS_pept        243020..243442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0229"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: rso:RSc0354 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61537"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBC5"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACS61537.1"
FT                   /translation="MKFFADYNNLALLAVAIVSGLLLLWAPIQRRIAGGGGAKVSAPVA
FT                   TQLINRRNAVVVDVRESGEYAAGHLPQAKHAPLGELEGKAPSLAKNKETPIILVCQTGQ
FT                   RAGRAQAVLKQAGYSEVYSLEGGLAAWQQAGLPVVK"
FT   gene            243461..243718
FT                   /locus_tag="Rpic12D_0230"
FT   CDS_pept        243461..243718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0230"
FT                   /product="glutaredoxin 3"
FT                   /note="TIGRFAM: glutaredoxin 3; PFAM: glutaredoxin; KEGG:
FT                   rso:RSc0355 glutaredoxin 3 (GRX3) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61538"
FT                   /db_xref="GOA:C6BBC6"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBC6"
FT                   /inference="protein motif:TFAM:TIGR02181"
FT                   /protein_id="ACS61538.1"
FT                   /translation="MAHVVMYSTTVCPYCVAAERLLKQRGVEQIEKILIDREPGKREEM
FT                   MTRTNRRTVPQIYIDERHIGGFDDLSALDREGGLVPLLAA"
FT   gene            243879..244397
FT                   /locus_tag="Rpic12D_0231"
FT   CDS_pept        243879..244397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0231"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: rso:RSc0356 preprotein
FT                   translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61539"
FT                   /db_xref="GOA:C6BBC7"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBC7"
FT                   /inference="protein motif:TFAM:TIGR00809"
FT                   /protein_id="ACS61539.1"
FT                   /translation="MSDQQQQQPGQDGQPFFNIQRVYLKDLSLEQPNSPHIFLEQEQPT
FT                   VEVQVDVGASQLAEGVFEVTVIGTVTTKVQEKVAFLVEAKQAGIFDIRNVPAEQMDPLL
FT                   GIACPTIVYPYLRSNIADTIGRAGFQPIHLAEINFQALYEQRLAAAMEQQGQAGGAGLV
FT                   MPDGSKATH"
FT   gene            244489..245520
FT                   /locus_tag="Rpic12D_0232"
FT   CDS_pept        244489..245520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0232"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; KEGG: rso:RSc0357
FT                   NAD(P)H-dependent glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61540"
FT                   /db_xref="GOA:C6BBC8"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBC8"
FT                   /inference="protein motif:PRIAM:1.1.1.94"
FT                   /protein_id="ACS61540.1"
FT                   /translation="MLNTRMRISVLGAGAWGTALASHAAQSHDVVLWGRDASLVSQMAA
FT                   THMNAPYLPGIALQASLHFSAELQGALDHAAGDDALAVIASPVAGLADLARTIAAHGGV
FT                   RNLIWLCKGFDPETSALPHAIVADVLKASGRTDLAVGVLSGPSFAKEVAQGLPCAMTVA
FT                   STSATLCKLTQRGFHHHAMRVYASDDLVGVEVGGAVKNVLAIATGAADGLGLGLNARAA
FT                   LVTRGLAEMTRLGLALGGRPETFMGLTGMGDLLLTATGDLSRNRTVGMQLAQGRSLDDI
FT                   LHSLGHVAEGVRCARAVAALARAKGVDMPITFTVCEVLFEGLPAAKAVERLLQRDAKSE
FT                   STR"
FT   sig_peptide     244489..244563
FT                   /locus_tag="Rpic12D_0232"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.618 at
FT                   residue 25"
FT   gene            complement(245550..246020)
FT                   /locus_tag="Rpic12D_0233"
FT   CDS_pept        complement(245550..246020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0233"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   rso:RSc0358 putative tRNA/rRNA methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61541"
FT                   /db_xref="GOA:C6BBC9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBC9"
FT                   /inference="protein motif:TFAM:TIGR00185"
FT                   /protein_id="ACS61541.1"
FT                   /translation="MFNVVLVEPEIPPNTGNVIRLCANTGAQLHLIEPLGFPLEDARMR
FT                   RAGLDYHEYATMRVHADWDAFLRDAQPDPARMFALTTRGSTPFASMAFQPGDWFVFGSE
FT                   TRGLSEERREWFPATQRIRLPMRPDNRSLNLSNTVAVVVFEAWRQNGFAGGA"
FT   gene            complement(246132..246854)
FT                   /locus_tag="Rpic12D_0234"
FT   CDS_pept        complement(246132..246854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0234"
FT                   /product="putative competence protein F-related protein"
FT                   /note="KEGG: rso:RSc0359 putative competence protein
FT                   F-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61542"
FT                   /db_xref="GOA:C6BBD0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBD0"
FT                   /inference="similar to AA sequence:KEGG:RSc0359"
FT                   /protein_id="ACS61542.1"
FT                   /translation="MHKHALSAWFRASLRHLLPCACALCGAVQGDLVCGGCAADLAPHL
FT                   YRRRCVQCAIALESPHVGQHCRACLAGAPDFDATVVIADYAWPLDHLVTGLKFRAQLPL
FT                   ADWLAAQLGNAIATASGDLPDVLLPVPLSPARLRSRGYNQAWEIARRLARRLDVPAHAG
FT                   ALHRVRDNVAQATLDRAERQANLHGAFVVDEPARIAGRHIGVVDDVMTTGTTLAEIATQ
FT                   LKRAGAVRITNVVALRTP"
FT   sig_peptide     complement(246762..246854)
FT                   /locus_tag="Rpic12D_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.601) with cleavage site probability 0.518 at
FT                   residue 31"
FT   gene            246963..247904
FT                   /locus_tag="Rpic12D_0235"
FT   CDS_pept        246963..247904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0235"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rso:RSc0360 putative biotin synthesis
FT                   protein (methyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61543"
FT                   /db_xref="GOA:C6BBD1"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBD1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACS61543.1"
FT                   /translation="MSDPVLARPAALRRAFDRRAARFADVDFLLREVGSRMQDRLSYIK
FT                   ATPARALDLGCGLGQGLAVLRAQYPDAQICGVDWSSAMLAQAQKLDPQRTDAGWLGRLL
FT                   KKRPVFDFAQADFRALPFAGASFDLLWSNLALHWDPAPHAIFPEWHRITTEGGLLMFSL
FT                   FGPDTLRELRSALAGIDAGIHTLRFVDMHDIGDMLVHSRWSTPVMDMEQITITYETPQA
FT                   LLADVHLLGGMAGLTDEAGRSVAGPGLHTPRWRQRLFDALDAQRNPDGVIPLTFEIVYG
FT                   HAWKLAPPQRQALDDQGRAMIPIDQIGRKPRA"
FT   gene            248097..248279
FT                   /locus_tag="Rpic12D_0236"
FT   CDS_pept        248097..248279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61544"
FT                   /db_xref="GOA:C6BBD2"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBD2"
FT                   /inference="similar to AA sequence:KEGG:RSc0361"
FT                   /protein_id="ACS61544.1"
FT                   /translation="MHDIETALHPACGVHISEAPRKNWLMKRNCSLSTRQLGWSIPLVV
FT                   ISPIVIAWFSAWQRA"
FT   gene            248525..249781
FT                   /locus_tag="Rpic12D_0237"
FT   CDS_pept        248525..249781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0237"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome C oxidase
FT                   subunit II transmembrane region; cytochrome c class I;
FT                   KEGG: rso:RSc0362 putative cytochrome c oxidase polypeptide
FT                   II precursor (cytochrome AA3 subunit 2) transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61545"
FT                   /db_xref="GOA:C6BBD3"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBD3"
FT                   /inference="protein motif:TFAM:TIGR02866"
FT                   /protein_id="ACS61545.1"
FT                   /translation="MKMLNKTLASLLAAGSLLALSQTALAVEDMPGGPAVRQLNLAPPV
FT                   TKIAAEIHWLHWMMLIICIVIFIGVFGVMFYSIFKHRKSVGHKPATFHESTTVEIIWTI
FT                   VPFLIVIGMALPATKAVVAMKDTTNSDLTIKATGYQWKWGYDYLKGEGEGISFLSTLTT
FT                   PRDQINNQAPKSNTYLIEVDNELVVPVNRKVRIVTTANDVIHSWMIPAFGVKQDAIPGF
FT                   VRDAWFKAEKVGIYRGQCAELCGKEHAFMPIVVRVLSQDDYTKWVDGKKKEMAAKADDP
FT                   NKTYTLEELKSRGEKVYTANCAVCHQPNGKGGGPFPALDGSKIANGPLADHVGIVLHGK
FT                   GAMPPWASALNDVEIAAVVTYERNNWGNHTGDLLQPTQVKDARGGKMPEGGAAKTAATE
FT                   SAGKVASKQANAAEDRNAG"
FT   sig_peptide     248525..248605
FT                   /locus_tag="Rpic12D_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 27"
FT   gene            249822..251426
FT                   /locus_tag="Rpic12D_0238"
FT   CDS_pept        249822..251426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0238"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number="1.9.3.1"
FT                   /note="KEGG: rso:RSc0363 cytochrome c oxidase polypeptide
FT                   I; TIGRFAM: cytochrome c oxidase, subunit I; PFAM:
FT                   cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61546"
FT                   /db_xref="GOA:C6BBD4"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBD4"
FT                   /inference="protein motif:TFAM:TIGR02891"
FT                   /protein_id="ACS61546.1"
FT                   /translation="MSTAVTHPQDHAHGHGDDHAHDHPHGWRRWLFATNHKDIGTLYLL
FT                   FSFMMLLSGGTLALLIRLELFQPGLQFFHPELFNQFTTLHGLIMVFGAIMPAFVGFANW
FT                   MIPLQVGASDMAFARMNNFSFWLLPPAALLLVGSFFAPGGATAAGWTLYAPLSVQMGPG
FT                   MDMAIFAIHIMGASSIMGAINIIVTILNMRAPGMTLMKMPMFCWTWLITAYLLIAVMPV
FT                   LAGAITMVLTDRHFGTSFFSAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGIISQIVPA
FT                   FARKPLFGYSSMVYATASIAILSFIVWAHHMFTTGMPVTGQLFFMYATMLIAVPTGVKI
FT                   FNWVATMWRGSMTFETPMLFAIGFIFVFTVGGFTGLILAVAPIDIQLQDTYYVVAHFHY
FT                   VLVAGSLFALFAGFYYWGPKWSGYMYSETRGKIHFWGSMITFNLTFFPMHFLGLAGMPR
FT                   RYADYPQQFADFNAVASIGALGFGLMQVYFFFFVVLPSYRGGEKAADKPWDGAEGLEWT
FT                   VPSPAPFHTFEEPPHVK"
FT   gene            251479..251610
FT                   /locus_tag="Rpic12D_0239"
FT   CDS_pept        251479..251610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61547"
FT                   /db_xref="GOA:C6BBD5"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBD5"
FT                   /inference="similar to AA sequence:KEGG:RSc0364"
FT                   /protein_id="ACS61547.1"
FT                   /translation="MSNPEKSPTPEQRAANRRLGFILGTIALVFFLGVIFKRVVFGG"
FT   gene            251660..252268
FT                   /locus_tag="Rpic12D_0240"
FT   CDS_pept        251660..252268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0240"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: rso:RSc0365 cytochrome c oxidase assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61548"
FT                   /db_xref="GOA:C6BBD6"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBD6"
FT                   /inference="protein motif:PFAM:PF04442"
FT                   /protein_id="ACS61548.1"
FT                   /translation="MSHTPAQPDPTQNDKALERGLNRSMLGKLAVVVVIMFGFGYAMVP
FT                   LYKKICEITNINVLNTRDEDGGALRNSQVDKTRTITVEFDSNSQGPFRFRPVKNSMDVH
FT                   PGEISQIVYEVVNKEGRTVEAQAIPSYAPKQATEFFKKIECFCFKQQTLTANESREMPV
FT                   VFVIDPDLPKDVKTITLSYTFFEIHAPSAIAPAMPNKGT"
FT   gene            252273..252485
FT                   /locus_tag="Rpic12D_0241"
FT   CDS_pept        252273..252485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61549"
FT                   /db_xref="GOA:C6BBD7"
FT                   /db_xref="InterPro:IPR021344"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBD7"
FT                   /inference="similar to AA sequence:KEGG:RSc0366"
FT                   /protein_id="ACS61549.1"
FT                   /translation="MDDLKEATKRRASFAQTMKAVFWSFFGVRKGRDHDRDMAQLNPVH
FT                   VIIAGVLAAVMFVVVLLLIVRAVVG"
FT   gene            252574..253434
FT                   /locus_tag="Rpic12D_0242"
FT   CDS_pept        252574..253434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0242"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   rso:RSc0367 cytochrome c oxidase subunit III transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61550"
FT                   /db_xref="GOA:C6BBD8"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBD8"
FT                   /inference="protein motif:PFAM:PF00510"
FT                   /protein_id="ACS61550.1"
FT                   /translation="MSANRANAPYYFVPGPSRHPITASLGLLIVLLSSAAWVNAQPWAP
FT                   WTFLVGLLWFLFVLRAWFADAISESETGKYGDRVDASFRWSMSWFIFSEVMFFAAFFGA
FT                   LFYARTIAMPWLGDLNNKLLWPDFNALWPNAGPAGTVAPFTTMGPWPIPTINTALLLTS
FT                   GVTLTWAHHALREGKRAQVIQGLLLTILLGFTFMGFQAFEYIHAYHELNLKLTSGIYGS
FT                   TFFLLTGFHGFHVTMGAIMLSVVLGRVIKGHFTPEHHFAFEGAAWYWHFVDVVWLGLYV
FT                   VVYWL"
FT   sig_peptide     252574..252690
FT                   /locus_tag="Rpic12D_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.748 at
FT                   residue 39"
FT   gene            complement(253561..253770)
FT                   /locus_tag="Rpic12D_0243"
FT   CDS_pept        complement(253561..253770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61551"
FT                   /db_xref="GOA:C6BBD9"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBD9"
FT                   /inference="similar to AA sequence:KEGG:RSc0368"
FT                   /protein_id="ACS61551.1"
FT                   /translation="MRIVVAIAFLLILGSLASALFFLMRDKGHSNRTVRSLMFRVGFSI
FT                   ALFIFIFVANRLGWIHSTGIRFGQ"
FT   sig_peptide     complement(253711..253770)
FT                   /locus_tag="Rpic12D_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.752 at
FT                   residue 20"
FT   gene            253840..254610
FT                   /locus_tag="Rpic12D_0244"
FT   CDS_pept        253840..254610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0244"
FT                   /product="putative transmembrane cytochrome oxidase complex
FT                   biogenesis factor transmembrane protein"
FT                   /note="KEGG: rso:RSc0369 putative transmembrane cytochrome
FT                   oxidase complex biogenesis factor transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61552"
FT                   /db_xref="GOA:C6BBE0"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBE0"
FT                   /inference="similar to AA sequence:KEGG:RSc0369"
FT                   /protein_id="ACS61552.1"
FT                   /translation="MTERVPMRRWFAPVPMLAGVALIALTCSLGRWQLSRAHERIERQA
FT                   RIMALENAPAQRITAQPVTADSVMYRPVLLRGTFDVAHTVLLENRPHVTNDVSRPGFEV
FT                   LIPLRLEGAGGRAVLVDRGWLPRDPVDRTRIAPYTTPAGEVQVEGMAVPHASRVFSLGS
FT                   KDGADEVGQRLRQNIDLDAFSREIGVPLQPFVVQQQSDVEDGLLRDWPRADLGAERNYG
FT                   YAFQWFAMAAAVLGLMVFYSVRRYRRLAGRSEPA"
FT   gene            254663..255319
FT                   /locus_tag="Rpic12D_0245"
FT   CDS_pept        254663..255319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0245"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61553"
FT                   /db_xref="GOA:C6BBE1"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBE1"
FT                   /inference="similar to AA sequence:KEGG:RSc0370"
FT                   /protein_id="ACS61553.1"
FT                   /translation="MVNQESAPGAPGTLGASEDPRIDARTRRGRLMMLFLLLVCASPVI
FT                   ASYLAYYVFTPAGGKAAYGALVDPQRPVPTGLMVQDEHGAEVPLASLKGKWLMVSVDGG
FT                   ACDDNCARKLFTMRQLRIGQGPDRDRIVPVWLVTDRGEIDPRLIKAYNDDYGAVRFLRA
FT                   PDLPKNWLADGKTPPTDHLFLVDPLGNLMMQFPKDPDPKKVRADMTRLLKYSRIG"
FT   gene            255323..256414
FT                   /locus_tag="Rpic12D_0246"
FT   CDS_pept        255323..256414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0246"
FT                   /product="cytochrome oxidase assembly"
FT                   /note="PFAM: cytochrome oxidase assembly; KEGG: rso:RSc0371
FT                   putative heme O oxygenase (cytochrome aa3-controlling)
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61554"
FT                   /db_xref="GOA:C6BBE2"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBE2"
FT                   /inference="protein motif:PFAM:PF02628"
FT                   /protein_id="ACS61554.1"
FT                   /translation="MLLQLASIGILIALIPLCYVLVKGDRNKYRKLVWITAFLTLDLIM
FT                   FGSFTRLTDSGLGCPDWPGCYGTSNPFHAREDIHAAQAAMPSGPVTWMKAWIEMTHRYF
FT                   ALALGVLIITLVVLAWVKRKELKQSPWYATAVLALVCVQGAFGAWTVTLKLQPAIVVTH
FT                   LLLGMSLLAALIWLGCKNDAPRAVDERGASLRMAAAIGLVLLVVQIALGGWVSTNYAVL
FT                   ACTDFPLCNGQWVPPMDFAHGFTFWRQLGKTASGDFISHDALVAIHWTHRVFAVVVLSY
FT                   LAWLSARARRIGGLGRVATVLLVVLAVQLATGLSNIVLGWPLLAAVAHNGGAAVLLLLM
FT                   VRLHYLIGLAQARAPMPVAAAVV"
FT   gene            256435..257376
FT                   /locus_tag="Rpic12D_0247"
FT   CDS_pept        256435..257376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0247"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: rso:RSc0372 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61555"
FT                   /db_xref="GOA:C6BBE3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBE3"
FT                   /inference="protein motif:TFAM:TIGR01473"
FT                   /protein_id="ACS61555.1"
FT                   /translation="MNTVATPTTSTQLPGWRTTASQYAALTKPRVTQLAVFCAVIGMFL
FT                   ATPGMVPWSVLIGGAVGIWLFAGAAFAINCLVERKIDAMMRRTAWRPSASGELGTRQIL
FT                   VFSVVLGGAGMWTLHVFANDLTMWLTFATFIGYAIIYTLLLKPATPQNIVIGGLSGAMP
FT                   PALGWAAVANSVPAEAWILVLIIFTWTPPHFWALALYRRADYAKSGLPMLPITHGEKYT
FT                   LLHILLYTLIMIAATILPFVYGMSGYIYLVTALVLGFGFLSYAWRMYRKYSDALAQKTF
FT                   RYSIIYLSILFAALLVDHYFKFGPALTQSAAL"
FT   gene            257440..258051
FT                   /locus_tag="Rpic12D_0248"
FT   CDS_pept        257440..258051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0248"
FT                   /product="electron transport protein SCO1/SenC"
FT                   /note="PFAM: electron transport protein SCO1/SenC; alkyl
FT                   hydroperoxide reductase/ Thiol specific antioxidant/ Mal
FT                   allergen; KEGG: rso:RSc0373 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61556"
FT                   /db_xref="GOA:C6BBE4"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBE4"
FT                   /inference="protein motif:PFAM:PF02630"
FT                   /protein_id="ACS61556.1"
FT                   /translation="MTMLSFRHFRAALFAMLAVAVLALAACSDKPAFKNLDITGSKSFG
FT                   TDFSLTDHTGKRRTLEDFRGKVVVMFFGYTHCPDVCPTTLAELRAVMDTLGKDADRVQV
FT                   LFVTVDPERDTQDLLAKYVPAFDPRFIGLRPANEAELKKVASDFKVFYSKVPGSSPDNY
FT                   TMDHSAGSYMFDPKGNLRLFIKHGQGPEPIAHDIKQLLAD"
FT   sig_peptide     257440..257517
FT                   /locus_tag="Rpic12D_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.473 at
FT                   residue 26"
FT   gene            complement(258118..259047)
FT                   /locus_tag="Rpic12D_0249"
FT   CDS_pept        complement(258118..259047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0249"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   KEGG: rso:RSc0374 RNA polymerase factor sigma-32"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61557"
FT                   /db_xref="GOA:C6BBE5"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBE5"
FT                   /inference="protein motif:TFAM:TIGR02392"
FT                   /protein_id="ACS61557.1"
FT                   /translation="MNAVIPVNTVSAIATQPSGNAGNGWALAFPGNLGNIDAYIQSVNR
FT                   VPMLSAEEEQRLAREYRDNDNLDAARRLVLSHLRLVVSIARGYLGYGLPHADLIQEGNI
FT                   GLMKAVKRFDPDQGVRLVSYAMHWIKAEMHEYILKNWRMVKVATTKAQRKLFFNLRSHK
FT                   QDAQATFTSDEIDAVAAELNVKGTEVREMETRLSGGDIALEGQMDDGEESYAPIAYLAD
FT                   THNEPTRVIEARSNDRMQSEGIEAALAKLDDRSRRIIEARWLNVNDDGSGGSTLHELAD
FT                   EFGVSAERIRQIESAAMKKMKGALQAFA"
FT   gene            complement(259246..262164)
FT                   /locus_tag="Rpic12D_0250"
FT   CDS_pept        complement(259246..262164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0250"
FT                   /product="diguanylate cyclase with PAS/PAC sensor"
FT                   /note="KEGG: rso:RSc0375 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: GGDEF domain
FT                   containing protein; PAS fold domain protein; PAS fold-4
FT                   domain protein; SMART: GGDEF domain containing protein; PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61558"
FT                   /db_xref="GOA:C6BBE6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBE6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS61558.1"
FT                   /translation="MVPRRPLVAIAGGIGFLLVLVGLTVMVGWLRHWPWAVKLGSDRLL
FT                   IVFATGVNLTLLGAGLAALLVGTVRPNVRWADPVARGLGGVVAVLSTLRLAEMLTGWPI
FT                   GLDFPGVHTWLDRQWVTGWIGGMHPSHALAMAASATALSLVPTLRKPHRARWFWGLVGL
FT                   AMLLCAGDLLGRAMALEYLYPAWLVWRASDVAAICTLLVVMGVLCVAVVRQPGVLRLRL
FT                   SPEDTIVWISGGCVVLAGLGATITAFIIQVDSVGLTFGTARARALSSYAEEFDQLLAMR
FT                   AENPRLVAAATHIQEVLRHPTDNAARLRSESALQAYRQQGYSYLQLRTLAGEGIVSLGT
FT                   QTLEPELSIRLHAGLAPERVTLQWVHGFAMRTETPVMADGMQIGLLVAEQPLAHMTARY
FT                   ANERGIGKTETLAMSGFDVRGRAMSFPQRFDAYVFELPALTVDRRPLPSRLALSGEAGY
FT                   GQWQDIHGMPTSFSYTPIGHTGLALISKIASAELYAPMRVQFERLGAFMLCLMIASVLV
FT                   IRLTVRPFANRLAASERALRTANESLERRRDALRASREQLRLVADNVPAQLSYVDSDGI
FT                   VRFASRTLLEAFGRREDEMLDHHVRDIYAPEDYRTLLPYMTEVLAGYPVQFEIQSMRTG
FT                   VPRYLSGHYFPDYDDRGTLRGYFSVLQDLTARTTAELALARSERALKLVLDNAPLLVSH
FT                   INPDGVFTFCNVTHARWLQRTPEEVCGQTPERVFTPSTYALIAPYLARAQRGESVQFEI
FT                   TAPWYERPSASGLRSRTRHLRGQLVPDAGEAQDGRCGFYAFVQDVTEAKRSEMELSRMA
FT                   RFDALTGLPNRYELYERLRAALERRQRLPAPLGVLYLDVDHFKHINDTYGHAAGDAVLV
FT                   EVAHRLQRAVRRSDTVARLAGDEFIILLDPIDAPDDALHTAQKIVGAIRPPITLRGDTI
FT                   LHVTTSVGVACPGPEVREPDTALREADRALYWAKSRGRNTAA"
FT   sig_peptide     complement(262081..262164)
FT                   /locus_tag="Rpic12D_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.647) with cleavage site probability 0.579 at
FT                   residue 28"
FT   gene            262406..262810
FT                   /locus_tag="Rpic12D_0251"
FT   CDS_pept        262406..262810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0251"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: rso:RSc0376
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61559"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBE7"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACS61559.1"
FT                   /translation="MSIVVSKDTEGLFRHKVTFPEGVTYTDVPKPTGEGSAPDPHAYFD
FT                   AALASCKALTVTLYARQRKYPLDSIDVAVEHDGTQERQGRYKLRTVLTLHGDLSDEQRA
FT                   DLLRVAGKCPIHKLMTEVEISVDTELAEHA"
FT   gene            262824..263693
FT                   /locus_tag="Rpic12D_0252"
FT   CDS_pept        262824..263693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0252"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: rso:RSc0377
FT                   putative pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61560"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBE8"
FT                   /inference="protein motif:PFAM:PF05726"
FT                   /protein_id="ACS61560.1"
FT                   /translation="MTSIQHIIGPHVRDLGGFSVKRVLPSAARQTVGPFIFFDHMGPVD
FT                   FAPGEGIDVRPHPHIGLATVTYLFDGSMVHRDSLGSVQTITPGDVNWMTAGNGIVHSER
FT                   SSPEGRERGARMHGIQTWVALPKDQEKVNASFAHHAADTLPKLECPGVQGVVIAGDAFG
FT                   LTSPVKVSSRTLYVALELAAGASLVIPPEHADRGLYLVEGAVTIDGEALDPHHLAVLEP
FT                   GGDVTLTAQVSSRVMLLGGDPTDGHRHIYWNFVASDKADIEDAKQRWESDAFAHVPGET
FT                   ERIPLPSK"
FT   gene            complement(263708..264718)
FT                   /locus_tag="Rpic12D_0253"
FT   CDS_pept        complement(263708..264718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0253"
FT                   /product="Glycosyl transferase, family 3-like protein"
FT                   /note="PFAM: Glycosyl transferase, family 3-like; KEGG:
FT                   rso:RSc0378 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61561"
FT                   /db_xref="GOA:C6BBE9"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBE9"
FT                   /inference="protein motif:PFAM:PF02885"
FT                   /protein_id="ACS61561.1"
FT                   /translation="MPAPPILPATATEDAFANGPFPAARFIKEIGRGADGARALVKHDA
FT                   RALFTAMLESRISDVQLGAILMAYRIKGETPEELDGMLEATHAHCRPLPAPNTPELALP
FT                   VVIPSYNGARRQPNLVPLLAKLLAREGVPVLVHGIRRFDGRVTTAALFEALGWPLCEHM
FT                   DDARERLERDRLAYVPIDVLSPQLTSLLDKREIVGLRNSAHTVVKMLQPIGGHAPHEAL
FT                   RLVSYTHPEYRDTLTDYFLRHPANVLLARGTEGEAVADARRGSAVEWLHDGSHETVIEA
FT                   VEGSSDAPPELPAGTDVAATARWIEAVLEGRQPVPEPIAKQVRAIVRCARPAQAA"
FT   gene            265431..268054
FT                   /pseudo
FT                   /locus_tag="Rpic12D_0254"
FT   gene            266161..267411
FT                   /locus_tag="Rpic12D_0255"
FT   CDS_pept        266161..267411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0255"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: rso:RSp0478
FT                   ISRSO7-transposase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61562"
FT                   /db_xref="GOA:C6BBF0"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBF0"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ACS61562.1"
FT                   /translation="MPRKPKAKPADLPAIPAELLEQFGSGPMTAEAINAATLALKKALI
FT                   ERALGGEMNHHLGYPPGASKPATVSNQRNGTGAKTVLTEGGPIRIEVPRDRDGSFAPLL
FT                   IPKHERRFKGFDDKIVAMYARGMTVREIQGFLLEQYATDVSPEFISSVTDEVMAEVTAW
FT                   QARPLDPMYPVVFFDALRVKIREDAVVRNKAVYLALGVLPDGTRDILGLWIENTEGAKF
FT                   WMKVFNDLKTRGVNDILIAVTDGLKGMPEALAAVFPATTLQTCIVHLIRNSLDYASWKD
FT                   RRALAAAIRPIYTAPSAEAAQAELEAFADGPWGQRYPTVSAAWRNAWDRVIPFFAFPPA
FT                   VRKVIYTTNAIENINAQLRKIIKTRGHFPSDEAATKLIWLALRNITAGWSRAAHDWKQA
FT                   MNQFAILYADRFVRPSV"
FT   gene            complement(268148..268951)
FT                   /locus_tag="Rpic12D_0256"
FT   CDS_pept        complement(268148..268951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0256"
FT                   /product="nitrate ABC transporter, ATPase subunits C and D"
FT                   /note="KEGG: rso:RSc0379 putative nitrate ATP-binding ABC
FT                   transporter protein; TIGRFAM: nitrate ABC transporter,
FT                   ATPase subunits C and D; PFAM: ABC transporter related;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61563"
FT                   /db_xref="GOA:C6BBF1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005890"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBF1"
FT                   /inference="protein motif:TFAM:TIGR01184"
FT                   /protein_id="ACS61563.1"
FT                   /translation="MTDKFLRIENVGQTFKTKRGPFVALRDIDLTVARGECIALIGHSG
FT                   CGKSTLLNLIAGLTRPTTGGLILAEREIAGPGPDRAVVFQNHSLLPWLTCFDNVYLAVE
FT                   RVFGTSETKAQLRDRTHAALALVGLSHAEQKHPHEISGGMKQRVGIARALSMEPKVLLM
FT                   DEPFGALDALTRAHLQDELLKVVAATGSTVVMVTHDVDEAVLLADRIVMMTNGPAATIG
FT                   EVLTVDLPRPRDRMALAEDPTYHACRTAVLDFLYRKQRHPVAEAA"
FT   gene            complement(268970..269821)
FT                   /locus_tag="Rpic12D_0257"
FT   CDS_pept        complement(268970..269821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0257"
FT                   /product="nitrate ABC transporter, inner membrane subunit"
FT                   /note="TIGRFAM: nitrate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rso:RSc0380 putative
FT                   nitrate transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61564"
FT                   /db_xref="GOA:C6BBF2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005889"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBF2"
FT                   /inference="protein motif:TFAM:TIGR01183"
FT                   /protein_id="ACS61564.1"
FT                   /translation="MNTLVKTLSGVQSDAAPEHRRFVARDWFVAAVVRGFPPVLGLVLF
FT                   VLAWQGIATAIPALPTPAVTWKAAVALFADPFYRNGPNDQGVGWNVLASLARVGAGFGM
FT                   AAVIGIPAGFLIGRFAFLNAMASPIISLLRPVSPLAWLPIGLLLFKSANPAAIWAIFIC
FT                   SIWPMVINTAVGVTRVPQDYLNVARVLNLSEWKVFTRVLFPAVLPYMLTGVRLSIGTAW
FT                   LVIVAAEMLTGGVGIGFWLWDEWNNLKVEHIVIAIFVIGVVGLLLEHALLAIARRFSYD
FT                   AV"
FT   gene            complement(269877..271157)
FT                   /locus_tag="Rpic12D_0258"
FT   CDS_pept        complement(269877..271157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0258"
FT                   /product="putative nitrate transporter protein"
FT                   /note="KEGG: rso:RSc0381 putative nitrate transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61565"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBF3"
FT                   /inference="similar to AA sequence:KEGG:RSc0381"
FT                   /protein_id="ACS61565.1"
FT                   /translation="MAAPDKTDALVNPINPKRRSIMKAAATIAGGSAVALIDPLVRAGA
FT                   WAAGSDAPEKTELKVGFIPLTDCASVVMASTLGLDKKYGIKITPSKEASWAGVRDKLVS
FT                   GDLDAAHVLYGLIYGVQLGIGGPKKDMAVLMTLNNNGQAITLSSKLKEAGVKDGASLKA
FT                   VMAKDKREYVFAQTFPTGTHAMWLYYWLAAHGIHPLQDAKAITVPPPQMVANMRVGNMD
FT                   GYCVGEPWGARAIADNIGFTAETTQAIWKDHPEKVLGTTAEFVQKYPNTARALTAAVLE
FT                   ASKFIDASASNRRKTAETIAAKSYVNTDMDIILDRMLGRYSNGLGKTWDDPDPMRFYHD
FT                   GAVNFPYLSDGMWFLTQHKRWGLLKAHPDYLAVAKQVNRIDIFKQAATATGTPLPKSDM
FT                   RTAKLIDGVVWDAKNPAAYADGFKLKA"
FT   gene            complement(271645..272283)
FT                   /locus_tag="Rpic12D_0259"
FT   CDS_pept        complement(271645..272283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0259"
FT                   /product="response regulator receiver and ANTAR domain
FT                   protein"
FT                   /note="PFAM: ANTAR domain protein; KEGG: rso:RSc0382
FT                   response regulator transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61566"
FT                   /db_xref="GOA:C6BBF4"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR008327"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBF4"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ACS61566.1"
FT                   /translation="MQAKPPTPSAPPAANHPAAPMRVLLVRDPLDAEQINLELIRAGLA
FT                   EAGFVDVGLADADLTLPERIAETQPDMVIVASESAARDTIEHVCVATQHAPRPIVLFTD
FT                   NDDATRIKTAFAAGITAYIVDGIKPTRVKAVLDVAYARFEHERELRAELDTAKTQLAER
FT                   KVLERAKGLLMKQMNLSEDDAFKRLRKMAMDRNIKLVEAAQRVIDVMAG"
FT   gene            272431..273132
FT                   /locus_tag="Rpic12D_0260"
FT   CDS_pept        272431..273132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0260"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rso:RSc0383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61567"
FT                   /db_xref="GOA:C6BBF5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBF5"
FT                   /inference="protein motif:PRIAM:4.1.1.68"
FT                   /protein_id="ACS61567.1"
FT                   /translation="MTDFVVTPPAVNGIPVRGGHGQFPVRRVYCVGRNYAAHAREMGSD
FT                   PDREPPFFFCKPADAVRYIPDGETGQFVYPTETRDCHYEIELVVAIGTGGRDIAVETAA
FT                   NHVYGYAIGLDMTRRDLQNAAKKGGRPWETGKAFDGSAPIGPIVPAKDVAHPDKGAITL
FT                   SVNGREHQRGDLSDLIWSVPETIAYLSRLFELRPGDLIYTGTPEGVGPVVVGDLMVGKI
FT                   DGVGELHVKVI"
FT   gene            273159..273803
FT                   /locus_tag="Rpic12D_0261"
FT   CDS_pept        273159..273803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0261"
FT                   /product="maleylacetoacetate isomerase"
FT                   /note="TIGRFAM: maleylacetoacetate isomerase; PFAM:
FT                   Glutathione S-transferase domain; KEGG: rso:RSc0384
FT                   maleylacetoacetate isomerase (glutathione transferase zeta
FT                   1) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61568"
FT                   /db_xref="GOA:C6BBF6"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBF6"
FT                   /inference="protein motif:TFAM:TIGR01262"
FT                   /protein_id="ACS61568.1"
FT                   /translation="MSIKLYNYFRSSASFRVRIALEVKGLPYDYAPVHLLKGEQLAPDF
FT                   VKLNPDALVPVLCDGNDVLNQSLAIVEYLEETHPEPTLLPGSASNRAHIRAIALAIACE
FT                   IHPLNNPRVLKYLKHTFNVEEEARNEWYRHWVKLGFAALETRLSQSPLTGAYCVGDTPT
FT                   LADVCLVPQVFNGKRFDVAVEDYPTLARIFEHCMAQEAFQRAAPAVQPDAA"
FT   gene            complement(273880..274410)
FT                   /locus_tag="Rpic12D_0262"
FT   CDS_pept        complement(273880..274410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sml:Smlt0450 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61569"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61569.1"
FT                   /translation="MALRPHPLLYLQAITALSFAMPPGTTYANCPHGLTGKPSYQAETS
FT                   LSVPSRSAENVFRRAVNEQAGLDFDEAKLFFDCLKDATKHDDKTALSRLVQYPLRIHAL
FT                   DRASTIATPVAFRKQYPLIFNQRVKDAIEAQRFEDVFVSYRGIMIGNGEVWISGITERG
FT                   RSKPTIKIISINN"
FT   gene            complement(275007..275333)
FT                   /locus_tag="Rpic12D_0263"
FT   CDS_pept        complement(275007..275333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0263"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61570"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61570.1"
FT                   /translation="MRISVPMLLLNALVATACSREHAAAVWTAKQSASAYASEEDTEDR
FT                   VLFTLVPGDTCTPLRSVVMKVYLHTEIQCKNGRGWVIDRQNFDIQPARIRSGAAQHSTS
FT                   SSPD"
FT   sig_peptide     complement(275262..275333)
FT                   /locus_tag="Rpic12D_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.777 at
FT                   residue 24"
FT   gene            complement(276117..276659)
FT                   /locus_tag="Rpic12D_0264"
FT   CDS_pept        complement(276117..276659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61571"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBF9"
FT                   /inference="similar to AA sequence:KEGG:H16_A0021"
FT                   /protein_id="ACS61571.1"
FT                   /translation="MIRSIAASILCLLSLQARASAPSDSIVDSCLLFDKPVRSTISILP
FT                   IDGAEVLQDDYEVPGYTVFRPGFKSNSLGVGYATSKHGNDDFVIVGRHRGYISRAIPRG
FT                   QYKPQRIEPPERALYAVIREDAQQYVCLVESNGNGSAAFVRSAFVARIPPDRNAGLTLY
FT                   FKVADIKKLKTFTEGSR"
FT   sig_peptide     complement(276600..276659)
FT                   /locus_tag="Rpic12D_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(276656..277279)
FT                   /locus_tag="Rpic12D_0265"
FT   CDS_pept        complement(276656..277279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0265"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A0022 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61572"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBG0"
FT                   /inference="similar to AA sequence:KEGG:H16_A0022"
FT                   /protein_id="ACS61572.1"
FT                   /translation="MSQSAISNLAPEERLLAAIAYGESSTQNKYEEMAALASVMVRQMK
FT                   ARGYQSIEAFTSKDPTFSFVRTDGNKRYALLMEATADEIGKSAPMTHAVRAARNAFSGG
FT                   FDYSNGAYFWDGADIKSNYSKHSKVWHGVRVDPAHNVYGIPDSRRTKILYKTVKKKVNG
FT                   KTASVQEEVGRYSWAYESTAGVGGTIFWRYSRDFVNVTRAKEYK"
FT   gene            complement(277276..277887)
FT                   /locus_tag="Rpic12D_0266"
FT   CDS_pept        complement(277276..277887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A0023 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61573"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBG1"
FT                   /inference="similar to AA sequence:KEGG:H16_A0023"
FT                   /protein_id="ACS61573.1"
FT                   /translation="MEYMRPGLRHGDLTTTGGVITATGRMRFHGKEVAAEGDLATCPAC
FT                   KSMGYLVNDAYPAFGLPSGRQLAIQGAWIFCKCANPPRAIASTDKFRVAVNRAGSIAQG
FT                   HAGVLPLSSVPSGAPDYVQQRESVHDRIHPDEEDIVEQYYELVDADTGQPVPGYRYDLL
FT                   TNGKRSSQDAALIDGRSVIVRGGLSIGIVLWLDKSREAQA"
FT   gene            complement(277899..278261)
FT                   /locus_tag="Rpic12D_0267"
FT   CDS_pept        complement(277899..278261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_B0505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61574"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBG2"
FT                   /inference="similar to AA sequence:KEGG:H16_B0505"
FT                   /protein_id="ACS61574.1"
FT                   /translation="MQNTQSGKVYVAAFNGAKTANGGEIIQGSCSIRDSGPTLLLVGDE
FT                   AVYPDGSTAVITAGAGIALVGDDRPAAIIGSPLSNGDTIVSSPITALTFDEPADAPIIG
FT                   LLDPAYRPEPATDSVI"
FT   gene            complement(278529..279725)
FT                   /locus_tag="Rpic12D_0268"
FT   CDS_pept        complement(278529..279725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0268"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: rso:RSc0386 putative cell division protein;
FT                   TIGRFAM: signal recognition particle-docking protein FtsY;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61575"
FT                   /db_xref="GOA:C6BBG3"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBG3"
FT                   /inference="protein motif:TFAM:TIGR00064"
FT                   /protein_id="ACS61575.1"
FT                   /translation="MFSFWKKRKAEPQPAAEPTPAAAPEAAQAPAPAAIPGAAPAPLPA
FT                   PVAAPQPVAAPAPAPAPVAAPAHVAVPDAPAAQPALDVQADDVETVPTPAVIEQARKGW
FT                   MSRLRSGLSKTSKGLTTLFVGVKVDEALFEELETALLMADAGVDATEYLLAELRRRIKA
FT                   QRIETSEGVKTALRDLLVELLHPLEKTMVLGREQPMVIMIAGVNGAGKTTSIGKLCKHF
FT                   QTYGQSVLLAAGDTFRAAAREQLVIWGQRNNVTVVAQESGDPAAVIFDAVNAARARGID
FT                   IVMADTAGRLPTQLHLMEELKKVRRVTAKAMATAPHETLLVIDGNTGQNALAQVKAFDE
FT                   ALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGVGEQVEDLQPFSAREFADALLG"
FT   gene            279798..281282
FT                   /locus_tag="Rpic12D_0269"
FT   CDS_pept        279798..281282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0269"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   rso:RSc0387 putative zinc protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61576"
FT                   /db_xref="GOA:C6BBG4"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBG4"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ACS61576.1"
FT                   /translation="MRIVSNRARSRVWQLAATALAAGLLACHVGAQELAAAAGHPTAAV
FT                   TGGKVGASQSDTHEYKLPNGLQLIVKEDHRAPTVAHMVWYHAGSIDEHNGTTGVAHMLE
FT                   HMMFKGTKTVGPGEFSRRVAALGGRENAMTTRDFTMYFQQIEKSHLADVMGLEADRMAN
FT                   LQLTDKEFKPEMNVVKEERRMRIDDSARSTVYEQMLATLFNAAPYRNPTIGWPGDLDTM
FT                   TVQDAQNWYHAWYTPNNVTVIVAGDVKPDEVFRLAQRTYGKLKPHALPRRYAQEEPKQI
FT                   GVKRIWVKAPAENPYVVLAYKVPRLSDVEKDVDPYALEVLSAVLDGYDNARLSSQLVKG
FT                   EKRIADDVNAGYDGLNRGPSIFLLDGSPADGHTTAEIEQALRAQIERIAKEGVTDAELK
FT                   RVKAQVVAAQIYKRDSVFGQGMEIGMNEMSGLSWRSIDRQLEKIKAVTSAQIQHVAQTY
FT                   FNEDNLVVATLLPQPIDPNKPARKPVPGMRDEGGLR"
FT   sig_peptide     279798..279893
FT                   /locus_tag="Rpic12D_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.814 at
FT                   residue 32"
FT   gene            281282..282634
FT                   /locus_tag="Rpic12D_0270"
FT   CDS_pept        281282..282634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0270"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   rso:RSc0388 putative zinc protease-like signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61577"
FT                   /db_xref="GOA:C6BBG5"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBG5"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ACS61577.1"
FT                   /translation="MRTMSLTLKTALVAIVAAAAQSALAALPIEHWTAPTGARVFFVPS
FT                   PSIPMLDINLDVDAGSRYEPANKVGLASLTAGMLDKGVAAQGNAPARDEAAIADAFADV
FT                   GASFGGGAGGDRTSLRLRTLSDPVERGPAIALMTQIISAPTFPDAVLARDKQRLVAAIR
FT                   ESLTKPSVLAERAFGKAIYGTHPYGQTASPETVESITRDDIVRYYQANYTAKRAVVTLI
FT                   GAISRQEAEAIAEQITRGLPADGATPPGLPDVKMPLAKAETIRIPHPAQQATIIIGQPG
FT                   IARGDKDYFPLLVGNYVLGGGGFSARLTNEVREKRGLTYSIGSYFAPAAQPGPFELALQ
FT                   TRKDQTEEALGVVRDTVAKFVADGPTDAELKAAKDNLVNGFPLRLDSNRKLLDNVANIG
FT                   WYNLPLDYLDTWTQRIAAVTRDQVRTAFQRVLQPQAMATIVVGGPEKAAAN"
FT   sig_peptide     281282..281359
FT                   /locus_tag="Rpic12D_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            282729..283385
FT                   /locus_tag="Rpic12D_0271"
FT   CDS_pept        282729..283385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0271"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; PFAM: Protein of unknown
FT                   function methylase putative; KEGG: rso:RSc0389 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61578"
FT                   /db_xref="GOA:C6BBG6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBG6"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ACS61578.1"
FT                   /translation="MAPRTSSSKGPKAKTATSHARAPQQVRIIGGQYKRTPLPVVDADG
FT                   LRPTSDRVRETVFNWLGQDLTGWRCADLFAGTGALGFEAASRGAAHVTLIENHAPAVRA
FT                   LHAIRDRLDARMVDIVSGDAFAWLARQPDAAFDAVFIDPPFAHDWTLRALEAATRVVKP
FT                   GGVIYVEAAQPLVDVSANSHDAEPMAGTELPTGLTLHKHLRAGAVHAHLLLRKNG"
FT   gene            283583..284086
FT                   /locus_tag="Rpic12D_0272"
FT   CDS_pept        283583..284086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0272"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: rso:RSc0390 phosphopantetheine
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61579"
FT                   /db_xref="GOA:C6BBG7"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBG7"
FT                   /inference="protein motif:TFAM:TIGR01510"
FT                   /protein_id="ACS61579.1"
FT                   /translation="MVIAVYPGTFDPFTRGHEDLVRRASNIFDELIVGVAQSPNKRPFF
FT                   ALEERIEIAREVLGHYPNVRVEGFSGLLKDFVRKNGARVIVRGLRAVSDFEYEFQMAGM
FT                   NRYLLPDVETMFLTPSDQYQFISGTFVREIAVLGGDVSKFVFPSVEKWLKEKTGKTEGS
FT                   GKSE"
FT   gene            284138..284401
FT                   /locus_tag="Rpic12D_0273"
FT   CDS_pept        284138..284401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0273"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: rso:RSc0391 ferredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61580"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBG8"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACS61580.1"
FT                   /translation="MALIITDECINCDVCEPECPNGAISMGPEIYVIDPGKCTECVGHF
FT                   DEPQCQQVCPVDCIPKDPAHEETHEQLMQKYTQLTSAPPRAA"
FT   gene            complement(284471..285109)
FT                   /locus_tag="Rpic12D_0274"
FT   CDS_pept        complement(284471..285109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0274"
FT                   /product="prolin-rich transmembrane protein"
FT                   /note="KEGG: rso:RSc0392 prolin-rich transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61581"
FT                   /db_xref="GOA:C6BBG9"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBG9"
FT                   /inference="similar to AA sequence:KEGG:RSc0392"
FT                   /protein_id="ACS61581.1"
FT                   /translation="MTPFATLTSRAAVLAGLALGLAAASLPTHAQVYRCSENGQTTYSD
FT                   HPCGTRAKPVPMIDNTPTAADQKAARERASAEAAEVQQMETARRKAQAAEDARQAQIAA
FT                   QAAEQARREQRQKVVVAQEGVRYCHRVYIGPLPYPQPYPTPMPVIRQPPAPAAGAMRQP
FT                   GNGPKPFVQAPVAPSPIVPRPLHPHYPHYRIVCEPGYAYEGPEDLLPIQ"
FT   sig_peptide     complement(285017..285109)
FT                   /locus_tag="Rpic12D_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 31"
FT   gene            complement(285134..285736)
FT                   /locus_tag="Rpic12D_0275"
FT   CDS_pept        complement(285134..285736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0275"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="KEGG: rso:RSc0393 peptidyl-tRNA hydrolase; TIGRFAM:
FT                   peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61582"
FT                   /db_xref="GOA:C6BBH0"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBH0"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ACS61582.1"
FT                   /translation="MIKLIVGLGNPGAEYAATRHNAGFWLVDQLARMGNVTLRNETRFH
FT                   GYAARANLWGNEVWLLQPQTFMNRSGLATVALARFYKVMPDEILVVHDELDLPPGAVKL
FT                   KLGGGSGGHNGLKDIAAHLTTQQFWRLRLGIGHPRNLLPPGTAASGQHDVANFVLKAPR
FT                   KEEQDLIDRAIDQSLDALPELIAGNAEKAMMRLHTAR"
FT   gene            complement(285907..286533)
FT                   /locus_tag="Rpic12D_0276"
FT   CDS_pept        complement(285907..286533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0276"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG: rso:RSc0394
FT                   50S ribosomal protein L25/general stress protein Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61583"
FT                   /db_xref="GOA:C6BBH1"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBH1"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ACS61583.1"
FT                   /translation="MKVVAFERSVQGTGASRRLRNSGKTPAIIYGAGAEPKLIELDHNA
FT                   LYHALKKEAFHSSILDIEVAGKVEKALLRDFQLHPFKQLVLHVDFQRVSAKEKIHVKVP
FT                   LHFLNQETAPGVKLGHGIVNHILNDVEVSCLPADLPEFIEVDLGTLEIGQTLHIADLKL
FT                   PKGVTILTHGGDENPAVANISVPAGEKSAAAEEGAAAAGEDKPAA"
FT   gene            complement(286686..287636)
FT                   /locus_tag="Rpic12D_0277"
FT   CDS_pept        complement(286686..287636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0277"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: rso:RSc0395 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61584"
FT                   /db_xref="GOA:C6BBH2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBH2"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACS61584.1"
FT                   /translation="MSSEGLMVFTGNANPKLAEAVVKHLGIPLGKALVGRFSDGEVQVE
FT                   IQENVRGKHVFILQSTCAPTNDNLMELMVMVDALKRASARRITAAIPYFGYARQDRRPR
FT                   SARVAITAKVVANMLEVAGVERVLTMDLHADQIQGFFDIPVDNIYASPILLEDLRKKNY
FT                   EDLLVVSPDVGGVVRARALAKQLGVDLAIIDKRRPKANVAEVMNIIGEVDGRNCVIMDD
FT                   MIDTGGTLCKAAQVLKERGAKQVFSYCTHPVLSGGAAARIADSALDEVVVTDTIPLRED
FT                   AIKCGKIRQLSTAPLLAETFTRIVRGDSIMSLFAE"
FT   gene            complement(287715..287791)
FT                   /locus_tag="Rpic12D_R0001"
FT                   /note="tRNA-Gln1"
FT   tRNA            complement(287715..287791)
FT                   /locus_tag="Rpic12D_R0001"
FT                   /product="tRNA-Gln"
FT   gene            complement(287842..288711)
FT                   /locus_tag="Rpic12D_0278"
FT   CDS_pept        complement(287842..288711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0278"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: rso:RSc0396
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61585"
FT                   /db_xref="GOA:C6BBH3"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBH3"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACS61585.1"
FT                   /translation="MSSAPVELRDCPAPAKLNLFLHVVGRRPDGYHLLQTVFQLIDWSD
FT                   TLHFARRPDGRLVRTTDIPGVHADDDLVIRAARLLQAETGCTYGVDIAIEKRLPMGGGL
FT                   GGGSSDAATTLLALNRLWGLDLPRTQLMAIGLKLGADVPFFVFGQNAFAEGIGEELTPV
FT                   TLPPAAFVVIHPRVHVPTPAIFSDEGLTRDTPLTIITDFPDQQIVFAYGRNDLQAVAER
FT                   KYGEIARALVWLRQFSPLARMTGSGACVFAPFDNVEQAQAVADQVPSEWEGRCAAGLSQ
FT                   HPLARFAV"
FT   gene            complement(288726..289349)
FT                   /locus_tag="Rpic12D_0279"
FT   CDS_pept        complement(288726..289349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0279"
FT                   /product="outer membrane lipoprotein LolB"
FT                   /note="TIGRFAM: outer membrane lipoprotein LolB; PFAM:
FT                   outer membrane lipoprotein LolB; KEGG: rso:RSc0397 outer
FT                   membrane lipoprotein LolB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61586"
FT                   /db_xref="GOA:C6BBH4"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBH4"
FT                   /inference="protein motif:TFAM:TIGR00548"
FT                   /protein_id="ACS61586.1"
FT                   /translation="MAMRFTHALGALMLGAGCALFSGCTSLRPANDLFAGTQDADTNIT
FT                   RYQGRFSARYTQNNAEQSAVGSFLWRERGPDVQLELMSPLGQTLAIVSQSNQGATLELP
FT                   NQPPRRAPEVDTLMQDALGFSLPVSGLRDWLRARPAPGTPARVARDAQSRPETIEQNGW
FT                   TVHYVAWTDDGNTTDGAKVSIRRLDLDRPQGANGPLSVRLVLDQ"
FT   sig_peptide     complement(289266..289349)
FT                   /locus_tag="Rpic12D_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.558 at
FT                   residue 28"
FT   gene            complement(289349..291286)
FT                   /locus_tag="Rpic12D_0280"
FT   CDS_pept        complement(289349..291286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0280"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   rso:RSc0398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61587"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBH5"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ACS61587.1"
FT                   /translation="MPHALSHSPATQRPRRFPRSRTALLAALVAGGLTSLPAWSSQSTA
FT                   VAPLIAQAAKEDGAGDRAAVQIERSRPRTGLLSSERTDLPRVALNEDIMYRVLASEVSL
FT                   QRGLVEPAYRTYLALAQDTRDPRFAQRATEIAFLTRSPAQAMTAARLWVELSPTSMPAR
FT                   QVQQLLLVATGQWSEVEPMLQAQLNKVSPGQRADALLQLQQQMSKSSDPAGAVGALQRI
FT                   ASHDMQRPETHLALARAKVAAKDTAGALTELDTALKLRPGYEDAAILAAELRADSDPDA
FT                   AITGLRSFLKAAPASIDGHLALARMYLVRNQQDKARAEFETLKKIAPNDARITLALGLL
FT                   NLQQRQYDDAERYLKEYVTATAKSPTLSPEPGYQGLAQLAEEKRDYAGALGWVDKITGS
FT                   ANGDADGQTALAAGIKRGQLLGKLRRIDEAQQTFDELVADSEDVPDGPRRQALMDGIRQ
FT                   AEIGMLMDAKAYGRARARVNELLKSDPDNVEYTYQLAMLEEHDGHYDNMETLLRKVIDL
FT                   RPGQAIGYNALGYSLADRSVRLQEAQELLEKAVSLAPDDPYIADSLGWVKYRRGDLPGA
FT                   TDILRKAWAAAPQAEIGAHLGEVLWQSGKQDDARQVWTEASKLDVNDTTLRDTLRRFGQ
FT                   PVPNVPVSAN"
FT   sig_peptide     complement(291164..291286)
FT                   /locus_tag="Rpic12D_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 41"
FT   gene            291388..292263
FT                   /locus_tag="Rpic12D_0281"
FT   CDS_pept        291388..292263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0281"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: rso:RSc0399 formamidopyrimidine-DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; DNA glycosylase/AP lyase, H2TH DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61588"
FT                   /db_xref="GOA:C6BBH6"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBH6"
FT                   /inference="protein motif:TFAM:TIGR00577"
FT                   /protein_id="ACS61588.1"
FT                   /translation="MPELPEVEVTRLGLIPHITERRIVRVVVRHHGLRWPVDPALPELL
FT                   AGLTVTRLLRRGKYLLIECMPEAEQSGGCAETAGGWLLIHLGMTGTLRVLETAVPPGLH
FT                   DHVDIELAGATGVPVTLRYRDPRRFGAVLWHAGDEAGLAEHPLLRNLGIEPFDARFDGD
FT                   WMFARTRGRRVAIKSALLAGDIVVGVGNIYCSESLFRAGIRPTTAAGRIGRPRYAALAE
FT                   AIRATLADAIARGGSTLRDFVGSDGQSGYFQLDAFVYDRAGLPCRVCGTPVRQIVQGQR
FT                   STFYCPTCQR"
FT   gene            292549..294495
FT                   /locus_tag="Rpic12D_0282"
FT   CDS_pept        292549..294495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61589"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBH7"
FT                   /inference="similar to AA sequence:KEGG:RSc0400"
FT                   /protein_id="ACS61589.1"
FT                   /translation="MMNNTLSTQFEQYSAWRASVLQSVGEFQDWLQAQELYDAQADMRA
FT                   QRIRGVLRSDKLKVAFIAEFSRGKSELINAIFFADFGRRILPSSAGRTTMCPTELMYDE
FT                   SYPPSIRLLPIETRLHDASTADFRDAGSHWLSVPLDPSSPEGMLEAFRHVVETVRVPKE
FT                   EAEQLGLYNDADPDAAFSVDAAGTVEVSKWRHAIINFPHPMLKQGLVILDTPGLNAIGT
FT                   EPELTLRLIPDAHVVVFVLAADAGVTKSDLELWRSHVGGGQRKGCIAVLNKVDGLWDPL
FT                   KSAEEVENEVSRQIMTTAQVLDIDVERVYPVSAQKGLVAKVSHDHELLAKSRLLELESV
FT                   LSDQLIPQRREIVTEQVQLAVKDMATGAQQLLQMRRRDIVEQLFELRGLRGKNHTMVKH
FT                   MLMRVQGEKEEFEQSIAKFQALRTVFGRHSAEIIKSVQLKQIRSTMREAREKMKERVFS
FT                   RGLRDDMDKLFGHLTGLVRDAANRIDQLHQMVDGMYKKFNAEHGFTLSPPLRFLGTRYD
FT                   ADLKETLMLAHNHFGAFSFLTRPKPQLVHGAFSTVASRVLDTFQDMNRDIEIWLKSVMT
FT                   PLEAQVRDHQKQLRKRVDSIERIHEATDTLEARITELEALLNTLDERSGTIAQYTDRIL
FT                   AAGTILERQSFAA"
FT   gene            294599..295747
FT                   /locus_tag="Rpic12D_0283"
FT   CDS_pept        294599..295747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0283"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="KEGG: rso:RSc0401 A/G-specific adenine glycosylase
FT                   protein; TIGRFAM: A/G-specific adenine glycosylase; PFAM:
FT                   HhH-GPD family protein; helix-hairpin-helix motif; NUDIX
FT                   hydrolase; SMART: HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61590"
FT                   /db_xref="GOA:C6BBH8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBH8"
FT                   /inference="protein motif:TFAM:TIGR01084"
FT                   /protein_id="ACS61590.1"
FT                   /translation="MTATPRRTRRAAQPAAALPSLPDDFAVRVVAWQQRHGRHHLPWQN
FT                   TGDAYRTWLSEIMLQQTQVSAVLGYYARFIERFPTVQALAAAPADDVMATWAGLGYYTR
FT                   ARNLHRCAQIVVAEHGGIFPRDPDVLATLPGIGRSTAAAIAAFSYGVRAAILDGNVKRV
FT                   FARVFGIDGFPGDKRVEDTMWRIAEAVLPPAEGIQPYTQGLMDLGATVCTRGKPACLSG
FT                   ERPCPLESLCEARRTDRVMELPVPRPRKAIPERAATLVIALNADAVLLQRRPQRGIWGG
FT                   LWSLPLVGEMDDALDAHPLDVGTVRRAAQAYGDVSTVETAGALTHAFTHFRLHMHLLRA
FT                   TIAAPAALDDDWRWVPLAQLNSVGLPAPVKLALETLVQPSLI"
FT   gene            complement(295778..296431)
FT                   /locus_tag="Rpic12D_0284"
FT   CDS_pept        complement(295778..296431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0284"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein; SMART:
FT                   peptidase S16 lon domain protein; KEGG: rso:RSc0402
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61591"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBH9"
FT                   /inference="protein motif:PFAM:PF02190"
FT                   /protein_id="ACS61591.1"
FT                   /translation="MQEDIALSPFSPLPPLPTELPLFPLHTVLFPGGLLPLRIFEARYM
FT                   DMVRTCLRDKTPFGVCLIERGNEVGTTDNPTVPVDVGCIAHITECDMEQLGLLMIKVRG
FT                   TQRFKVLSFETTPNGLMRGTVEPIGADVEDCKGELFDDCVGALRRIITTLGSREDGNIP
FT                   MVEPYEWNSPSWVANRLCELLPVPLKAKQKLMELMDAGMRIEIVHRYMKQHHIL"
FT   gene            complement(296534..297427)
FT                   /locus_tag="Rpic12D_0285"
FT   CDS_pept        complement(296534..297427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rso:RSc0403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61592"
FT                   /db_xref="GOA:C6BBV8"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBV8"
FT                   /inference="protein motif:PFAM:PF03668"
FT                   /protein_id="ACS61592.1"
FT                   /translation="MRIILITGMSGSGKSVALNVLEDAGYYCVDNLPAQFIPELARYLA
FT                   DQGYTHLGVATDIRSRESLRKVPETVTVLRKEHDVRMLFLTASTNALVQRYSETRRRHP
FT                   LSIRNGRPDAAANVQAAAKGLDTSLIEAIEMERELLSPLADPAHRIDTSTLRTNALRAY
FT                   IKEFISDEPHDITLMFESFGFKHGVPTDADLVFDVRSLPNPYYDTQLRPLTGRDQPVID
FT                   FLQSQPMVLAMAEDIRAYVEKWLPSFIADNRSYLTVAIGCTGGQHRSVYIAERLATYFR
FT                   AHGNVLVRHRELAVDG"
FT   gene            complement(297522..297851)
FT                   /locus_tag="Rpic12D_0286"
FT   CDS_pept        complement(297522..297851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0286"
FT                   /product="PsiF repeat protein"
FT                   /note="PFAM: PsiF repeat protein; KEGG: rso:RSc0404
FT                   putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61593"
FT                   /db_xref="InterPro:IPR011690"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBV9"
FT                   /inference="protein motif:PFAM:PF07769"
FT                   /protein_id="ACS61593.1"
FT                   /translation="MKQLIAACALALPFLAGQAFAQGSAPAAAPTAPAARNSQQDKMKQ
FT                   CNMDAAGKKGDERKAFMKGCLSDKPAAAAKPMTQQEKMAACSKANKGKKGDEYKNAQKE
FT                   CLSKG"
FT   sig_peptide     complement(297786..297851)
FT                   /locus_tag="Rpic12D_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            complement(298034..299008)
FT                   /locus_tag="Rpic12D_0287"
FT   CDS_pept        complement(298034..299008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0287"
FT                   /product="HPr kinase"
FT                   /note="PFAM: HPr serine kinase domain protein; KEGG:
FT                   rso:RSc0405 HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61594"
FT                   /db_xref="GOA:C6BBW0"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBW0"
FT                   /inference="protein motif:PFAM:PF07475"
FT                   /protein_id="ACS61594.1"
FT                   /translation="MELTGVIAQSIFDDNAADLKLSWVAGLEGADRAFDVDFAKEATSA
FT                   ADLVGHLNLIHPNRIQVLGKPEITYYQRLSEENRKRQMGELILLEPPFLVVADGVDPPP
FT                   DLELRCTRSSTPLFTSPISSAAVIDHLRLYLSRISAPRVTMHGVFLDILGMGVLIMGDS
FT                   GLGKSELGLELISRGHGLVADDAVDFVRLGPDFIEGRCPPLLQNLLEVRGLGLLDIKTI
FT                   FGETAVRRKMKIKLIVQLVRRNDGEFERLPLDSQYLDVLGLPIHMVKIQVAAGRNLAVL
FT                   VEAAVRNTILRLRGIDTLRDFMDRQRAAMQAEAASHSPQGRLL"
FT   gene            complement(299082..299537)
FT                   /locus_tag="Rpic12D_0288"
FT   CDS_pept        complement(299082..299537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0288"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: rso:RSc0406
FT                   putative nitrogen regulatory IIA (enzyme IIA-Ntr)
FT                   (phosphotransferase enzyme II, A component) transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61595"
FT                   /db_xref="GOA:C6BBW1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBW1"
FT                   /inference="protein motif:TFAM:TIGR01419"
FT                   /protein_id="ACS61595.1"
FT                   /translation="MNRLAKLLPPGNIALDVSVTSKKRVFEQAGLLFENNHGVTRAVVT
FT                   DNLFARESLGSTGLGAGVAIPHGRIKGLKQPLAAFMRLSEPVPFESPDGKPVSLLIFLL
FT                   VPEQATQQHLEILSEIAQLLSDRDMREGLATLPSPEAIHQLLTDWRP"
FT   gene            complement(299884..300237)
FT                   /locus_tag="Rpic12D_0289"
FT   CDS_pept        complement(299884..300237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0289"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   rso:RSc0407 putative sigma-54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61596"
FT                   /db_xref="GOA:C6BBW2"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBW2"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ACS61596.1"
FT                   /translation="MNFKLSGHHLDITPALREYVETKLERVIRHFDQVIGVSVLLSVDN
FT                   HKEKDRRQYAEINLHLKGKDVFVESHHEDLYAAIDLLVDKLDRQVIKYKDRVQGHDRDS
FT                   MKHQAFQAVQMQQ"
FT   gene            complement(300288..301799)
FT                   /locus_tag="Rpic12D_0290"
FT   CDS_pept        complement(300288..301799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0290"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 DNA-binding domain protein; sigma-54 factor
FT                   core-binding region; sigma-54 factor; KEGG: rso:RSc0408 RNA
FT                   polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61597"
FT                   /db_xref="GOA:C6BBW3"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBW3"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ACS61597.1"
FT                   /translation="MKQSLQLRLSQHLALTPQLQQSIRLLQLSTIELQQEVEQALTENP
FT                   LLERENEWLDTSARIGADGSVNALQSNSATPLPTESPPPAPNGGDSSNSSDSSYENGHD
FT                   NGADFDSDYGSDRSDWSLDDFARKPQSDEDDRAPLQLREAEQSLREFLMEQLAPLKLSM
FT                   RDKGLVIFLIESLDDEGYLSGTLDEILADLPTELEVELDELQAALRMLQSFDPPGIGAR
FT                   SAAECLSLQLHRLDSPAKALALVIVNQHLELLAARDYTRLKKALSVDEPALKAAHELIR
FT                   SLTPFPGHAFGRAEADFVVPDVIVRKTSAGWMAQLNPDVMPRLRINDMYAQILRSSRGE
FT                   SGAANLQQKLQEARWLIKNIQQRFDTILRVSQAIVERQKSFFTHGEIAMRPLVLREIAD
FT                   TLGLHESTISRVTTNKYMATPMGTFELKYFFGSHVSTETGGAASSTAIRALIKQLVGAE
FT                   DPKNPLSDSRIAELLGEQGFVVARRTVAKYREALKIPAVNLRKSL"
FT   gene            complement(301896..302684)
FT                   /locus_tag="Rpic12D_0291"
FT   CDS_pept        complement(301896..302684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0291"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RSc0409 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61598"
FT                   /db_xref="GOA:C6BBW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBW4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61598.1"
FT                   /translation="MSATTLAPKTAAPQATTSSTLVVRHLKKRYGTRTVVKDVSLDVKS
FT                   GEVVGLLGPNGAGKTTSFYMIVGLVALDAGDIVLDGEHISRLPIHQRARMGLSYLPQEA
FT                   SVFRKLNVQENIRAVLELQEQNGKKLSQDEVNRRLDGLLDDLQIAHLRDNPALSLSGGE
FT                   RRRVEIARALASSPRFILLDEPFAGVDPIAVGEIQRIVSFLKDRNIGVLITDHNVRETL
FT                   GICDHAYIISEGTVLAAGMPEQIIENEDVRKVYLGDNFRM"
FT   gene            complement(302715..303302)
FT                   /locus_tag="Rpic12D_0292"
FT   CDS_pept        complement(302715..303302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0292"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="TIGRFAM: lipopolysaccharide transport periplasmic
FT                   protein LptA; PFAM: OstA family protein; KEGG: rso:RSc0410
FT                   putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61599"
FT                   /db_xref="GOA:C6BBW5"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBW5"
FT                   /inference="protein motif:TFAM:TIGR03002"
FT                   /protein_id="ACS61599.1"
FT                   /translation="MTDSLRAAGLAIVAALLLPALPAHAERADRDKPLVLEADNASYDD
FT                   LKQVYHLTGNVVLTKGTMVLRSDQADLRTDPEGYNYAVATSKPGNLAFIRQKRDNVDEY
FT                   IQGWGERIEYDGKQEISKLITRARMERLQGATQLDEIRGAVITYDGQKEFYTASGGAEN
FT                   ATAANPSGRVRAVLAPRTSTPAAPASNPAAKP"
FT   sig_peptide     complement(303225..303302)
FT                   /locus_tag="Rpic12D_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            complement(303362..303994)
FT                   /locus_tag="Rpic12D_0293"
FT   CDS_pept        complement(303362..303994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0293"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   rso:RSc0411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61600"
FT                   /db_xref="GOA:C6BBW6"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBW6"
FT                   /inference="protein motif:PFAM:PF06835"
FT                   /protein_id="ACS61600.1"
FT                   /translation="MASERSQRLVSSVLQIMLRGLPILLMAIVCGVTFLLVQVNTPQTD
FT                   EAATQPKRHIPDYTMDGISATALDEIGTTKYRFTGVHMNHYEDDLTYDVTYPALRVYAP
FT                   DRPQVTARADLGKMNGDGTIIDLYNNAKVIRAQGPDARQDPLMTADSTYFQVLLNEDIV
FT                   RTDKPVELHRGPSIMNANGLTFNNVTRQVQLLGNVRGRIEGLGAPKQ"
FT   gene            complement(303999..304583)
FT                   /locus_tag="Rpic12D_0294"
FT   CDS_pept        complement(303999..304583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0294"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family; hydrolase, HAD-superfamily,
FT                   subfamily IIIA; KEGG: rso:RSc0412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61601"
FT                   /db_xref="GOA:C6BBW7"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBW7"
FT                   /inference="protein motif:TFAM:TIGR01670"
FT                   /protein_id="ACS61601.1"
FT                   /translation="MTTPSDPVHSNIEARFPQAMERAARVRLMVFDVDGVLTDGRLLVG
FT                   PEGEISKAFDTLDGHGIKLLAQAGVTPAIITGRQSEIVAWRAGELGIEHLYQGVADKRE
FT                   AFAHLLAATQLQAADTGYMGDDWPDLPVMAMVGFTACPAQAHAELRSRAHYVTHATGGR
FT                   GAVREVADLILKAQGAYDALLAQLLRAVQPS"
FT   gene            complement(304600..305583)
FT                   /locus_tag="Rpic12D_0295"
FT   CDS_pept        complement(304600..305583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0295"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: rso:RSc0413 hypothetical protein; TIGRFAM:
FT                   KpsF/GutQ family protein; PFAM: sugar isomerase (SIS); CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61602"
FT                   /db_xref="GOA:C6BBW8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBW8"
FT                   /inference="protein motif:TFAM:TIGR00393"
FT                   /protein_id="ACS61602.1"
FT                   /translation="MIANFNPDRALALAQQTFDIEAQAVLGLKTQVSADFARAVEMVLG
FT                   CTGRVVVSGMGKSGHVARKIAATLASTGTPAFFVHPAEASHGDLGMVTRDDVFIGFSNS
FT                   GEVSELNVILPLVKRLGAKLIAVTGNPESSLGKHADVVLNSHVDVEACPLNLAPTASTT
FT                   AQIALGDALAVAVLDARGFGAEDFARSHPGGSLGRKLLTHVRDVMRAGDAIPRVNEDTP
FT                   LSQALMEITRKGMAMTAVVDAGGRAVGVFTDGDLRRLLETPRDWRTVPIHEVMHRNPRS
FT                   VGPDQLAVEAVEVMETHRINQLLVVDAAGLLVGALHIHDLTRAKVI"
FT   gene            305893..307872
FT                   /locus_tag="Rpic12D_0296"
FT   CDS_pept        305893..307872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0296"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; TrkA-N domain
FT                   protein; TrkA-C domain protein; KEGG: rso:RSc0414 putative
FT                   glutathione-regulated potassium-efflux system K+/H+
FT                   antiporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61603"
FT                   /db_xref="GOA:C6BBW9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBW9"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACS61603.1"
FT                   /translation="MHSPLELTLVLLAAAVIGVVLFRMLQLPPMLAYLVVGVLIGPKAT
FT                   GLESDSAQTRYLAEFGVVFLMFSIGLEFNLSKLRSMRRLVLGLGASQVVLTMLLTIPVS
FT                   MLLSHWYPLSWQAGLALGGALAMSSTAIVSKMLAERLQLETEHGRNIISVLLFQDLAVV
FT                   LLLIVIPSLGKNPTDLVLALSVAALKITVALVLILFLGQKLLSRWFHLVAARRSQELFM
FT                   LNLLLVTLGMAALTERLGLSMALGAFLAGMLVSETPYKLQVEEDIKPFRDVLLGLFFVT
FT                   VGMLLDPRVVVDHWALVLALVAGPVLFKFVLIALLARAFGSGGGAAIRTALGLAQAGEF
FT                   GFVLLNQIDGLHLIDPLLGQAILAAMLLSMLLAPFLIQYSDVIAMRLSRTDWLMQSLAM
FT                   TKIAAQSIATERHVIICGYGRSGQNLAHMVEQEGIGYVALDLDPDRVREAAAAGEHVVY
FT                   GDAARRESLVAAGIHRAAAVAITYADTASALKVLHHVQALEPTLPVIVRTIDDADLDRL
FT                   QQAGATEVVPEIIEGSLMLASHALVLLGVPLRRVVRRAQQMRDARYSLLRGYFHGQDDE
FT                   EDMLERDAVRLHSVPLAKGSPAIGRKLGTMGLETFKTSVTAIRRQGIRALDPDPDTVLE
FT                   LGDIVVLRGTPEGLQMAEERLSPR"
FT   gene            complement(307882..308286)
FT                   /locus_tag="Rpic12D_0297"
FT   CDS_pept        complement(307882..308286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0415 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61604"
FT                   /db_xref="InterPro:IPR027373"
FT                   /db_xref="InterPro:IPR038268"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBX0"
FT                   /inference="similar to AA sequence:KEGG:RSc0415"
FT                   /protein_id="ACS61604.1"
FT                   /translation="MCEIFIRANPHSYDSLARSLRLHGVATSVRLECLFWEVLEEIGQR
FT                   DGLTVNQLISKLYDELLERRGEVANFASFLRVCCLRYLKLQQDGRIPADTRVSISSLDA
FT                   ATVLDGLPPNMADAPPPRRSRGPLLESLVK"
FT   gene            complement(308327..308905)
FT                   /locus_tag="Rpic12D_0298"
FT   CDS_pept        complement(308327..308905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0298"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: rso:RSc0416 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61605"
FT                   /db_xref="GOA:C6BBX1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBX1"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ACS61605.1"
FT                   /translation="MAKKILMLVGDYVEDYEVMVPFQALQMVGHTVHAVCPDKRAGDSV
FT                   ATAVHDFEGAQTYSEKPGHRFTVNATFADVDPAAYDALVVPGGRAPEYLRLNARVLEVV
FT                   RHFFHADKPVAAICHGAQLLSAAGVLEGKTCSAYPACGPEVTAAGGTFKVIPVDQAHTD
FT                   GKLVTAPAWPAHPAWLAQFLEVLGTRVLH"
FT   gene            309014..309622
FT                   /locus_tag="Rpic12D_0299"
FT   CDS_pept        309014..309622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0299"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /note="TIGRFAM: adenine phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: rso:RSc0417 adenine
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61606"
FT                   /db_xref="GOA:C6BBX2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBX2"
FT                   /inference="protein motif:TFAM:TIGR01090"
FT                   /protein_id="ACS61606.1"
FT                   /translation="MSQVPHHQAALLTPSSIPAATELGDVSRYLRDRIRTVPDWPQAGV
FT                   MFRDITPLLQDPKSLRVLVDVFVHRYMGQGLNLVAGIDARGFILGSIVAYELNLGFVPI
FT                   RKKGKLPFNTVTEEYMLEYGSATVEIHADACKPGDRVLLIDDLIATGGTMMAGKRLLER
FT                   LGATVVEGAAIVDLPELGGSQLLIEGGLPLFTVCRFDGH"
FT   gene            309747..310367
FT                   /locus_tag="Rpic12D_0300"
FT   CDS_pept        309747..310367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0300"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rso:RSc0418 transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61607"
FT                   /db_xref="GOA:C6BBX3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBX3"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACS61607.1"
FT                   /translation="MPHVVLFLLTSIAITVMPGPDNLQVVARGASQGRKAGLSAAAGFA
FT                   SGCLFHTTLAALGLAAVLQSSPVAFQAIRWLGAAYLIWLGIQALRSKGSVGLNPAGPQA
FT                   APDLWRVYRQSVFANLLNPKVTLFFVVFLPQFVDAQAGHAALQMLLLGGVFMAQTIVVF
FT                   SIYGWSAAALGGWMRRTPRASLWLDRLSGCIFIGLGLRVALTK"
FT   gene            complement(310398..310883)
FT                   /locus_tag="Rpic12D_0301"
FT   CDS_pept        complement(310398..310883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0301"
FT                   /product="protein of unknown function DUF355"
FT                   /note="PFAM: protein of unknown function DUF355; KEGG:
FT                   rso:RSc0419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61608"
FT                   /db_xref="InterPro:IPR007153"
FT                   /db_xref="InterPro:IPR036902"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBX4"
FT                   /inference="protein motif:PFAM:PF04008"
FT                   /protein_id="ACS61608.1"
FT                   /translation="MDLTVVPIVKPEATNFIFGQSHFIKTVEDLHEALVGAVPGIRFGI
FT                   AFCEASGKRLVRWSGNDETALQLARDNALAIGAGHTFLIFLGDGFFPVNVLAAVRAVPE
FT                   VCRIYCATANPTQVIVAQTELGRGVLGVVDGASPLGVETDADIAWRKALLRQIGYKL"
FT   gene            complement(310964..313828)
FT                   /locus_tag="Rpic12D_0302"
FT   CDS_pept        complement(310964..313828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0302"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: rso:RSc0420 excinuclease ABC
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61609"
FT                   /db_xref="GOA:C6BBX5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBX5"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ACS61609.1"
FT                   /translation="MDEIKIRGARTHNLKNINLDLPRNQLIVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLQLMEKPDVDLIEGLSPAISIEQKATSHNPRSTVGTVTEI
FT                   HDYLRLLYARAGTPYCPDHGQPLEAQSVSQMVDAVLALPADTKLMILAPVVANRKGEHV
FT                   DLFEAMQAQGFVRFRIRSGGGTAHEAEAKVYEVDNLPKLKKNDKHSIEVVVDRVKVNPE
FT                   LKQRLAESFETALRLADGRALALEMDTGKEHGFSSKFACPICSYSLQELEPRLFSFNNP
FT                   MGACPHCDGLGQITFFDPKRVVAFPNLSLASGAIKGWDRRNQFYFQMLQSLAAFYDVDI
FT                   DVAFEDLPAEIQEIVLHGSGKQQIPFTYINERGKTTVREHAFEGIIPNLERRYKETDSI
FT                   AVREELAKYQNNQPCPECHGTRLRREARFVKIGEADQARGIYEINGWPLRDALTYFLTL
FT                   NMHGAKREIADKIVKEITARLNFLNNVGLDYLSLERSADTLSGGEAQRIRLASQIGSGL
FT                   TGVMYVLDEPSIGLHQRDNDRLIGTLKHLRDLGNSVLVVEHDEDMIRASDYVVDIGPGA
FT                   GVHGGQIIAEGTPQQVEQSPASLTGDYLSGKRRIEVPKQRTAPDEERWLRIINASGNNL
FT                   KNVSADIPIGLLTCITGVSGSGKSTLINDTLYHAVARHLYGSTPEPAAHDRIDGLEHFD
FT                   KVINVDQSPIGRTPRSNPATYTGLFTPIRELFAGVPSAKERGYDPGRFSFNVKGGRCEA
FT                   CQGDGVLKVEMHFLPDVYVPCDVCHGKRYNRETLEVLYKGKNITEVLEMTVEQAHEFFA
FT                   PVPVVRRKLQTLLDVGLGYIRLGQSATTLSGGEAQRVKLSLELSKRDTGRTLYILDEPT
FT                   TGLHFHDIELLLKVIYKLRDHGNTIVIIEHNLDVIKTADWLLDLGPEGGAGGGQIIAKG
FT                   TPEDVAKSKASFTGKYLAPLLKRR"
FT   gene            314050..315234
FT                   /locus_tag="Rpic12D_0303"
FT   CDS_pept        314050..315234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0303"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RSc0421 putative multidrug-efflux transporter
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61610"
FT                   /db_xref="GOA:C6BBX6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBX6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS61610.1"
FT                   /translation="MTSASGRMNGLELRAAASLAGIFALRMLGLFMIMPVFAVFAKTLP
FT                   DGNNTQLVAFAIGVYGLTQAVLYIPYGWLSDRFGRKPVIVTGLVIFAVGSLVAAFSHSV
FT                   AGIAVGRAIQGAGAISSAVIAFVADLTREEHRTKAMAMIGGSIGLSFAVAIVSAPVIFR
FT                   WVGMPGMFTAIGVLAIVAIGVVLWVVPNPPRPPEHVKAPFGEVLRNPELLRLNFGVFAL
FT                   HATQTALFVVLPHMLEAAGLPVDSHWKIYLPVMGVSFVLMVPAIIAAEKRGKMKAVLLS
FT                   AVALVMVAQLALGEVNPTLAALAIALLVYFLGFNVLEASQPSLVSKYAPGVRKGAAMGV
FT                   YNTTQALGLFAGGAGGGWILLHAGQHAVFLTCAALAFAWLIIASPMQMPALRRH"
FT   sig_peptide     314050..314175
FT                   /locus_tag="Rpic12D_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.963 at
FT                   residue 42"
FT   gene            315282..315839
FT                   /locus_tag="Rpic12D_0304"
FT   CDS_pept        315282..315839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0304"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: rso:RSc0422 single-strand DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61611"
FT                   /db_xref="GOA:C6BBX7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBX7"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACS61611.1"
FT                   /translation="MASVNKVIIVGNLGADPETRYMPSGDAVTNIRVATTDRYKDKASG
FT                   EMKEATEWHRIAFFGRLAEIAGEYLKKGSSVYIEGRLKTRQWEKDGQKQYSTEIVADQM
FT                   QMLGGRGGEGGGSSGGGGGGYSRGGEGGGGGYGGSRSQGQSQGQGGGYSRGGEGGGGQG
FT                   GGARRQAAPSNGFEDMDDDIPF"
FT   gene            complement(316298..316531)
FT                   /pseudo
FT                   /locus_tag="Rpic12D_0305"
FT   gene            complement(316530..318026)
FT                   /locus_tag="Rpic12D_0306"
FT   CDS_pept        complement(316530..318026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0306"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   pol:Bpro_0544 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61612"
FT                   /db_xref="GOA:C6BBX8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBX8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS61612.1"
FT                   /translation="MSGRGEAVLSRRLSLVFAVLLLVCCGTSAWLQLRSNGRHEQEVIQ
FT                   RLSSGLAAHIAENAELMRPEGLNPVAVKDLFDKLMAVNPSVEVYLLSPDGHIAAQAAPP
FT                   GHLKRDRVDLAPVRRLLAGATMPVLGDDPRNLQTPKVFSAAPMRVDGRDAGYVYVVLQG
FT                   EDHDAVAAHVAADNVLRTTLWSMGLVALLGLVAGTMAFWLITRPLRELTAVVRRFESEG
FT                   IGSLESQTATLERIARGGGEIATLSQAFVQMTRRIAEQWRELTLQDQQRRELVANISHD
FT                   LRTPLTSLHGYLETLRLKAGILDDEERRRYLDIALGQSRKVGRLAQELFELARLEYGVV
FT                   KPEKENFALADLVQDVFQKFELAAGARQQQLKPDIAPGLPIVSADLGMIERVLTNLLDN
FT                   AIHHTPVGGAIEVQLRPTNTGVAVQVSDTGPGIPGELQKGLFVRPVFMSGARSDGSRSG
FT                   GLGLMIVQRILQLHGSEIRLVPQPGKGAVFRFQLAGAASG"
FT   sig_peptide     complement(317931..318026)
FT                   /locus_tag="Rpic12D_0306"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.818) with cleavage site probability 0.460 at
FT                   residue 32"
FT   gene            complement(318023..318751)
FT                   /locus_tag="Rpic12D_0307"
FT   CDS_pept        complement(318023..318751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0307"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: pol:Bpro_0543 two component transcriptional
FT                   regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61613"
FT                   /db_xref="GOA:C6BBX9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBX9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS61613.1"
FT                   /translation="MDSAKRVLLVEDDAHIAELLRMHLRDEGYAVVHAADGHAGQREME
FT                   RGNWDALVLDLMLPGIDGLEICRRARVQARYTPIIIISARSTEVHRILGLELGADDYLA
FT                   KPFSVLELVARVKALIRRTDALARNARMESGSLTLGNLEIEPLAREVRVDGKPIELTPR
FT                   EFDLLHFFARHPGKVFSRLDLLNQVWGYQHDGYEHTVNTHINRLRAKVEVDPAQPRRIL
FT                   TVWGRGYKLSIGADGKEDAA"
FT   gene            318884..319558
FT                   /locus_tag="Rpic12D_0308"
FT   CDS_pept        318884..319558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0308"
FT                   /product="thiosulfate reductase cytochrome b subunit
FT                   (membrane anchoring protein)"
FT                   /note="KEGG: dac:Daci_3135 thiosulfate reductase cytochrome
FT                   b subunit (membrane anchoring protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61614"
FT                   /db_xref="GOA:C6BBY0"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBY0"
FT                   /inference="similar to AA sequence:KEGG:Daci_3135"
FT                   /protein_id="ACS61614.1"
FT                   /translation="MKRDAHLSMPTSIDTSPVHPLWMRCTHWFNALAVMVLVLSGWRIY
FT                   NAAPFFPFTIPASATLGGWLGGALQWHFAAMWLLVVNGLVYLVMNVASGRLARKFFPVT
FT                   PAGVRCDMVAALKGRLSHADPRHYNNVQRLAYLSVILDIVLLVLSGLVLWKSVQFATLR
FT                   ELLGGYEVARRIHFCAMAGAVAFVVVHLVMVALVPRTLLTMLGGRVAGTPSPIQDRSSH
FT                   DA"
FT   gene            319567..320358
FT                   /locus_tag="Rpic12D_0309"
FT   CDS_pept        319567..320358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0309"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   dac:Daci_3134 oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61615"
FT                   /db_xref="GOA:C6BBY1"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBY1"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACS61615.1"
FT                   /translation="MKIFKAPRFDGIDGDAALIEARRQIARHVNLPARRTFLQRSLTLG
FT                   GLSLLTGCSISDNEQVEAALSRISRFNDKVQGLIFDPNQLAPTYPDSMITRPFPFNAYY
FT                   GEDEVRQVDAQAWRLEVTGLVSDRRQWNLADLRAMQQYDQVTRHICVEGWSAIGKWGGV
FT                   RFGDFLRRVGADLSAKYVGFKCADDYYTSIDMATALHPQTLMAITYDGAPLPPKYGFPM
FT                   KLRMPTKLGYKNPKHIQAIFVTNTYPGGYWEDQGYNWFGGS"
FT   gene            320479..320808
FT                   /locus_tag="Rpic12D_0310"
FT   CDS_pept        320479..320808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0310"
FT                   /product="pentapeptide MXKDX repeat protein"
FT                   /note="TIGRFAM: pentapeptide MXKDX repeat protein; KEGG:
FT                   dac:Daci_3133 pentapeptide MXKDX repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61616"
FT                   /db_xref="InterPro:IPR014299"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBY2"
FT                   /inference="protein motif:TFAM:TIGR02953"
FT                   /protein_id="ACS61616.1"
FT                   /translation="MNKFATTLLAVSLTFGGASAVFAADAMGKDAMSKDAMSKDAMSKD
FT                   AMSKDAMSKDAMSKDAMSKDAMSKDAMSKDAMSKDAMKKDAMKKDAMKKDAMKKDAMKK
FT                   DAMSQ"
FT   sig_peptide     320479..320550
FT                   /locus_tag="Rpic12D_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            320854..322254
FT                   /locus_tag="Rpic12D_0311"
FT   CDS_pept        320854..322254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0311"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   pol:Bpro_0539 cytochrome c biogenesis protein,
FT                   transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61617"
FT                   /db_xref="GOA:C6BBY3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBY3"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ACS61617.1"
FT                   /translation="MTLFIISFLGGALTVLAPCILPVIPFVFARVDQPFVKSGLPMLVG
FT                   MASTFAAVGTLGAAAGSWAVEANEYGRIAATALLGLMGAAMVFPRLAERLTRPLVSVGL
FT                   DLSNAANAHTAMAGNCVLPSFIRGVATGLLWAPCAGPILGLILTGAVLQGPNVKTSLLL
FT                   LAYGAGAVSSLALVLLTGHRIFAAMKRSLGIGEWFRKGLGITVLSGAVVVMTGVDTGWL
FT                   AQVSSGSVEASVERMLLQHFAPRQTGKMPIVDGQQQAKRNAPGGRLILVQAQQNRQPLN
FT                   LPVEGLFPPLTGAVDWLNSPPLTVEALRGKVVLVNFWTFGCINCRNVLPYVREWDRKYK
FT                   DQGLVVVSVHAPEFAYEKNIENVKRAASELGATFPIAIDNRFEIWKAFNNNYWPANYFI
FT                   DSQGRIRFHHFGEGEYEKSERAIQQLLKEARVGNRPVPMTATTLEKLNAALALQRAGDF
FT                   VAAGGGAG"
FT   sig_peptide     320854..320943
FT                   /locus_tag="Rpic12D_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.925 at
FT                   residue 30"
FT   gene            complement(322508..322768)
FT                   /locus_tag="Rpic12D_0312"
FT   CDS_pept        complement(322508..322768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0312"
FT                   /product="signal peptide protein"
FT                   /note="KEGG: rso:RSc0424 signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61618"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBY4"
FT                   /inference="similar to AA sequence:KEGG:RSc0424"
FT                   /protein_id="ACS61618.1"
FT                   /translation="MNGRLLLIPALLVALLSPLARADLSETKENIKQDTKEAARKTGHA
FT                   AKEAGHATANAARAVGHGVKNAAHATKCGVKHVFKKPCESD"
FT   sig_peptide     complement(322700..322768)
FT                   /locus_tag="Rpic12D_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(322793..323254)
FT                   /locus_tag="Rpic12D_0313"
FT   CDS_pept        complement(322793..323254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61619"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBY5"
FT                   /inference="similar to AA sequence:KEGG:RSc0425"
FT                   /protein_id="ACS61619.1"
FT                   /translation="MTSSAQPTPPLDRDWIAARIPHSGAMCLLDAVIAWDEAHIYCSAT
FT                   SHRDIANPLRSHGQLAAVCGIEYAAQAMAVHGALCDAAQARPRAGFLASVRSIEAHVPR
FT                   LDTIETPLDVEAERIGGDGINVLYRFTVRSGARILLTGRAAVVLDATVA"
FT   gene            complement(323251..324054)
FT                   /locus_tag="Rpic12D_0314"
FT   CDS_pept        complement(323251..324054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0314"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_A6097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61620"
FT                   /db_xref="GOA:C6BBY6"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBY6"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_A6097"
FT                   /protein_id="ACS61620.1"
FT                   /translation="MTRLSAFIESVGILGPGLPDWSHTTDVLAGRARYAHAPTELPPPA
FT                   GLPSAERRRTGPVVKLALAVGHEAVAASGRDAATLATVFSSSGGDGHNCNAICETLAGD
FT                   DRKLSPTRFHNSVHNAPAGYWSIATHAMAPSNVLCAYDGSFAAGLLDSLCQVAIDATPT
FT                   LLIAYDGDYPEPLNAVRAVPDLFAVALVLAPEAGPRTLARIDVALTDAPLTALAEPGLE
FT                   TLWHGNAAARALPLLEALAEGRQGRVVLEYLAETRVQVDITLGTT"
FT   gene            complement(324051..325268)
FT                   /locus_tag="Rpic12D_0315"
FT   CDS_pept        complement(324051..325268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0315"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG:
FT                   bac:BamMC406_2685 beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61621"
FT                   /db_xref="GOA:C6BBY7"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBY7"
FT                   /inference="protein motif:PFAM:PF02801"
FT                   /protein_id="ACS61621.1"
FT                   /translation="MKPVLLTHFTATSCLGRGLDATLEALRGQRGGLAPCTFPRADLDT
FT                   WIGEVPGADAAPVRADLADFDCRNNRLAQIGLTQDGFAESVEAAKARHGAARVGVFIGT
FT                   STSGILETERAYQQRDPQTGALPASFHYAQTHNIYSPAAFVRAYFGLSGPAMAISSACS
FT                   SGAKVFASARRMLAAGLIDAAVVGGVDSLCLTALYGFNSLELLSRQPCRPYDVARDGIS
FT                   IGEAAAFALLERAPEANDALDDDAILLLGIGESSDAHHMSSPHPEGLGARAAMAQALAT
FT                   SGLSTADIDYINLHGTGTPSNDAAESRAIQALFHSTACSSTKGATGHTLGAAGALEAVI
FT                   TALALRHQFLPAGINTTQPDPALIANYLTESGHARVRTALSNAFGFGGTNCSLVFGRAD
FT                   HLGLSS"
FT   gene            complement(325342..326205)
FT                   /locus_tag="Rpic12D_0316"
FT   CDS_pept        complement(325342..326205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0316"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   bac:BamMC406_2684 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61622"
FT                   /db_xref="GOA:C6BBY8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBY8"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ACS61622.1"
FT                   /translation="MNSPTTSPLGTARRWKPSPLINGALALHAVAAVAVAADPSTWPWA
FT                   GGSVIASHLVLMAGGLWPRSSWLGPNWTRLPVTAERHIALTIDDGPDPDVTPRVLDILD
FT                   QYGAKATFFCIGELAQRHPRCVEAIVARGHAVENHSQRHRHTFSLQGPGALRREIAAAQ
FT                   DTLTQITGTRPLFFRAPAGLRNPFLEPVLCQLGLQLASWTRRGFDTRSRNPEAVTQRLL
FT                   HGLAPQDILLLHDGHAARDAHGAPVLLTVLPKVLETAARAQLQCTTLRAALPAQPAQPA
FT                   RPQMAI"
FT   sig_peptide     complement(326095..326205)
FT                   /locus_tag="Rpic12D_0316"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.640 at
FT                   residue 37"
FT   gene            complement(326202..328622)
FT                   /locus_tag="Rpic12D_0317"
FT   CDS_pept        complement(326202..328622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0317"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: bch:Bcen2424_2764
FT                   exporter-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61623"
FT                   /db_xref="GOA:C6BBY9"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBY9"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ACS61623.1"
FT                   /translation="MKRLYALRRPAVLVWLTGLLLCAIVIGQTSFTADLSAFLPRSPSA
FT                   EQRVLVDQLREGLVSRLILVGIEGGDAATRATLSKQLAARLRTDTQFNAVNNGEPVSEA
FT                   RDRQFIFDHRYVLSPAVTPQRFSAEGLHAALGESLDLLSSSAGLVAKNMLPRDPTGEVA
FT                   ALVSQLDNTALPSSKHGVWASRDGQRAVLVVQTTAAGSDTDAQAHAIDAVRGAFDAVAR
FT                   AVPNAASTRILMTGPGVFSVESRDTIKHDVERLSAVSLVLVVALLLTVYRSPRTVVLGL
FT                   LPVLSGVAAGVAAVSLTFGAVHGLTLGFGTTLIGEAVDYSIYLFVQSARLRGATPNDSL
FT                   RAWITTYWPTIRLGVLTSVCGFASMLFSGFPGLVQLGLYSIVGLVTAALVTRYVLPHLR
FT                   GAEVATRDVSRVGAWLAQATHAAPRLRWVLAMVLVGACAALALHRDGLWSRELAALSPV
FT                   PAKSQALDASLRADVGAPDVRYLVVIPAATEQAALEGAEKVAAQLQPLVDNGVLAGFEN
FT                   PARYLPSDATQRARLASLPPGDALAARMRSAVEDQPIRVKPDLFAPFIADVDAARAQPL
FT                   LRRADLKGTSMALAVDALLTERAGQWSAMLPLRAPSAAPATTKNASNPPSLDAAPIRAA
FT                   VEHANVPGALFVDMKAEADRLYVDYVREDLRLSLAGFAAIALLLLVALRSPQRTLRALA
FT                   PLVAAVLVVTAGFALARVPLTILHLVGMLLIVAVGSNYALFFNQRTQANAPQTLVSLLV
FT                   ANLATVAGFGLLAFSRVPMLETFGLTVGPGAMLALVFSAILAPRAHHDHHAAA"
FT   sig_peptide     complement(328524..328622)
FT                   /locus_tag="Rpic12D_0317"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.914 at
FT                   residue 33"
FT   gene            complement(328636..329232)
FT                   /locus_tag="Rpic12D_0318"
FT   CDS_pept        complement(328636..329232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_2682 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61624"
FT                   /db_xref="GOA:C6BBZ0"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBZ0"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_2682"
FT                   /protein_id="ACS61624.1"
FT                   /translation="MTATRPFFRAFLALLAASMLGATAHAADTAWTLDRLMSTLARNKS
FT                   GRATFTETKTLSIAAQPIESSGELVFVAPDHLEKHTLAPKPEHLVIDGDKLTVERNQRK
FT                   FTMPLSQYPELGAFIESIRATLAGNRYALEAIYKVAIAGHGDDWTLTLSPIDTRMQQVV
FT                   RTITLEGTRDVLRSVAIRQADGDHSLMRLQRVPGN"
FT   sig_peptide     complement(329152..329232)
FT                   /locus_tag="Rpic12D_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 27"
FT   gene            complement(329229..330191)
FT                   /locus_tag="Rpic12D_0319"
FT   CDS_pept        complement(329229..330191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0319"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   rso:RSc0431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61625"
FT                   /db_xref="GOA:C6BBZ1"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBZ1"
FT                   /inference="protein motif:PFAM:PF03279"
FT                   /protein_id="ACS61625.1"
FT                   /translation="MKRSDWAERPERSNLALLRLMTWLSLRLGRPFGRVLLRLIALYFV
FT                   AASPAARRASREYLRRAFGRPATLREVFRHMLTFATTIHDRIYLISGRFGLFDIQLQGQ
FT                   QHVHNVLAQGRGAFLLGAHLGSFEVVRALGRTVPDLRVAVAMYEENARNINAAVAAINP
FT                   AAAPEVIPLGQVDAMLRVREALDDNRLVGMLADRTLLRDAGPSVRHMDFLGSPAAFPLG
FT                   PLHMAAMLKRPVLFMTGLHLGGNRYAVHFDLLADFADVRREDRAAAVQAALGRYVERVE
FT                   HYCRTAPYNWFNYFDFWQDADAAGAPDHTPADHQTTQTP"
FT   gene            complement(330188..331885)
FT                   /locus_tag="Rpic12D_0320"
FT   CDS_pept        complement(330188..331885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0320"
FT                   /product="Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA/FabZ"
FT                   /note="PFAM: Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA/FabZ; KEGG: rso:RSc0432 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61626"
FT                   /db_xref="GOA:C6BBZ2"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBZ2"
FT                   /inference="protein motif:PFAM:PF07977"
FT                   /protein_id="ACS61626.1"
FT                   /translation="MPTYPLVSHSTLDHTLAWRDGTPVSARAFLADVMALAPMLPPGGH
FT                   VFNACADRYRFAVGLCATLVAGKISLLPPMQTPQMVRQLSAFAPDVFCLHDAAACPVDL
FT                   PGFCYPDALDADTAPIDVPQIDASQIMAVLFTSGSTGTPVPHRKTWGALVRCMRTAVDH
FT                   LGLGDGRAFTLVGTVPAQHMYGFEVTVLLALQGGLAFSNRQPFYPADIREALDAVPQPR
FT                   VLVTSPVHLRALLASEAALPSASLVLSATAPLSEALAREAETRLSAPLLEIYGSTETGQ
FT                   VATRRTAQETAWHLYPGVRMESRAGTPADEGPTVWVYGEHVETPVPMGDAIELIDDTHF
FT                   LLHGRKADLINIAGKRSSLAYLNHQLNAIAGVVDGVFYMPNDAPAAPHKHGSAAVTRLV
FT                   ALVVAPGLSAADVLRALHDRIDAAFMPRPLLLVDALPRNETGKLARDVLAALIAQHSHR
FT                   NAHKHGMRFTIPADHPALPGHFPGHPIVPGVVLLDHALHTIGAAQGRSLDACKINSAKF
FT                   LSPAAPGEVLDLAFETTASNAVRFTIRAGEREVASGVLSAPAPEGVAA"
FT   gene            complement(331911..332585)
FT                   /locus_tag="Rpic12D_0321"
FT   CDS_pept        complement(331911..332585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61627"
FT                   /db_xref="GOA:C6BBZ3"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBZ3"
FT                   /inference="similar to AA sequence:KEGG:RSc0433"
FT                   /protein_id="ACS61627.1"
FT                   /translation="MHRLTSFARGAAGVGAIVAYQVGAHYAAATPGAHGVGLAMALLPP
FT                   LAIALVAATRTTHRAWLLPLWLLVCSVLWRARAPLAAHFDWGLYLEHASFNLMMAYVFG
FT                   RTLVAGREPLCTHFAHMVHGTLTPRIARYSRQVTLAWTLFFLVTAAVSTLLFATAPTVT
FT                   WSTFANYLSLPLVGVMFVAEYLCRRIVLRGEPHSSLFDAVRAYRQSEQSRHATPIATER
FT                   PR"
FT   sig_peptide     complement(332496..332585)
FT                   /locus_tag="Rpic12D_0321"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.667 at
FT                   residue 30"
FT   gene            332998..333258
FT                   /locus_tag="Rpic12D_0322"
FT   CDS_pept        332998..333258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0322"
FT                   /product="acyl carrier protein"
FT                   /note="KEGG: rso:RSc0434 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61628"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBZ4"
FT                   /inference="similar to AA sequence:KEGG:RSc0434"
FT                   /protein_id="ACS61628.1"
FT                   /translation="MNDLEKELAALMIGELNLEDIQLDALTADTPLYGEGFGLDSIDIL
FT                   EVALLISKKYGFELRSGDPDNQKIFASLGSLAAYVAEHRTR"
FT   gene            333313..334083
FT                   /locus_tag="Rpic12D_0323"
FT   CDS_pept        333313..334083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0323"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rso:RSc0436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61629"
FT                   /db_xref="GOA:C6BBZ5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBZ5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACS61629.1"
FT                   /translation="MPMTGASTSHLVLIPSYNPGPKVDDTVRSARAQWNPVWVVVDGST
FT                   DGSTERLQAMAEQDPGLRVIVLPRNRGKGVAVLAGLEAAAAAGFTYVLTMDADGQHPAN
FT                   LIPEFMAASQAAPDAMILGQPVFDATAPQMRVQGRRLSNGCADIETLWAGIGDTLFGFR
FT                   VYPIAPLAEIMRRQSWMRGFDFDPEAAVRLCWAGVRPIRLAAPVRYFRPNEGGVSHFRY
FT                   LRDNILLIAMHLRLAAEGLLRLPSMIARRLQRGW"
FT   gene            complement(334100..334678)
FT                   /locus_tag="Rpic12D_0324"
FT   CDS_pept        complement(334100..334678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0324"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   bur:Bcep18194_C6808 TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61630"
FT                   /db_xref="GOA:C6BBZ6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBZ6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS61630.1"
FT                   /translation="MRASKRQQVVDKAGELFSQHGFHPVGVDWIIDESGVARMTLYRHF
FT                   SGKDDLIKEVLEQRYTYVMGGIAAKLSPMPDATARLKGIFDWYGAWFRTPEFAGCLFER
FT                   ALAEFGSTCPKVTDVAVRYRDDLLAMMETLLKDVVPAKTARQLAGVYVMLLSGATADAR
FT                   AIGDPSVASQAWHAAETLLNQAKATVEAV"
FT   gene            335004..335585
FT                   /locus_tag="Rpic12D_0325"
FT   CDS_pept        335004..335585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0325"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   SMART: Sel1 domain protein repeat-containing protein; KEGG:
FT                   bam:Bamb_5148 Sel1 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61631"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBZ7"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ACS61631.1"
FT                   /translation="MRNRLLMLGVVSLLAACAQPQPPSDVVRVCDDRGCADRPKAQVAF
FT                   DQANIPDEDPRIVALKDVAKREPKAAYDLGLRYFRGDGVRQDSYQALNWMREAAEHGNL
FT                   QAQKALGAFYLFGLEEMGSDPREAEKWLSIAVSRGDKESKKLLEQARAAKKSDEDDYKW
FT                   RAQWRSTYYGYWYSGYPYLGVWRQTGWYWY"
FT   sig_peptide     335004..335060
FT                   /locus_tag="Rpic12D_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 19"
FT   gene            335737..336570
FT                   /locus_tag="Rpic12D_0326"
FT   CDS_pept        335737..336570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0326"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bcj:BCAS0626 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61632"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBZ8"
FT                   /inference="similar to AA sequence:KEGG:BCAS0626"
FT                   /protein_id="ACS61632.1"
FT                   /translation="MKTNLLSRTAKAAGVALITASLAACAGGGMVTPGGQNAGVSGAAA
FT                   GGSSVGADPTLERCASPLGTIAMDDGRNADWYGQFGSATKVTTIDPLLRMAVQQSNCFV
FT                   ITSIGNQKTDARLSRITDLQRNSGEYRAGSKQQKGQRVAADYYMEPQIIINDSPVGGVA
FT                   GAVGGLLGNSAIAALAGSVKSKASVVTLTLFDVRSAVQIAAAEGSSTATNYGAVLAGFG
FT                   GGVGGGLAGFSATPEGKATVVAFIDAWNKMVVALRSYKAQDVKGGLGRGGQLKVN"
FT   sig_peptide     335737..335817
FT                   /locus_tag="Rpic12D_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.830 at
FT                   residue 27"
FT   gene            complement(336655..337464)
FT                   /locus_tag="Rpic12D_0327"
FT   CDS_pept        complement(336655..337464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0327"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: rme:Rmet_5347
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61633"
FT                   /db_xref="GOA:C6BBZ9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C6BBZ9"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ACS61633.1"
FT                   /translation="MTLRKLCAAMALAIGTSAFAQTAPATLPVPDEATIPAGPVGEAIK
FT                   RGKLILTDTKRQLPHNVGNGLNCTSCHLNGGTTPYASPWVGLTAAFPEYRSRSGAVISL
FT                   QQRVNDCFQRSMNGKPIAFDGEDMNAILAYMKWLSSGVPVGTNVTGRGFEKIDTALAPN
FT                   RDNGKAVYAQRCAACHGAEGQGLPHPQGGYLMPPLWGKDSFNVGAGMARMYTAAAFVKH
FT                   NMPLGQGGTLTAQEAVDVAAFFTQQPRPDYAARANDWPKGDKPKDAR"
FT   sig_peptide     complement(337402..337464)
FT                   /locus_tag="Rpic12D_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.943 at
FT                   residue 21"
FT   gene            complement(337515..337928)
FT                   /locus_tag="Rpic12D_0328"
FT   CDS_pept        complement(337515..337928)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0328"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: rso:RSc0437 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61634"
FT                   /db_xref="GOA:C6BC00"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC00"
FT                   /inference="protein motif:PFAM:PF04143"
FT                   /protein_id="ACS61634.1"
FT                   /translation="MAIVIALVAGLLFGTGLIVSGMANPAKVLGFLDLFGQWDPSLAFV
FT                   MAGAIAVGVIAFFVAGRRGRSWLGTPIQLPSATGVTARLVLGSAVFGIGWGLAGFCPGP
FT                   ALVALGAGVPKAVGFVAAMLAGMAVFSWLQRKR"
FT   sig_peptide     complement(337857..337928)
FT                   /locus_tag="Rpic12D_0328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.921 at
FT                   residue 24"
FT   gene            complement(337930..338364)
FT                   /locus_tag="Rpic12D_0329"
FT   CDS_pept        complement(337930..338364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0329"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: rso:RSc0438 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61635"
FT                   /db_xref="GOA:C6BC01"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC01"
FT                   /inference="protein motif:PFAM:PF04143"
FT                   /protein_id="ACS61635.1"
FT                   /translation="MSIDFTHFTPGAALVGGLIIGLAAAVLVLGTGRIAGISGIVGGLL
FT                   LRPRGDMDWRIAFLIGLMGAPVVAALLGHPVVPEIAAGWGEVLAAGFLVGIGTRYAGGC
FT                   TSGHGVCGLSRGSVRSLVATLSFMTAGIVTVFVVRHVFGG"
FT   sig_peptide     complement(338287..338364)
FT                   /locus_tag="Rpic12D_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.787) with cleavage site probability 0.556 at
FT                   residue 26"
FT   gene            338697..339668
FT                   /locus_tag="Rpic12D_0330"
FT   CDS_pept        338697..339668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0330"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: rso:RSc0439 putative lipase/esterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61636"
FT                   /db_xref="GOA:C6BC02"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033140"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC02"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACS61636.1"
FT                   /translation="MSWQNWVVSRMVRNQIKKPTEREPFDPIATRLHAEKRKMPSPVEL
FT                   PPDWRIVPAFGANSGALTGEWIEPADPDLHDDAPVVLYLHGGGYFFCSPRTHRPITIGL
FT                   ATHARARVCVPDYRLAPEHPFPAPVEDALLTYRTLLAQGVAPSRIVVAGDSAGGGLALA
FT                   LLVALRDAADPLPAGAVLYSPWTDLAATGQSLIENDESDVMFRGAWMAHGAALYLGDSG
FT                   APTDHPLASPLYADFTGLPTLHCYVSTSEVLRDDTLRMAERARAAGVSVSVEMGRRLPH
FT                   VWPIFYPFLPEARVALKRSGEQIRRLVAARHENREPVALTPA"
FT   gene            339727..340521
FT                   /locus_tag="Rpic12D_0331"
FT   CDS_pept        339727..340521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0331"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RSc0440 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61637"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC03"
FT                   /inference="similar to AA sequence:KEGG:RSc0440"
FT                   /protein_id="ACS61637.1"
FT                   /translation="MRRVVVLGVVLAVAAGTWQWIRLHRLRLADVRFAPIENVLAATGV
FT                   AGAPARNANKSHWLKACDQALGPMRVEVRATETPLSFSNDRSVEQLTAEAPPYDRSARV
FT                   LGKTYATLVARFDVTSRYMAIATQPATTCLRPSISVELVLSNFRVTVAREFAPGTCAYN
FT                   AIREHELRHVAVNRAVLPHAAEVIRKEIESEYGGRLYFGDPDRIAADLQAALTRHWLPR
FT                   AQSLIELGLQAHEQIDTPREQDRMSRVCNGEVQAVLQQFTRG"
FT   gene            complement(340541..341050)
FT                   /locus_tag="Rpic12D_0332"
FT   CDS_pept        complement(340541..341050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0332"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: rso:RSc0441 thermoresistant gluconokinase
FT                   (gluconate kinase 2) protein; TIGRFAM: carbohydrate kinase,
FT                   thermoresistant glucokinase family; PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61638"
FT                   /db_xref="GOA:C6BC04"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC04"
FT                   /inference="protein motif:TFAM:TIGR01313"
FT                   /protein_id="ACS61638.1"
FT                   /translation="MIVVVMGVSGCGKSTVGQRIAERLGCAFRDGDEFHSEANRAKMHA
FT                   GIPLNDDDRKPWLESIRAYMDEKTGNGQSLVVACSALKQRYRDVLRGPAGNAEFVYLKG
FT                   DFDLLQGRLAARKDHFFNPNLLRSQFETLEEPADAIVVDIALPPEAIVDQAVAQLQARA
FT                   AHRPAA"
FT   gene            341283..342998
FT                   /locus_tag="Rpic12D_0333"
FT   CDS_pept        341283..342998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0333"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   rso:RSc0442 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61639"
FT                   /db_xref="GOA:C6BC05"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC05"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACS61639.1"
FT                   /translation="MAGEVFDARPRNGASYVVGDTTVPLAHVTVSALLAETVRRCPDDE
FT                   AVVFREQNVRWTWRTFAEQVDALAAGLHALGLERGDRIGIWSPNRVEWVLTQFATARLG
FT                   LILVNINPAYRLSELEYALNKVGCKAIVAAEAFKTSRYLEMLQTLAPELASAQPGALNA
FT                   AKLPALRWVIRMGEANTPGMLNFADVVARGKSVPVDALDAITATLSPDDAINIQFTSGT
FT                   TGAPKGATLTHVNVVNNARFVAMAMNLQEGDRLCIPVPLYHCFGMVMSVLTCTATGACM
FT                   VFPGEAFDPLATLRTVAEERCTQLHGVPTMFIAQLDHPDFKSFDVSTLRGGIMAGSPCP
FT                   IEVMKRVVSELNLREVTIAYGMTETSPVSFQSAVTDPLDKRVTTVGRIQPHLQVKLVDG
FT                   AGEVVPVGEKGELCTKGYSVMLGYWDDEAKTAESIHDGWMRTGDLATFDAEGYCNIVGR
FT                   VKDMLIRGGENVYPREIEEFLFRHPKVQAVNVFGVPDPKYGEEVCAWIVLKPGQQATED
FT                   EIRAFCQGQIAHYKIPRYIRFVTEMPMTVTGKVQKFVMRDRMIEELKLTVAATA"
FT   gene            343700..344974
FT                   /locus_tag="Rpic12D_0334"
FT   CDS_pept        343700..344974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0334"
FT                   /product="glycin-rich signal peptide protein"
FT                   /note="KEGG: rso:RSc0443 glycin-rich signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61640"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC06"
FT                   /inference="similar to AA sequence:KEGG:RSc0443"
FT                   /protein_id="ACS61640.1"
FT                   /translation="MKKTLLATAIAMGLGVSGVALADIGNTASGAGDKTQTTTSTINRT
FT                   STDTDTTTTTTATDNSNQHNNSSQGSNRDNSGTASATGYGTAASNNGGVSTATFTNSFN
FT                   TSKAIAISKLEGTVTNLSISGIGNVATNNGGSANGGAGGRGGYGYGGAGAGGNGGAGGA
FT                   GGGGGAGGSSGSVTHGSATNGGATAGNGGNGGGAAGNAGSGGSGGSSGTLSASLGAGLG
FT                   GLAGSASAAGGGAGGSGGGAGGSDGGDANHHHGSGSATGGAAAAAGGNGAAGGTGTSGS
FT                   STASGGAGTGTSTATGTSTGGAGAAGGAATNVAGTGGAGGTSTNGSATNGAASSTAGNG
FT                   AVGAVGAAGGAGGVGNGGVGNGAVGGTGGAGGTVMVDAGTFNMSNAMTSVGQSAAGVMV
FT                   ASQNSGFASLIQQSINVQANLNVGK"
FT   sig_peptide     343700..343768
FT                   /locus_tag="Rpic12D_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            345099..345533
FT                   /locus_tag="Rpic12D_0335"
FT   CDS_pept        345099..345533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0335"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RSc0444 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61641"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC07"
FT                   /inference="similar to AA sequence:KEGG:RSc0444"
FT                   /protein_id="ACS61641.1"
FT                   /translation="MRSDRRTTAGWAAWWLACGLVAWPAAAATAANDAPIADGAQVAST
FT                   EAVRPPAAAAMSVPGLGHAVGADRLDSYRGGTQDLYQTVNEARLSGTVSDNAAINVATG
FT                   SNIVRDGSFANASGIPTVIQNSGANVLIQNATIVNVQFRP"
FT   sig_peptide     345099..345182
FT                   /locus_tag="Rpic12D_0335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.658 at
FT                   residue 28"
FT   gene            345550..346233
FT                   /locus_tag="Rpic12D_0336"
FT   CDS_pept        345550..346233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0336"
FT                   /product="peptidase C39 bacteriocin processing"
FT                   /note="PFAM: peptidase C39 bacteriocin processing; KEGG:
FT                   rso:RSc0445 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61642"
FT                   /db_xref="GOA:C6BC08"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC08"
FT                   /inference="protein motif:PFAM:PF03412"
FT                   /protein_id="ACS61642.1"
FT                   /translation="MMRKTFGAVLVALICGPALAGTIDMLGTGGGTYAMPVTSMKAARY
FT                   LRTVHQRFDFSCGSAAVATLLTYQYGYPVSEQTVFQAMYEHGNQEKIRREGFSLLDIKR
FT                   YLASLGFEADGFEQPLDALKDAHLPAIVLLTENGYHHFVVVKGVQEGRVLVGDPAMGTR
FT                   AIPRASFESMWDNHLLFVVHNREAGATFNASSDWRVAPRAPLEEGMDRSGLGNIVVPKH
FT                   GPSDF"
FT   sig_peptide     345550..345612
FT                   /locus_tag="Rpic12D_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            346279..346815
FT                   /locus_tag="Rpic12D_0337"
FT   CDS_pept        346279..346815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0337"
FT                   /product="lipoprotein"
FT                   /note="KEGG: rso:RSc0446 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61643"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC09"
FT                   /inference="similar to AA sequence:KEGG:RSc0446"
FT                   /protein_id="ACS61643.1"
FT                   /translation="MKRFGKVAWAAGWFALAAAGHACAAGMGGMDNNPVHAWQAVSEDK
FT                   LDDMRGGFDVPSLAGLRISFGIDRAVFINGDLVASASVNIPDVARMTTTQAQQLASVVN
FT                   TVNIVQNGPNNVAPPDVAAGGAAAATVIQNSLNNQTLQAVTTINAAVNSLPQFRQMNLS
FT                   NVLQGALANVVTMLH"
FT   sig_peptide     346279..346353
FT                   /locus_tag="Rpic12D_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.853 at
FT                   residue 25"
FT   gene            complement(346817..348127)
FT                   /locus_tag="Rpic12D_0338"
FT   CDS_pept        complement(346817..348127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0338"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61644"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC10"
FT                   /inference="similar to AA sequence:KEGG:RSc0447"
FT                   /protein_id="ACS61644.1"
FT                   /translation="MKNAPWGPLRAVACACLLLCGRSALAQTNEPVDDKPPSLEALQRE
FT                   LADTQARLQELKRSIQQQETHLRHMRRALGMSEGRLDTVRGAGAPGAAGDAVELAQNDQ
FT                   PGTTPVGKPPEPPDRPPRIAQIFDEPSALTPPGKVVVEPSFQMAYSSSDRVALVGYTII
FT                   PALLIGLIDVRQVKTTTLTGTVAMRYGLARRWELEARVPYVYSKSDTVSRELFTGTATD
FT                   NAFSSHGHGIGDVELTARYQINAGGVDKPFYIGWLRFKTRTGKDPFEVTTDCVTRCVSN
FT                   TTGTGLPLQQPTGSGFFAVQPGLTWLFPTDPAVFFGSISYLHNFERKDVSLNLVDGSKQ
FT                   FLGNVKAGDIIGLNFGMGLALNEKASFSIGYDQSIIAPTTQNGQRVPGSVRTILGTLLV
FT                   GYSYRLSPKMALNLSVGAGLTRDTPDLTVTLRLPIQF"
FT   sig_peptide     complement(348047..348127)
FT                   /locus_tag="Rpic12D_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 27"
FT   gene            complement(348351..349187)
FT                   /locus_tag="Rpic12D_0339"
FT   CDS_pept        complement(348351..349187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0339"
FT                   /product="7-cyano-7-deazaguanine reductase"
FT                   /note="TIGRFAM: 7-cyano-7-deazaguanine reductase; PFAM: GTP
FT                   cyclohydrolase I; KEGG: rso:RSc0448 7-cyano-7-deazaguanine
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61645"
FT                   /db_xref="GOA:C6BC11"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC11"
FT                   /inference="protein motif:TFAM:TIGR03138"
FT                   /protein_id="ACS61645.1"
FT                   /translation="MSNQPEHSPLGKTSAYKTEYDPSLLFPIPRQGKRDEIGLAAGTPL
FT                   PFFGVDLWNLYELSWLNLRGKPQVALGTVIVPADSPNIVESKSFKLYLNSFNQTKVASH
FT                   EALQQLIHHDLSEACGAPVQVRIVTQEEFARQKMGELDGLLLDRLDIETDVYQPTPELL
FT                   HADEEESPVEETLVSHLLKSNCLVTGQPDWGSVQIRYVGAPINQEALLKYLISFREHNE
FT                   FHEQCVERIFTDILRQCHPVKLAVYARYTRRGGLDINPFRTNYNTPWPDNLRNARQ"
FT   gene            complement(349187..350707)
FT                   /locus_tag="Rpic12D_0340"
FT   CDS_pept        complement(349187..350707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0340"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   Threonine dehydratase domain protein; KEGG: rso:RSc0449
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61646"
FT                   /db_xref="GOA:C6BC12"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC12"
FT                   /inference="protein motif:TFAM:TIGR01124"
FT                   /protein_id="ACS61646.1"
FT                   /translation="MAIDYLKKILTAKVYDVAVETELKFAPNLSARTGNRVYLKREDDQ
FT                   PVFSFKLRGAYNKMASLTPAERKRGVITASAGNHAQGVAFSAARMECKAVICMPVTTPQ
FT                   LKIDGVRSRGGDWVEVVLHGESYSDAYNHAAQLQEKHGYTFVHPFDDPEVIAGQGTIAM
FT                   EILRQHPQPIHAIFCSIGGGGLISGIAAYVKAVRPDVKVIGVQSVDSDAMARSVAAGKR
FT                   VELKEVGLFADGTAVKLVGKETFRITRELVDEIITVDTDAICAALKDVFQDTRSLLEPS
FT                   GALALAGLKQYAETHKLKNESLVAVASGANMNFDRLRFVAERAEVGEAREAVFAVTIPE
FT                   ERGSFKRFCELVGWSRNVTEFNYRIASKDAAHIFVGVQIASRAEGDKIAENFRKHGFPT
FT                   LDLSNDELAKQHIRYMVGGRSPLAENEHLYRFEFPERPGALMKFLSSMSPNWNISLFHY
FT                   RNQGADSSNILVGIQVPKNEKREFKAFLATLGYTYWDESENPVYSLFL"
FT   gene            350851..351768
FT                   /locus_tag="Rpic12D_0341"
FT   CDS_pept        350851..351768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0341"
FT                   /product="K channel inward rectifier conserved region 2
FT                   domain protein"
FT                   /note="PFAM: K channel inward rectifier conserved region 2
FT                   domain protein; Ion transport 2 domain protein; KEGG:
FT                   rso:RSc0450 putative ATP-sensitive inward rectifier
FT                   potassium channel related transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61647"
FT                   /db_xref="GOA:C6BC13"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="InterPro:IPR041647"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC13"
FT                   /inference="protein motif:PFAM:PF01007"
FT                   /protein_id="ACS61647.1"
FT                   /translation="MNTPSSSSQLSRPARRGRTVWSGTQHVIAYGMPPLGWRDVYHHAL
FT                   EVNWPTFFALLATMFLALNAVFAGLYSLGDGAIANQSPPGFVGAFFFSVETLATVGYGD
FT                   MHPQTLYAHVIATLEIFIGMSGIAMATGLVFARFSRPRAKIMFARNVVVRPLNGKSTLM
FT                   LRAANARQNVIAEATARLRLMQDEVSPEGYSIYKIHDLKLERSEHPIFLLGWVMMHVID
FT                   EASPLHGATAESLAAGDALLLLTIEGADETAAQTVQARYSWRHDEIRWNYRYADLIHDE
FT                   GGVTSVDYDNFHLIHPLETSPQAQ"
FT   gene            351800..353047
FT                   /locus_tag="Rpic12D_0342"
FT   CDS_pept        351800..353047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0342"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   rso:RSc0452 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61648"
FT                   /db_xref="GOA:C6BC14"
FT                   /db_xref="InterPro:IPR011415"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC14"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ACS61648.1"
FT                   /translation="MALNLVWLAFFLVAFVTACVQVVQGDMEVFSRMLTGMFDAARTGF
FT                   EIAIGLTGMMALWLGIMRVGERAGVVDLFARLVNPLMRHLFPSVPAGHPANGAMMMNVS
FT                   ANVLGLDNAATPLGLQAMRELQQINPQPQRASDAQLMFVVLNTAGVTLVPTSVIAIRQA
FT                   MAVKQGLVGFNAADIFLPTLLSTFIGFCAGIAAVAWYQRINLFKPALLAYFGGFVATMG
FT                   LLFAWLRQFPPQQMAAWIGLIGAGAILTIVVAFLVCGAIRRINVYETFVDGAKDGFQVA
FT                   IGIVPYLVAVLVGIAVFRAAGCMDVLMHGLSALFTHLGIDTRFVPALPVGLMKTLSGAG
FT                   ARGLMVDVMTTYGVNSFQGKLAAIIQGSTETTFYVLAVYFGSVGIKDTRYALACGLWAD
FT                   LVGLIGAVLVAYLFFA"
FT   sig_peptide     351800..351877
FT                   /locus_tag="Rpic12D_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.253 at
FT                   residue 26"
FT   gene            353105..353686
FT                   /locus_tag="Rpic12D_0343"
FT   CDS_pept        353105..353686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0343"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61649"
FT                   /db_xref="GOA:C6BC15"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC15"
FT                   /inference="similar to AA sequence:KEGG:RSc0453"
FT                   /protein_id="ACS61649.1"
FT                   /translation="MEQWIDTLFATLALPKVGLPAVFVVSFISATLLPLGSEPAVFAYI
FT                   KLNPEMFWPAISVATLGNTLGGVVDWWMGYAAKLALVRYHLARRRRQHSAEHTQHVPHP
FT                   KRHREPPLDKKYFRWMRRIGPVSLLVSWLPGIGDPLCTLAGWLRLKFWPSVMYMAIGKF
FT                   LRYLAMTAALMTLPDGFWHGILGWIKSVMM"
FT   gene            353888..357925
FT                   /locus_tag="Rpic12D_0344"
FT   CDS_pept        353888..357925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0344"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; protein of
FT                   unknown function DUF224 cysteine-rich region domain
FT                   protein; KEGG: rso:RSc0454 putative oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61650"
FT                   /db_xref="GOA:C6BC16"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR021817"
FT                   /db_xref="InterPro:IPR022153"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC16"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACS61650.1"
FT                   /translation="MNAPLLIDAKLTAQDAAPRLREIPYNYTSFSDREIVIRLLGESAW
FT                   QILDELRAERRTGRSARMLYEVLGDIWVVRRNPYLQDDLLDNPKRRQMLIDALNHRLAE
FT                   IEKRRVADHDSHHDPVGDERASKVQQLVVHARRAVKAFQEEFAQVYDLRRRAQKVLGRV
FT                   TAKDNIKFDGLSRVSHVTDATDWRVEYPFVVLTPDTEEEIAGIVKGCFELGLTIIPRGG
FT                   GTGYTGGAVPLTPFSAVINTEKLERLDAVEMTDLPGVDHPVATIYSGAGVVTRRVADAA
FT                   EKAGLVFAVDPTSIDASCIGGNVAMNAGGKKAVLWGTALDNLAWWRMVDPDGNWLEVTR
FT                   LNHNLGKIHDAPVVTFELKWFDGNAPVGAKLLRTETLTIEGRKFRKEGLGKDVTDKFLA
FT                   GLPGVQKEGCDGIITSARWILHRMPKSIRTVCLEFFGQARDAIPSIVEIKDYLDAETKK
FT                   PGGAILAGLEHLDERYLRAVGYATKSKRNAFPKMVLIGDIVGDDDDAVARATSEVIRLA
FT                   NGKSGEGFVAVSPEARKKFWLDRSRTAAIAKHTNAFKINEDVVIPLNRMGEYTDGIERI
FT                   NIELSIKSKLKLTDALLDFFAGSNLPLGRTDDANEIPSAELLEDRVQQAQQLLRATRAR
FT                   WQYLLDHLDTPVTTARASLIGLGLGYLAQTIDDRLVNQPDANLFHLLQDRTIRVSWKAE
FT                   IRAELRKIFNGGEFKPILDEAQAIHKKVLRGRVFVALHMHAGDGNVHTNIPVNSDDYDM
FT                   LQDAHKAVARIMTLARSLDGVISGEHGIGITKLEFLTDEEIADFAAYKRRVDPNGRFNK
FT                   GKLLRDINDPQGLAADLRNAYTPSFGLMGHESIIMQQSDIGAISESIKDCLRCGKCKPV
FT                   CATHVPRANLLYSPRNKILATSLLIEAFLYEEQTRRGVSVKHWEEFADVGDHCTVCHKC
FT                   VTPCPVKIDFGDVSMNMRNLLRKMGQKKFNPGTAAAMFYLNATNPETINLTRKVMFDWG
FT                   YKAQRLGNDILKKFAKKQTARPPATVGKPPVREQVIHFINKKMPGNLPKKTARALLDIE
FT                   DNEIVPIIRNPKATTPDSEAVFYFPGCGSERLFSQVGLATQAMLWHAGVQTVLPPGYLC
FT                   CGYPQRGTGQFDKAEKIVTDNRVLFHRVANTLNYLDIKTVVVSCGTCYDQLAGYEFDKI
FT                   FPGCRIIDIHEYLLEKGVKIDGVQGTRYMYHDPCHTPIKTMDPTKLVNQLMGGNIGADG
FT                   QTSAIEKNDRCCGESGTLAISRPDISTQVRFRKEEEMQKGADKLRSLGQTSGQGGEAFN
FT                   GDVKILTSCPACLQGLSRYTEDVSVQADYIVVEMARHVLGETWLQDYVAQANAGGIERV
FT                   LV"
FT   gene            357922..358374
FT                   /locus_tag="Rpic12D_0345"
FT   CDS_pept        357922..358374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0345"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   rso:RSc0455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61651"
FT                   /db_xref="GOA:C6BC17"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC17"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ACS61651.1"
FT                   /translation="MTVATTGERAPGCALCEADGGEPVWRNAKARVVLVEHARFPGFCR
FT                   VIWNDHVAEQTDLSDADRHWLMDVVSRVERVLRAELAPDKINLASFGNFVPHLHWHVIP
FT                   RYRWDTHFPEAVWGPEQRAPDTARMAEITARLPALSYALHAALANA"
FT   gene            358489..360333
FT                   /locus_tag="Rpic12D_0346"
FT   CDS_pept        358489..360333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0346"
FT                   /product="ABC transporter domain protein"
FT                   /note="PFAM: ABC transporter domain protein; ABC
FT                   transporter related; SbmABacA family protein; SMART: AAA
FT                   ATPase; KEGG: rso:RSc0456 ATP-binding transport ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61652"
FT                   /db_xref="GOA:C6BC18"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC18"
FT                   /inference="protein motif:PFAM:PF06472"
FT                   /protein_id="ACS61652.1"
FT                   /translation="MTTPRTAATPDSHKDSISELTVHHGRLNLSETWQLIRPYWFSEDR
FT                   HKAWGLLALVVALNLFLVYMNVLFTDWNRLFYNALEQKNYGEFWTQLGRFSWIAALLIF
FT                   GSIMRLYYSMMLQMRWRTWITGSFLDDWLSKQAFYRLEQTHSADNPDQRIADDLRNFTD
FT                   ATLTLALGFLNSAVTLVSFFGILWAVSGPLAFSLGGHDFVIPGYMVWFALLYSIVGSVI
FT                   IHFVGRPLIGLSFQQERYEAYFRFLLVRVRENSESIALYRGEPTEKAILRGRFERIRTN
FT                   WNQLMDYTRRLTFASSGYAQFAIIFPFLVSAPRYFGGTLTLGGMMQVATAFGQVQDAMS
FT                   WFVTNYRTLVTWKASTNRLIEFQRAIRAAEREEEHRAGVRDVEVETAAVPAIEARGLAL
FT                   NLPNRKPEDLLVKPFDMTLARGERVLVNGPSGCGKSTLVRAVAGIWPYGSGRIEVPDDA
FT                   RVLFLPQRSYLPSGTLADALSYPDLATQYTAERLTQVLNACRLPALVDLLDEVSNWSLR
FT                   LSPGEQQRLAFARALLQRPDYLFLDEATSALDEDTEAFMYSLMLESMPDVTIVSVAHRS
FT                   TVARFHHRRLRYIPEGDPLTAVSYRVVEEPAHMALAAS"
FT   gene            360365..360781
FT                   /locus_tag="Rpic12D_0347"
FT   CDS_pept        360365..360781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0347"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   rso:RSc0457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61653"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC19"
FT                   /inference="protein motif:PFAM:PF06155"
FT                   /protein_id="ACS61653.1"
FT                   /translation="MAGLSADTPHPTGITVHTQSRVLEIAFADGKQFSLPFEYLRVLSP
FT                   SAEVQGHGPGQEVLQTGKREVGIVGVEPVGNYAIRPLFSDGHDSGIYDWAYLYRLGVEH
FT                   DALWQAYLDRLTAAGVDRDAPMAANAGHACGHSH"
FT   gene            360834..361565
FT                   /locus_tag="Rpic12D_0348"
FT   CDS_pept        360834..361565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0348"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   rso:RSc0458 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61654"
FT                   /db_xref="GOA:C6BC20"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC20"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ACS61654.1"
FT                   /translation="MSQTHFGFQQVDEQEKAGKVAGVFHSVASKYDVMNDLMSGGLHRV
FT                   WKMFTIAQAAVRPGYKVLDIAGGTGDLAKAFARQAGPTGEVWLTDINESMLRVGRDRLL
FT                   DAGVLTPTALCDAEHIPFPNAYFDVVTVAFGLRNMTHKDRALAEMRRVVKPGGKVMVLE
FT                   FSKVWQPLEKAYDLYSFKVLPWLGSKVAGDPESYRYLAESIRMHPDQETLKQMMEQAGL
FT                   DSVEYFNLTAGVVALHVGRRL"
FT   gene            361720..362739
FT                   /locus_tag="Rpic12D_0349"
FT   CDS_pept        361720..362739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0349"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase subunit
FT                   Tim44; KEGG: rso:RSc0459 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61655"
FT                   /db_xref="GOA:C6BC21"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC21"
FT                   /inference="protein motif:PFAM:PF04280"
FT                   /protein_id="ACS61655.1"
FT                   /translation="MAGALVATLALGTAIDANAKRMGGSRSIGKQSSTVTQRQQTPPAT
FT                   TPSPTQQAAPAAQPSPAAPAPGAPAAKPGRNWGGMLRGLAAGLGIGYLLSKFGLGAGLA
FT                   SLLSNLILIALVAFVVMWIIRKVRGSRPQGPAYATGGPSLGGDREPYVPQPAAPAPQAS
FT                   APAAASLNTGNTSGLGAGAATAAQSWNLGGSAASAQAVNAQPAAAAPQQPWGVPADFDT
FT                   QAFLRNAKVYFIRLQAAWDAGNLNDIREFTTPEMFAEIKMDLADRGTSPNKTDVVSVEA
FT                   EMLGIETQAAEYLASVRFSGMIREEANAPAQPFAEVWNLTKPTQGAGGWVLAGIQQLQ"
FT   gene            362885..363547
FT                   /locus_tag="Rpic12D_0350"
FT   CDS_pept        362885..363547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0350"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   rso:RSc0460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61656"
FT                   /db_xref="GOA:C6BC22"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC22"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ACS61656.1"
FT                   /translation="MSSTATSSPSSFPLVLMQPLLLALNHLLRQEPWAQETLRPFAGRV
FT                   ARFDLAPMSMTLQVDAAGLVTAPPPDVEPAVTVVVPLAAAAGDYATGGQAAVLKHVRIE
FT                   GEAEFANVLSTLLRNLRWDAAEDLSRLFGDVIAQRMVSGAQAARTEATRVSRSLAESVA
FT                   SYLTDEQPTLVRHARLAQFADDVAALRDAEARLVKRLERLEKLPRPATRIARQGESA"
FT   gene            363544..365121
FT                   /locus_tag="Rpic12D_0351"
FT   CDS_pept        363544..365121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0351"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: rso:RSc0461 putative ubiquinone
FT                   biosynthesis protein UbiB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61657"
FT                   /db_xref="GOA:C6BC23"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC23"
FT                   /inference="protein motif:TFAM:TIGR01982"
FT                   /protein_id="ACS61657.1"
FT                   /translation="MTRFFRLGKIVFVILYYGLDQLALSGFKSRRIRALVWLLTLGRKP
FT                   KLPRGERLRLALEQLGPIFVKFGQVLSTRRDLLPPDVADELAKLQDRVPPFDPKVAAAI
FT                   VEKSLGKPLSALFHRFDHHPVASASIAQVHFATLRGGPYDGREVAVKVLRPGMLPVIDS
FT                   DLALMRDLATWIEKLWADAKRLKPREVVAEFDKYLHDELDLMREAANASQLRRNFAKSD
FT                   LLLVPEVFWDWCTSEVFVMERMHGMRISHTEELRAAGVDMHKLARDGVEIFFTQVFRDG
FT                   FFHADMHPGNILVSVAPETLGRYIALDFGIVGALSEFDKNYLAQNFLAFFQRDYHRVAV
FT                   LHIESGWAPEETRVEELEGAIRACCEPYFDRPLGEISLGLVLMRLFQTSRRFNVEVQPQ
FT                   LVLLQKTLLNVEGLGRQLDPDLDLWKTAKPFLERWMHEQIGWRGFVERLKVEAPQWANK
FT                   LPDFPRLVHQILDRHSREDGNAQTAALTALLAEQKRTNRLLSAALLFVGGFAVGIVATH
FT                   VLAWMARY"
FT   gene            365145..365774
FT                   /locus_tag="Rpic12D_0352"
FT   CDS_pept        365145..365774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0352"
FT                   /product="thiopurine S-methyltransferase"
FT                   /note="PFAM: thiopurine S-methyltransferase;
FT                   Methyltransferase type 12; KEGG: rso:RSc0462 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61658"
FT                   /db_xref="GOA:C6BC24"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC24"
FT                   /inference="protein motif:PFAM:PF05724"
FT                   /protein_id="ACS61658.1"
FT                   /translation="MAEPPVFQSRDAADPAFWDERFSREHTPWDAAGVPAAFQQFCESQ
FT                   PVPLSTLIPGCGSAYEAGWLAERGWPVTAIDFAPSAVASARAVLGPHADVVEMADFFGF
FT                   SPARSVQWIYERAFLCAMPRRLWPDYAAQVAKLLPPGGLLAGFFAVVEGREAVPKGPPF
FT                   ETTQPELDALLSPAFERISDIPIAEADSIPVFAGRERWQVWRRRAD"
FT   gene            366006..367445
FT                   /locus_tag="Rpic12D_0353"
FT   CDS_pept        366006..367445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0353"
FT                   /product="Na+/solute symporter"
FT                   /note="PFAM: Na+/solute symporter; KEGG: rso:RSc0463
FT                   sodium/solute symporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61659"
FT                   /db_xref="GOA:C6BC25"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC25"
FT                   /inference="protein motif:PFAM:PF00474"
FT                   /protein_id="ACS61659.1"
FT                   /translation="MLIWFVIVYWVISVGIGLWAALRVRNTADFAVAGRSLPFYVVTAT
FT                   VFATWFGSEAVLGIPAEFLKDGLHGVVADPFGSSLCLVLVGLFFAKPLYRMNLLTIGDF
FT                   YRNRFGRVAETLTTLCIVVSYLGWVAAQIKALGLVFYTVSDGAVSQDLGMMIGAGSVLV
FT                   YTLFGGMWSVAVTDFIQMIIIVIGMLYIGWEVSGQAGGVGTVVAHAAASGKFSFWPAFN
FT                   PIEIIGFVTAWITMMLGSIPQQDVFQRVTSSRTERIAGTASVLGGVLYFMFAFVPMFLA
FT                   YSATLIDPQMVAKYIDTDSQMILPNLVLQHAPIFAQVMFFGALLSAIKSCASATLLAPS
FT                   VTFAENVLRPLLPNMDDKRFLRVMQAVVLTFTVLVTLFALNSHLSIFHMVESAYKVTLV
FT                   AAFVPLAFGLFWKRATKQGGLLAIILGLAAWIWCEVFLPNAMLPPQLVGLLASFGAMVA
FT                   GSLGPQWIANRAPTTKAATQA"
FT   gene            367696..368037
FT                   /locus_tag="Rpic12D_0354"
FT   CDS_pept        367696..368037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0354"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; KEGG:
FT                   rso:RSc0464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61660"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC26"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ACS61660.1"
FT                   /translation="MPIYAYRCDACGHAKDVLQKMSDAPLTDCPACGAPAFKKQLTAAG
FT                   FQLKGSGWYVTDFRGGSGGASAAAGGPGTAAKTDAAAPTAPAASSDSVSSSASAPAASG
FT                   GCGTSCACH"
FT   gene            368068..368805
FT                   /locus_tag="Rpic12D_0355"
FT   CDS_pept        368068..368805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0355"
FT                   /product="protein of unknown function DUF502"
FT                   /note="PFAM: protein of unknown function DUF502; KEGG:
FT                   rso:RSc0465 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61661"
FT                   /db_xref="GOA:C6BC27"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC27"
FT                   /inference="protein motif:PFAM:PF04367"
FT                   /protein_id="ACS61661.1"
FT                   /translation="MKQKTSALKTWFLTGLLVLVPLAITLWVLSLIIGTMDQSLALLPS
FT                   AWQPDQLFGRRIPGVGAILTLAFILIVGVLAHNFIGQKLVLWWEALVGRIPVVGPIYSS
FT                   VKQVSDTLLSSNGNAFRKALLVQYPREGSWTIAFLTGRPGGDVENHLQGEYVSVYVPTT
FT                   PNPTSGFFLMMPKADTIELDMTVDAALKYIVSMGVVAPEALPRRMDPPDASQQTEDRSP
FT                   AQGPRDPSNPTALPAEGGAIAAP"
FT   sig_peptide     368068..368139
FT                   /locus_tag="Rpic12D_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.276 at
FT                   residue 24"
FT   gene            368860..370731
FT                   /locus_tag="Rpic12D_0356"
FT   CDS_pept        368860..370731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0356"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /note="TIGRFAM: aspartyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); tRNA synthetase class II
FT                   (G H P and S); GAD domain protein; nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: rso:RSc0466 aspartyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61662"
FT                   /db_xref="GOA:C6BC28"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC28"
FT                   /inference="protein motif:TFAM:TIGR00459"
FT                   /protein_id="ACS61662.1"
FT                   /translation="MRDAFLAARFAENHNMQMRTQYCGQVTEQLLGQSVTLSGWAHRRR
FT                   DHGGVIFIDLRDREGLVQVVCDPDRPEMFKVAEGVRNEFCLQVKGVVRARPEGTTNANL
FT                   TSGKVEVLCHELTVLNASVTPPFQLDDDNLSETTRLTHRVLDLRRPQMQYNLRLRYKVA
FT                   MEVRKYLDDKGFIDIETPMLTKSTPEGARDYLVPSRVNAGQFFALPQSPQLFKQMLMVS
FT                   GFDRYYQITKCFRDEDLRADRQPEFTQIDCETSFLSEQEIRDLFEEMIRTVFKNTMSVE
FT                   LDAKFPVMEFREAMARFGSDKPDLRVKLEFTELTDAMKDVDFKVFSGPANAEGGRVVAL
FT                   RVPGGASLSRGDIDAYTKFVEIYGAKGLAWIKVNEVAKGRDGLQSPIVKNLHDAAIAEI
FT                   LKRSGAQDGDILFFGADRAKVVNDAMGALRLKVGHSDFAKSTGLFEDAWKPLWVIDFPM
FT                   FEYDEEDARWVAMHHPFTSPKDEHLEYLETDPGKCIAKAYDMVLNGWEIGGGSVRIYRE
FT                   EVQSKVFRALKINDEEARAKFGFLLDALQYGAPPHGGIAFGLDRVVTMMAGADSIRDVI
FT                   AFPKTQRAQDLLTQAPSPVDEKQLRELHIRLRAAEAKVAAPTAATTA"
FT   gene            370879..371739
FT                   /locus_tag="Rpic12D_0357"
FT   CDS_pept        370879..371739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61663"
FT                   /db_xref="GOA:C6BC29"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC29"
FT                   /inference="similar to AA sequence:KEGG:RSc0467"
FT                   /protein_id="ACS61663.1"
FT                   /translation="MDYIDFARTWVVAHAEFLLTWLIAALVVILLAWIEIRRATRRAAI
FT                   AMTEAVATTVAACVPEIAAAAQSAHPGVPASATSPGLAEAMRALGDLAAERMHWLHAVA
FT                   NLRLPEAALPPAAPGMPVHQLVYDTPRPLAEAHLAAERRFADHARILQAERRALQALET
FT                   AEREGTSELHRIERETSAIVERFDQANAQSEQTDVQRFLIQKFNTLGNRERELTTQLAA
FT                   LRQQLAERTEALWAQSQRAADDYAAMLDPLLAGARRELGHETSTDETALWLARTRTGQG
FT                   PLRAV"
FT   gene            371847..372332
FT                   /locus_tag="Rpic12D_0358"
FT   CDS_pept        371847..372332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0358"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: rso:RSc0468 dATP
FT                   pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61664"
FT                   /db_xref="GOA:C6BC30"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC30"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACS61664.1"
FT                   /translation="MPHKIPVSVLVVIHTPDLHVLVMERADHPGFWQSVTGSCDALDEP
FT                   LADTARREVLEETGIDAAQHHLIDWGHQIEYEIYPRWRHRYAPGVTRNTEHWFGLLVSG
FT                   KVPVRMSPREHVQAEWLPYEDAAARCFSRSNAEAILQLPERLAAYHARQAALTKDQA"
FT   gene            372334..373080
FT                   /locus_tag="Rpic12D_0359"
FT   CDS_pept        372334..373080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0359"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   rso:RSc0469 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61665"
FT                   /db_xref="GOA:C6BC31"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC31"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACS61665.1"
FT                   /translation="MLRLRVATYNIHKGVTGIARRVRVHDVRQGLHTMDADIVFLQEVQ
FT                   DRNDRLVAAELFDPNYTQLRYLATDVYPHTVYGRNAVYEHGHHGNAILSRFPILLSENL
FT                   DISDHRFEQRGLLHAVTDLGFGEVHLLCAHFGLFARSRQRQAEALVDRVRSVVPPDAPL
FT                   VVAGDFNDWNNRLDRMICQALGATEVADKAADARPVRTFPSQMPWLRLDRIYVRGFDIE
FT                   RAHALTGREWAQRSDHVPLLAELAHP"
FT   gene            373077..374345
FT                   /locus_tag="Rpic12D_0360"
FT   CDS_pept        373077..374345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0360"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; SMART:
FT                   phospholipase D/Transphosphatidylase; KEGG: rso:RSc0470
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61666"
FT                   /db_xref="GOA:C6BC32"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR030872"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC32"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ACS61666.1"
FT                   /translation="MKVVRDAGPLRSEWRRGKPLPGNHVDLLRGGAEFFPALIQAIDAA
FT                   QRRVALETYIYTDDATAHSVTEALARAARRGVDVHLTLDGFGTGLLPATIATMLKEAGV
FT                   RLRIYRPLRGFRLQRRHLRRLHRKIAIIDDDVAFVGGINIIDDLNHAPFNDTALGPRYD
FT                   FAVRVQGPLVAQIALTVDRLWWQMGVRAGMREVGVTGVAAEFPVITDTPRPRHRGASGQ
FT                   ESERAPGNVLASLVLRDNVRNRRAIEREYLRALGAARQEVIIANAYFLPGVRFMRALSA
FT                   CRRRGVRVRLLLQGQVEYRLQHYATRSLYHMLLRDNVEIHEYTASFLHAKVAVVDDRWA
FT                   TVGSSNIDPFSLLLAREANVVVWDATVANELRAALEDAIARHARRILADEHAARRWWWR
FT                   FADWCAYRLVRIGVVISGRAAHY"
FT   gene            374385..376049
FT                   /locus_tag="Rpic12D_0361"
FT   CDS_pept        374385..376049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0361"
FT                   /product="coenzyme A transferase"
FT                   /note="PFAM: coenzyme A transferase; KEGG: rso:RSc0471
FT                   putative transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61667"
FT                   /db_xref="GOA:C6BC33"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR014388"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC33"
FT                   /inference="protein motif:PFAM:PF01144"
FT                   /protein_id="ACS61667.1"
FT                   /translation="MQVITTDAAARLVQPGWTVACAGFVGAGHAEAVTHALERRFLTTG
FT                   EPRDLTLVYSAGQGDRATRGVNHFGNPGMTRCVVGGHWRSATRLADLALAEQCDAFNLP
FT                   QGVLTHLYRAIAGGKPGVLTKMGLHTFVDPRTELDARYHGGAINNRAKAARAAGKASWV
FT                   EYERFRGEDYLFYPSFPLHCVFLRGTAADPRGNISTHEEAFHHELLAMAQAARNSGGIV
FT                   IAQVRRLVDRHDNLQAIHVPGILVDYVVVADDETEHQMTFGEAFNRAYIRPWQGEAIQL
FT                   KEDAVEASEALEASQHGAMDARTLVQRRAVLELIAQQPRVVNLGVGMPAAVGALAEQEG
FT                   ARGFTLTVEAGPIGGTPADGLSFGASAYPEAVVDQPAQFDFYEGGGIDLAILGLAELDG
FT                   AGNVNVSLFGEGGDTIVAGVGGFINITQSARSVVFMGTLTAGGLQVEAEDGKLRIVREG
FT                   RLKKIVPAVSHLTFNGEYAARSGIPVRYVTERAVFEMRGDGHGARRLTLTEIAPGIDLQ
FT                   RDVLDQCAADVAVAADLREMDARIFRRGAMYAGITPA"
FT   gene            376403..377044
FT                   /locus_tag="Rpic12D_0362"
FT   CDS_pept        376403..377044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0362"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rso:RSc0472
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61668"
FT                   /db_xref="GOA:C6BC34"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC34"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS61668.1"
FT                   /translation="MRHPTARLESNHAAATPMRKGELTRAAILDAALELASRDGLEGLT
FT                   IGVLAERMQMSKSGVFAHFGSREDLQVEVVREYHKRFEQEVFYPSLTEPRGLPRLWSMV
FT                   RRWMERRIQEVTTGCIYISGAVEYDDRAESPVRDELVKSVTIWRAALARAIAQAKEEGH
FT                   LRAEADPQLMLFEMYSLELGLHHDARFLRLPNSAELAMVALNKLIQSYRT"
FT   gene            377096..378883
FT                   /locus_tag="Rpic12D_0363"
FT   CDS_pept        377096..378883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0363"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   rso:RSc0473 putative acyl-CoA dehydrogenase oxidoreductase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61669"
FT                   /db_xref="GOA:C6BC35"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC35"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS61669.1"
FT                   /translation="MGQYTAPLRDMQFVLHELLGVENHLKEMPQHAEIDADTINQVIEE
FT                   AGKFCSEVIFPLNQSGDREGCTYHGDGVVTAPKGFKEAYQQYVEAGWPSLGCDPEYGGQ
FT                   GLPILINNALYEMLNSANQAWTMYPGLSHGAYEALHAHGTDELKQRYLPKLVSGVWTGT
FT                   MCLTEPHCGTDLGILRTKAEPLADGSYAITGTKIFISAGEHDLAENIIHLVLARLPDAP
FT                   GGTKGISLFVVPKFIPDASGNPGERNGVKCGSIEHKMGIHGNATCVINLDGAKGWMVGE
FT                   PNKGLNAMFVMMNAARLGVGMQSLGLTEVAYQNSAAYAKERLQMRSLSGPKAPDKPADP
FT                   IIVHPDVRRMLLTQRAFAEGGRAFSYWIALQIDRELSHKDESVRKDAADLVALLTPIAK
FT                   AFLSDNAFIATNEGMQVFGGHGYIAEWGMEQYVRDARINMIYEGTNTVQSLDLLGRKIL
FT                   GDMGAKMKKFGKLVQDFVEAEGTNEAMQEFINPLADIGDKVQKLTMEIGMKAMANPDEV
FT                   GAAAVPYLRVVGHLVFSYFWARMAKIALEKQDSGDSFYKVKLATARFYFAKLLPETASQ
FT                   IRMARAGGATLMALEADLF"
FT   gene            378959..381439
FT                   /locus_tag="Rpic12D_0364"
FT   CDS_pept        378959..381439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0364"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   Enoyl-CoA hydratase/isomerase; 3-hydroxyacyl-CoA
FT                   dehydrogenase domain protein; KEGG: rso:RSc0474 putative
FT                   3-hydroxyacyl-CoA dehydrogenase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61670"
FT                   /db_xref="GOA:C6BC36"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC36"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACS61670.1"
FT                   /translation="MTRTELPTSAQPQAGQRSNFLVRRVAVLGAGVMGAQIAAHLINAK
FT                   VPVTLFDLPAKEGPKSGIALKAIENLKKLSPAPLGIKEDANLIQAANYEDDIERLRDCD
FT                   LVIEAIAERMDWKHDLYKKVAPHIAPHAIFASNTSGLSITELSDGFDAELKSRFCGVHF
FT                   FNPPRYMHLVELIPTAHTRGDILDKLETFLTSALGKGVVRAKDTPNFIANRVGIFSILA
FT                   VFAESAKYGIPFDVVDDLTGSKLGRAKSATFRTADVVGLDTMAHVIKTMQDNLKDDPFA
FT                   PVYATPPVLAKLVEAGALGQKTGAGFYKKEGKEIKVLDPQSGQYGPSGKKADDIVVRIL
FT                   KKEPAERLKLLRESTNPQAQFLWAVFRDVFHYIAVYLEQIADSAAEVDLAIRWGFGWNS
FT                   GPFEDWQEAGWKQVAEWVKEDIEAGKALSNAALPQWVFSGPVADNGGVHSTQGSWSAHQ
FT                   GTFLSRSTLPVYGRQVFRAPIKGATTVNPLTYGKTIEETDAVRIWVDDAAGQDDVLIVS
FT                   FKSKMNTIGPSVIDGLTRAVDLAEAGYKGLVVWQPTSLRLGAPGGPFSAGANLEEAMPA
FT                   FMMGGAKGIEPFVKKFQDGMMRVKYAGVPVVSAASGIALGGGCELLLHSAKRVAALETY
FT                   IGLVEVGVGLVPAGGGLKEAALAAAKAAQAAGSTNILQFLTNRFQAAAMAKVSSSALDA
FT                   QKIGYLQPTDTIVFNVHELLHVARNEVRALSDSGYRAPLRPVGIPVAGRSGIATIKASL
FT                   VNMRDGGFISQHDFTIASRIAEAVCGGDVEAGALVDEEWLLALERKAFVDLLGSAKTQE
FT                   RIMGMLQTGKPVRN"
FT   gene            381473..382672
FT                   /locus_tag="Rpic12D_0365"
FT   CDS_pept        381473..382672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0365"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="TIGRFAM: acetyl-CoA acetyltransferase; PFAM:
FT                   Thiolase; KEGG: rso:RSc0475 acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61671"
FT                   /db_xref="GOA:C6BC37"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC37"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACS61671.1"
FT                   /translation="MTKQLQDAYIVAATRSPIGKAPKGTLKNLRPDDLLATILKSAVAQ
FT                   VPNLDPALIEDAIVGCAIPEAQQGLNVARIGALLAGLPNTVGGVTVNRFCASGLTAVAM
FT                   AADRIRVGESDVMIAAGVESMSMVPMMGNSPSMSPDIFTRDENVGIAYGMGLTAEKVAQ
FT                   QWKISREAQDAFSLASHQKALAAQQAGEFKDEITPIEIIEKFPNLGTGAIDIKTRTMSL
FT                   DEGPRADTSVEGLGKLRAVFANKGSVTAGNSSQTSDGSGALILVSEKILKQFNLVPLAR
FT                   FVSFAVRGVPPEIMGIGPKEAIPAALKAGGLTQDQIDWIELNEAFAAQSLAVIQDLGLD
FT                   TSKINPLGGAIALGHPLGATGAIRAATVVHGLRRRNQKYGMVTMCVGTGMGAAGIFERM
FT                   "
FT   gene            382891..383856
FT                   /locus_tag="Rpic12D_0366"
FT   CDS_pept        382891..383856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0366"
FT                   /product="degV family protein"
FT                   /note="TIGRFAM: degV family protein; PFAM: DegV family
FT                   protein; KEGG: reu:Reut_A0449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61672"
FT                   /db_xref="InterPro:IPR003797"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC38"
FT                   /inference="protein motif:TFAM:TIGR00762"
FT                   /protein_id="ACS61672.1"
FT                   /translation="MGNTIGDTIVLTDAACDMPRSMIDQLGLGVVPFRIRAGELFVEDR
FT                   RDEAALPQLYRKYLVDKQDHYAESIPLLEREIEDFLLRHVVTQHDRALLLTIASSRSHF
FT                   YSHATGAVVGTTAKSFKPRKDAGRSGLFELTVVDTGAIGPGQALMVHEAARMLREGAEV
FT                   RDVVHVIENRLRDASHVYLVPDELLYMYTRAKQKGEKSITWGRYMMGTAFNVRPLIHMH
FT                   RGETEAIAKVRGSEEGIRRLLAHTETMIAEERLATPVVAITYSGSLDTVRRMEPVQALM
FT                   RTAQDHGVEVLLAPMSLTVALNVGANAFSVGYLSDSPVPI"
FT   gene            383883..384647
FT                   /locus_tag="Rpic12D_0367"
FT   CDS_pept        383883..384647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0367"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   rso:RSc0476 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61673"
FT                   /db_xref="GOA:C6BC39"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC39"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACS61673.1"
FT                   /translation="MSIRTETADGILTLTFDRLDRKNAITAAMYQTLADALVAAETDPA
FT                   IRVIVLAGHESVFTAGNDLEDFMKNPPKDESAPVHQFLRAISTASKPLIASVSGAAVGV
FT                   GTTMLLHCDLVYASETAKLSMPFAQLGLCPEAASSLLLPQLAGYHRAADKLLFGEPFDA
FT                   NEARELGLVNRVLPAGELDAFVRTQARKLTLLPPASLRATKRLMKEGATPQIAERMSVE
FT                   GKQFGEMLRAPEAREAFTAFFEKRRPDFSKFN"
FT   gene            complement(384711..385148)
FT                   /locus_tag="Rpic12D_0368"
FT   CDS_pept        complement(384711..385148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0368"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   rso:RSc0477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61674"
FT                   /db_xref="GOA:C6BC40"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC40"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACS61674.1"
FT                   /translation="MLPCIIMSDTQAPPETVTLPADKQPAVRVMPMPSDANVHGDVFGG
FT                   WIMSQVDIAGSIPAVVRANGRVATIAVNSFVFKQPVYVGDLVSFYANVVKTGRTSITVD
FT                   VEVYAQRMHANGRHATVKVTEATLTYVATDETRKPRVLPPL"
FT   gene            385239..387077
FT                   /locus_tag="Rpic12D_0369"
FT   CDS_pept        385239..387077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0369"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG: rso:RSc0478
FT                   ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61675"
FT                   /db_xref="GOA:C6BC41"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC41"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61675.1"
FT                   /translation="MRRFPASSEPPPPGAARGDWRTIKSLLPYLLAYKWRVALALSFLI
FT                   AAKVANLGVPMVMKRLIDSMNVSPSDPRALLVVPVGIIIGYGLLRLSTSLFSELREILF
FT                   AKVTESSVRTLALQVFRHLHALSLRFHLERQTGGMSRDIERGTRGIQSLISYSLYSILP
FT                   TLVEVGLVITYFFVKYDVWFALITFCALVSYIVFTVTVTNWRTHFRRKMNELDSRANQK
FT                   AIDSLLNFETVKYFGNEDYEARRYDENLKHYRAAAIRSQNSLSVLNFGQQFIVATALIL
FT                   ILYRATQGVAAGHMTLGDLVLVNTLMLQIYIPLNFLGVIYRELKQAVTDMDRMFNLLQT
FT                   NREVADKPDAPPLTVHAGEVRFAHVDFSYEANRQILFDVDFTIPAGTTTAVVGQSGSGK
FT                   STLARLLFRFYDVKSGAIQIDGQDLRDVTQSSVRAAIGIVPQDTVLFNDTIYYNIAYGR
FT                   PDASREEVIQAARAAQIHHFVESLPDGYETQVGERGLKLSGGEKQRVAIARTLLKRPPI
FT                   LVFDEATSALDSRTEHAIQEELMRLAQNHTTLVIAHRLSTIVRAHQILVMEHGRIIERG
FT                   THESLLRAEGRYAQMWRMQAREPERVAEETEDARAG"
FT   gene            387094..388038
FT                   /locus_tag="Rpic12D_0370"
FT   CDS_pept        387094..388038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0370"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RSc0479 putative transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61676"
FT                   /db_xref="GOA:C6BC42"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC42"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACS61676.1"
FT                   /translation="MELKWLEDFISLAETRSFSRSAELRHVTQPAFSRRIQSLEAWLGN
FT                   ELIDRSSYPTRLTPAGEVFYEQALAMLAQVSETRALMRGQRPASASTIDFAVPHTLSLT
FT                   FFPGWLAQVEEKIGKLQCRLRALNVHDAVMTLVEGGCDLVMVYHHARQMIQLDPTRYDM
FT                   LVLGTERLSPFSRPDASGRPIYRLVPTARKPIAYLSYTPNAFLGRMVDVLLENSPVAPL
FT                   LDKCYETDMAEALKVMALAGHGVAFLPESAVRDDVAAGRLVRAEGKGGGTLSIEMEIRL
FT                   YREHPQSGAHDRRHPQSKRKRELIDTLWSALAD"
FT   gene            388190..389491
FT                   /locus_tag="Rpic12D_0371"
FT   CDS_pept        388190..389491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0371"
FT                   /product="Glu/Leu/Phe/Val dehydrogenase"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   rso:RSc0480 glutamate dehydrogenase (NAD(P)+)
FT                   oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61677"
FT                   /db_xref="GOA:C6BC43"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC43"
FT                   /inference="protein motif:PFAM:PF00208"
FT                   /protein_id="ACS61677.1"
FT                   /translation="MSNVASPSTLQHAIPSYLPADNLGPWGIYLQQVDRVTPYLGSLAR
FT                   WVETLKRPKRALIVDVPIQMDDGRIAHFEGYRVQHNTSRGPGKGGVRFHQDVTLSEVMA
FT                   LSAWMSVKNAAVNVPYGGAKGGIRVDPRKLSSGELERLTRRYTSEIGIIIGPNKDIPAP
FT                   DVNTNAQIMAWMMDTYSMNEGSTATGVVTGKPIALGGSLGRREATGRGVFVVGSEAARN
FT                   LGIDVKGARIVVQGFGNVGSVAAKLFHDAGAKVIAVQDHKGIVFNGNGLDVDALIQHVD
FT                   HNGSVAGFAAETVSQDEFWALECEFLIPAALEGQLTAKNAPHIKAKIVVEGANGPTTPE
FT                   ADDILRDRGILVCPDVIANAGGVTVSYFEWVQDFSSFFWTEDEINQRLVRIMQDAFRGV
FT                   WQVAQDNKVTLRTAAFIIACTRILQARQERGLYP"
FT   gene            390014..390922
FT                   /locus_tag="Rpic12D_0372"
FT   CDS_pept        390014..390922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0372"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   rso:RSc0481 amino-acid-binding periplasmic (PBP) ABC
FT                   transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61678"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC44"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS61678.1"
FT                   /translation="MNLAKLATVVAAVGVAVGTFGSAAHAEELTGTLKKIKDTGTITLG
FT                   VRDSSIPFSYNVGGVRTIGYSYDVATKIAEDVKKQLGLKDLKVNEIPVTSQNRITLLQN
FT                   GTIDLECGSTTNNLERQKQASFTNTIFIIGTRIMVKKDSGVKDWADLKGKNVVTTAGTT
FT                   SERLLRKMNDEKQMGMNIISTKDHGQSFLTLESGRAVAFMMDDALLYGERAKAKNPADW
FT                   VVVAKPQSREAYGCMVRKDDKPFKALADKTIAGMMKDGTINAEYKKWFEQPVPPKGVNM
FT                   EFPLSDDMKALIKNPNDKALD"
FT   sig_peptide     390014..390094
FT                   /locus_tag="Rpic12D_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            391022..391750
FT                   /locus_tag="Rpic12D_0373"
FT   CDS_pept        391022..391750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0373"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rso:RSc0482
FT                   glutamate/aspartate transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61679"
FT                   /db_xref="GOA:C6BC45"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC45"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS61679.1"
FT                   /translation="MNYHWNWGVFFTEAAQNQTYLDWLLAGLKTTVVLGLSSWIIALVI
FT                   GSVLGVLRTVPNKWLSGLAAAYVEVFRNIPLIVQLFIWYFVMPELVPGGDYIKQMNPAT
FT                   AMFLCAMLCLGTFTAARVCEQVRSGINSLPRGQRNAGLAMGFTLAQTYRYVMLPMSFRI
FT                   IVPPLTSEFLNIFKNSAVASTIGLLELAAQGRQLVDYTAQPYESFIAVTLMYMLINLTV
FT                   MGLMRWVEARSRLPGFIGGK"
FT   gene            391768..392451
FT                   /locus_tag="Rpic12D_0374"
FT   CDS_pept        391768..392451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0374"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: rso:RSc0483
FT                   glutamate/aspartate transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61680"
FT                   /db_xref="GOA:C6BC46"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC46"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS61680.1"
FT                   /translation="MAYQFDFSSINVDNMRVLGEGMLLSLEITGTAILVGIVWGTLLAM
FT                   MRLSGIKPLQVFGQAYVNLFRSIPLVMVLLWFFLIVPQVLQKIFNLSPATDMRMTSALV
FT                   AFALFEAAYYSEIIRAGIQSVSRGQMFAAYAMGMTYGQAMRLVILPQAFRNMIPLLLTQ
FT                   AIVLFQDTSLVYVSALSDFFTQAYNIGERDGRIVELLLFAGLCYFVICFGASVLVKRLQ
FT                   KKVTQ"
FT   gene            392448..393182
FT                   /locus_tag="Rpic12D_0375"
FT   CDS_pept        392448..393182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0375"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RSc0484 putative glutamate/aspartate transport
FT                   ATP-binding ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61681"
FT                   /db_xref="GOA:C6BC47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC47"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS61681.1"
FT                   /translation="MIEIKNVSKWYGSFQVLTDCTTSVKKSEVVVVCGPSGSGKSTLIK
FT                   TVNALEPFQKGEIFVDGTSVGAKGTNLPKLRSRVGMVFQNFELFPHLSITENLTIAQQK
FT                   VLGRSKEEAMAKGLKYLDRVGLKAHAAKYPGQLSGGQQQRVAIARALSMDPICMLFDEP
FT                   TSALDPEMVNEVLDVMVELAKEGMTMMCVTHEMGFARKVANRVIFMDQGRIVEDCEKEE
FT                   FFGNIDARSDRAKQFLSKILSH"
FT   gene            complement(393372..394202)
FT                   /locus_tag="Rpic12D_0376"
FT   CDS_pept        complement(393372..394202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0376"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   rso:RSc0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61682"
FT                   /db_xref="GOA:C6BC48"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC48"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ACS61682.1"
FT                   /translation="MCQLLGMNCAEPTDVTFSFTGFAARGGVTDHHADGFGVAFFEDKA
FT                   CRLFIDNQSAGTSPVAELVKRYPIKSKNVISHIRKATQGTVRLENCHPFMRELWGRHWI
FT                   FAHNGDLKNFSPFLSGVYQPVGDTDSELAFCFIMQALRKRFPGSQPPLNELFYALSDIT
FT                   KEITRYGVFNFLLCNGQAQFAHCSTRLYYIVRQWPFSTAHLIDADMTIDFAKYTTPADR
FT                   VAVIATAPLTDNEVWTQFAPGELLMFESGQATMATKVPIPEAVQIANAANTACT"
FT   gene            394359..395657
FT                   /locus_tag="Rpic12D_0377"
FT   CDS_pept        394359..395657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0377"
FT                   /product="Hydroxypyruvate reductase"
FT                   /EC_number="1.1.1.81"
FT                   /note="PFAM: MOFRL domain protein; KEGG: rso:RSc0486
FT                   putative hydroxypyruvate reductase oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61683"
FT                   /db_xref="GOA:C6BC49"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC49"
FT                   /inference="protein motif:PRIAM:1.1.1.81"
FT                   /protein_id="ACS61683.1"
FT                   /translation="MKLDRTAARALLLESYAAAVGAADPLKIVADFLPPPHAVGKTLVV
FT                   GAGKAAASMALAVEQAYAGRAQIEGLVVTRYAHGLPTEHIRVIEAGHPVPDEAGEQAAQ
FT                   EILDRVCALTERDRLIVLVSGGGSSLLSLPAEGIPMADLKAVTRELLRCGAPITDMNIV
FT                   RKHLSRIQGGRLAAASRAPVTTLIVSDVAGDDPSAIASGPTVPDASTYADALAIIKRWG
FT                   AQIPDTVRAHLERGARGEIAETPKPGDACFARVTNHVIATAQQSLQAGAQVFATRGIHT
FT                   AILGDTVTGEAREVAQVYGALARQVRQHGTPFVAPVALISGGECTVTIPPGLTGGRGGR
FT                   CAEFLLSLGVTLEDMDNVYALAADTDGIDGSEDNAGALLDPESIARAAANGVGARAALD
FT                   AHDAYGFFAAAHDLIVTGPTRTNVNDYRVILIL"
FT   gene            395691..396725
FT                   /locus_tag="Rpic12D_0378"
FT   CDS_pept        395691..396725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0378"
FT                   /product="dihydroorotase, homodimeric type"
FT                   /EC_number="3.5.2.3"
FT                   /note="KEGG: rso:RSc0487 dihydroorotase; TIGRFAM:
FT                   dihydroorotase, homodimeric type; PFAM: amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61684"
FT                   /db_xref="GOA:C6BC50"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC50"
FT                   /inference="protein motif:TFAM:TIGR00856"
FT                   /protein_id="ACS61684.1"
FT                   /translation="MTDTLTIVRPDDWHLHLRDGDALADVVGDTARQFGRAIIMPNLKP
FT                   PVTTTAQARAYRERILAALPAGTQFEPLMTLYLTDNTSPEVIREAKASGFIHGVKLYPA
FT                   GATTNSDAGVTDLRRCAKTLEAMQEVGMPLLVHGEVTDPTVDIFDREAVFIDTVMLPLR
FT                   RDFPALKVVFEHITTKHAAEYVRDAEGPVGATITAHHLLYNRNALFVGGIRPHYYCLPV
FT                   LKRETHRLALVAAATSGHPRFFLGTDSAPHAKGVKEHACGCAGCYTALHAMELYAEAFE
FT                   DANALDKLEGFASLHGPDFYGLPRNAGTLTLTRSQWQLPAEVPFGEQTLVPLRGGEMLR
FT                   WKSV"
FT   gene            396733..397530
FT                   /locus_tag="Rpic12D_0379"
FT   CDS_pept        396733..397530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0379"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0488 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61685"
FT                   /db_xref="GOA:C6BC51"
FT                   /db_xref="InterPro:IPR021390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC51"
FT                   /inference="similar to AA sequence:KEGG:RSc0488"
FT                   /protein_id="ACS61685.1"
FT                   /translation="MECLGAIDWSHPAFAPLAAVGAPLAEAISRGADLRDALNAQPAAQ
FT                   AIRTCSGHALRFVPQDALPAGAAYEAHIAATGQVPTRDNLHDFFNALIWLHWPRAKAAL
FT                   NARQARAITQDGIGAARGTVRDAATLFDENALIFVHTEDAPERCLTGFDWRGLFVEGRA
FT                   AWGATCAVLPFGHAVLEKLVAPYKSITAHAWPVRVAALPANRPSLDAALAATLLHADLA
FT                   PGNFRPLPVMGIPGWCDANEDAGFYLDTSVFRPGRRRFLPEQC"
FT   gene            397594..397869
FT                   /gene="rnpB"
FT                   /locus_tag="Rpic12D_R0002"
FT   ncRNA           397594..397869
FT                   /gene="rnpB"
FT                   /locus_tag="Rpic12D_R0002"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam
FT                   (RF00010), score 178.53"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            complement(397887..398333)
FT                   /locus_tag="Rpic12D_0380"
FT   CDS_pept        complement(397887..398333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0380"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: rso:RSc0489
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61686"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC52"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACS61686.1"
FT                   /translation="MDCTVSWTGPDGMAFLAETGSGHLVTMDGAPDGGGRNLAPRPMEM
FT                   VLLGTGGCTAYDVVLILKRGRQDVQGCSVKLHADRAETDPKVFTRIHFTFTVTGRNLKR
FT                   ETVERAVQLSHEKYCSASIMLAKTAEITHSLELVDLATQPTASE"
FT   gene            399034..399462
FT                   /locus_tag="Rpic12D_0381"
FT   CDS_pept        399034..399462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0381"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: rso:RSc0490 50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61687"
FT                   /db_xref="GOA:C6BC53"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC53"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ACS61687.1"
FT                   /translation="MKTFSAKPHEVKRDWYVIDATDKVLGRVASEVAHRLRGKHKPEFT
FT                   PHVDTGDFIIVINAAKLRVTGAKTTDKKYYRHSGYPGGIYETTFGKMQQRFPGRALEKA
FT                   VKGMLPKGPLGYAMIKKLKVYAEGSHPHEAQQPKALEI"
FT   gene            399475..399867
FT                   /locus_tag="Rpic12D_0382"
FT   CDS_pept        399475..399867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0382"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: rso:RSc0491 30S
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61688"
FT                   /db_xref="GOA:C6BC54"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC54"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ACS61688.1"
FT                   /translation="MIGNWNYGTGRRKSAVARVFIKSGKGDIIVNGKAINEYFARETSL
FT                   MIVRQPLELTNHAATFDIKVNVVGGGETGQAGAVRHGITRALIDYDATLKPALSKAGLV
FT                   TRDAREVERKKVGLRKARRAKQFSKR"
FT   gene            400098..400853
FT                   /locus_tag="Rpic12D_0383"
FT   CDS_pept        400098..400853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61689"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC55"
FT                   /inference="similar to AA sequence:KEGG:RSc0492"
FT                   /protein_id="ACS61689.1"
FT                   /translation="MKARRLLRRASVLAPNVTVRSRLPWPVTVLLVAVVLGLAAAAALW
FT                   AFEEGRRLTGPHDADLRAMNRELAAKLAAVQAERDKLSASAGTVDARLGIAEGAQAQMA
FT                   EQLKALETENAQLKEDLAFFDSLLPAPTNSAGIYVRSFRIAPDEAQPTRMRFRVLLMQG
FT                   GGKAFAPVSEFEGQLALTLNVVQGGKPATIDFPGAAASGSPATSARVKLTHYQRLEGWV
FT                   DVPPGATVQSVMVKVLQNGKIKASQSFSI"
FT   sig_peptide     400098..400238
FT                   /locus_tag="Rpic12D_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.840 at
FT                   residue 47"
FT   gene            400897..401301
FT                   /locus_tag="Rpic12D_0384"
FT   CDS_pept        400897..401301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0384"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   rso:RSc0493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61690"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC56"
FT                   /inference="protein motif:PFAM:PF04519"
FT                   /protein_id="ACS61690.1"
FT                   /translation="MLFGKKKGLAIETLLGARTKLEGDLRFSGGLRIDGEIKGNIYGDP
FT                   DKPSMLVITDSARVEGEVHVGHLILNGTVVGPVHVAELLELQPKARIEGNVQYAALEMH
FT                   QGAVVMGTLTHAAPGDVKLLPNLKLASNQD"
FT   gene            401428..401802
FT                   /locus_tag="Rpic12D_0385"
FT   CDS_pept        401428..401802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0385"
FT                   /product="iron-sulfur cluster assembly accessory protein"
FT                   /note="TIGRFAM: iron-sulfur cluster assembly accessory
FT                   protein; PFAM: HesB/YadR/YfhF-family protein; KEGG:
FT                   rso:RSc0494 iron-sulfur cluster insertion protein ErpA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61691"
FT                   /db_xref="GOA:C6BC57"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC57"
FT                   /inference="protein motif:TFAM:TIGR00049"
FT                   /protein_id="ACS61691.1"
FT                   /translation="MNAVAQAATPDVNEVPAPLVFTDSAADKVKQLIEEEGNPELKLRV
FT                   FVQGGGCSGFQYGFTFDEETNEDDTTMTKNGVSLLIDSMSYQYLVGAEIDYKEDINGAQ
FT                   FVIKNPNASTTCGCGSSFSV"
FT   gene            complement(401868..403022)
FT                   /locus_tag="Rpic12D_0386"
FT   CDS_pept        complement(401868..403022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0386"
FT                   /product="protein of unknown function UPF0075"
FT                   /note="PFAM: protein of unknown function UPF0075; KEGG:
FT                   rso:RSc0495 anhydro-N-acetylmuramic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61692"
FT                   /db_xref="GOA:C6BC58"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC58"
FT                   /inference="protein motif:PFAM:PF03702"
FT                   /protein_id="ACS61692.1"
FT                   /translation="MSHPNHTALSTDRYIGLMSGTSLDGVDGVLADFSGETPTVLADAY
FT                   VPFSPELRQRFLDLQHAGHDEIHREALAANALAMAYADCVARLLAATGLAAQDVRAIGA
FT                   HGQTIRHQPGTHDGIGYTRQTQHPAVLAERTGIDVIADFRSRDIAAGGQGAPLVPALHR
FT                   ALFGLPDAWRVVCNIGGIANLTILPPQASNARDAVLGFDCGPGNALMDYWVHMHRDTRY
FT                   DADGAWARSGHVDEMLLARLKAEPFFAALPPKSTGRDLFNPAWLQQILGDALNTARPED
FT                   VQATLLALTADTITDAVHTHAAQAASLLVCGGGARNGALMARIAQQLPGVQVAPTEVFG
FT                   VPAHQVEALAFAWLARQCLLRAHGNLHTATGASGGRILGAIYPA"
FT   gene            403198..404463
FT                   /locus_tag="Rpic12D_0387"
FT   CDS_pept        403198..404463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0387"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /note="KEGG: rso:RSc0496 tyrosyl-tRNA synthetase; TIGRFAM:
FT                   tyrosyl-tRNA synthetase; PFAM: aminoacyl-tRNA synthetase
FT                   class Ib; RNA-binding S4 domain protein; SMART: RNA-binding
FT                   S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61693"
FT                   /db_xref="GOA:C6BC59"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC59"
FT                   /inference="protein motif:TFAM:TIGR00234"
FT                   /protein_id="ACS61693.1"
FT                   /translation="MTAPATSAASDNATPGKPKYPVTLEVAHAMEVSLRGCDELLIAAE
FT                   WEQKLAKSAATGVPLRIKLGLDPTAPDIHIGHTVVLNKMRQLQDLGHQVIFLIGDFTST
FT                   IGDPSGRNATRPSLTREQIETNAQTYYRQASMVLDPSKTEIRYNSEWCDPLGARGIIQL
FT                   AAKYTVARMMERDDFTKRYKAGVPISVHEFLYPLMQGYDSVALKSDLELGGTDQKFNLL
FT                   VGRELQKEYGQEPQCILTMPLLVGLDGVEKMSKSKGNYVGISEAPNEMFGKLMSISDDL
FT                   MWTYYTLLSFRPLAEIDLMKQEIALGRNPRDCKVMLAQEIVARFHSQADAERALEDFNH
FT                   RARGGVPDDIPQIELSGAPLGIAQLLKQAGLCPSTSDANRNIEQGGVKIDGTVISDKGL
FT                   KVEAGTFVMQVGKRRFARVVLK"
FT   gene            404460..404972
FT                   /locus_tag="Rpic12D_0388"
FT   CDS_pept        404460..404972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0388"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="TIGRFAM: D-tyrosyl-tRNA(Tyr) deacylase; PFAM:
FT                   D-tyrosyl-tRNA(Tyr) deacylase; KEGG: rso:RSc0497
FT                   D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61694"
FT                   /db_xref="GOA:C6BC60"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC60"
FT                   /inference="protein motif:TFAM:TIGR00256"
FT                   /protein_id="ACS61694.1"
FT                   /translation="MIGLIQRVSEAAVRVDGRVVGEIGPGLLALVCAERGDTAAEADRL
FT                   LEKLLNYRVFSDAQGKMNLPVRNIDGNGQAGGLLVVSQFTLAADTKSGTRPSFTPAAPP
FT                   EDGRRLYEHFVARARAQHPIVATGEFGADMKVSLVNDGPVTFWLQVAPQAAASAAKTAT
FT                   PDVAKSV"
FT   gene            404992..405672
FT                   /locus_tag="Rpic12D_0389"
FT   CDS_pept        404992..405672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0389"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: rso:RSc0499
FT                   putative phosphoglycerate mutase 2 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61695"
FT                   /db_xref="GOA:C6BC61"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC61"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACS61695.1"
FT                   /translation="MPRAAAIPLPMLQITHIVLIRHGETDWNRERRLQGQLDVPLNTQG
FT                   LEQAAQLGKALARERFDAVYASDLSRAKQTARALADEVGVPVRDDAGLRERCYGQFEGL
FT                   TYAEVAARHPDDFDAWQNRVPEFAPPGGETLTEFHERAVETALRLIRRHPGERIALVSH
FT                   GGVLDCLYRHANAMTLTEPRQHELRNASINRLSSDGHQLTVLQWGDVAHLDLLVLDEVD
FT                   RRVP"
FT   gene            complement(405669..406385)
FT                   /locus_tag="Rpic12D_0390"
FT   CDS_pept        complement(405669..406385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   protein of unknown function DUF165; KEGG: cti:RALTA_A0450
FT                   putative membrane lipoprotein, DUF165"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61696"
FT                   /db_xref="GOA:C6BC62"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC62"
FT                   /inference="protein motif:TFAM:TIGR00697"
FT                   /protein_id="ACS61696.1"
FT                   /translation="MSAAPHHPNRTFRYYDFIMAAFVTVLLCSNLIGASKAAQVTLPVL
FT                   GSVTFGAGVLFFPISYIFGDILTEVYGYGRDRRVVWAGFAALIFASFMSLVVLALPVAP
FT                   FMAGYQKSLNDVFGNTPRIVAGSLIAFWCGSFANSYTLAKMKIATEGKWLWTRIVGSTV
FT                   VGEAVDSSLFYVIAFYGIWPHEQVLRVAIAQYILKTGWEIVATPLTYRVVAFLKRAENE
FT                   DYYDRDTNFTPFRLKV"
FT   sig_peptide     complement(406272..406385)
FT                   /locus_tag="Rpic12D_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.732) with cleavage site probability 0.649 at
FT                   residue 38"
FT   gene            complement(406403..407476)
FT                   /locus_tag="Rpic12D_0391"
FT   CDS_pept        complement(406403..407476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0391"
FT                   /product="Holliday junction DNA helicase RuvB"
FT                   /note="KEGG: rso:RSc0500 Holliday junction DNA helicase B;
FT                   TIGRFAM: Holliday junction DNA helicase RuvB; PFAM: AAA
FT                   ATPase central domain protein; Holliday junction DNA
FT                   helicase RuvB domain; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61697"
FT                   /db_xref="GOA:C6BC63"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC63"
FT                   /inference="protein motif:TFAM:TIGR00635"
FT                   /protein_id="ACS61697.1"
FT                   /translation="MIETDKLAAKAVSAERIISASPASPNEEAFERALRPKLLDEYVGQ
FT                   EKVRGQLDIFMTAAKNRSEALDHVLLFGPPGLGKTTLAHIIAREMGVNLRQTSGPVLER
FT                   PGDLAALLTNLEANDVLFIDEIHRLSPVVEEILYPALEDYQIDIMIGEGPAARSVKLDL
FT                   QPFTLVGATTRAGMLTNPLRDRFGIVARLEFYTPAELAKIVTRSSGLLNAHIVDEGALE
FT                   IAKRSRGTPRIANRLLRRVRDFAEVKADGIITREVADAALAMLDVDAVGFDLMDRKLLE
FT                   AILHKFNGGPVGIDNLAAAIGEERDTIEDVLEPYLIQQGYLQRTPRGRVATASAYQHFG
FT                   LGAPKSGPVRDLWDDNQ"
FT   gene            complement(407541..408122)
FT                   /locus_tag="Rpic12D_0392"
FT   CDS_pept        complement(407541..408122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0392"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="KEGG: rso:RSc0501 Holliday junction DNA helicase
FT                   motor protein; TIGRFAM: Holliday junction DNA helicase
FT                   RuvA; PFAM: DNA recombination protein RuvA domain I; RuvA
FT                   domain protein; SMART: Helix-hairpin-helix DNA-binding
FT                   class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61698"
FT                   /db_xref="GOA:C6BC64"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC64"
FT                   /inference="protein motif:TFAM:TIGR00084"
FT                   /protein_id="ACS61698.1"
FT                   /translation="MIGRIAGTLIEKNPPHLLVDCHGVGYEIDVPMSTFYNLPATGEKV
FT                   VLLTQQIVREDAHLLYGFGTAAERETFRQLIKISGIGARIALAVLSGMSVAELAQAVTL
FT                   QEAGRLTRIPGIGKKTAERLLLELKGKLGADLGAVPGGPAVSDDAVDVLNALLALGYSD
FT                   KEAALAIKQVPAGTGVSEGIKLALKALSKG"
FT   gene            complement(408223..409362)
FT                   /locus_tag="Rpic12D_0393"
FT   CDS_pept        complement(408223..409362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0393"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: rso:RSc0502 putative glycerophosphoryl diester
FT                   phosphodiesterase, periplasmic precursor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61699"
FT                   /db_xref="GOA:C6BC65"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC65"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACS61699.1"
FT                   /translation="MPRRLILPTLLILSTSVALSACRLEYHHGSGGGGNTTPIATLQVI
FT                   GHRGASALRPEHTLASYQKAIDDGADIIEPDLVSTKDGVLVARHENEISGTTNVADVAA
FT                   FSGRRTTKTIDGQSVTGWFTEDFTLGELKTLRARERIPSIRPDNVAYNDQFDIPTLDEI
FT                   IALARDQSAKLGRNIGIYPETKHPTYFQSIGLPLEDRLIDGLRRDAFTASRTTVYIQSF
FT                   EVANLKAIRNKIGGSQPNWKLVQLMGTSGRQPYDFVVAKDSRTFGDMMTSQGMRDIAAY
FT                   ANGVGPDKSSIMGLDANGKLTDPTDLIRNAHNAGLIVHPYTFRPENTFLPPSLRSGADN
FT                   TRNVNGSITEIQAFLRAGVDGFFTDDPAVGRQAVSTFKR"
FT   sig_peptide     complement(409297..409362)
FT                   /locus_tag="Rpic12D_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.700 at
FT                   residue 22"
FT   gene            complement(409442..409987)
FT                   /locus_tag="Rpic12D_0394"
FT   CDS_pept        complement(409442..409987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0394"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number="3.1.22.4"
FT                   /note="KEGG: rso:RSc0503 Holliday junction resolvase;
FT                   TIGRFAM: crossover junction endodeoxyribonuclease RuvC;
FT                   PFAM: Crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61700"
FT                   /db_xref="GOA:C6BC66"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC66"
FT                   /inference="protein motif:TFAM:TIGR00228"
FT                   /protein_id="ACS61700.1"
FT                   /translation="MRILGIDPGLRTTGFGVLERHGHKLVYVASGTIKSNGNADLPSRL
FT                   KTLYDGVSELVSTYRPDCASIEKVFVNVNPQSTLLLGQARGAVICGLMSGNLPVFEYTA
FT                   LQLKQAVVGYGRANKDQVQEMVVRLLNLAGRPGADASDALGVAICHAHGGETLAAMAGL
FT                   APQLAQKGLRVRRGRLVG"
FT   gene            complement(410071..411645)
FT                   /locus_tag="Rpic12D_0395"
FT   CDS_pept        complement(410071..411645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0395"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /note="KEGG: rso:RSc0504 bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein; SMART: AICARFT/IMPCHase bienzyme formylation
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61701"
FT                   /db_xref="GOA:C6BC67"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC67"
FT                   /inference="protein motif:TFAM:TIGR00355"
FT                   /protein_id="ACS61701.1"
FT                   /translation="MIQQALLSVSDKTGIVDFARALHERGVKLLSTGGTAKLLAESGLP
FT                   VTEVADYTGFPEMLDGRVKTLHPKVHGGILARRDLPEHMAALSEHSIPTIDLLVVNLYP
FT                   FQQTVAKDECTLVDAIENIDIGGPTMLRSAAKNHRDVTVIVDPADYATVLAEMQANNNT
FT                   VGYETNFMLAKKVFAHTAQYDGAITNYLTSLGADKSHSTRSAYPQTLNLAFEKVQEMRY
FT                   GENPHQSAAFYRDLKAVDGALANYTQLQGKELSYNNIADADAAWECVKSFDPAKGAACV
FT                   IIKHANPCGVAIGVTAQEAYEKAFKTDSTSAFGGIIAFNVPLDDAAAQVVAKQFVEVLI
FT                   APGFSEGARAVFAGKQNVRVLEIPLGKGVNAFDFKRVGGGLLVQSPDAKNVQPSELRVV
FT                   TKRHPTPKEMDDLMFAWRVAKFVKSNAIVFCGGGMTLGVGAGQMSRVDSARIASIKAQN
FT                   AGLTLAGSAVASDAFFPFRDGLDVVVDAGASCVIQPGGSVRDDEVIAAADERNVAMIFT
FT                   GTRHFRH"
FT   gene            complement(411742..411975)
FT                   /locus_tag="Rpic12D_0396"
FT   CDS_pept        complement(411742..411975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0396"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix Fis-type; KEGG: rso:RSc0505
FT                   DNA-binding protein fis"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61702"
FT                   /db_xref="GOA:C6BC68"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC68"
FT                   /inference="protein motif:PFAM:PF02954"
FT                   /protein_id="ACS61702.1"
FT                   /translation="MSRNPIERCIRDSLDAYYRDLDGENPSNVYDMVLQAIERPLLETV
FT                   MEWASNNQSQAADYLGINRNTLRKKLQQHGLI"
FT   gene            complement(411972..413039)
FT                   /locus_tag="Rpic12D_0397"
FT   CDS_pept        complement(411972..413039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0397"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: rso:RSc0506 NifR3-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61703"
FT                   /db_xref="GOA:C6BC69"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC69"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ACS61703.1"
FT                   /translation="MQIGPHTLRNNLFVAPMAGVTDRPFRQLCKRLGAGYAVSEMVASN
FT                   AQLWKSEKTMRRANHTGEVEPIAVQIAGAEPMMMAEAARYNVDRGAQIIDINMGCPAKK
FT                   VCNVAAGSALLQNEPLVQRIVEAVVGAVGDRVPVTLKIRTGWDREHRNALSVARIAQDA
FT                   GISMLTVHGRTRADLYHGEAEYDTIAAVKASVRIPVVANGDITTPAKAKHVLAVTGADA
FT                   IMIGRAAQGRPWLFREIEHFLQTGTLLPAPEVEEIRGIMNAHLEEHYAFYGEYTGVRTA
FT                   RKHIAWYTRGLAGANLFRHRMNTIEDTVAQLAAVNAFFDEQRALSDRLVYEDQATGGDH
FT                   PTTGNNDNNKELLAA"
FT   gene            complement(413235..414518)
FT                   /locus_tag="Rpic12D_0398"
FT   CDS_pept        complement(413235..414518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0398"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rso:RSc0507 amino acid dehydrogenase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61704"
FT                   /db_xref="GOA:C6BC70"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC70"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACS61704.1"
FT                   /translation="MATPEGCAAGDRHQITVIGAGIVGTACALQLQRDGHQVTLLDQAG
FT                   IGEGCSFGNAGCLSVASVVPMALPGMLKQVPKWLADPMGPLTVRWPYLPRALPWLLQWV
FT                   FAGNETQARATAQPLANLFGATFPDYRNLLDAAQYDSLIRQTGHLYVWRTLARSSGDVL
FT                   AQSIRDATGVRSQALSAGEARELEPALAADIQSGLLLPDNGFTINPEQLVKTLAANFMA
FT                   AGGTFLRRKVLDVEFGRSDYGGPTRLHTDCGTLPLSKLVLCAGAWSMRLGAKLTSIRIP
FT                   LDTERGYHATLRAPSVQPSRPIMDCERKFIATPMEGGLRIAGTVEIGGLDAAPDYRRAR
FT                   ILMRQGQQLFPGLGFTDDSQWMGHRPSLPDSLPVIDRSERYRNVFFAFGHGHLGMTGAP
FT                   GTARLIADLVSERTPFIDGRPYGLQRFR"
FT   gene            complement(414522..415757)
FT                   /locus_tag="Rpic12D_0399"
FT   CDS_pept        complement(414522..415757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0399"
FT                   /product="2-polyprenyl-6-methoxyphenol 4-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenyl-6-methoxyphenol 4-hydroxylase;
FT                   Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6
FT                   family; PFAM: monooxygenase FAD-binding; KEGG: rso:RSc0508
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61705"
FT                   /db_xref="GOA:C6BC71"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC71"
FT                   /inference="protein motif:TFAM:TIGR01984"
FT                   /protein_id="ACS61705.1"
FT                   /translation="MTGSITANSAAPEFDVAIVGAGPVGLALANWLLRDTDLRIALFDA
FT                   RDAEAAARDPRALALSHGSRVLLQEIGGWPTRATPITHIHVSQRGHFGQAHIRREDYDV
FT                   PALGHVVQYGDLSAALNAALDTQMERHPGRLTRYDHTPVERVEQLPRADGTVAPARVRA
FT                   LREGRHPLAIETEVVIQAEGGLFDDARKQQRGIAQARRRDYGQTAIVAHVRCSAPLEGW
FT                   AWERFTPEGPLALLPQDDAQGPGYALVWCCAPDEARRRAALPDDAFLAELGAAFGERMG
FT                   RFTHASPRHTFALGLHAQRIPVDRRVAAIGNAAQTIHPVAGQGFNLGLRDAFEMARALR
FT                   EGATAATLARFARERAFDRAVTIGLTDLLPRAFAVPGRPFGHLRGAALTLLECLPPLKH
FT                   GLARQMMFGQRG"
FT   gene            complement(415754..417142)
FT                   /locus_tag="Rpic12D_0400"
FT   CDS_pept        complement(415754..417142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0400"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; peptidase M24B X-Pro
FT                   dipeptidase/aminopeptidase domain protein; KEGG:
FT                   rso:RSc0509 Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61706"
FT                   /db_xref="GOA:C6BC72"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC72"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ACS61706.1"
FT                   /translation="MSATELAFLQTYRQRRERVVQWLRTASGSRGGVAIVPTAPEAMRN
FT                   RDSDYPYRHDSYFYYLTGFTEPEAVLAIVVPAGNAPARSVLFCRPKHEEREIWDGFRFG
FT                   PEAAKDAFGLDEGHSVEDIDATLPKLLANAGAVAYPLAESSAFDRRMRRWLDAVRMQGR
FT                   AGVSSPHQALDVRAILDEMRLFKDASELDIMRRAGRISAGAHVRAMQASRAGLREYHLE
FT                   AELLYEFRRHGAQSVAYNSIVATGPNACVLHYRAGNAELRDGDLCLIDAGCELDGYASD
FT                   ITRTFPVNGRFTGPQRELYELVVAAQEAALAQTRPGVPYNVPHDAATRVLAQGMLDTGL
FT                   LDANKVGTLDDVIAGGQYRQFYMHRTGHWLGMDVHDVGEYRTPGTVAPAEGERPWRPLE
FT                   AGMVLTVEPGIYVRPAPGVPEQYWHIGIRIEDDAIVTPEGCEIITRDVPVAPDEIELVM
FT                   RSRA"
FT   gene            417368..419431
FT                   /locus_tag="Rpic12D_0401"
FT   CDS_pept        417368..419431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0401"
FT                   /product="diguanylate cyclase/phosphodiesterase with MHYT
FT                   sensor"
FT                   /note="KEGG: rso:RSc0510 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: EAL domain protein; GGDEF domain
FT                   containing protein; MHYT domain protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61707"
FT                   /db_xref="GOA:C6BC73"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC73"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS61707.1"
FT                   /translation="MLASSYNPLLVLLSLFVAILASYTALDMAGRVVTAQGQGRAALWW
FT                   LIGGASAMGLGIWSMHFVGMLALNLPIPVGYDVDITLTSLAIGIGASIFALWLVSRREL
FT                   PWPRLAGGAVLMGAGVAGMHYTGMVALRMNPGIQYDPARFVLSIVIAVLASGVALWMAF
FT                   RLRQQSRRVRALRAGSAVVMGVAIVGMHYVGMAAAAFPYGSVCGAAHTGASAEWLALVI
FT                   IIVTLAVLAIALIISVLDLRMEARTALLANSLAAANKELAYLALHDNLTKLSNRVLLED
FT                   RLTQAIRTADREKRRFAVMFMDLDGFKAVNDVYGHHVGDLLLIDVAQRIGARVRQQDTV
FT                   ARVGGDEFVVLAYVDDPEDAGTLADALLEVVREPFMAGGHELRVSTSIGIAVYPGDGGN
FT                   QHDLLTNADAAMYHAKGLGRNAYSFFEPSMNADVHQQLQLVQDLRRAVERHELVLHYQP
FT                   KFNAPNGPIMGVEALVRWQHPQRGLVPADEFIPLAEKTGLIVPLGAWVLDEACRQMAQW
FT                   QREGHSGWSVAVNLSALQFGHAALIDTVRETLARHALDPRSLMLEITESTAMRDVDASL
FT                   QILQQLDAMGVRISIDDFGTGYSSLLYLKRLPASELKIDRGFVRDLAHDTEDAAIVSAI
FT                   VALGQTLNLRIVAEGVETAEQQAFLTRLGCHSLQGYLLGRPMTAESLSAAMA"
FT   sig_peptide     417368..417442
FT                   /locus_tag="Rpic12D_0401"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.307 at
FT                   residue 25"
FT   gene            complement(419436..420140)
FT                   /locus_tag="Rpic12D_0402"
FT   CDS_pept        complement(419436..420140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0402"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG: rso:RSc0511
FT                   putative mannose-1-phosphate guanyltransferase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61708"
FT                   /db_xref="GOA:C6BC74"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC74"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ACS61708.1"
FT                   /translation="MTRAMIFAAGRGDRMRPLTDHTPKPLLTVGGKPLIVWQIERLAAA
FT                   GVRDIVINHAWLGAQIETALGDGSAWGVRLAYSPEGQALETAGGVAQAMPLLHAGDGHS
FT                   VFIAVSGDVFCDYDYALLRDRAPAMAAQAAPGMHLVMVPNPPYHLRGDFALDNEGMLHT
FT                   EGAERLTFGNIGLYDTRLFAGIAPGTRLAMTPLYHQAIAEGRATGERFDGRWENVGTPA
FT                   QLAALDAEIASR"
FT   gene            complement(420146..420472)
FT                   /locus_tag="Rpic12D_0403"
FT   CDS_pept        complement(420146..420472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0403"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   rso:RSc0512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61709"
FT                   /db_xref="GOA:C6BC75"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC75"
FT                   /inference="protein motif:PFAM:PF05437"
FT                   /protein_id="ACS61709.1"
FT                   /translation="MKALILFGVLLIAGAATYLIRLSFIALEGRMNLPMWFRSALPYVP
FT                   AAMLTALIAPDLLMRDGALAVSIDNPRLLAGIVAIVIARVTKSAMWTIVGGMAVLLILM
FT                   KVMA"
FT   gene            complement(420469..421197)
FT                   /locus_tag="Rpic12D_0404"
FT   CDS_pept        complement(420469..421197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0404"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: rso:RSc0513
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61710"
FT                   /db_xref="GOA:C6BC76"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC76"
FT                   /inference="protein motif:PFAM:PF03591"
FT                   /protein_id="ACS61710.1"
FT                   /translation="MASPRTVEFRAGMLALAPMLLGVVPFGMIYGVLATAAGMPAWLAV
FT                   AMSAIVFGGASQMILVQLWAGGAPALVIAATVSMVNLRHALYSASIAPALAHLPRRWKW
FT                   LIAYLLTDEAFAAMNRRVVTAQPGSEEAAYRHWYFLGAGVALWSSWQASTIVGVLLGAQ
FT                   VPTSWPLDFFLPLTFIAIVVPALRTRAQLAAALAGAALAVAWTGWPHKLGLMSAACVGI
FT                   AVGALVERLLARPSDKGAAA"
FT   sig_peptide     complement(421087..421197)
FT                   /locus_tag="Rpic12D_0404"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.874 at
FT                   residue 37"
FT   gene            complement(421197..422270)
FT                   /locus_tag="Rpic12D_0405"
FT   CDS_pept        complement(421197..422270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0405"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   rso:RSc0514 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61711"
FT                   /db_xref="GOA:C6BC77"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC77"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACS61711.1"
FT                   /translation="MASTPGAAAGATDARLSQLRDWLGTLPAADGLRIDTLQPASADAS
FT                   FRRYFRLDSAVSGKPGTLVVMDAPPPQEDCRPFVHVAGLLNGAGVRAPQVLEQDLAQGF
FT                   LLLTDLGPQTYLQSLRERDFDLAYANTLFRPAIHTLVRWQLASREGELPPYDEALLRRE
FT                   LSLFPDWYVDRHLQRPLDATQRESLDKVFKLLVDSALAQPRVYVHRDYMPRNLMINAAD
FT                   PSQPGVLDFQDAVYGPITYDAASLLRDAFLSWDEEQELDWAVRYWEAARAAKLPVDEDF
FT                   GEFYRALEWMGAQRHLKVAGIFARLCYRDGKTGYVEDTPRFIAYLRRVCSRYNALAPLA
FT                   RLLDQLEDRTQQIGYTF"
FT   gene            422447..424888
FT                   /locus_tag="Rpic12D_0406"
FT   CDS_pept        422447..424888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0406"
FT                   /product="Organic solvent tolerance protein"
FT                   /note="PFAM: Organic solvent tolerance protein; OstA family
FT                   protein; KEGG: rso:RSc0515 organic solvent tolerance
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61712"
FT                   /db_xref="GOA:C6BC78"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC78"
FT                   /inference="protein motif:PFAM:PF04453"
FT                   /protein_id="ACS61712.1"
FT                   /translation="MTEPNRARKNRQRAAVAAPDQRPADLATIRRGTLALRPLVFAVAG
FT                   VWTATSAAQSAGTTQATAPAVTPASSVTALATSGPTTPGGSPLVPKMAEPVQRPDNTVP
FT                   TFTAADKMDGRTNEDIHLRGHGELRRNGSVLKGDTLDYNQDTDVATATGNVRLFKGGTL
FT                   VTGPDAKLKITANEGTISTPSYEFHSNGGHGTADRIDFIDKDNSRITRGTYTTCSPDNV
FT                   DWYFSASRIDIDSDRQVGTGRNGVLHFFGVPVFAAPVMDFPLNDDRRSGFLAPVFGYNS
FT                   RSGADVTLPYYFNIAPNRDLTLYPRLLSQRGLQLGAEYRYLGTSYSGVLRGEFLPDDRE
FT                   AGRNRWSISAAHAQRLAPGLTGYINYNKVSDNTYPDDLGRSIVTATQRQYVQEGGVTYS
FT                   IGDWVAVARVQKFQTLSTATTPLSAPYERVPELSLTYNRYDVGGFDINFLTDYTRFSIP
FT                   TANTVQGERLFMQPTISYPIVRPGWYVTPKFILNTTAYRLDRPTGDTQDTQINRTLPTF
FT                   SLDSGMTFERDAPLVSKLFGVSYIQTLEPRVFYVYTPYRDQSQIPLFDTGQSDYNLGQI
FT                   FTENPYTGYDRIADNNKVTAGVTTRFIEAESGIERLRATIAQRIDLDGQRVTLAGAAPA
FT                   SVRRYSDLLGATTIQMFRGIFFDTNLQYNQDLDRIMRSTVAFSWKPEANKVINLGYRYY
FT                   RQDANTGQLPLEQADISTQWPITRRLYGLGRIGYDLDARKPSDMLLGLEYVADCWVGRL
FT                   AVQRYSNAVSGYTTHIFAQIEFKGLSKVGNNPIDVIRLNVPGYQPVTAQPITPSVLDQY
FT                   E"
FT   gene            424881..426383
FT                   /locus_tag="Rpic12D_0407"
FT   CDS_pept        424881..426383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0407"
FT                   /product="SurA domain protein"
FT                   /note="PFAM: SurA domain; PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase; KEGG: rso:RSc0516 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61713"
FT                   /db_xref="GOA:C6BC79"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR023034"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C6BC79"
FT                   /inference="protein motif:PFAM:PF09312"
FT                   /protein_id="ACS61713.1"
FT                   /translation="MNNDIMAFQSTAFATRVASLGRLRVATGVLLALLAGTTLSPAVHA
FT                   QQAQSAKKSAPVRGIFANPGSSPSQPLLQGTLPEPTAPGAPRSQLVDEVVAVVNTDVIT
FT                   RRELLNRADLVERTFRAQNRPLPPRADLLGEVLEQLILERVQAQTAKESGIRVSDADVD
FT                   RAVESVAQRNNLSVPQLKSKLKDAGMTYDKYRDDLRQEILLARLREREVDSKVQVYDGE
FT                   IDNYLAQQGGGTAPAGEQQYNVAQILVPVAEGATDAEKAAARKKAEGLLKQAQGGADFA
FT                   KLARDNSGAQDAAQGGELGLRPIGRLPAVFANAVVDMKAGQVASQVVESPAGYHVIKLL
FT                   DKRAPGTAIAAKVQQTQVRHILIKTGPTMSADDARRQLVGLRDRIVHGYDFGDAARRYS
FT                   QDGSAGAGGELGWVSPGQLVPEFEQAMNQLKPGDVSQPVQSQFGVHLIQVEGRREAEVS
FT                   GDRQRDYARSVIREQKVQAAYEDWLRELRDSAHVEYRVNRQQ"
FT   sig_peptide     424881..425018
FT                   /locus_tag="Rpic12D_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 46"
FT   gene            426472..427488
FT                   /locus_tag="Rpic12D_0408"
FT   CDS_pept        426472..427488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0408"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /note="KEGG: rso:RSc0517 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; TIGRFAM: 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase; PFAM: Pyridoxal phosphate biosynthetic
FT                   protein PdxA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61714"
FT                   /db_xref="GOA:C6BCK3"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCK3"
FT                   /inference="protein motif:TFAM:TIGR00557"
FT                   /protein_id="ACS61714.1"
FT                   /translation="MLNIAITTGEPAGIGPDITVAALLHLARQASPRYADVQWHVMGDS
FT                   ALLQARADAIGQGDFWRIVSTALTVVERPLGAPVRAGVLDDANGRYVLDLLDAAIDGCL
FT                   IGTADGMRYDAMVTAPVQKSTINDAGVPFTGHTEYLAERSHTPRVVMMLAGPQPAHDNA
FT                   MLRVALATTHLPLRDVPDAITPAVLDETLDIVQRDLRTRFGLTAPRILVTGLNPHAGES
FT                   GHLGREEIEVIEPAIARARARGIDARGPYPADTLFQPRLLTDADCVLAMYHDQGLAPLK
FT                   YGTFGHGVNITLGLPFVRTSVDHGTALDLAGTGRAEFGSMIEAIDTAIAMARHTTRS"
FT   gene            427520..428365
FT                   /locus_tag="Rpic12D_0409"
FT   CDS_pept        427520..428365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0409"
FT                   /product="dimethyladenosine transferase"
FT                   /note="KEGG: rso:RSc0518 dimethyladenosine transferase;
FT                   TIGRFAM: dimethyladenosine transferase; PFAM: ribosomal RNA
FT                   adenine methylase transferase; SMART: ribosomal RNA adenine
FT                   methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61715"
FT                   /db_xref="GOA:C6BCK4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCK4"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ACS61715.1"
FT                   /translation="MARSTTGVHQGHQARKRFGQNFLVDDGVIHAIVAAIDPKPDDVLV
FT                   EIGPGLGALTVPLMERVRTLQVVELDRDLVARLQKRFGDRLVVHAGDALAFDFGALQEV
FT                   DRPLRIVGNLPYNISSPLLFHLATFADRVRDQHFMLQKEVVDRMVAAPGSKAFSRLSVM
FT                   LQVRYYMELVLDVPPGSFNPPPKVDSAVVRMIPWPADKSPYAPVDMRALGTVVTMAFSQ
FT                   RRKVLRNTLGALRDVVDFDALGFDLSRRAEEVPVEDFVAVANALPANRIAGSVSDLSED
FT                   "
FT   gene            complement(428352..429257)
FT                   /locus_tag="Rpic12D_0410"
FT   CDS_pept        complement(428352..429257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0410"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rso:RSc0519 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61716"
FT                   /db_xref="GOA:C6BCK5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCK5"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS61716.1"
FT                   /translation="MATATDAIRRPLDSTAIGLMVVLCMCWGFQQVAIKVAAHDVGPVM
FT                   QAGVRSAIASVLVFAFALWRGTCLSLRDGTLTGGLMAGVLFGVEFLCIFIGLGYTTASR
FT                   MAVFLYTAPIFTALGLHFFVPGEHLRPRQWAGIGIAFAGIVLAFADGVLHPAAGPSTSL
FT                   GDALGVVAGALWGATTIVVRASKLSEAPAAKTLLYQLAVSAVLLLLMAAGTGQAFTANL
FT                   TPTALASLAYQSVLIAFASYLTWFWLLRRYLASRLSVFSFLTPLFGVAFGVLLLHEPVG
FT                   LRFALAATLVLSGILLVNLR"
FT   gene            complement(429241..429648)
FT                   /locus_tag="Rpic12D_0411"
FT   CDS_pept        complement(429241..429648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0411"
FT                   /product="lactoylglutathione lyase"
FT                   /EC_number="4.4.1.5"
FT                   /note="KEGG: rso:RSc0520 lactoylglutathione lyase; TIGRFAM:
FT                   lactoylglutathione lyase; PFAM: Glyoxalase/bleomycin
FT                   resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61717"
FT                   /db_xref="GOA:C6BCK6"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCK6"
FT                   /inference="protein motif:TFAM:TIGR00068"
FT                   /protein_id="ACS61717.1"
FT                   /translation="MRMLHTMLRVGDLQRSIDFYTKVLGMQLLRTSDNPEYKYSLAFVG
FT                   YGPEAGNTVIELTYNYGVSEYELGTAFGHLAIEVDNAAQACDQIRNAGGKVTREAGPVK
FT                   GGSTIIAFVEDPDGYKIELIQARSMPDGNRH"
FT   gene            complement(429768..430646)
FT                   /locus_tag="Rpic12D_0412"
FT   CDS_pept        complement(429768..430646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0412"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   rso:RSc0521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61718"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCK7"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="ACS61718.1"
FT                   /translation="MKLLRPPTSPTPADSVQLELPLLAPEAPSALQPPDAPLLAPPALD
FT                   FSTAPLGPHQRRLTLGERALIYNLKRSSRRTIGFVIDDRGLSITAPRWVTLAEIEHAIA
FT                   EKQKWIFAKLAEWRTSAARRMLPTMEWQDGAGLPFLGKTITLKLESPIGALMFDADTSM
FT                   LHLGLPHTTTEQQIKDRVQGWLQTQARRLFGERLEVYAERLGVRHSAYALSSAATRWGS
FT                   CTADGKIRLNWRLVHFPLSLIDYVVAHELAHLKEMNHSPRFWDTVESIFPEFREAREQL
FT                   RSHPPEYLPAF"
FT   gene            complement(430643..431395)
FT                   /locus_tag="Rpic12D_0413"
FT   CDS_pept        complement(430643..431395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0413"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: rso:RSc0522
FT                   putative acyltransferase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61719"
FT                   /db_xref="GOA:C6BCK8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCK8"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACS61719.1"
FT                   /translation="MTFIRSLLYLVFLIVWTPIYAVACFIVFPFMNPHRRFWMVSGWTK
FT                   SAIWMARWLLGIRWQYQGWENIEEAVATNKQVVLLSKHQSAWETMAFVATMPRPLCYVF
FT                   KRELLFVPFFGWALGMLKMVHINRKDGANAFASVARQGKERLADGAWVIMFPEGTRTRS
FT                   GDPKPRYKSGGARFAVDTGAWVIPIAHNSGRVWPRNSFLKHPGLITLSVGPAISSAGKT
FT                   SDELNREVEAWIETEMRRIDADSYREHA"
FT   sig_peptide     complement(431324..431395)
FT                   /locus_tag="Rpic12D_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.713) with cleavage site probability 0.525 at
FT                   residue 24"
FT   gene            complement(431407..431985)
FT                   /locus_tag="Rpic12D_0414"
FT   CDS_pept        complement(431407..431985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0414"
FT                   /product="histidinol-phosphate phosphatase family protein"
FT                   /note="TIGRFAM: histidinol-phosphate phosphatase family
FT                   protein; hydrolase, HAD-superfamily, subfamily IIIA; PFAM:
FT                   Polynucleotide kinase 3 phosphatase central region; KEGG:
FT                   rso:RSc0523 D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61720"
FT                   /db_xref="GOA:C6BCK9"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCK9"
FT                   /inference="protein motif:TFAM:TIGR01656"
FT                   /protein_id="ACS61720.1"
FT                   /translation="MPHVPKLVILDRDGVINRDSDQFIKSPDEWIALDGSLEAIAELNQ
FT                   AGYQVVVATNQSGIGRGLFEAAALNAMHEKMYKALATSGGRVDAVFFCPHTAADACECR
FT                   KPKAGMLREIARRFDMDLTGVPVVGDSLRDLQAGVEVGAVPHLVLTGKGAKTRDAGNLP
FT                   PGTQIHEDLRAFVRALLSPVPQGTPTRAP"
FT   gene            complement(432017..434110)
FT                   /locus_tag="Rpic12D_0415"
FT   CDS_pept        complement(432017..434110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0415"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: rso:RSc0524 glycyl-tRNA synthetase subunit
FT                   beta; TIGRFAM: glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61721"
FT                   /db_xref="GOA:C6BCL0"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCL0"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ACS61721.1"
FT                   /translation="MSTLLIELLTEELPPKALARLGEAFARGLFDGLSAQGLLEEGAAV
FT                   EGFATPRRLAASITGVRRTAPDRELREKVLPVTIAFDAEGKPAAPLVKKLAALAKTVGV
FT                   EAIAPESLERAPDGKAEALFYRYTARGALLADGLQTALSQTVANLPIPKVMTYQRPNGE
FT                   NVQFVRPAHKLIALLDSEVIPVSAFGLQSGNVTLGHRFLSAGEIVIQDAASYASTLESQ
FT                   GKVIAGYGKRKEAIRAELLKTAGADTVVMPEALLDEVNALVEWPVVYPCHFEEAFLAVP
FT                   QECLILTMQTNQKYFALTDAQGHLRNRFLIVSNIATDTPEAIIQGNERVVRPRLADARF
FT                   FFEQDKKKPLADRVPLLSRVVYHNKIGTQLERVSRLQAIAGQLAEKLGADVAHASRGAL
FT                   LAKADLLTDMVGEFPELQGTMGTYYARHDGEPDDVALACSEHYQPRFAGDALPSTATGT
FT                   VVALADKFETLVGIWGIGLQPTGEKDPFALRRHALGILRMLIEKPLALTIDDALQIAAA
FT                   SFDGIAAVKPNLAAITDFLYDRLRGYLKDKGYSTNEVEAVVSQRPQRLDDIVARLEAVR
FT                   AFAALPQAEALAAANKRITNILKKTDVAIGAVQPPLLKEDAERALHQSVVAAEPQVHDA
FT                   FARGDFTTALKTLAGLREAVDTFFDGVMVMADDTALRDNRLALLAELHGLMNRVADISK
FT                   LAA"
FT   gene            complement(434197..434856)
FT                   /locus_tag="Rpic12D_0416"
FT   CDS_pept        complement(434197..434856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0416"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RSc0525 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61722"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCL1"
FT                   /inference="similar to AA sequence:KEGG:RSc0525"
FT                   /protein_id="ACS61722.1"
FT                   /translation="MTANRARRGLALLTAASIAALTLPASVAQAARHRTSKPASAEKVF
FT                   VVPNTLTQLCVADSKPLQQALSAAWTPPPPSLDQWTSLVRTMACDLSGARDLGWHRVPL
FT                   RTYATALRFPLTWVEWQGTGVKAQRRARVFRSAGQLPSRLEFNVSGTLQEVRYDARRGL
FT                   LSARFLRRDAAVPGTTPAPIAPPPPPGQCAGTQLQFQQQNGVWLLSGVEPVPGSPC"
FT   sig_peptide     complement(434764..434856)
FT                   /locus_tag="Rpic12D_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.442 at
FT                   residue 31"
FT   gene            complement(434853..435839)
FT                   /locus_tag="Rpic12D_0417"
FT   CDS_pept        complement(434853..435839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0417"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: rso:RSc0526 glycyl-tRNA synthetase subunit
FT                   alpha; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61723"
FT                   /db_xref="GOA:C6BCL2"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCL2"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ACS61723.1"
FT                   /translation="MLTFQQLILKLQSYWDAQGCALLQPIDLEVGAGTSHVHTFLRAIG
FT                   PEPWRAAYVQPSRRPKDGRYGENPNRLQHYYQYQVVLKPAPENILDLYLGSLEALGLDL
FT                   KQNDVRFVEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCKPVTGEITYGIE
FT                   RLAMYLQQVENIYDLVWTEWEEPGPNGPVKRRLTYGDVYHQNEVEQSTYNFEQADTTVL
FT                   FRRFAEHEAEAKRLMGVRAEGDAAAEGNAPVVQLALPAYEQVLKAGHTFNLLDARGAIS
FT                   VTERAAYIGRIRNLSRLVAQAYYDSRERLGFPMCGTAAAAVKTTEAA"
FT   gene            complement(436009..437520)
FT                   /locus_tag="Rpic12D_0418"
FT   CDS_pept        complement(436009..437520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0418"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: rso:RSc0527 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61724"
FT                   /db_xref="GOA:C6BCL3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCL3"
FT                   /inference="protein motif:TFAM:TIGR00546"
FT                   /protein_id="ACS61724.1"
FT                   /translation="MPLARLRFAMPLAALLGVMHTLSFAPNHWWWLQILSLTGLAALVQ
FT                   RAPRLRDAAWIGYAFGLGWFVSGVWWLYISMHVYGDMPAWMAALAVLLFAGYLALHPAL
FT                   AVWAWQWLTRRGRWSGTASALIFGAAWAVTEWLRGTVWTGFPWINGGYAHTDGPLAGYA
FT                   PLVGVYGIVLIAAVLAGLLCVAAERRLHWLAGIAGALVLVAGWPLHGIAWTQPVGKPIS
FT                   VRLLQGNVPQDVKFQQTGIERSLELYTKMVTEKPAQLVVTPETAFPIMIQEMPQEIALA
FT                   LRTYVDATGSSVLFGAASEDSRVDYTNSVFGIGPQFQGVYRYNKHHLVPFGEFIPFGFH
FT                   WFVNMMNMPLGDFRRGLPVQPPMAVADQRVAPNICYEDLFGEEIAASLRHADQPATMLA
FT                   NVTNLAWFGDTIALDQHLQISRMRALETGRPMLRATNTGATAVVRPDGSVQARLPVFTL
FT                   GTLQADVQGTQGLTPFVRAGNAPALGLGALVLLVACVRRRRASAD"
FT   gene            complement(437585..438514)
FT                   /locus_tag="Rpic12D_0419"
FT   CDS_pept        complement(437585..438514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0419"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: rso:RSc0528
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61725"
FT                   /db_xref="GOA:C6BCL4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCL4"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACS61725.1"
FT                   /translation="MLGRCLTTRDRAMNDPYPSPKPADKPRSLLERLTDLISPEPESRA
FT                   ELLEILQDAHARSLIDADSLSMIEGVFQVSDLCARDIMIPRAQMDALNIADAPSEFIPF
FT                   VQEAAHSRFPVYEGSRDNIIGILLAKDLLRFYTDEGFDVRDMLRPAVFIPESKRLNVLL
FT                   RDFRVNRNHIAIVVDEYGGVAGLITIEDVLEQIVGDIEDEYDFDQEEDNILPTADGHMR
FT                   VRGLTEISQFNEAFGTHFSDEDVDTVGGLLSNHLGRVPHRGEKIVMGTLQFDVLRADAR
FT                   QVQVLLVRRLTTPAGGNATADTSGSHPA"
FT   gene            438683..439504
FT                   /locus_tag="Rpic12D_0420"
FT   CDS_pept        438683..439504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC769970"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61726"
FT                   /db_xref="GOA:C6BCL5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCL5"
FT                   /inference="similar to AA sequence:KEGG:769970"
FT                   /protein_id="ACS61726.1"
FT                   /translation="MRVAALVVLVMVVPARNSIALTVMLPLSPRVVALAAAVMVCSVVA
FT                   FTLALAVVMTVAAVVILTVVVAAVAVAAVVVIPTVMTVAAVVVIPTVMTVAAVVVIPTV
FT                   MTVAAVVVIPTVMTVAAVVVIPTVMTVAAVVVIPTVMTVAAMVMIPTVMAVAAAVVIPT
FT                   VMTVAAMVVIPTVMTVAAVVVIPTVMTVAAVVVVATVMTVAAMVVVPPRMAAVIVIMIM
FT                   VVAVMVTAVVATPARRWDGRWARRRCGGWSWCRRWTRTRRWSWRRTWPGAR"
FT   sig_peptide     438683..438745
FT                   /locus_tag="Rpic12D_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.851) with cleavage site probability 0.725 at
FT                   residue 21"
FT   gene            complement(440485..441297)
FT                   /locus_tag="Rpic12D_0421"
FT   CDS_pept        complement(440485..441297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0421"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   rso:RSc0529 putative metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61727"
FT                   /db_xref="GOA:C6BCL6"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCL6"
FT                   /inference="protein motif:PFAM:PF02130"
FT                   /protein_id="ACS61727.1"
FT                   /translation="MAKAKTDTKAKTKKTQLAAAESLGPRVDVFDAQGKPKTVDASALR
FT                   IAFADGRSLILGLPNTVDGAITLVAEHADADMHAMLSLRPEHHDSITLRIETQPAELAD
FT                   STEEAFDDDTAGAEMLTLDLTVQYGDELKAAARKALPKERDIEAWIAPALFADAQLNVR
FT                   FVGEEEGRTLNRTYRGKDYATNVLTFSYAESAEDPVSADIVLCCAVVEKEAKEQKKPLT
FT                   AHYAHLIVHGALHAQGYDHEDAADAKEMEGIETEILRDLGFADPYADR"
FT   gene            complement(441310..442302)
FT                   /locus_tag="Rpic12D_0422"
FT   CDS_pept        complement(441310..442302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0422"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG: rme:Rmet_0452
FT                   PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61728"
FT                   /db_xref="GOA:C6BCL7"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCL7"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ACS61728.1"
FT                   /translation="MKPSIAEFTAPKNDNTRLQNLCGPLDENLRQIEQALDVTINRRGS
FT                   KFTVRGANAQGATNALETFYNAAREPLSVDDIQLGLVETRQVAAHGAYLPESGTDEPDG
FT                   NDLSPVLHTRRTDLHGRTPMQRAYLRHILSHDLSFGIGPAGTGKTYLAVACAVDALERD
FT                   AIKRIVLTRPAVEAGERLGFLPGDLAQKVDPYLRPLYDALYDLLGFDKTQKMFERQMIE
FT                   IAPLAYMRGRTLNHAFIILDEAQNTTPEQMKMFLTRIGFGSKAVITGDTTQIDLPRGQK
FT                   SGLVEAQHVLRDVRGVAMTRFTSVDVVRHPLVARIVEAYDEFHAQHKDA"
FT   gene            complement(442324..443694)
FT                   /locus_tag="Rpic12D_0423"
FT   CDS_pept        complement(442324..443694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0423"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: rso:RSc0531 hypothetical protein; TIGRFAM:
FT                   tRNA-i(6)A37 thiotransferase enzyme MiaB; RNA modification
FT                   enzyme, MiaB family; PFAM: Protein of unknown function
FT                   UPF0004 ; Radical SAM domain protein; deoxyribonuclease/rho
FT                   motif-related TRAM; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61729"
FT                   /db_xref="GOA:C6BCL8"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCL8"
FT                   /inference="protein motif:TFAM:TIGR01574"
FT                   /protein_id="ACS61729.1"
FT                   /translation="MKKVFIKTYGCQMNEYDSDKMSDVLNAAEGLVPTDTPEDADVILF
FT                   NTCSVREKAQEKVFSELGRVKALKALKPDLVVGVGGCVASQEGASIVARAPYVDVVFGP
FT                   QTLHRLPDLIAARRRTGRSQVDVSFPEIEKFDHLPPARVDGASAFVSIMEGCSKYCSYC
FT                   VVPYTRGEEVSRPFDDVLAEVAGLAEQGVREVTLLGQNVNAYIGKMGDTSERADFALLL
FT                   EYVAEIPGIERIRYTTSHPKEFSSRLIEAYATNPKLVDHLHLPVQHGSDRILMAMKRGY
FT                   TVLEYKSSIRKLRAIRPNISIATDFIVGFPGETDADFAKTMDLIHEIGYDTSFSFIYSP
FT                   RPGTPAANLPDDTPQAVKLERLKHLQATIEENVARISQGMVGSVQRILVEGPSRKDPTE
FT                   LHGRTENNRVVNFALPDLPQARRDQLIGQMLDVRIVHAFPHSLRGEVAEQRTASATH"
FT   gene            complement(443747..444160)
FT                   /locus_tag="Rpic12D_0424"
FT   CDS_pept        complement(443747..444160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0532 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61730"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCL9"
FT                   /inference="similar to AA sequence:KEGG:RSc0532"
FT                   /protein_id="ACS61730.1"
FT                   /translation="MRTRRQVLALAFAAVAAASAPLLSHAQVLRNIPATAPAAQLTVNS
FT                   ANTGTLSTGSTGIVRILLLGFGSSSADIRFAPGVRILSLDGRLLPPGSVVGQTFKVRYQ
FT                   LDLYQQLLTAWVVSDDDYKAAVAAQSQAQAQSQ"
FT   sig_peptide     complement(444080..444160)
FT                   /locus_tag="Rpic12D_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 27"
FT   gene            complement(444251..445318)
FT                   /locus_tag="Rpic12D_0425"
FT   CDS_pept        complement(444251..445318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0425"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0533 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61731"
FT                   /db_xref="GOA:C6BCM0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCM0"
FT                   /inference="similar to AA sequence:KEGG:RSc0533"
FT                   /protein_id="ACS61731.1"
FT                   /translation="MADCYSPITAPIPDSCPRTHATSMTQPSIAIVGAGIAGVACANAL
FT                   AAEGIATTVYERAGGVGGRLATTVLPESAPAYAFDHGAQSFNVRSEVFRRAVDAAGRQG
FT                   SVLPWPARWGHRTVDGLEADSRDEARYVGLPGMGALVRSLAAPLDVRFGRAVTRVTHDG
FT                   RRWTIERNGTDAAHADFLALALPAPELPALFHGATPASLQEAIAPVHYAPCWALMMGFA
FT                   QPLGLPYDGIRIDDDMLAWAARDNTKPGRVMVDESWVVHASPGWSAAHANDSPEQALHA
FT                   MHARFAEAFPGTPEPDLMAVHLWPHALVEQSAGMPCHWDAAARLGACGDWCEGPRVEAA
FT                   FLSGVALAAKIAEAL"
FT   gene            complement(445389..446309)
FT                   /locus_tag="Rpic12D_0426"
FT   CDS_pept        complement(445389..446309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0426"
FT                   /product="OmpW family protein"
FT                   /note="PFAM: OmpW family protein; KEGG: bpd:BURPS668_3797
FT                   OmpW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61732"
FT                   /db_xref="GOA:C6BCM1"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCM1"
FT                   /inference="protein motif:PFAM:PF03922"
FT                   /protein_id="ACS61732.1"
FT                   /translation="MNRTARRFAAAFACAAASTLAAPLAHAQSTAEANVAASASNGSGT
FT                   SSGGGFSGFMDNYVWGRNVMALGWFYIRPMDSATPLTTTTSALGLGTYQSPGTDVKVSN
FT                   ANTLSLTFTHFFNDNIAGTFVGGVPPKFNLYGSGNVIAPVPVVGPLTLINLGLPQNNPV
FT                   ATVREWSPAIVAQYYFGTKESKLRPFVGAGVSYNFFTNLRLNSNFVNALQNLGQVLQLG
FT                   MGQVPTGPAKVTAETSSSWTPVANVGVSYEFAKNWTAIGTVSYLPLKTTSTITIRSQQG
FT                   QVLAVNKTDIKVDPIVFGLAVGYKF"
FT   sig_peptide     complement(446226..446309)
FT                   /locus_tag="Rpic12D_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            complement(446521..447438)
FT                   /locus_tag="Rpic12D_0427"
FT   CDS_pept        complement(446521..447438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0427"
FT                   /product="lipoprotein transmembrane"
FT                   /note="KEGG: rso:RSc0534 lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61733"
FT                   /db_xref="GOA:C6BCM2"
FT                   /db_xref="InterPro:IPR011465"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCM2"
FT                   /inference="similar to AA sequence:KEGG:RSc0534"
FT                   /protein_id="ACS61733.1"
FT                   /translation="MQLRTLALATLLAGAVHAWAQPAAPDASVPAAAAPTATQTAASQS
FT                   AAIGSFAAMDIARQTAWLGSQVNANAFASWSDEDVLAMAQAMKPETLVRWLKGEAAKLP
FT                   EYEYRMRRQERVRDQWQSQPALMLVRYRNAPRQVYARWLKGGAHAGQEIIYDETVRKDE
FT                   MYGHLGGLVGFVAIWSALDGSLAKSQSNHTARELGLQFIVDSVERDGRAHVAAGGSGKF
FT                   NEAKVVTEDGERMLRLTWDSPSGPPTFYAKRVRLYFDLKNPWVRIEEAWDESGNQLEKI
FT                   VIESVTRKTWNDQTFNPKNPEYKF"
FT   sig_peptide     complement(447376..447438)
FT                   /locus_tag="Rpic12D_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.899 at
FT                   residue 21"
FT   gene            complement(447459..449198)
FT                   /locus_tag="Rpic12D_0428"
FT   CDS_pept        complement(447459..449198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0428"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bph:Bphy_1704 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61734"
FT                   /db_xref="GOA:C6BCM3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCM3"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACS61734.1"
FT                   /translation="MNTVADRSDLTDRIWLKSYPEGVPAEINPDRYHSLVEVFRESVEK
FT                   YRTRVAYVSVGTEMTYGECERQAKQFAAWLQSRGVKKGDRVAIMLPNSLQYPVCLFGTL
FT                   LAGAIVVNVNPLYTVPELAHQLRDSGAQTIVVLENFARTLEQALPGSQVRNIVITGIGD
FT                   LMGGALNLKGRALNFVMRHVQKQVPPYKLPSPVWLRDALAAGGSRTLQSVQLAPEDLAF
FT                   LQYTGGTTGVAKGAMLTHRNIIANLLQAEEWSKSMLNGGVETNVTLLPLYHIFSLTVNL
FT                   LMFMTLGGRNILIANPRDTKRVIFILRNERFSGIAGVNTLFNALLEDPDFAKRDFSAMK
FT                   ITIGGGMAVQRAIAQRWKEVTGHTIVEGYGLTECSPVVSMNPPHVTEFSGTIGLPAPST
FT                   EVRFKRDDGTIAPLGEPGELQVRGPQVMRGYWQRPDETAKSIDAEGWFSTGDIGVMDAN
FT                   GYIRLIDRKKDMILVSGFNVYPNEIEDVVALHPDVLEVAAIGVPDPVAGERVKIIVVPR
FT                   TGALTEPALLEHCRAHLTGYKMPRIVEFRHEELPKSTVGKILRRELRDADPDIKRARAQ
FT                   AQQ"
FT   gene            complement(449299..450618)
FT                   /locus_tag="Rpic12D_0429"
FT   CDS_pept        complement(449299..450618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0429"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: bpy:Bphyt_1673 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61735"
FT                   /db_xref="GOA:C6BCM4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCM4"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACS61735.1"
FT                   /translation="MLVNAQLRRVAILGGNRIPFARSNTAYATASNQQMLTAALQGLID
FT                   RFNLHGQRLDEVVAGAVIKHARDFNLTRETVLSTTLAKQTPAYDIQQACGTGLEAAILV
FT                   ANKIALGQIDVGIAGGTDTTSDAPVGLNEKMRKILLEANRAKSTGARVKALAGLRPSMF
FT                   VRPLLPRNSEPRTGLSMGEHCELMAKRWGIRREDQDALALRSHHNLTAAYERGFFTDLM
FT                   TAHLGLDRDNNLRSNLTIEQLAKLQPVFDRSAAGTMTAGNSTPLTDGASCVLLASEDWA
FT                   RAHNLPVLAYMTCADTAAVDFFSGTPEQNEGLLMAPAYAVSRMLERAGLTLQDFDYYEI
FT                   HEAFAAQVLCTLAAWESPEYCREKLGRSAPMGSIDRSKLNVNGSSLGTGHPFAATGGRI
FT                   VATLAKMLAQRGSGRGLVSICAAGGQGVVAILERPETMSQ"
FT   gene            complement(450623..451543)
FT                   /locus_tag="Rpic12D_0430"
FT   CDS_pept        complement(450623..451543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0430"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   pfl:PFL_2941 MaoC-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61736"
FT                   /db_xref="GOA:C6BCM5"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCM5"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACS61736.1"
FT                   /translation="MRTLAPLFPMIATQTLVTAPPSPGALAWRALLSQRKGRRGGPLPR
FT                   HTLVRQEVPLEAEHIAQYAAVCGFSAAHGVPMTYPHLLGFPLQLMLMTESAFPYPVIGL
FT                   VHLCNTIRQHQGLQVGERVRVEVRPRRLFHHARGQAFAIETAIVKAGAVVWESLSTYLR
FT                   VGVPSPQGAPLIALPGAQTFSPDGRWDVPADTGRRYAGVSGDWNPIHVSTIGARLFGFA
FT                   HPIAHGMWTKARALAELLPAAPLTQGEVLAEFKTPLSLPGTATLWQASEATPGRAFEVR
FT                   NATGDKPYLRGMLTLPQAQQDNTGD"
FT   gene            complement(451550..452962)
FT                   /locus_tag="Rpic12D_0431"
FT   CDS_pept        complement(451550..452962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0431"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: rso:RSc0536
FT                   3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61737"
FT                   /db_xref="GOA:C6BCM6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCM6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS61737.1"
FT                   /translation="MQDKYLDFVGSGFGKWLSANLGLPQPVPLRRYVPGEPEFVGPFLV
FT                   GAAPGGSMRETLAALFAETGVPTRFHESDPEWLGTANRHGQITGRFVAPTGKEGEAFDR
FT                   IGGIVFDATGIASVDGLDALYHVFHDGVRAIGRCGRVVVIGRPPEGSKTPEAAIAQRAL
FT                   EGLTRSLGKEVRRGCTAQLVYVAEGAENVAASTLRFLLSARSAYVSGQVVRVHRAAAVS
FT                   VDWQKPLAGRTALVTGASRGIGAAIAHVLARDGARVLCLDVPAAQEALGTVAQEIGGEA
FT                   MAYDIAAPETPALLAQQLAALGGVDILVHNAGITRDKTIARMTEPAWRSVLDINLAAQL
FT                   RINDALLAANALHAGGAIVCVSSISGIAGNMGQTNYATSKAGVIGLVQAGAPLLAERGI
FT                   TINAVAPGFIETQMTAAVPFAIREAGRRMNAMSQGGQPVDVAETIAWFANPASNGVTGN
FT                   IVRVCGQSLLGA"
FT   gene            complement(452995..455505)
FT                   /locus_tag="Rpic12D_0432"
FT   CDS_pept        complement(452995..455505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0432"
FT                   /product="Protein of unknown function DUF1974"
FT                   /note="PFAM: Protein of unknown function DUF1974; acyl-CoA
FT                   dehydrogenase domain protein; Acyl-CoA dehydrogenase type 2
FT                   domain; KEGG: rso:RSc0537 acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61738"
FT                   /db_xref="GOA:C6BCM7"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR015396"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCM7"
FT                   /inference="protein motif:PFAM:PF09317"
FT                   /protein_id="ACS61738.1"
FT                   /translation="MTTIWIVLLCIGALALASMEASAVAWLIATAVWLVAGAWLGLVGP
FT                   VMTAVLAIVFVLPALVLAVKPLRRALITRPVLAMFRKIMPEMSQTERDAIEAGTVWWDA
FT                   ELFSGRPNWSRLMSSPPPRLSAEEQSFLDIETEKLCDLANDWESTQIWQDLSPEAWAYA
FT                   KRAGFLGMIIPKEYGGKGFSAYAHSQVIMKLSTRCSAAAVSVMVPNSLGPAELLLHYGT
FT                   EAQKDHYLPRLARGEEIPCFALTNAYAGSDAAAIPDVGVVCRGMHEGRETLGFRVTWSK
FT                   RYITLGPIATVLGLAFRAVDPDGLLGADKEPGITCALIPTKHPGVNIGRRHWPLNAVFQ
FT                   NGPNWGKDVFIPIDWVIGGRAQVGRGWRMLMECLAAGRAISLPSSNVGMAKLAVRSTGA
FT                   YAAVRRQFRTPIGKFEGIQEALGRMGGNLYMMDSARRLSALAVDLGEKPSVISAIAKYH
FT                   VTERARDVVTDAMDIVGGKGICMGPNNFLARAYQQVPIAITVEGANIMTRCLIIFGQGV
FT                   IRCHPYVLREMTAAQGTDSPETLRAFDAALFGHGAFIAGNVVRAFLHALSGGRVASVPG
FT                   NAAPEMHRYYRAVNRFSTALALLSDVSMFTLGGTLKRRESITGRLGDILSQMYLISSTL
FT                   KRFEDEGRPAEDAPLVHWSVQDALVKAHDALDGVLANFPNAGIAALLRALIFPFGTPYR
FT                   KPSDALAAQVAELMQTPGVVRDRLLADSYCPTPEVDPIAYGEAAFRLQPAVDAIEQRLK
FT                   PAIRAGKLPPVPQSLPDFEAWTAQAVAQNLIDESERKQLCDYARYGEHAVAVDDFPPDF
FT                   NLMADLQRRKDALDALQTAERRAA"
FT   sig_peptide     complement(455434..455505)
FT                   /locus_tag="Rpic12D_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.707 at
FT                   residue 24"
FT   gene            complement(455623..456687)
FT                   /locus_tag="Rpic12D_0433"
FT   CDS_pept        complement(455623..456687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0433"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rso:RSc0538
FT                   putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61739"
FT                   /db_xref="GOA:C6BCM8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041586"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCM8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS61739.1"
FT                   /translation="MGRPGAGDTKGRILEATELLFIEFGYEAMSLRQITARAKVNLAAV
FT                   NYHFGSKEALMQSVLGRRLDPLNTRRLALLDACEERWSKEQLTCDHVLGALFVPALQMA
FT                   RNPDTGGPAFLRLMGRVYSDTSPFVQNYLLGHYAPVFDRFFEAFSRALPHLPRAELGWR
FT                   LHFALKALAGVLAGDDLNNLLPLFTQGKTMNDASLLARLTALVVATLNAPLPGEAGALD
FT                   QVVELAEAQVPTPVAQADDASNGNDSGHGGSGRHAGHGNGRITERSATPATASPFAGDL
FT                   FGRTPGSRASADDAADDHDDLSADEHDDHHGADSNSDGPAPSARTRALAIRRSNAARAI
FT                   FPANPMRPWRSPNA"
FT   gene            457335..459032
FT                   /locus_tag="Rpic12D_0434"
FT   CDS_pept        457335..459032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0434"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicases ;
FT                   helicase domain protein; KEGG: rso:RSc0539 ATP-dependent
FT                   RNA helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61740"
FT                   /db_xref="GOA:C6BCM9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028622"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCM9"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACS61740.1"
FT                   /translation="MSFSELGLSDKLVRAVAELGYAEPTPIQRQAIPAILKGGDLLAGA
FT                   QTGTGKTAGFTLPLLHRLSASQPNKVQTPQGMRFPIRALVLTPTRELAAQVEESVRAYG
FT                   KYLPLKSMVMFGGVGINPQIDALKRGVDIVVATPGRLLDHVGQRTIDLSHIELLVLDEA
FT                   DRMLDMGFIHDIRKILNILPPKRQNLLFSATFSDDIRELADRLLDKPALIEVARRNTTA
FT                   ETVEQRIYPVDRERKRELLAKLVRDNDWHQVLVFTRTKHGANRLAEQLTRDGIPALAIH
FT                   GNKSQSARTRALTEFKAGTLRVLVATDIAARGIDIDQLPHVVNFDLPNVPEDYVHRIGR
FT                   TGRAGAQGEAISLVCVDEHGLLRDIERLIKRELPRTVLEGFEPDPSIAAEPIPNGRNSA
FT                   GRGGNARGGRPGGGRSQQPRQASGNAAPREPRAPREPREPRRESSGNGQGQGQGQNQGQ
FT                   GQGQGQGRNGAGSRQRQPQGQRDGQAAPKPRNGHGAGNGNGQSQARGQRQGNGQGQGQG
FT                   NGQGGQGGQQRRASNTQAAQPAHKAQPAKQPFNGLFAKAAALLGGRKA"
FT   gene            459038..460090
FT                   /locus_tag="Rpic12D_0435"
FT   CDS_pept        459038..460090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0435"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   rso:RSc0540 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61741"
FT                   /db_xref="GOA:C6BCN0"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCN0"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACS61741.1"
FT                   /translation="MHDDGPPASADAPYDGLTPDSILDALAEVGLMPDGRMFPLNSYEN
FT                   RVYQVGVEDSAPVVVKFYRPGRWTDAQIVEEHAFTAELAAAEIPVVAPLEIDGRTLHAF
FT                   ERWHFAVFPRCAGRVPAIDQDHTLEWMGRFLGRIHVVGARRPFVARPALDIDTFGVQSR
FT                   DWLLEHDFIPPDLLPAWRSVADAALDGVRRCYDRAGDVSLLRLHGDCHASNVLWIEEAD
FT                   AKQGDPLQKGDSLRSAGPHFVDFDDSRTGPAVQDLWMLLSGDRASMQSQLASLLAGYED
FT                   FCEFDTRELYLVEALRTLRLLHYSAWLARRWNDPAFPAAFPWFNTQRYWQDRVLELREQ
FT                   IALLDEPPLW"
FT   gene            complement(460124..461020)
FT                   /locus_tag="Rpic12D_0436"
FT   CDS_pept        complement(460124..461020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0436"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: rso:RSc0541
FT                   pirin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61742"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCN1"
FT                   /inference="protein motif:PFAM:PF05726"
FT                   /protein_id="ACS61742.1"
FT                   /translation="METLVQPQVQRARLVERIITGRPTSDGAGVKLTRVLTNNLQRRLD
FT                   PFLMLDAFRSDDPNDYLAGFPDHPHRGFETVTYMIAGRMRHRDSAGHEGLLQHGGVQWM
FT                   TAGSGVVHSEMPEQEDGVMEGFQLWLNLPARDKMTTPWYRDIPSNEIPEFTTEDSVAVR
FT                   VIAGESHGVQGAMTREATQPLYLDITLPAGTSFAQALPAGHNAFVYVFRGSALVGDAGA
FT                   PGDAGLQRVEDKQMAILANTEGSDGVVIRAGDAEARVLLVAGKPLNESIAQYGPFVMNT
FT                   QEEIFQAVRDFQAGKFA"
FT   gene            461170..462087
FT                   /locus_tag="Rpic12D_0437"
FT   CDS_pept        461170..462087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0437"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rso:RSc0542 transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61743"
FT                   /db_xref="GOA:C6BCN2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCN2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS61743.1"
FT                   /translation="MDLNQLALFVRVVEAGSFTAAATRLDLPKSSVSRGIAALEQDLNV
FT                   RLLQRTTRTLHLTDAGQSLYQVASHALEDIERATTCAGELQDLPRGKVRITSSEDVGRL
FT                   LVAPVAARFMQQYPEIDLDVVLTPRNVDLVQEGFDLAVRVGRLADSSLVARSLGVLRIG
FT                   LFASPDYLQRRGAPDTVQGLADHCCLDFRGTGRGETQWRLVGPDGLKTVAVRARLNADS
FT                   LIYLETLIASGAGIGPLPLYASAVARANAPLPRLVRVLPDYATSGEPINLVTPSARFVP
FT                   RRVRLLIDMLTESIRQELENADPT"
FT   gene            462543..463283
FT                   /locus_tag="Rpic12D_0438"
FT   CDS_pept        462543..463283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0438"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: rso:RSc0543 response regulator
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61744"
FT                   /db_xref="GOA:C6BCN3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCN3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS61744.1"
FT                   /translation="MRIALLEDDPFQSEVIVQILSQSGHDVVTYTDGATLLRMLGRSSY
FT                   DMLILDWHTPGMLGIDVLSVVRSRHKEVLPVLFVTAEEGEKSLVRALTHGADDYIAKPF
FT                   RIAELRARVDALLRRAYPIPYGRLPFAVGPYHFNTQRQQITLHGEPVTLTGIEFQLALL
FT                   LFSNVGRTLSRDHIFGQVWGRNSSEYTRTIDSHVSRIRMKLNIEPVNEVRLVAVYKHGY
FT                   RVDHLKPANDMNALSEMDIASYDA"
FT   gene            463362..463694
FT                   /locus_tag="Rpic12D_0439"
FT   CDS_pept        463362..463694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0439"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   spe:Spro_2546 cupin 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61745"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCN4"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACS61745.1"
FT                   /translation="MLGVSLSLGEAGVPFFNLNAEAEALPRAWSSRVLERFGSANFKVL
FT                   RMDGTSYPNEVHDYAEGLLVIDGQLRLRTGDEAVTVSRGELYVVPAGVPHSVDAGSAGT
FT                   LVILDV"
FT   gene            complement(463740..464900)
FT                   /locus_tag="Rpic12D_0440"
FT   CDS_pept        complement(463740..464900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0440"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: rso:RSc0545 oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61746"
FT                   /db_xref="GOA:C6BCN5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCN5"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACS61746.1"
FT                   /translation="MSALRPLSIGIAGAGNAGLAAAIAFARQGHDVHVFEKHPQLTAMG
FT                   AGLLIQPQGIRALEALGVGRELEGIGAPIDRLIGLNHRGWRLLDIDYAETPGRAVTRHA
FT                   LSSMLYDAALHAGATFHFGCAIQQLLVDGPRAQVAHTQGESVFDLFVIADGAASALREP
FT                   AGLAGPSSTYRWGTLWFQGWVEGWNPRVLQQRFRGTREMMGLLPTDVDGTRTRLSMFWS
FT                   LPSDAVDAWRQTDITQWKAHVLSLWPQAAPMVEQIGSHDDMPFAVYRHTWPRALAKPPY
FT                   CVIGDAAHAMSPQLGLGTTLAAQDALALAGCVQVHGAADGALAYHARRLRTVQAYQTLS
FT                   RALTPCFQAQYGGWMRDVVFATGLRVPGVAWLMKRSLAEPPARDAG"
FT   sig_peptide     complement(464820..464900)
FT                   /locus_tag="Rpic12D_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.648 at
FT                   residue 27"
FT   gene            465022..465945
FT                   /locus_tag="Rpic12D_0441"
FT   CDS_pept        465022..465945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0441"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bcj:BCAS0107 LysR family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61747"
FT                   /db_xref="GOA:C6BCN6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCN6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS61747.1"
FT                   /translation="MQIKWLEDFKELAKTRSFSRAAENRNVTHPAFGRRIKALEEWVGT
FT                   SLIERSEHPVTLTAAGRLFLDAAANAVDGLNDVRLLLREAQLPVALRIGTGRTLARTFV
FT                   PGWYETLARQRGVFPLSVTTGGTQEGVLALADGTVDLLIAYASPQADALLDPRKYDHCL
FT                   LGSETLVPVSAPDKRGRPRFTLPGSAAAPLPWLAFARGLTLRQMLDSHLAAADRKAHLQ
FT                   PVFQADFYEAVEEMALRGFGMAWLPYRLARPHLNAGELRPAGDDAWHIHVNIRMMRVRS
FT                   NQSALLDEVWQRAVDNASGHGRNDLA"
FT   gene            466085..467419
FT                   /locus_tag="Rpic12D_0442"
FT   CDS_pept        466085..467419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0442"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: bur:Bcep18194_C7600 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61748"
FT                   /db_xref="GOA:C6BCN7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCN7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS61748.1"
FT                   /translation="MPAHTLNASSAGARAADAHRHPAPWRAVLAASVGNALEYYDLLIY
FT                   GYFAITIGKLFFPTGDAWSSLMLSVGTFGVSFIMRPLGSMVLGSYADRVGRKAALTWSI
FT                   LLMMLGTAMIAFAPTYASIGLWSPAIVIVARLLQGFSAGGEFGSATAFMIEHANGKRMG
FT                   YNASWQAATQGLATLLAAGLSAWITYALPTAQVESWGWRVAFLFGLLIGPIGVYIRRHT
FT                   PETPEFLTMQAEAPAALQARSPLRDTLTQGLPGLLLGAGVVVAVTAFNYVQKVYMPTYA
FT                   INQLHIATSASLVCTMITGAMLMVMAPAFGLMADRFGSIRVVSIAMVVIALSTYRMFAT
FT                   LVAQPTFWTLLVMQAIVGVLLAAILAPLPALLADIFPTRTRGTGLALSYNLSVTIFGGF
FT                   SPLIVTWLIGVTHIKTSPSFYVFATTLISLASLWMLRGRSRAHRT"
FT   gene            467451..468437
FT                   /locus_tag="Rpic12D_0443"
FT   CDS_pept        467451..468437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0443"
FT                   /product="Succinylglutamate desuccinylase/aspartoacylase"
FT                   /note="PFAM: Succinylglutamate
FT                   desuccinylase/aspartoacylase; KEGG: bur:Bcep18194_C7599
FT                   succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61749"
FT                   /db_xref="GOA:C6BCN8"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCN8"
FT                   /inference="protein motif:PFAM:PF04952"
FT                   /protein_id="ACS61749.1"
FT                   /translation="MMTLEALRATLPVYPIELHKPDIRRWKTGTHGIDYVHTFDSGMPG
FT                   PHVMINALTHGNELCGAIAVDALLAAGVRPAHGRLTLSFANVEAYERFDINDPDATRFI
FT                   DEDLNRVWSADKLDGSGNTLELRRARELRPVIDTVDTLLDIHSMHEKAEPLMLTGPHAK
FT                   GVALGYQVGAPSHLMIDAGHAAGRRLRDYGGFGDAASPKNALLIECGQHFERVSRDVAL
FT                   DACARFLLALGTVDASAVSDWLAMAPALDVRCIRVTDPVVARSTAFRFADDYRGMETIA
FT                   RAGTVIATDGALQIVTPYDNCVLLQPSLRHLAPGVTVVRLGRLEGSA"
FT   gene            complement(468434..469102)
FT                   /locus_tag="Rpic12D_0444"
FT   CDS_pept        complement(468434..469102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0444"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bte:BTH_II0405
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61750"
FT                   /db_xref="GOA:C6BCN9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCN9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS61750.1"
FT                   /translation="MEKTLETADAPAKKGRPYGGVAPEARAAERRDALIRAGTRVFGTV
FT                   GFRKATVRAICQEAKLNDRYFYAAFDSTEALLRATYQQHAEDLRAQVSEATAAAGNTLE
FT                   ARVDAGLHAFFAFLRDPCAARVLLLEVMGVSPETDATYQRNLLEFGKQIMANAELPGAP
FT                   LEDNAEQRADQRILGLALVGALTNVGAAWLLTGYRDPEEKMVRNCRQVVLGTLRAMLGV
FT                   "
FT   gene            469211..470761
FT                   /locus_tag="Rpic12D_0445"
FT   CDS_pept        469211..470761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0445"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bpd:BURPS668_A2821 arylesterase/monoxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61751"
FT                   /db_xref="GOA:C6BCP0"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCP0"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACS61751.1"
FT                   /translation="MDTTMERSANPGVPRNRAAAPDTDVDVLIVGAGLSGIGAAYHLRE
FT                   RCPSARFTILEGREAIGGTWDLFRYPGIRSDSDMFTLGYSFRPWHSSKAISDGQTILDY
FT                   IRDTARVFGIDKSIRFRHKVTGASWDSAAARWTVQALRSDGTREEPVQFTCKFLYMCSG
FT                   YYDYEEGHAPTWPEMDRFQGRIVHPQHWPNDLSYAGKRVVVIGSGATAVTLVPAMAGTA
FT                   QHVTMLQRSPTYIVSRPEQDAVANTLRRWLPSGLAHRLVRTKNVLLTMYFYSLARRKPK
FT                   AFKEFIIGMAGKQIGPGFDVRKHLTPRYNPWDQRLCLVPDGDLFKTIRAGKASIATDEI
FT                   ERFTATGLQLKSGEHLDADVIVTATGLKLKVLGGAAITVDGHAVNLAETVSYKGMMYSG
FT                   VPNLASSFGYTNASWTLKAELIAQYVCRLLNHMQSNGFDTCVPRLDDEAMSREPAVDLT
FT                   SGYIQRAAAILPKQGDKQPWKSYQNYARDLMMLKFGTLADSAIQFERRAQPIGAAQPA"
FT   gene            470785..471741
FT                   /locus_tag="Rpic12D_0446"
FT   CDS_pept        470785..471741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0446"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   bte:BTH_II0402 alpha/beta fold family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61752"
FT                   /db_xref="GOA:C6BCP1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCP1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACS61752.1"
FT                   /translation="MTSIVLGVIALAILAPVAFTFFIARRVNKGFPPEGQFIDIGGDRV
FT                   HYTDRGTGPAIVFVHGLCGNLRNFAYLDMDRLARSHRVIVIDRPGAGRSVRAADSPANI
FT                   YAQAHTVAQCIEQLGLDKPVLVGHSLGGAISLAVGLNHPHVIRRLALIAPLTHAESTPP
FT                   GAFRGLVLTSPLVRRLVSWTLAIPLSIINSRKAIAAVFAPEAMPKDFPFKGGGLLGLRP
FT                   HVFYAASSDLVAAPEDLPDMERRYASMTVPVDVLYGRGDRILNVKRQGEALKQKLDRVN
FT                   LRIIDGGHMLPVTQPALTTDWVLAVAAAAPAQAELLA"
FT   sig_peptide     470785..470847
FT                   /locus_tag="Rpic12D_0446"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.865) with cleavage site probability 0.619 at
FT                   residue 21"
FT   gene            complement(471816..471892)
FT                   /locus_tag="Rpic12D_R0003"
FT                   /note="tRNA-Met4"
FT   tRNA            complement(471816..471892)
FT                   /locus_tag="Rpic12D_R0003"
FT                   /product="tRNA-Met"
FT   gene            complement(471941..473644)
FT                   /locus_tag="Rpic12D_0447"
FT   CDS_pept        complement(471941..473644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0447"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: rso:RSc0547 putative sugar
FT                   transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61753"
FT                   /db_xref="GOA:C6BCP2"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCP2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS61753.1"
FT                   /translation="MATVQSAPNAPVGRVQPAPMTREEKKVIFASSLGTVFEWYDFYLY
FT                   GSLAAIIAKQFFSGLDPTAGFIFALLAFAAGFLVRPFGALVFGRLGDMIGRKYTFLVTI
FT                   VIMGTSTFIVGLLPSYGTIGVAAPIILIALRMLQGLALGGEYGGAATYVAEHAPHGRRG
FT                   AYTSWIQTTATLGLFLSLVVILAVRELTGKAFDDWGWRIPFLVSILLLATSVYIRLSMS
FT                   ESPAFQKMKAEGKTSKAPLTEAFGQWRNLKIVILALIGLTAGQAVVWYTGQFYALFFLT
FT                   QVLKVDAFTANVLIAVALAIGTPFFVFFGSLSDRIGRKKIIMAGCLLAVVTYFPLFKAL
FT                   THYANPALERAQQTAQITITVDPKECSFQGSPIAREVDFRSSCDIAKRTLAQSSASYET
FT                   VEGPAGTVASVSIAGKQISSLNATRTADGQSFDADSKTKIADFKKQVSESLKAANYPAK
FT                   ADPAQMNTVMVLVILVILVIYVTMVYGPIAAMLVEMFPTRIRYSSMSLPYHIGNGWFGG
FT                   LLPTISFALVAQNGNIYHGLWYPIWIAAITFVIGVLFVRETKDVDIYRND"
FT   gene            474169..474477
FT                   /locus_tag="Rpic12D_0448"
FT   CDS_pept        474169..474477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0448"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   bur:Bcep18194_B1981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61754"
FT                   /db_xref="GOA:C6BCP3"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCP3"
FT                   /inference="protein motif:PFAM:PF04341"
FT                   /protein_id="ACS61754.1"
FT                   /translation="MQDGLVGKIEAHPKYAQLKQRRNRLGLVLTVLMLAVYYGYIALIA
FT                   FDKAFLAKPVGTGVMSVGMPVGMAVIIFTVVITGIYVRRANSEYDQLTQDILKDVAK"
FT   gene            474474..476204
FT                   /locus_tag="Rpic12D_0449"
FT   CDS_pept        474474..476204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0449"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: bur:Bcep18194_B1980
FT                   Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61755"
FT                   /db_xref="GOA:C6BCP4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCP4"
FT                   /inference="protein motif:TFAM:TIGR00813"
FT                   /protein_id="ACS61755.1"
FT                   /translation="MKKMLSILLVALLAAGACGAALAAGGDVGQTAKQETNTTAIVLFA
FT                   LFVAGTLWITKWAAKRTRSAADFYTAGGGITGFQNGLAISGDYMSAASFLGISAAVMTS
FT                   GYDGLIYSIGFLVGWPIITFLMAERLRNLGKFTFADVAGYRFEQGPIRSFAAVGTLVVV
FT                   AFYLIAQMVGAGQLIKLLFGLDYWIAVVIVGALMMVYVLFGGMTATTWVQIIKACMLLA
FT                   GVTFMAIMVLAQYGFSLEALFAKAVQVKTAIAANAGKSPDEAAKIGLSVMAPGGFIKDP
FT                   ISAISFGMALMFGTAGLPHILMRFFTVPDAKEARKSVFWATTWIGYFYILIFIIGFGAI
FT                   TLVLTNPELSDVAKGVIKGGAGTANMAAVLVAKTVGGDVFYGFISAVAFATILAVVAGL
FT                   TLSGASAVSHDLYATVFKHGKANSADELKVSRITTLVLGVIAVLLGIAFEKQNIAFMVS
FT                   LAFAVAASANFPVLFLSMLWKGCTTRGAVIGGFLGLISSVGLTIVSPSVWEATLGYPKG
FT                   SAWFPYTSPALFSMTIGFVGVWLFSVLDSSVRAKNEKASFAAQQVRSETGLGAAGASGH
FT                   "
FT   sig_peptide     474474..474545
FT                   /locus_tag="Rpic12D_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            476268..478094
FT                   /locus_tag="Rpic12D_0450"
FT   CDS_pept        476268..478094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0450"
FT                   /product="putative CBS domain and cyclic
FT                   nucleotide-regulated nucleotidyltransferase"
FT                   /note="PFAM: protein of unknown function DUF294
FT                   nucleotidyltransferase putative; CBS domain containing
FT                   protein; cyclic nucleotide-binding; SMART: CBS domain
FT                   containing protein; KEGG: pna:Pnap_0480 cyclic
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61756"
FT                   /db_xref="GOA:C6BCP5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCP5"
FT                   /inference="protein motif:PFAM:PF03445"
FT                   /protein_id="ACS61756.1"
FT                   /translation="MPSAFNFAVWPFDCLNQDEQRLVRDAVDIGYYPEGQTILDAGAAP
FT                   LHLFVIIKGRVGQYDGDELIATFGPDDCFDGRALVAGKASSRFVAAEEVVAYQVARQAV
FT                   RDLIAANATFGALLFSDLGSKLSAIAQRQSMETMQSLAVSHVSDAFIRPAHFVDAGTDV
FT                   VSVVKLFQAQNTSNVLVRDGAANPPRVGIFTRSSLQRAVLQGTPLDRLPVGQMSQFSLI
FT                   TVPASAQIGDALTLMLRHRVHRLVVTRGDEILGLLESLDVFSFLANHSYLLTVQINLAQ
FT                   SLDALAQVAAQITRMVTLLTRGGSRIDHVASLVREINARLFERAWQMIAPPELVENSCL
FT                   FVMGSEGRGEQLLKTDQDNALVLRDGYVPPADLQRIVTRFSHALAAFGYPPCPGGIMLS
FT                   RPEWCMTASDFARRIREWLILPSPEGLMHLAIFFDAHAVCGDAALLKQLRRALLELTVD
FT                   NDAVLGRFAAAVEAFSAAPGWRDRLLGFGDSDPVLDVKKEGIFPIVHGVRSLALAHRIL
FT                   DETGTVPRLEALVRAGALDAHMAAELGDSLHFLMTLRLKAGLAEIDAHQPVSSDVHLAR
FT                   LSSLERDLLKDALSTVKRFKALLRQRWRTEWM"
FT   gene            478097..478747
FT                   /locus_tag="Rpic12D_0451"
FT   CDS_pept        478097..478747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0451"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: dac:Daci_5959 DNA polymerase III
FT                   subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61757"
FT                   /db_xref="GOA:C6BCP6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCP6"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ACS61757.1"
FT                   /translation="MGGRLASWLQVLQRQRQMRKLRDPAFRFLLDAPPPGEWVALDCET
FT                   TGLNVRTDEIVSIGAVRIVGNRILTSERMELLIRPQGEMRPESICVHRLRNRDLDSGVS
FT                   IEQAIHALLHFIGSRPLVGYYLEFDVAMLNRVVVSMLGIGLPQPKIEVSALYYDYRFQQ
FT                   LPPYRQQGDPDLDLRFATVMKELDLPTWDAHDALNDAVMAALAFVKLRQLGAA"
FT   gene            complement(478757..479068)
FT                   /locus_tag="Rpic12D_0452"
FT   CDS_pept        complement(478757..479068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0548 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61758"
FT                   /db_xref="GOA:C6BCP7"
FT                   /db_xref="InterPro:IPR019886"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCP7"
FT                   /inference="similar to AA sequence:KEGG:RSc0548"
FT                   /protein_id="ACS61758.1"
FT                   /translation="MSITPGTPARRRWIANMRWIAALLAVWFVVTFVVAFFARDLSMHL
FT                   FNSDWTFAYWVGAQGAPIVYVLITVLYAWRTNRAADAAAEHEEAVQRDTSEPTQPPSI"
FT   gene            complement(479065..480645)
FT                   /locus_tag="Rpic12D_0453"
FT   CDS_pept        complement(479065..480645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0453"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Two-component sensor kinase domain protein;
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: rso:RSc0549
FT                   transmembrane sensor histidine kinase transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61759"
FT                   /db_xref="GOA:C6BCP8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCP8"
FT                   /inference="protein motif:PFAM:PF08521"
FT                   /protein_id="ACS61759.1"
FT                   /translation="MGDRLAWPWRRDRALLRERAGTAPGADGRDDGGDGGGNLTDTLPH
FT                   LEDDATRPVARSLFGEILDWMLAPLLLLWPMSIAVTYLVAKSIANAPYDRALESSAIVL
FT                   SQQLREVNGRVTLQLPISAREILRADETDNIYYQVLGTNGEFVSGDRDLPLPPEEDANA
FT                   GGLVQLRDDHIHGTEIRVAYTFVQRPGPGDKPALVQVAETLDKRAQLANEIIKGVILPQ
FT                   FVILPLAVILVWFGLTRGLAPLNAIQERIRARNPGDTSPIDEGAAPQELTPLVASFNDL
FT                   LGRLEQSVHTQKRFIADAAHQMKTPLAGLRMQAELAQREQSPDELRRTLAHIADSSDRT
FT                   AHLVKQLLSLARMENMGATDGLVPLDICALSRQVVADWLPKAWAKQIDLGFEEPGLPVT
FT                   ISGNATMLAEMLNNLLDNAIRYTPDGGHVTVRVTTAPFEPFVFIDVDDTGPGIPVAERE
FT                   RVMQRFYRILGTQAEGSGLGLAIVREIVQQHGGDIEVLDNVYQASPRLAGARFRITLHR
FT                   ASAGEEATA"
FT   gene            complement(480638..481345)
FT                   /locus_tag="Rpic12D_0454"
FT   CDS_pept        complement(480638..481345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0454"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: rso:RSc0550 response regulator
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61760"
FT                   /db_xref="GOA:C6BCP9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCP9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS61760.1"
FT                   /translation="MRILIAEDDATLADGLTRSLRQAGYAVDQASDGATADAALSAQTA
FT                   QTYDLLILDVGLPRMSGLEVLKRLRSRGAMLPVLILTAADSVEERVKGLDLGADDYMAK
FT                   PFALSELEARVRALVRRGTGGGATLVRHGPLAFDQVGRIAYIHDQVVELSAREIGLLEI
FT                   LLARVGRLVSKEQLVDHLCGWGEEVSNNAIEVYIHRLRKKIEVEGIRIATVRGLGYCLE
FT                   RVATPTTTAAAHG"
FT   gene            481611..482669
FT                   /locus_tag="Rpic12D_0455"
FT   CDS_pept        481611..482669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0455"
FT                   /product="recA protein"
FT                   /EC_number="3.6.3.8"
FT                   /note="KEGG: rso:RSc0551 recombinase A; TIGRFAM: recA
FT                   protein; PFAM: RecA domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61761"
FT                   /db_xref="GOA:C6BCQ0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCQ0"
FT                   /inference="protein motif:TFAM:TIGR02012"
FT                   /protein_id="ACS61761.1"
FT                   /translation="MEDGKKAATMSAEKQKALAAALAQIEKQFGKGSIMKMGDAEVEPV
FT                   QVVSTGSLGLDVALGVGGLPRGRVIEIYGPESSGKTTLTLQVVAEMQKLGGTCAFIDAE
FT                   HALDVTYADKIGVSVPDLLISQPDTGEQALEIADALVRSGSVDLIVIDSVAALVPKAEI
FT                   EGEMGDALPGLQARLMSQALRKLTGTIKKTNCMVIFINQIRMKIGVMFGSPETTTGGNA
FT                   LKFYASVRLDIRRIGSIKRGDDVVGNETKVKVVKNKVAPPFREAIFDILYGQGVSREGE
FT                   IIDLGVEAKVVEKSGAWYSYGGERIGQGRDNCREYLRENPDLAREIENKVREQLGVTPM
FT                   GAVAVAEEVGEE"
FT   gene            482780..483259
FT                   /locus_tag="Rpic12D_0456"
FT   CDS_pept        482780..483259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0456"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: rso:RSc0552
FT                   recombination regulator RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61762"
FT                   /db_xref="GOA:C6BCQ1"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCQ1"
FT                   /inference="protein motif:PFAM:PF02631"
FT                   /protein_id="ACS61762.1"
FT                   /translation="MPLPRQPLSLKARALGYLSRREHSRVELRRKLVPHAESAEEVDAL
FT                   LDWLESQNWLSNARFAESMVHRRAGRYGTARLMQELKTHQLGEETLGEVKAQLQSTEAA
FT                   RAKALWEKRFGRPPADLAERAKQVRYMMARGFSRSVVSRIIAGADELLEDGDMSD"
FT   gene            483546..484172
FT                   /locus_tag="Rpic12D_0457"
FT   CDS_pept        483546..484172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0553 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61763"
FT                   /db_xref="InterPro:IPR021312"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCQ2"
FT                   /inference="similar to AA sequence:KEGG:RSc0553"
FT                   /protein_id="ACS61763.1"
FT                   /translation="MPLSAPLPRSMRHRRAITVEAYLREDGLWDIEARLTDIKPRDIPL
FT                   ASGGVRPEGEPLHDLWLRVTIDTRMNVVDAEACSDWVPYPTHCDTIGPAYRKLIGLNLM
FT                   KGFRKASRERLGGVAGCTHLTELCGVLPTAAIQAFAGDVFPVRDNSNDLRPIEPGEKPP
FT                   YQLHGCHALHLEGEVVRKHYPRWFAYQPEAKIQPPPTELSLEPSS"
FT   gene            484239..485405
FT                   /locus_tag="Rpic12D_0458"
FT   CDS_pept        484239..485405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0458"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="KEGG: rso:RSc0554 succinyl-CoA synthetase subunit
FT                   beta; TIGRFAM: succinyl-CoA synthetase, beta subunit; PFAM:
FT                   ATP-grasp domain protein; ATP-citrate lyase/succinyl-CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61764"
FT                   /db_xref="GOA:C6BCQ3"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCQ3"
FT                   /inference="protein motif:TFAM:TIGR01016"
FT                   /protein_id="ACS61764.1"
FT                   /translation="MNIHEYQGKEILRKYNVPVPRGIPAFSVDEAIKAAETLGGPVWVV
FT                   KAQIHAGGRGKGGGVKVAKSIEQVKEYASSILGMTLVTHQTGPEGKLVKRLLIEEGADI
FT                   KKELYVSLVVDRVSQQVALMASSEGGMDIEEVAESHPEKIHTLLIDPQAGLQDAQADDI
FT                   ARKIGVPDASIAQARQALQGLYKAFWETDASQAEINPLILTGDGKVIALDAKFNFDSNA
FT                   LFRHPEIVAYRDLDEEDPAEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGG
FT                   EPANFLDVGGGATTEKVTEAFKLMLKNPDVKAILVNIFGGIMRCDVIAEGVIAAAKAVS
FT                   LSVPLVVRMKGTNEDLGKKMLADSGLPIIAADTMAEAAEKVVAAAAGK"
FT   gene            485494..486375
FT                   /locus_tag="Rpic12D_0459"
FT   CDS_pept        485494..486375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0459"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /note="TIGRFAM: succinyl-CoA synthetase, alpha subunit;
FT                   PFAM: ATP-citrate lyase/succinyl-CoA ligase; CoA-binding
FT                   domain protein; KEGG: rme:Rmet_0470 succinyl-CoA synthetase
FT                   subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61765"
FT                   /db_xref="GOA:C6BCQ4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCQ4"
FT                   /inference="protein motif:TFAM:TIGR01019"
FT                   /protein_id="ACS61765.1"
FT                   /translation="MSILINKDTKVITQGITGKTGQFHTRGCRDYANGKNCFVAGVNPK
FT                   KAGEDFEGIPIYATVKDAKAQTGATVSVIYVPPAGAANAIWEAVEAELDLVVCITEGIP
FT                   VRDMMMVKDKMRKAGSKTLLLGPNCPGLITPDEIKIGIMPGHIHRKGRIGVVSRSGTLT
FT                   YEAVGQLTALGLGQSSAVGIGGDPINGLKHIDVMKMFNDDPETDAVVMIGEIGGPDEAN
FT                   AAYWIKDNMKKPVVGFIAGVTAPPGKRMGHAGALISGGADTAQAKLDIMEECGIKTTKN
FT                   PSEMARLLKAML"
FT   gene            486524..487219
FT                   /locus_tag="Rpic12D_0460"
FT   CDS_pept        486524..487219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0460"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   rso:RSc0556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61766"
FT                   /db_xref="GOA:C6BCQ5"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022301"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCQ5"
FT                   /inference="protein motif:PFAM:PF03741"
FT                   /protein_id="ACS61766.1"
FT                   /translation="MALTSSAFWFALGSIILTNIVLSGDNAVVIALAARNLPKRQQKQA
FT                   IFWGSAGAIVLRVVLTVLAVKLLALPYLKTIGAVLLVYIGVKLLTDAEDEAADHHQRDG
FT                   LWPAIQTILIADFVMSLDNVVAVAAAAEKGPPGTTFLLLVLGLGLSVPLIVFGSTLLVG
FT                   VMARFPVIITLGAALLGYLAGDMLVTDPIDAAWFERAVPYADVVVGCVGALLVVGVGRW
FT                   LSRRTLRQA"
FT   sig_peptide     486524..486595
FT                   /locus_tag="Rpic12D_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.744) with cleavage site probability 0.709 at
FT                   residue 24"
FT   gene            487403..487906
FT                   /locus_tag="Rpic12D_0461"
FT   CDS_pept        487403..487906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0461"
FT                   /product="fimbrial protein precursor PilE (MS11 antigen)"
FT                   /note="KEGG: eba:ebB136 fimbrial protein precursor PilE
FT                   (MS11 antigen)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61767"
FT                   /db_xref="GOA:C6BCQ6"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCQ6"
FT                   /inference="similar to AA sequence:KEGG:ebB136"
FT                   /protein_id="ACS61767.1"
FT                   /translation="MGFKHSKETTRRAGGFTLIELMIVVAIVGILAAIALPAYNNYMVK
FT                   SKLTEAIATLDSARVAVNEAYTSGGGVFPAQPPVVVQAVANNAKYVTGIQYNLGPASTV
FT                   GVVVKLGNTGAASIDNAYLGIFGQGKVDGTVAWACSTARTPGDFASGAAMTAMYPYLPL
FT                   ACQN"
FT   gene            complement(487897..487995)
FT                   /locus_tag="Rpic12D_0462"
FT   CDS_pept        complement(487897..487995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61768"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCQ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61768.1"
FT                   /translation="MALLPPSFPPRLSAEDFCLECMNTGKDWHLQF"
FT   gene            488360..488863
FT                   /locus_tag="Rpic12D_0463"
FT   CDS_pept        488360..488863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0463"
FT                   /product="type 4 fimbrial pilin signal peptide protein"
FT                   /note="KEGG: rso:RSc0558 type 4 fimbrial pilin signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61769"
FT                   /db_xref="GOA:C6BCQ8"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCQ8"
FT                   /inference="similar to AA sequence:KEGG:RSc0558"
FT                   /protein_id="ACS61769.1"
FT                   /translation="MKSMRLNKRVQKGFTLIELMIVVAIVGILAAIALPAYNNYMIKSK
FT                   LTEATTLMDSFRSALSEAFANNGNSFPVASPISLTTPGNTKYVGGITYNPTAGATPNNV
FT                   SVTFQVGSTGAAAIDGKYLGLFGIGRADGTVQWVCGTATNGGASAAGATMSAMFPYLPA
FT                   ACQN"
FT   sig_peptide     488360..488461
FT                   /locus_tag="Rpic12D_0463"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.568 at
FT                   residue 34"
FT   gene            489060..490832
FT                   /locus_tag="Rpic12D_0464"
FT   CDS_pept        489060..490832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0464"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: rso:RSc0559
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61770"
FT                   /db_xref="GOA:C6BCQ9"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCQ9"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ACS61770.1"
FT                   /translation="MLRSCFLLSPLWVVIAMCGMVPFVVAPHSYPLPTFYAEFAAGICW
FT                   IALAVVVLALTWRNKARLPAIALAPFALVGVLFAQLLIAPPLNPSYSLEATVFLLAAAA
FT                   ACGLGARCRNLPGVLEAFAIGLVLGGLATVAVELLQLFRVQGLPIAFFSILPAGTDRRM
FT                   WGNINQPNLLASYLAFGIAASGFLAHRCRHARIPLALIAVIFLLGMSLAFSRTAWLHIV
FT                   VLGTLAGAIWTLEQRGWRRWVKACVPALVLLVTYQLCNWLVAYANIRWHLDLPTSMGER
FT                   INEGVGPRAVLWQHAWHMFVVHPWLGGGWGDYAWNQYLQTDQLGRAVMATNAHNIVLDQ
FT                   LAKLGVLGLLAVALPFLGFVWNLRKRRATPGMAFLLGTILVMGAHSMLEFPLHYLFFLL
FT                   PFAFALGYLDERSLPAPSSSMAWTLTAVLSVGAAALMSHLWGDYRAVERLNYAPDGPAA
FT                   EWARYQQHGSTLLLPYEQLVISINLRVAPDMASSLLKMGLQAAQFYPVGSTVQRYALGL
FT                   AYQGKTDEAVLQIRRLRDEYWYETDYVPQIGLLIQLCSRKNDTLAAFCTRLKSEKLLVE
FT                   PGAETQTRPVQMSK"
FT   sig_peptide     489060..489149
FT                   /locus_tag="Rpic12D_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.721) with cleavage site probability 0.689 at
FT                   residue 30"
FT   gene            490829..490936
FT                   /locus_tag="Rpic12D_0465"
FT   CDS_pept        490829..490936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61771"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCR0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61771.1"
FT                   /translation="MKAIDSRWDDHRGEDLRWMEFRFTKRSPAAKTMLP"
FT   gene            491010..492779
FT                   /locus_tag="Rpic12D_0466"
FT   CDS_pept        491010..492779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0466"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: rso:RSc0559
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61772"
FT                   /db_xref="GOA:C6BCR1"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="InterPro:IPR021797"
FT                   /db_xref="InterPro:IPR031726"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCR1"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ACS61772.1"
FT                   /translation="MSRPLPLLLPLWLAIAACWSVPFLIAPHTYPIPTFYAEYAAAVCW
FT                   AALTLCVLALTWGSKAGFPVIVTAPLALIGALALQLVVAPPINTFFSIAASAFLLAAVV
FT                   ATWLGARCRDVPGVLAALAIGVIVGGMLTVAVELLHLFRVPRLPSAFFSMTPLGTGRRM
FT                   WGNLNQPNHVGSYLAFGLAACVFVAQEFKRWRLALAVIAVIFLLGMALTISRVTWMHVV
FT                   VVGALAGLAWSASARGLRRWLAVGASVLLLVAVYEACNWFVSYANVLWHLDLPGSLGER
FT                   MQEGVGPRAALWQHAWHMFLAHPWLGGGWGDYAWNQYVQTDRLGNVAMSLNAHNIVLDL
FT                   LAKVGLLGLFAVTLPFLSFAWSLRKQPITPARAFLLAIILVLAAHSMLEYPLHYLFFLL
FT                   PLAFALGYLDTRTLRFGSGRIAWASTGIVALGAIALLMQLWGDYASAERLQYGSASQPP
FT                   LLTRDHQHAPTLLLPYENEAMASRWNVGPATAASLVTLERQAVQFYPGPSTVQRYALAL
FT                   AYLGKTEEAVIQVRRLHSHYWTDYADQSWLLKQACGQKSGDALETFCVRLKSEKLLATA
FT                   DNPSGGEPLAASK"
FT   sig_peptide     491010..491072
FT                   /locus_tag="Rpic12D_0466"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.844) with cleavage site probability 0.798 at
FT                   residue 21"
FT   gene            492951..493466
FT                   /locus_tag="Rpic12D_0467"
FT   CDS_pept        492951..493466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0467"
FT                   /product="type 4 fimbrial pilin signal peptide protein"
FT                   /note="KEGG: rso:RSc0558 type 4 fimbrial pilin signal
FT                   peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61773"
FT                   /db_xref="GOA:C6BCR2"
FT                   /db_xref="InterPro:IPR001082"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCR2"
FT                   /inference="similar to AA sequence:KEGG:RSc0558"
FT                   /protein_id="ACS61773.1"
FT                   /translation="MHSKRQISNKDQAGFTLIELMIVVAIVGILAAFAMPAYQDYMGRS
FT                   RVAEGLALAAGAKAIVAENAMAGGSDLSHGFAPNSVATRNVVANGVEVNPKNGEISIKY
FT                   ASNVAKEGANLLVLKPTANGIALAQSERPTGPIRWDCYVADTPKRTDIEKPETGGTLPK
FT                   NIAPAECS"
FT   sig_peptide     492951..493055
FT                   /locus_tag="Rpic12D_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.807) with cleavage site probability 0.685 at
FT                   residue 35"
FT   gene            complement(493532..494008)
FT                   /locus_tag="Rpic12D_0468"
FT   CDS_pept        complement(493532..494008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0468"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: rso:RSc0560 molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61774"
FT                   /db_xref="GOA:C6BCR3"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCR3"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ACS61774.1"
FT                   /translation="MSQLTHFDAAGQAHMVDVGDKAVTHRVAVATGTIRMLPETFALVR
FT                   DGNAKKGDVLGIARVAAIQGSKRTSDLIPLCHPLALTKVAVEFSLDEASHTVRCTVRAE
FT                   TRGQTGVEMEALTAVQVGLLTIYDMCKAVDRGMVIGDVRLLEKHGGKSGDWVAG"
FT   gene            494114..495817
FT                   /locus_tag="Rpic12D_0469"
FT   CDS_pept        494114..495817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0469"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; Tetratricopeptide TPR_2
FT                   repeat protein; KEGG: rso:RSc0561 putative signal peptide
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61775"
FT                   /db_xref="GOA:C6BCR4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCR4"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACS61775.1"
FT                   /translation="MTLSLFRPRVRKLTAAMLLSTWLAPLPLPVLAQVAASAPAASVNP
FT                   GLGSAAAADQVQSNLNRSVQIGRQSPYLPKEPTVIDAPTYELPDMGDPSTASLSPEVER
FT                   RLGDRVMRQIRRDPDFVPDPLITDYLNTIGYKLIEAARRQHVAGSTSASSFELFAVRDP
FT                   GINAFALPGGYIGVNTGTLVATESESELASVLGHEIGHVLQRHIARGIDKSGESMWIAL
FT                   ASILLAGLAATKSGDAAQALAMGGQAAAVSNQLAFSRGAEREADRVGFTLLTGAGYNPD
FT                   GMPDFFRRLQRVTNIADTGVIPGYARTHPLTSERIADMEDRARGLPHPRQPRRPEFGFA
FT                   KVRARVLQETSTSGYIDVRNAMRSQLSSAPDAPVEKRAALWYGVAVANQMAGRLDEAEQ
FT                   ALQEARRLYGNIPGITSGSVELDVTAIELARARNRAPEALTLARAALAAYPLSRAVGIT
FT                   YAQTLLSAGRTDDAIPYLKDKTREDTAQPIWWDMLARAYADKGKRVEQHRALAEKYARD
FT                   GAWGSAVEQLKLARDAGDADFYTLSEVDARLHQMERQYREEKAEDKALPK"
FT   sig_peptide     494114..494212
FT                   /locus_tag="Rpic12D_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 33"
FT   gene            complement(495838..496419)
FT                   /locus_tag="Rpic12D_0470"
FT   CDS_pept        complement(495838..496419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0562 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61776"
FT                   /db_xref="InterPro:IPR021332"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCR5"
FT                   /inference="similar to AA sequence:KEGG:RSc0562"
FT                   /protein_id="ACS61776.1"
FT                   /translation="MDDIVRQAMAKWPNVPNCFGWLALDRRGQWRMRNEYAQANKLSGE
FT                   PIRHTALLDFIVRNYAHDDAGRWFFQNGPQRVFVELDYTPWVAQLSADGAPRAFTTTTG
FT                   AAFSPSGCFLDEQGSVLLSGYVGGFEAEETIAVLHDHDLEPFSSLANWHAEACGAALGT
FT                   LTWGDRTFDIEPIARAEVAKRYGFVARPAE"
FT   gene            complement(496412..497488)
FT                   /locus_tag="Rpic12D_0471"
FT   CDS_pept        complement(496412..497488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0471"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rso:RSc0563
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61777"
FT                   /db_xref="GOA:C6BCR6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCR6"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACS61777.1"
FT                   /translation="MTDPSRHATSLELNLNALLAGPFEPHAFRSPWWLIGGNAQTIVPA
FT                   RLWRFPRIAYRRERWDTPDHDFIDLDWTTHETDAHAPLVVMFHGLEGDSRSHYARLLMD
FT                   ALRGRRWLGVIPHFRGCSGEMNLAPRMYHCGDGAEIAWILERLYRTVCHPQGRKLLVVG
FT                   ISLGGNALLRYLGEQGADARYVTAAATVSAPLDMRAGGAALSKGFNMVYTRMFLRTLKA
FT                   KANAKLDQHPGLYDRDAMMATRTLGQFDNLVTAPLHGFRDVLDYWTRASSKPVLREVRV
FT                   PALVLNARNDPFLPGQHLPGAAEVAPDITLDQPLHGGHVGFLLRHGKTGRVDWMPARVL
FT                   RFFDEVLGRQANAEDAHG"
FT   gene            complement(497523..497963)
FT                   /locus_tag="Rpic12D_0472"
FT   CDS_pept        complement(497523..497963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61778"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCR7"
FT                   /inference="similar to AA sequence:KEGG:RSc0564"
FT                   /protein_id="ACS61778.1"
FT                   /translation="MPRFARLFEAAEDILEAYRDALKRRDADGALKLWLDEDSVSFILP
FT                   DGQRLHGHEQLRGCLDALVEKNPVWIECLSQQVHSSLGVSIFEATEALRFSATATEADL
FT                   YVHTTYVLMQNHEGWRIAHVHSSQAAEERVAASIASVTHSLH"
FT   gene            complement(497989..499014)
FT                   /locus_tag="Rpic12D_0473"
FT   CDS_pept        complement(497989..499014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0473"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase family 9; KEGG: rso:RSc0565
FT                   ADP-heptose--lipopolysaccharide heptosyltransferase II
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61779"
FT                   /db_xref="GOA:C6BCR8"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCR8"
FT                   /inference="protein motif:TFAM:TIGR02195"
FT                   /protein_id="ACS61779.1"
FT                   /translation="MMRKILVVAPNWIGDALMAQPLFAQLKARHPRAQIHAIAPKWVAP
FT                   VLARMPEIARVLPTDLAHGKLQLGSRTMFAQQIKGETFDAAYVLPNSFKSALIPWLAGI
FT                   PLRIGYKGESRLGVLNVRYPNPPKNARPPMVQHYATLAFKPHAKLPDTLPDPKLDVDVQ
FT                   RVAATSAKFGIPGNARLIAFCPGAEYGPAKRWPAEHFAELAQMLRRSFPYAQIVALGSG
FT                   KDRDMANAIVERAPFVRNLCGETSLDEAIELLARAEAAICNDSGLMHVTAALGRPQVAV
FT                   FGSSDPRHTPPLSPAASIMWLHLECSPCFARECPLGHLRCLRDIGPEMVFHELRRLLQP
FT                   Q"
FT   gene            complement(499064..499261)
FT                   /locus_tag="Rpic12D_0474"
FT   CDS_pept        complement(499064..499261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0566 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61780"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCR9"
FT                   /inference="similar to AA sequence:KEGG:RSc0566"
FT                   /protein_id="ACS61780.1"
FT                   /translation="MTTQTATSIEIGADDLPLHCPTAKTPAWNYHPRVFLDIADTGEAK
FT                   CPYCGTVYKLAPGVELKGHH"
FT   gene            499589..500383
FT                   /locus_tag="Rpic12D_0475"
FT   CDS_pept        499589..500383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0475"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: rso:RSc0568
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61781"
FT                   /db_xref="GOA:C6BCS0"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCS0"
FT                   /inference="protein motif:PFAM:PF03591"
FT                   /protein_id="ACS61781.1"
FT                   /translation="MALVRWAAALQRRWEAIDPAERAGFFAGVRAYMPSMPPVLAWGLV
FT                   TGVAMSKSVLTIPQAIGMTIFVYAGSSQLAVLPLLAAGLPIWTVLLTAFIVNVRFIIFS
FT                   AGLMQHFGHLPFMRRVVLGVFNGDLPFVLFTQQYPSAAPQAGKEGYYWGMVLLSFVGWQ
FT                   VSSILGIVAASLFPDAWGLALAGTLALIPVMVSTIRSRATLMAVAVAAVLALVAFKLPY
FT                   RLSLVLAVTGAMAAGLAADEAAARLQWQRRRASQPATDEDDA"
FT   gene            500380..500703
FT                   /locus_tag="Rpic12D_0476"
FT   CDS_pept        500380..500703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0476"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   rso:RSc0569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61782"
FT                   /db_xref="GOA:C6BCS1"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCS1"
FT                   /inference="protein motif:PFAM:PF05437"
FT                   /protein_id="ACS61782.1"
FT                   /translation="MSALQIWLVIAGMTVVTIVTRSLFLIVGDRMTLPTRVQHALRFAP
FT                   AAALVAIVLPDLLWNQGHFDASWTNPRLMAGIAATAFYVATRRMLGMIFVGMGVFTVLR
FT                   LWG"
FT   gene            500706..501602
FT                   /locus_tag="Rpic12D_0477"
FT   CDS_pept        500706..501602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0477"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   rso:RSc0570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61783"
FT                   /db_xref="GOA:C6BCS2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCS2"
FT                   /inference="protein motif:TFAM:TIGR00688"
FT                   /protein_id="ACS61783.1"
FT                   /translation="MSGSNRNGVIFAFLAYTMWGLFPLYFKLLKAVSPIEILSHRVIWS
FT                   LAVMVVILLVKRHGAWLWALRKQPRVVGRYAASTSLLAANWLTYIWAVNHDHVLEASLG
FT                   YFINPLVVVMLAALVLGERLRPVQWVSVALAAAGVAWLTWQAGTLPWIALALAFSFGLY
FT                   GLLRKTSPLGALEGLTLETLLLFPLALAYLGWLASQHQNAFLAASPGTQWLLALAGPLT
FT                   ALPLLLFGAGARRIPLSLLGLLQYVSPTLQLLLGVWLYNEPFAGPKVAGYVLIWAGLAV
FT                   YSAESWMRLRRRTLVPA"
FT   gene            501722..502933
FT                   /locus_tag="Rpic12D_0478"
FT   CDS_pept        501722..502933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0478"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: rso:RSc0571
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61784"
FT                   /db_xref="GOA:C6BCS3"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCS3"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ACS61784.1"
FT                   /translation="MPHVLRLSDLISEGKLAGKRVFIRADLNVPQDDAGNITEDTRIRA
FT                   SVPAIKAALDAGAAVMVTSHLGRPTEGEFKPEDSLAPVAKRLSELLGRDVKLVQNWVDG
FT                   VDVAPGQVVLLENCRVNKGEKKNSDELAQKMAKLCDVYVNDAFGTAHRAEATTHGIAKF
FT                   APVACAGPLLAAELDALGKALGQPARPLVAIVAGSKVSTKLTILKSLADKVDNLIVGGG
FT                   IANTFMLAAGLKIGKSLAEADLVGDAKAIIEMLAARGASVPIPVDVVCAKEFSATAVAT
FT                   VKDVADVADDDMILDIGPKTAAQLAEQLKSAGTIVWNGPVGVFEFDQFGNGTKVLAEAI
FT                   AASSGFSIAGGGDTLAAIAKYNIADKVGYISTGGGAFLEFLEGKTLPAVEILEQRAQNQ
FT                   AAVA"
FT   gene            502982..504421
FT                   /locus_tag="Rpic12D_0479"
FT   CDS_pept        502982..504421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0479"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /note="KEGG: rso:RSc0572 pyruvate kinase; TIGRFAM: pyruvate
FT                   kinase; PFAM: Pyruvate kinase barrel; Pyruvate kinase
FT                   alpha/beta"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61785"
FT                   /db_xref="GOA:C6BCS4"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCS4"
FT                   /inference="protein motif:TFAM:TIGR01064"
FT                   /protein_id="ACS61785.1"
FT                   /translation="MTRATKIVATLGPASSTQEVLTRMIAAGVDVVRLNFSHGAAQDHI
FT                   DRAQLVREVARSVGREVAIMADLQGPKIRVGKFENGKITLEPGDRFTLDARCELGNQER
FT                   VGLDYKELPRDVGPGDLLLLNDGLIVLQVERVVGEEIETIVKIGGDLSNNKGINRQGGG
FT                   LSAPALTAKDMEDIKTAMALGADYVAVSFPKNATDMEMARQLAAVAGAPHNHKTRMIAK
FT                   IERAEAIRPGVLEEILAASDGIMVARGDLAVEVGNAAVPALQKRMIKLARENNKLAITA
FT                   TQMMESMIVNPVPTRAEVSDVANAVLDGTDAVMLSAETAAGRYPVETIEAMAAICVEAE
FT                   KSQTVHLDADFLDQTFSRIDQSIAMGALFTAHHLQVKAIAALTDSGATALWMSRHGINI
FT                   PIYAMTPNVASQRKMALYRNVQSLPLANSTDRDEALHQAEELLVARGVVQRGDFIVLTV
FT                   GEPMGQAGGTNTLKIVRVGMH"
FT   gene            504509..505573
FT                   /locus_tag="Rpic12D_0480"
FT   CDS_pept        504509..505573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0480"
FT                   /product="fructose-bisphosphate aldolase, class II, Calvin
FT                   cycle subtype"
FT                   /EC_number="4.1.2.13"
FT                   /note="KEGG: rso:RSc0573 fructose-1,6-bisphosphate
FT                   aldolase; TIGRFAM: fructose-bisphosphate aldolase, class
FT                   II, Calvin cycle subtype; ketose-bisphosphate aldolase;
FT                   PFAM: ketose-bisphosphate aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61786"
FT                   /db_xref="GOA:C6BCS5"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCS5"
FT                   /inference="protein motif:TFAM:TIGR01521"
FT                   /protein_id="ACS61786.1"
FT                   /translation="MPLVSMRQLLDHAAENGYGLPAFNVNNLEQVQAVMEAAKEAGAPV
FT                   ILQASAGARKYAGESFIKHLIQAAVEAYPEIPLVMHQDHGQSPAICQGAIDLGFGSVMM
FT                   DGSLREDGKTPADFDYNVDVTRRVVEMAHKVGVTVEGELGCLGSLETGMAGEEDGHGAE
FT                   GKLDHSSLLTDPEEAAQFVKATQLDALAIAIGTSHGAYKFTRKPTGDILAISRVKEIHA
FT                   RIPNTHLVMHGSSSVPQELLAIINQYGGKMKETYGVPVEEIQEAIKYGVRKINIDTDIR
FT                   LAMTGAVRKFLAENPDKFDAREWLKPAREAAKQICKARYIQFGCEGQAGKIKPISLSVM
FT                   AQKYQSGDLAQVVQ"
FT   gene            505710..506633
FT                   /locus_tag="Rpic12D_0481"
FT   CDS_pept        505710..506633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0481"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number="6.3.2.6"
FT                   /note="KEGG: rso:RSc0574
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61787"
FT                   /db_xref="GOA:C6BCS6"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCS6"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ACS61787.1"
FT                   /translation="MSATPASSALYESSITSLPLLGRGKVRENYAVGDDKLLMVTTDRL
FT                   SAFDVILGQPIPDKGRVLAQMSDFWFNKLRHIVPTHETGIAPETVVAPDEVDQVRGRAI
FT                   VVKRLKPILVEAVVRGYLAGSGWKDYQATGAVCGVHLAPGLQNAQKLPEPIFTPAAKAE
FT                   MGEHDENISFDEVERRIGPDLAAQIRDVSIRLYKEASDFAATRGIIIADTKFEFGLDEN
FT                   GTLTLMDEALTADSSRFWPADSYQVGTNPPSFDKQFVRDWLEAVRIDGKPWSKTAPAPQ
FT                   LPADVIEKTADKYREALTRLTGESLR"
FT   gene            506649..507158
FT                   /locus_tag="Rpic12D_0482"
FT   CDS_pept        506649..507158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0482"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: rso:RSc0575 phosphoribosylaminoimidazole
FT                   carboxylase catalytic subunit protein; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, catalytic
FT                   subunit; PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61788"
FT                   /db_xref="GOA:C6BCS7"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCS7"
FT                   /inference="protein motif:TFAM:TIGR01162"
FT                   /protein_id="ACS61788.1"
FT                   /translation="MTAQQSAPLVGVVMGSSSDWEVMRHAVDMLTQFGIPFEAQVVSAH
FT                   RMPDDMFRYAEAARGRGLRAIIAGAGGAAHLPGMIAAKTIVPVFGVPVPSKYLRGEDSL
FT                   LSIVQMPKGIPVSTFAIGEAGAANAALAAIATIATTDSALADKLEAFRAQQTEVARGMT
FT                   LPVHGA"
FT   gene            507178..508413
FT                   /locus_tag="Rpic12D_0483"
FT   CDS_pept        507178..508413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0483"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="KEGG: rso:RSc0576 phosphoribosylaminoimidazole
FT                   carboxylase ATPase subunit; TIGRFAM:
FT                   phosphoribosylaminoimidazole carboxylase, ATPase subunit;
FT                   PFAM: ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61789"
FT                   /db_xref="GOA:C6BCS8"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCS8"
FT                   /inference="protein motif:TFAM:TIGR01161"
FT                   /protein_id="ACS61789.1"
FT                   /translation="MADDLNPRLAQAHTAESRALNVPNAILPDAWLGMLGGGQLGRMFT
FT                   HAAQAMGYKVCVLDPDPNSPAGTIAERHLCAGYTDEAALAEMAALCPAVTTEFENVPAQ
FT                   ALDRLEQLGAFVAPRANCVSIAQNRIAEKKFFALCAARTGIHPAPSWVIEHEADIEQLP
FT                   ADLLPGILKIARMGYDGKGQARVSTIEELRAAWGAMQHVPCVLEKMLPLAYEVSVLAAR
FT                   GADGSTATWPLAENVHRDGILFSTIMPSRSVSDDIATRTRAAAAMIAEEMGYVGVLCIE
FT                   FFVLQDGSLVANEMAPRPHNSGHITMDVCETSQFEQQVRAMARLPLGSTRQHSPGRMLN
FT                   VLGDVWFEYGLERTPAWHEVMGHSGAKVHLYGKADARPGRKMGHVNCVGTSAEVVDEAF
FT                   RHAAQVLGLQSD"
FT   gene            508427..509440
FT                   /locus_tag="Rpic12D_0484"
FT   CDS_pept        508427..509440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0484"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; SUA5 domain protein; KEGG:
FT                   rso:RSc0577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61790"
FT                   /db_xref="GOA:C6BCS9"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCS9"
FT                   /inference="protein motif:TFAM:TIGR00057"
FT                   /protein_id="ACS61790.1"
FT                   /translation="MPYRTTSPYNMPSAERLDEAARRLEAGELVAFPTETVYGLGADAE
FT                   NPQAIAKIYAAKGRPSNHPVIVHVVDGADISYWADDVPGIALQLIEAFWPGPLTLILKR
FT                   APHIPAAVAGGQDSIGLRCPSHPVAQALLSRFKRGRGGIAAPSANKFGQVSPTTAQHVR
FT                   DEFGDAVFVLEGDGVDVGIESTIIDLSRLDQGIGPVLLRPGAITPEDIERVTGELPAAP
FT                   DAAAPRASGTLKAHYAPRTPLYLLSAADVPARLAALPADKRIVWLGAPVALRDGCDQRV
FT                   APATPAAYANALYALLRELDRGGYDAIWVETLADTPAWAAVNDRLRRAAAAFETDL"
FT   gene            509586..510629
FT                   /locus_tag="Rpic12D_0485"
FT   CDS_pept        509586..510629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0485"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   rso:RSc0580 putative lipase / esterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61791"
FT                   /db_xref="GOA:C6BCT0"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCT0"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ACS61791.1"
FT                   /translation="MKLRQWMGVVASATLALGLAACGGESDQSGNPNVAKVQRMVVFGD
FT                   SLSDAGTYTPAAAAVGGGKFTTNPGPVWAETVAAQLGVALTPAVMGYANSVQNCPKPGC
FT                   FDYAQGGSRVTDPNGIGHNGGAGALTYPVKQQLANFYSASNNTFNGNNDVVFVFGGNND
FT                   IFYWAAAVATPNSGVTPAIATAQVQQAATDLVGYVKDMISKNATQLYVFNLPDSSLTPQ
FT                   GVAGGAAGQALLHALVGAFNTTLQAGLAGTGARVIDFNSQLTAVIQNGATFGFSNTSVP
FT                   ACDATKINTLVPGAGGSSLFCSANTLVTAGADTSYLFADGVHPTTGGHRLISSNVLQRL
FT                   LADGVTH"
FT   sig_peptide     509586..509657
FT                   /locus_tag="Rpic12D_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.839 at
FT                   residue 24"
FT   gene            complement(510981..511508)
FT                   /locus_tag="Rpic12D_0486"
FT   CDS_pept        complement(510981..511508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0486"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /note="TIGRFAM: molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B; PFAM: molybdopterin-guanine
FT                   dinucleotide biosynthesis MobB region; KEGG: rso:RSc0583
FT                   molybdopterin-guanine dinucleotide biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61792"
FT                   /db_xref="GOA:C6BCT1"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCT1"
FT                   /inference="protein motif:TFAM:TIGR00176"
FT                   /protein_id="ACS61792.1"
FT                   /translation="MSSRKSLLGITGTSGSGKTTLVEQLIARFVHDGRRVAAIKHTHHG
FT                   FDLDSPGKDSHRMREAGSAEVVLVGGERLVLMREYANALEPELDDVLALLSPATDLVIV
FT                   EGYKRSTFPKIEVFRPSLGRQPLWPEIGGVVAVATDSPAAVRPPEGVAVLDLNDVDAVY
FT                   RFAIQQLANASI"
FT   gene            complement(511505..513043)
FT                   /locus_tag="Rpic12D_0487"
FT   CDS_pept        complement(511505..513043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0487"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="KEGG: rso:RSc0584 D-alanyl-D-alanine
FT                   carboxypeptidase; TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61793"
FT                   /db_xref="GOA:C6BCT2"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCT2"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ACS61793.1"
FT                   /translation="MARIRPTRLLNLSRSALACALLLTLGASPLAHAKKAKAHAAPRTT
FT                   AAQARQAAHNPAGLPANVALAFARAHIPLDAVSVFVIRTGTATPILQWNADTGMNPAST
FT                   MKLLTTFAGLDLLGPDFRWKTTAYADSAPVNGTLNGNLYLRGQGDPKLIPEELVKLVSD
FT                   VRRAGVDELAGNIVLDRTYFEGGLSEAPPLDGDSARAYNVAPDALLYSFKTLTFTLSPD
FT                   AGNGAVNIDVSPPLAQLQIDNQLRTTRGGCGDWQTASGANISTQTDGHVIASFGGRYAA
FT                   ACGERVFNIAALTHADFIWGGFLALWQQAGGTTRFTPGLREGKVPRQAVLLATHYGPPL
FT                   SEVVHDIDKYSNNVMARQLFLTIGAEIGRKPASVRQSTEVINRWLAKQNLTMPELVLEN
FT                   GSGLSRIERISARNMGRLLQQADANPNGGVLRDALPVVGVDGTMRNRLTRAGVAGNAEI
FT                   KTGTLNGVRAIAGYVEGEDGQRFVVVSMINHPNASGGQAAHDALLQWIYQGAPR"
FT   sig_peptide     complement(512942..513043)
FT                   /locus_tag="Rpic12D_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 34"
FT   gene            complement(513184..515787)
FT                   /locus_tag="Rpic12D_0488"
FT   CDS_pept        complement(513184..515787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0488"
FT                   /product="DNA ligase D"
FT                   /note="TIGRFAM: DNA ligase D; DNA polymerase LigD, ligase
FT                   domain protein; DNA polymerase LigD, polymerase domain
FT                   protein; DNA ligase D, 3'-phosphoesterase domain protein;
FT                   PFAM: ATP dependent DNA ligase; ATP dependent DNA ligase
FT                   domain protein; DNA primase small subunit; KEGG:
FT                   psb:Psyr_3245 ATP-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61794"
FT                   /db_xref="GOA:C6BCT3"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014143"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR033651"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCT3"
FT                   /inference="protein motif:TFAM:TIGR02776"
FT                   /protein_id="ACS61794.1"
FT                   /translation="MPRHLADYRRKRDFTQTQEPAGARRKADEQRDHGALHFVIQKHDA
FT                   TRLHYDFRLELDGTLKSWAVPKGPSLDPADKRLAVHVEDHPLDYADFEGHIPEGQYGGG
FT                   DVIVWDRGTWRPHGDPRKAYRDGKLKFDLHGEKLHGAWALVRTHLHGTGRHPKEQWLLI
FT                   KERDDQVRASSDYDVTEALPASVITGENIGSKPRGKAKAKSSDGKTGRSEPEQVQPPAG
FT                   AVPAPLPRTLEPQLATLVDGPPAQGEWDYEVKFDGYRILARIDGDTVRLFSRNGRDWTG
FT                   KLPRQARTLQALGLREAWLDGEVVVMGERGVPDFQALQNAFETAHAEHIAYYLFDIPFC
FT                   NGMDLRGVPLRERRALLERILNAAPGDLDREAVLFSGTFHAAPEDLLSSACSMSLEGVI
FT                   GKRADAAYRAGRSPAWIKLKCGQRQEFVIGGYSAPKGSRSGFGALLLGVYDDAGKLRYA
FT                   GRVGTGFNETSLHALHHELTGLTVDTPPFANPPTGSDARDVQWVKPERVAEIAFAEWTR
FT                   EGIVRQAVFQGLRDDKPARNIVREQAKPPSAAARKETRAVHATERKVRPGAERIADVDV
FT                   THPDRVIEKASGTTKADLARYYAGVAEWMLPHLHNRPTSLVRAPDGIDGERFFQKHSAA
FT                   LKLQGITQLDPSLDPGHPSLLAINSAEALVGAVQMGTVEFHTWNALADRIEQPDRIVFD
FT                   IDPDPALPFARVIEATQLMLAMLDELGLKAFLKTSGGHGMHVVVPLTRREASGWDTLKA
FT                   FAQAVVQHMAATFPDRFVAKMGPQNRVGKIFIDYLRNNRGASTVAAYSVRARTGLPVSV
FT                   PIRHDELEGLQSSAQWTLRTLPDRLAKLKGDPWADYAGTRQSVTADMRKRVGAND"
FT   gene            complement(515806..516720)
FT                   /locus_tag="Rpic12D_0489"
FT   CDS_pept        complement(515806..516720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0489"
FT                   /product="Ku protein"
FT                   /note="KEGG: bph:Bphy_0980 Ku protein; TIGRFAM: Ku protein;
FT                   PFAM: Ku domain protein; SMART: Ku domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61795"
FT                   /db_xref="GOA:C6BCT4"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCT4"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ACS61795.1"
FT                   /translation="MPRVIWKGAVSFGLVHIPVALYPATRSDDLDFDWLDRRTMDRVGY
FT                   KRINKTTGKEVPREQIVRGYAYEKDRYVILTDEDIRAANPVSTQTVDLLTFVDAAEIPF
FT                   LYLDTPYFLAPDRRGEKVYALLREALTRSQKIGVANVVLHTKQHLAALIPMGPVLVLHT
FT                   LRWSNEVRDWSELDVPEEGAKAAKLTAKEIDMAEKLIDDMSGKWDPAEYHDTFRDDILG
FT                   LVDRKVREGRTESVEPMETETAAPRSGNVIDLTDLLRQSLAKRGKGKGESAQEAEEEPA
FT                   PRKRAPRKAATKAARKTATRKRA"
FT   gene            516912..518063
FT                   /locus_tag="Rpic12D_0490"
FT   CDS_pept        516912..518063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0490"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RSc0585 putative transport transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61796"
FT                   /db_xref="GOA:C6BCT5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCT5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS61796.1"
FT                   /translation="MPPRRLPLSARAATMALFFANGATFATWGIHIPTVKARFGLSEAS
FT                   LSLAMFMVAAGAIVAMKFAGQWAARVGTRRASVQGGVAFGVMTALIMLMPTYPALLAVL
FT                   LLFGITNAGFDVAMNAQAATVEANHHKPIISSLHGMFSLGGMAGAAVGGVLLELGVPPA
FT                   VHCGGMALVTMAAALCAGPFMLPDHMHAEGESAHPTTGRTLFLLGVLAFLGLVGEGAMY
FT                   DWTTVYMREIAQSPEAIASAGYAAFSGGMALARFGGDFARGRWGNMRVLGASGVLATGG
FT                   ILLALLWPAPMAVLTGFALMGVGAANMVPIFFITASRLPGVPAAEGIAAVARFAYVGLL
FT                   IGPVIIGLIAHRSDLRWGLSVVALTMAMIALAGPRAIRLPEHR"
FT   sig_peptide     516912..516992
FT                   /locus_tag="Rpic12D_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.791 at
FT                   residue 27"
FT   gene            518276..518665
FT                   /locus_tag="Rpic12D_0491"
FT   CDS_pept        518276..518665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0586 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61797"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCT6"
FT                   /inference="similar to AA sequence:KEGG:RSc0586"
FT                   /protein_id="ACS61797.1"
FT                   /translation="MPYKRLTLVAAVAVVAAVGTVAHAQTDQKKFDPYSQGAKVGDKFD
FT                   PYQQGAKAGDKFDPYSQGANKNDSTASALNPGAQPANVEKGKYDTYTQGAKAGEKFDPY
FT                   SQGAKAGGKFDPYSEGANKKDAPKQ"
FT   sig_peptide     518276..518350
FT                   /locus_tag="Rpic12D_0491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 25"
FT   gene            518685..519497
FT                   /locus_tag="Rpic12D_0492"
FT   CDS_pept        518685..519497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61798"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCT7"
FT                   /inference="similar to AA sequence:KEGG:RSc0587"
FT                   /protein_id="ACS61798.1"
FT                   /translation="MKTLMHRPMHRRFSLWNAAAAAAIALALPAQAAGLCSAPWVHDGS
FT                   RVRLDGNGKTPMIVEFTLHDVSHDMQDGCEIGLHIYAKSGLVALGGRPIETVQEHQLLV
FT                   DEAGVVTRIVSINGRVFAQSEHADLVGTVSTAISGMFLYGAGLAPEAQMLPGDTYESSF
FT                   DFDVVSPRLGISVGRMRAERAKVEVSEREVGPPQPMNTVVGQLQCRPIRYTRTARLGVL
FT                   RLGNETLEPDPTVAHITDWYCPEAAVVMRQEVEQHGQTQVIDVVELKR"
FT   sig_peptide     518685..518783
FT                   /locus_tag="Rpic12D_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            complement(519487..520275)
FT                   /locus_tag="Rpic12D_0493"
FT   CDS_pept        complement(519487..520275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0493"
FT                   /product="protein of unknown function DUF1045"
FT                   /note="PFAM: protein of unknown function DUF1045; KEGG:
FT                   reh:H16_B1290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61799"
FT                   /db_xref="InterPro:IPR009389"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCT8"
FT                   /inference="protein motif:PFAM:PF06299"
FT                   /protein_id="ACS61799.1"
FT                   /translation="MQQARAPLSSSIPTAWRYALYLLPPEPWYGLGTRWLGRCARTNTA
FT                   ISADQREAFVREAGIDLATLDRWTEAPRQYGLHATFKPPFRLASDRTVDELDAALRGFA
FT                   LQQQAFTIEPALQTLRGFLAWRLRHGDPARDTLHAFADACVSEFDAFRAPPPPAELARR
FT                   RRVGLSDAQELHLQHWGYPYVFGTFTFHITLTGRLDHAEQLACYRALEATRVVLPAAMP
FT                   IDHIALFSQAAPEAPFNVVRVYWFDGSTEDFSAAHGTPSA"
FT   gene            complement(520284..521459)
FT                   /locus_tag="Rpic12D_0494"
FT   CDS_pept        complement(520284..521459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0494"
FT                   /product="Amidohydrolase 3"
FT                   /note="PFAM: Amidohydrolase 3; amidohydrolase; KEGG:
FT                   reu:Reut_B4184 amidohydrolase:amidohydrolase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61800"
FT                   /db_xref="GOA:C6BCT9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCT9"
FT                   /inference="protein motif:PFAM:PF07969"
FT                   /protein_id="ACS61800.1"
FT                   /translation="MQSFSSSVGHVAGLISRRALLAEGLAEAAVQFRDGQIAACDGSPT
FT                   RGMIDYGDLLVLPGIVDLHGDAFERAVMPRPGVAFPYETALADVDGQLLACGITTEFHG
FT                   VTYSWEGGLRGRAYAVRMLDTLDAMRPHLGAQHLMHLRFELHHADGVADALAWMDAGRV
FT                   HFLSFNDHLPMMRDKLGDARKLAQYADRAECDIDTFLARLNAAAANATRLNEVTGTLAR
FT                   AAQQRGICMASHDEPDIATRNTFHAHGCTVTEFPLTEDVARAARAHGGHTVFGAPNVVR
FT                   GGSHHGAPNASAMVAAGLGTVLASDYYYPALLAAPFKLAERGVVPLAEAWALVASNPAE
FT                   AAGLTDRGVLAPGLRADAIVVDDRRPGLPRVVAAVVGGRLRHAAGQLPLIG"
FT   gene            521630..524353
FT                   /locus_tag="Rpic12D_0495"
FT   CDS_pept        521630..524353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0495"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC and GAF sensor(s)"
FT                   /note="KEGG: rso:RSc0588 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; GAF domain
FT                   protein; PAS fold domain protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein; GAF domain
FT                   protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61801"
FT                   /db_xref="GOA:C6BCU0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCU0"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS61801.1"
FT                   /translation="MDATSAERPDRPEPDVIDQDSPRPLPLADDRYEALVRQMPDALYI
FT                   VADDIIVFVNEAGVRLFGAQTARDIVGHELDEFVHDNSMHLARQRREWMVSHGAGLPPV
FT                   EQTLLRCDGTPVEVEVLSAPVQLGWRTAIQVVARDITQRKQAEQALRESEANYRALAAE
FT                   TARAKELLRCEKTVLELSSRNVPLPDLLAEVCRLVEALLDDGAMCSVLLSGDGEHVTQA
FT                   VAPSLPCTLSQVLVGIAIGPSVGSCGTAMFLNKTVVVEDIDADPLWDGYRDIVAPLGLR
FT                   ACWSTPIRGDNAQMIGAMGIYYDSPRAPTRDAMGLLDGITDIIGVAVQKAHIARDLRES
FT                   EERYRLAVDNLTEGIVVQAADGTILACNPSARRILRAGSVSPVGTSHLALMRRSLREDG
FT                   SEIPVNERPTRVVLATGRPLLGLTVGLELVDGDVVWVHENVLPIVRPGDDTPSAVLISF
FT                   NDIGPARAAQQQLTFLAQRDALTGLYNRAYFSQRMQAVMEQAASQANEARQVAVLFLDL
FT                   DGFKKVNDTAGHEAGDHLLRIVAQRLSACVRQSDTLARLGGDEFVVLLDNVRSLGEAER
FT                   LAKRIVHSIAQPFSTSGTEYYLGASIGIALYPEHGNDAATLLRCADAAMYNAKQNGRNQ
FT                   HRVYTARLSQRAQRRFQLEYHLRRALTAGELSLRFQPIVDATSMDIVGAEVLLRWHSTE
FT                   LGEVSPAEFIPVAEDAGLIGDIGEWVLAQACRQAAHWRATCMPEFFVAVNLSPRQFGEG
FT                   LVPTISRCLTEAGLPASALEMEITEGLLMRDTAAVMPMLDALTALGIRISIDDFGTGYS
FT                   SLSYLQRFPIDNLKVDRSFVSGIPRHRDSVVISRAVVAMAASLDMTVTAEGVETLEQAE
FT                   FLQAAGCDKLQGFLFGPPMTAAAYESRLRRDRSARA"
FT   gene            524503..525915
FT                   /locus_tag="Rpic12D_0496"
FT   CDS_pept        524503..525915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0496"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: bph:Bphy_1275
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61802"
FT                   /db_xref="GOA:C6BCU1"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCU1"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS61802.1"
FT                   /translation="MKPFAWGRGPKASPDLVARIAEEAGRVGMGICEVSGNVEDVAVRL
FT                   RRQADVFDQLRNAADVTMRGNHDIAVAARHAREVASHASEEVSGSRETVDASLRDIREL
FT                   AVGVASMEQQIAALREALIQVAQASEQISQIAKQTNLLAINAAIEAARAGESGRSFAVV
FT                   AGAVKQLAGQTAEATQRIETTLADLSGQTDKLIGDSSANVARAQRVDAGTQAIGAVIGV
FT                   AGEAIARFDVEATSIAESTAAIEDECASLAREVEAMAEGVKQSSHNIDNAQRQLSGLLG
FT                   ASETLIRLTASTGVQSADTPFIEAVQTAAGKISALFESALARGDISESDLFDRTYAPVP
FT                   NTDPPQHMTRFTAFTDRVLPAVQEPLLQLDPRVVFCAAVDTNGYLPTHNLKFSQPQGSD
FT                   PVWNAANSRNRRLFTDRTGLGAARNTEAFLLQTYRRDMGNGTFAMMKDVSAPIYVKGRH
FT                   WGGFRMGYKVAG"
FT   gene            complement(526264..527586)
FT                   /locus_tag="Rpic12D_0497"
FT   CDS_pept        complement(526264..527586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0497"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rme:Rmet_1926 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61803"
FT                   /db_xref="GOA:C6BCU2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCU2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS61803.1"
FT                   /translation="MSQTQALPANPTDPASRPLPSTELEATYRRIAYRLVPFLVVLFIL
FT                   AWIDRVNVGFAKLSMLQDLQFSEAVYGLGAGIFFIGYFLFEVPSNLLLEKIGARKTLAR
FT                   ITILWGLASMAMIYVKTPTSFYVMRFLLGIFEAGFFPGVVLYLTYWFPSAHRARINGLF
FT                   MTSFAIAGVVGGPVAGFIMSRMEGVGHLANWQWLFLLEGIPSVLAGFAVLAWLPETPRQ
FT                   AKWLSAAEQDAVVRAVEAENHDPAKHASFGAALANARVWVCAAIYFCVVSGNATIAFWT
FT                   PSIIKELGVQGNFQIGLIAAIPFIAGTIAMVWNGAHSDRTGERRMHCAIAAVIAAAGLV
FT                   ATGALLGSPALALISLTVAAIGILAAFPVFWSIPAVFLAGTAAAGGIALINSIGNLAGF
FT                   VAPYMIGWLKTSTGHLSAGLYFVATLELGAAVLVILGTRKH"
FT   gene            complement(527756..529117)
FT                   /locus_tag="Rpic12D_0498"
FT   CDS_pept        complement(527756..529117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0498"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: rso:RSc0589 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61804"
FT                   /db_xref="GOA:C6BCU3"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCU3"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACS61804.1"
FT                   /translation="MMTPRPNMIRALAAALAAGRTTSVALTEAALERAESHRAAGGTAY
FT                   VSIDVQAALAMARAADAARAAGNVPSLLAGLPVSIKDLFDVAGQVTAAGSRALADQPRA
FT                   TADAAAVARLRAAGAVLLGRTNMSEFAFSGLGLNPHYGTPRTPADGARAAGGSTSGGAV
FT                   TVAGGMAVAALGTDTGGSIRIPSAFCNLTGFKPTARRVPMTGGVPLSTSLDSGGPLANS
FT                   VDCCAIVDAVLSGESGNDAFDTAAVPLAGLRFGVTQDYVGADLDNTVAVAFERAVERLE
FT                   RAGAHIVRFEFPELLQLPEINSGGGFSAAESWAWHRSLLARAEAQYDPRVATRIRRGEQ
FT                   MSAAAYIDVINARARMIAAARKRLGHFDAWLMPTVAIVPPEVAPLEADDAAFFRVNALA
FT                   LRNPSVINFLDGCALTLPVHAAGELPVGLSLCGLANDDARILRVGRAVEAALRR"
FT   sig_peptide     complement(529040..529117)
FT                   /locus_tag="Rpic12D_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.751 at
FT                   residue 26"
FT   gene            complement(529145..529822)
FT                   /locus_tag="Rpic12D_0499"
FT   CDS_pept        complement(529145..529822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_1928 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61805"
FT                   /db_xref="GOA:C6BCU4"
FT                   /db_xref="InterPro:IPR021269"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCU4"
FT                   /inference="similar to AA sequence:KEGG:Rmet_1928"
FT                   /protein_id="ACS61805.1"
FT                   /translation="MTTLHLNLIGHGPIDVTVDHLVIAGWTGRDAQAVEHHIAELEAIG
FT                   VARPARVPCFYRVSASLLTTDATVEIPGADSSGEAEFVLYSTPMGLLVGIGSDHTDRKV
FT                   EAYGVTVSKQMCAKPVSRDVWRFEALADHWDSLQMKTWRTRDGQTALYQEGGVTRMLDP
FT                   RDLIRRYTGNDTLPVGTAMFCGTQPIIGELGFGEAFDMALIDPVSGTELRHRYAVDTLP
FT                   VEG"
FT   gene            complement(529869..530591)
FT                   /locus_tag="Rpic12D_0500"
FT   CDS_pept        complement(529869..530591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0500"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   rme:Rmet_1929 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61806"
FT                   /db_xref="GOA:C6BCU5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCU5"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACS61806.1"
FT                   /translation="MSRPIKLVSGSAQTAPASAPFAVEPAAHAPKGAAMRELAYNEIKR
FT                   RIMACEFRPGEPLNEAQLGALLGLGRTPIHQALHRLEVEGLVQILPRKGVLVTPLSLND
FT                   VLDMIEVRATNEILCVTLAAERAHPADFEAMRAIVEASPALIEHRDIAALAALDLKFHL
FT                   AISAASRNRVLAELLRGLHEKQARFWFLSLSEPQHLQNVYDEHLAVLDALERRDVPAAR
FT                   EAIREHIDEFRRTIIRTL"
FT   sig_peptide     complement(530523..530591)
FT                   /locus_tag="Rpic12D_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.976 at
FT                   residue 23"
FT   gene            530768..532033
FT                   /locus_tag="Rpic12D_0501"
FT   CDS_pept        530768..532033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0501"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG:
FT                   cti:RALTA_A0534 putative salicylate 1-monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61807"
FT                   /db_xref="GOA:C6BCU6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCU6"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACS61807.1"
FT                   /translation="MKIAIIGAGIGGLTLALMAERQGFEVEVWEAVQTLRPLGVGINLL
FT                   PHAARQLCELGLEDTLSALAIRTSALAYYNRFGQPIWHEPRGLAAGYDWPQFSIHRGEF
FT                   QMALADAVIERLGANCIRLGHSFEAVQSTGEKGGPVRFTLRDRTNDTVVESSADVLIGA
FT                   DGIHSAVRRHFYPTGDAPRFAGRMLWRAVTEAEPYLDGRTMFMAGHQDQKFVAYPISEP
FT                   LRQQGRSRINWIAELRVPDEAPPRSDWNREVDRAIFRSAFADWKWNWIDIPALIDGAQA
FT                   VYEFPLVDKDPLPRWTFGRVTLLGDAAHPMYPIGSNGSAQAILDARALVDCLLATRDTG
FT                   VALREYEADRLPRTAGIVLRNRLNGPEQVMQLAHERAPQGFASIHDVIPRAELEGIAMR
FT                   YKKLAGFDPQSLRDQPPMPRRA"
FT   sig_peptide     530768..530827
FT                   /locus_tag="Rpic12D_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.867) with cleavage site probability 0.825 at
FT                   residue 20"
FT   gene            532079..533212
FT                   /locus_tag="Rpic12D_0502"
FT   CDS_pept        532079..533212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0502"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   reh:H16_A0577 ABC-type transporter, periplasmic component:
FT                   HAAT family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61808"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCU7"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACS61808.1"
FT                   /translation="MTIRRTLCAAAALLLATAAHADIVVGVSLSTTGPSASLGITQKNS
FT                   LAFYPDAIGGEKLRLVVVDDASDPSTGTRLARKLVTEDHVDIIVGSSAVAPSIAIAEVA
FT                   TESHTPQLALAPVELKPGKGDWTYRLAQPISLMAEAIATRMAASGIKNVGFIGFADAYG
FT                   ESWLKDFTAAATPRGIKIVDVERYARADTSVTGQVAKLVSIKPDAVLVAGAGTGAALPH
FT                   TALRDRGYVGPIYQTHGAATKDLIRIGGKAVDGAILPAGPVIVAEQLPDSHPSKKTAIE
FT                   YVTRYEKANGPDTRTQFGAHTWDALQVLQRIVPVALKKAKPGTLEFRQALKNALESEHD
FT                   IVVSHGVLNYTSTDHFGFDARGRVLLTIDHGKWKLLN"
FT   sig_peptide     532079..532144
FT                   /locus_tag="Rpic12D_0502"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            533286..533801
FT                   /locus_tag="Rpic12D_0503"
FT   CDS_pept        533286..533801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0503"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: rso:RSc0590 putative transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61809"
FT                   /db_xref="GOA:C6BCU8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCU8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACS61809.1"
FT                   /translation="MPRTPKADDLYPAVAPSGHFNPHLADVEYGALDGLVGYAVRRAQL
FT                   HIYEDFVRSLQAWNITPPRFSAMTVIAHNPNLKLTELANILGVARSGAVLLVDTLEDMG
FT                   MVERQPSPKDKRAFRLVLTAKGATTLDEITRAVTAHDARVTAHLSADERQTLLALLNKL
FT                   ASGPDSAS"
FT   gene            complement(533877..534218)
FT                   /locus_tag="Rpic12D_0504"
FT   CDS_pept        complement(533877..534218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0591 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61810"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCU9"
FT                   /inference="similar to AA sequence:KEGG:RSc0591"
FT                   /protein_id="ACS61810.1"
FT                   /translation="MTQDPVSQRKQHNADDFALTRDAIRWLASLPDPVRPIELGRKFPR
FT                   IINTIAAKWADFIGCRRYLNSLQIDDRGGRQGFPFEIVQEICTLREYFDSLYPPDKDLW
FT                   QKAIDANKR"
FT   gene            534562..535776
FT                   /locus_tag="Rpic12D_0505"
FT   CDS_pept        534562..535776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0505"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: rso:RSc0592 hypothetical protein; TIGRFAM:
FT                   metal dependent phophohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61811"
FT                   /db_xref="GOA:C6BCV0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCV0"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACS61811.1"
FT                   /translation="MKRIDASQLRVGMFVMKLGGSWLKHPFWRAQFQLSHQGQIDDIRK
FT                   AGITEIWIDPERGEDVMSETLMPAPAPAPAPEPLTRETVAARPPITPTSLKEEWKHAQQ
FT                   LMQNGKATLGHMFAEARMGRALETEKALLLVDDVSNSLARNSYALIALARLKNKDDYTY
FT                   LHSFAVCALMVALAKTLGLPEDEIRECGLGGLVHDIGKSAMPRTLLDKSTALTKDELAL
FT                   LQTHAVGGHHLLQGTGQFSEIAREICLHHHERIDGSGYPDAQKADGISLWAKMGAICDV
FT                   YDTLTSSSPYHHAWSPAQALKYMMARTDTQFDRTVFQAFTRSVGIYPVGTLVKLRTNRL
FT                   GVVVHQNDASALKPDVVVFYSGNTKTRVRPERISLGKSDDSIVTVEDATTWGLSDEEVS
FT                   DMCLV"
FT   gene            complement(535804..535977)
FT                   /locus_tag="Rpic12D_0506"
FT   CDS_pept        complement(535804..535977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61812"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61812.1"
FT                   /translation="MSAQPGHSETDTTPPPADTGHPNTTPAPDKRKPGGPQVPRDTHPD
FT                   PAEQNEPPVEDY"
FT   gene            536210..537196
FT                   /locus_tag="Rpic12D_0507"
FT   CDS_pept        536210..537196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61813"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCV2"
FT                   /inference="similar to AA sequence:KEGG:RSc0593"
FT                   /protein_id="ACS61813.1"
FT                   /translation="MNVSNLLHAASNWVIQSRAFNVTQSVAHHRTPSDALSHWKLDIWH
FT                   KSVPFLFEGGLAEPAHQLFPKHLAHAEWVGELHHHLSQLVGVRREHCKIDIRAVTGLAQ
FT                   SPCSVHSFPSMLVFAHQHCRRIPHSTDADFAANRRHVFRYADQANVFRAYDFAGGELFY
FT                   MNEWGAHHFAALALQARTQNRELLVDAEVRHARSALGLRRLLDSFHVIGARRQGQQRYG
FT                   TRLSEALASHQVPHRWMHGRREAEGFELCFLPKSDRFANCVGEQLVRDGWFDYGAWLAS
FT                   LHDATELGAPAQRAEAARKTRPNWKRVPVPSLGVPTGLMPGFAHTRL"
FT   gene            537396..537716
FT                   /locus_tag="Rpic12D_0508"
FT   CDS_pept        537396..537716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61814"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCV3"
FT                   /inference="similar to AA sequence:KEGG:RSc0594"
FT                   /protein_id="ACS61814.1"
FT                   /translation="MFLLFGQQGALRHALSHWSEFSEATGVAFNAAATAKPASAERSQP
FT                   AQEHAACLQCAAYAALAAALPMLVALRLAHTRRWHFPHIGFHAGAPVFPVAVCSRDPPI
FT                   RL"
FT   gene            537756..539987
FT                   /locus_tag="Rpic12D_0509"
FT   CDS_pept        537756..539987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0509"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: rso:RSc0595 putative outer membrane
FT                   receptor signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61815"
FT                   /db_xref="GOA:C6BCV4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCV4"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACS61815.1"
FT                   /translation="MRVPLFNASARFKGFFMIPFQPRKLVMALAAVLPSVASVSALAQE
FT                   ATPPAAAPSTPATTAPATNVRDLSETRVTAKRLDAARNALSPDTGSSVYKFDTDDIDRL
FT                   PLGDATPLNQVLLQAPGVVQDSYGQLHVRGDHSNLQYRINGVIVPEPISGFGQMLDTRF
FT                   ANQINVLTGALPAQYGYRTAGIVDITTKGASTDEDGEPKAFGGEIGTVLGSNATHEVNA
FT                   QIQGTKDRFSYYLSGVFAENNMGIENPTGNRNATHDHTTQNKSFGMLSYLLDSDSRVSF
FT                   MFGTSNGRFQIPTRPGLAPKFTLDGAVPPASEALNANQREKTDFQILTYQQKVSPKLDY
FT                   QVSVFRRASRIDYMPDPIGDLVYNGVAADITRRNEAYGLQGDASYKLTDKHTLRAGVFV
FT                   QRERYVADNTASVFAADSSGAQTSTTPFTIVDNHSGSGTTLGVYLQDEWKPTDKLTVNY
FT                   GARYDRVNTIVSEQQLSPRLGLTYDLTPRTRVHAGYARYFTPPPTEKFDTTSVQAFAGT
FT                   TNALPSDANTAVKSERSNYFDLGISHQLTPHLTLGLDAYYRDVRHLQDEGQFGNALLYS
FT                   AFNYERGRIYGLEGSANYRNGNFGAYLNLAVSRAQGKGIETGQFNFGADELAYINNHWV
FT                   NLDHDQRLTASAGVSYRYSGTTYTSDVLFGTGLRNGFANTEHLPAYWQMNLGAARDFTL
FT                   PTLGKFKTRLTVLNIFDRSYQLRDGTGIGVGAPQFAPRRTFLLSVSKPF"
FT   sig_peptide     537756..537887
FT                   /locus_tag="Rpic12D_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 44"
FT   gene            complement(540042..540677)
FT                   /locus_tag="Rpic12D_0510"
FT   CDS_pept        complement(540042..540677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_4932 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61816"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCV5"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_4932"
FT                   /protein_id="ACS61816.1"
FT                   /translation="MTRLRFFARTAAAVALLTAALPLPASAQSTAAAPTRVRATINAVH
FT                   STTVDVTDTSGNKATVTLPVDISVTQVAPIEPSAIRAGSYIGTAAVKEPDGTLRALEVH
FT                   VFPEAMRGTGDGHRPYDLGPNSSMTNGTVEQAGAVTGAQGRTLSVKYKDGEQRIVVPPQ
FT                   VPIVTFEPGRRDDLKAGAHVVMFVRADAQGTLVAQRVLVGKDGMVPPM"
FT   sig_peptide     complement(540594..540677)
FT                   /locus_tag="Rpic12D_0510"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.889 at
FT                   residue 28"
FT   gene            complement(540815..541402)
FT                   /locus_tag="Rpic12D_0511"
FT   CDS_pept        complement(540815..541402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0511"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcn:Bcen_1390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61817"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61817.1"
FT                   /translation="MATSNLYRTGEAPAQTGKGHGTDALGPSDSSDSGSDVVGGPGLGS
FT                   DVEDRFDDDPAVHPHGNAANRTAGADLGDVNLDSDTDSTGTGERRAAGHEPVIREGGDL
FT                   MPDTIRDLNDPEVDTPIDDENFEHATGLAGENDDADAPDAVELDDAPIDPQPGSRDLPV
FT                   QSPTGGGTDGADNMRRSRPTYKGKRVPGQHRG"
FT   gene            541575..541880
FT                   /locus_tag="Rpic12D_0512"
FT   CDS_pept        541575..541880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0512"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc0596 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61818"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61818.1"
FT                   /translation="MKQHAQQPHKPAAQAGGNAGERTSESKKGDRRDQAQKEGAGAKGS
FT                   TESDRAERTSMQHGTDQSAKRPTPTPAEDGRAAAQEGQLPQNQQRLGQHQNSRKQP"
FT   gene            541877..542080
FT                   /locus_tag="Rpic12D_0513"
FT   CDS_pept        541877..542080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61819"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCV8"
FT                   /inference="similar to AA sequence:KEGG:RSc0597"
FT                   /protein_id="ACS61819.1"
FT                   /translation="MSGTHTPRDDNKAKAPSSDATAKPVAPAIPSESGVGEEDPGDFEN
FT                   ASISAGDGERPAAPPAKPDRRR"
FT   gene            complement(542099..542440)
FT                   /locus_tag="Rpic12D_0514"
FT   CDS_pept        complement(542099..542440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0598 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61820"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCV9"
FT                   /inference="similar to AA sequence:KEGG:RSc0598"
FT                   /protein_id="ACS61820.1"
FT                   /translation="MTATTSAHEPQWLALCPGQAGLHWLPVGTTLVTLEGSLRLEPPSR
FT                   SVAAARYTLGAGHAHVVETSGWWRLRADERSGAHLRIVAGAARTPRPMWSAMGRWLANI
FT                   IQPRQTSRG"
FT   gene            542645..544108
FT                   /locus_tag="Rpic12D_0515"
FT   CDS_pept        542645..544108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0515"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   rso:RSc0599 putative transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61821"
FT                   /db_xref="GOA:C6BCW0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCW0"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACS61821.1"
FT                   /translation="MSVTELTSPPAQPLYRTLADHYLGAIRSGVLAPGERMPSVRMLMR
FT                   THAVSLSTALQVCRHLETEGWLEARERSGYFVRQPRRALLAPVKEPEVSTPDPAAYVGV
FT                   HARVSAIVARGQQATVHVDLSGASGAAALYPAAALNRIASQVLRRYPLLLTQAVIPNGH
FT                   PELQTAVARRALDMGVQVAPDDVIVTHGCIEAVNLALRAVAQPGDTVAVESPTYYGLLQ
FT                   VLESLGMRAVEIPTSPRTGMSLEALEMAVQAYGNIRAVVVVPNLQNPLGSIMPDAAKRR
FT                   MAAFCDANRIALIEDDTYSALGDSPTPLKALKAWDRTGNVIYCASLSKVLAPGLRLGWM
FT                   AAGRWQGRVQMLKFAQSRPNDSWSQVLAGRFIASGAYDRHLRTLRQTLREQRERMAESI
FT                   AGCFPAGTRLSVPSGGLAMWVELPANVSSMELFDAALAQGIRIAPGTMFSNLNRFDHFF
FT                   RICFGLEPSANLEAALATLGQLTQQLAER"
FT   gene            complement(544118..544786)
FT                   /locus_tag="Rpic12D_0516"
FT   CDS_pept        complement(544118..544786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0516"
FT                   /product="protein of unknown function DUF330"
FT                   /note="PFAM: protein of unknown function DUF330; KEGG:
FT                   rso:RSc0600 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61822"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCW1"
FT                   /inference="protein motif:PFAM:PF03886"
FT                   /protein_id="ACS61822.1"
FT                   /translation="MMPMQTTMLSFSLRVAGGAAVALLVGACASPEPTLHTLSARPEAT
FT                   DTSRFQRAFRLSGVRVPDRLDKPQIVLRTSDSEVVALEEQRWAAPFGSELRDALSANLA
FT                   TTLSAVDVGSAAAPAGVPLYRIGAEMRSYDARPGQGVTALVTWRVSRDVAAQGASTAAL
FT                   TCQTTLALPVSGPSAAADSAAGVNAVVSSTQRLVQQWSQQIAQSVQGLEAPSAVPAWCR
FT                   "
FT   sig_peptide     complement(544697..544786)
FT                   /locus_tag="Rpic12D_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.883 at
FT                   residue 30"
FT   gene            complement(544783..546426)
FT                   /locus_tag="Rpic12D_0517"
FT   CDS_pept        complement(544783..546426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0517"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: rso:RSc0601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61823"
FT                   /db_xref="GOA:C6BCW2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCW2"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ACS61823.1"
FT                   /translation="MTDPVDNENIPAPRRMKRKRWLPSLIWLVPIVALTVGATLMARVI
FT                   LARGAQVTVTFSSAEGIEAGKTRVKYKSVDIGVVKAVGLTDDRSGAVVLIELTHDGKAF
FT                   AASDTRFWVVRPRVAAGSISGLGTLLSGAYIGVDGGRSQEKKSVFKGLDTPPAISADAP
FT                   GKQFTLHAPDLGSLDIGAPVYFRRVRVGQVTAYDIDADGKGVTLHIFVNAPFDKFVARG
FT                   TRFWNASGIDLKLDANGLKVDTQSLLTVALGGIAFQTPEEADHEPAASDAQFQLVRNET
FT                   AALKDPEHLSQTVVMYFHRSLRGLNVGAPVEFKGINVGEIKSIGIHYSKKRHEFVLPVT
FT                   ATLYPTRFGMDIRDDNPQHAAEDVRTQFDVLVKNGMRAQLKSASLLTGQQFVNLDFIDT
FT                   AEREKTPPRFGMRDRDGAYVFPTADNPTDDIEAQIAGIAKKLNKVPFEQIGQDVHRTLT
FT                   TLDATLKQTEQLAKTVNSDLAPQMKETLAEARRTLDSARQVFSDDAPLQRNARDTLEQV
FT                   AKAAASVRVLTDYLDRHPEALIRGKAKDAQ"
FT   gene            complement(546423..547160)
FT                   /locus_tag="Rpic12D_0518"
FT   CDS_pept        complement(546423..547160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0518"
FT                   /product="Paraquat-inducible protein A"
FT                   /note="PFAM: Paraquat-inducible protein A; KEGG:
FT                   rso:RSc0602 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61824"
FT                   /db_xref="GOA:C6BCW3"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCW3"
FT                   /inference="protein motif:PFAM:PF04403"
FT                   /protein_id="ACS61824.1"
FT                   /translation="MNSATTPAQAQPGQEGRPLRAAAHGLVTCERCGLLARMPESEAAT
FT                   RAVLTRENAPDDSVAAPVCPRCMSPLHVRKPDSLARCWALLIAAAAMYLPANLLPVMIT
FT                   DTLLGTQQDTIMSGIVYLWTSGSWHLAIIVFIASFLVPLAKLGILAVLCLSVQQRWHWN
FT                   PRLRTRLYALVEIIGRWSMLDVFVVTLLAGLVHLSTLAVIKPGPGVGPFAAVVVLTMFA
FT                   ARCFDPRLIWDVIDEPDPEETDV"
FT   gene            complement(547157..547936)
FT                   /locus_tag="Rpic12D_0519"
FT   CDS_pept        complement(547157..547936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0519"
FT                   /product="Paraquat-inducible protein A"
FT                   /note="PFAM: Paraquat-inducible protein A; KEGG:
FT                   rso:RSc0603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61825"
FT                   /db_xref="GOA:C6BCW4"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCW4"
FT                   /inference="protein motif:PFAM:PF04403"
FT                   /protein_id="ACS61825.1"
FT                   /translation="MELLTVKLPIPLPQSWRPAGDTTDAKAAPVALPLPGDPDAWIACE
FT                   HCDTLHRHEVIALDEEAHCTRCGIKLYRNQSERLSVLLPLVVTGLIVYIVANIFPIAEM
FT                   NGGGNRHATTLWGAIVALYDYDMLFAAVLVALTTVFFPLMYMSVLAPLLIARWRGRQHP
FT                   AAALVLRAAALIRPWAMVEIFMLGVVVALIKVARMVSLEADAGLWAFAALTVFLTVALS
FT                   IDLRPFWREIGLTLQPGSHVDAPTGMDAAARPGEDRP"
FT   gene            548173..548682
FT                   /locus_tag="Rpic12D_0520"
FT   CDS_pept        548173..548682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0520"
FT                   /product="triple helix repeat-containing collagen"
FT                   /note="KEGG: mgi:Mflv_5091 triple helix repeat-containing
FT                   collagen"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61826"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCW5"
FT                   /inference="similar to AA sequence:KEGG:Mflv_5091"
FT                   /protein_id="ACS61826.1"
FT                   /translation="MTYLRASSLVVALALAGGTAAAYAQTGAAQSNSTAGGSSMSPAGG
FT                   TSTDATTTGRGGTAVDGGSTGSGRDATRNRNATGKQGRSGNTSSRSGSSGGYGGGANDS
FT                   TGSTTGGGSGGVGVGALGTGGSMGAPGGGNGGGTGGAAGSGGVGGGAGSGGAGGAAGGS
FT                   GGGSGR"
FT   sig_peptide     548173..548247
FT                   /locus_tag="Rpic12D_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.960 at
FT                   residue 25"
FT   gene            complement(548701..549564)
FT                   /locus_tag="Rpic12D_0521"
FT   CDS_pept        complement(548701..549564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0521"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: rso:RSc0604 hydrolase oxidoreductase protein;
FT                   TIGRFAM: S-formylglutathione hydrolase; PFAM: putative
FT                   esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61827"
FT                   /db_xref="GOA:C6BCW6"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCW6"
FT                   /inference="protein motif:TFAM:TIGR02821"
FT                   /protein_id="ACS61827.1"
FT                   /translation="MTIPVPALELLSEHACFGGVQRFYRHASTAIGLPMRFSVYLPPQA
FT                   LAGTSCPALFYLAGLTCTEETFAIKAGAQRVAAREGLILIAPDTSPRDANAPGETDSWD
FT                   FGIAAGFYLDATQAPWREHYRMESYIADELHHIARVVFPVAAGRIGIFGHSMGGHGALT
FT                   LALRHRERFASVSAFAPIAHPSVCPWGIKAFTGYLGDDRTAWAAHDATQLMQQASCPFP
FT                   RGILVDQGEADKFLAEQLYPDDFAAACAAAGQPLQLRRHPGYDHGYYFIETFIEDHLLH
FT                   HAAQLR"
FT   gene            complement(549587..550693)
FT                   /locus_tag="Rpic12D_0522"
FT   CDS_pept        complement(549587..550693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0522"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase/class
FT                   III alcohol dehydrogenase"
FT                   /note="TIGRFAM: S-(hydroxymethyl)glutathione
FT                   dehydrogenase/class III alcohol dehydrogenase; PFAM:
FT                   Alcohol dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: rso:RSp0069
FT                   bifunctional: glutathione-dependent formaldehyde
FT                   dehydrogenase/alcohol dehydrogenase class III"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61828"
FT                   /db_xref="GOA:C6BCW7"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCW7"
FT                   /inference="protein motif:TFAM:TIGR02818"
FT                   /protein_id="ACS61828.1"
FT                   /translation="MKTKAAIAWKAGAPLTVEEVDLQGPRAGEVLVEIKATGICHTDYY
FT                   TLSGADPEGIFPAILGHEGAGVVLEVGAGVTSLKAGDHVIPLYTPECRQCKFCLSRKTN
FT                   LCQAIRATQGKGLMPDGTSRFSLDGNPLFHYMGTSTFANHIVVPEIALAKIRPDAPFDK
FT                   VCYIGCGVTTGVGAVVYTAKVEAGANVVVFGLGGIGLNVIQGAKMVGADKIIGVDLNPA
FT                   REAMARKFGMTHFINPNEVENVVDHIIQLTDGGADYSFECIGNTKVMRQALECCHKGWG
FT                   QSIIIGVAEAGAEISTRPFQLVTGREWKGSAFGGARGRTDVPKIVDWYMEGKLNIDDLI
FT                   THTLPLERINEGFELMKRGESIRSVVLY"
FT   gene            550897..552723
FT                   /locus_tag="Rpic12D_0523"
FT   CDS_pept        550897..552723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0523"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: chemotaxis sensory transducer; histidine kinase HAMP
FT                   region domain protein; KEGG: rso:RSc0606 putative
FT                   methyl-accepting chemotaxis transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61829"
FT                   /db_xref="GOA:C6BCW8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCW8"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS61829.1"
FT                   /translation="MGLVGNHTVLASIRTRILLTCVAIVVGALTFAGGLNYLVTRSYND
FT                   ESIRQNLQSVARGHIAGIDDWVASKTQMMVSLQDVAVSADPIPVFKAVHKAGGFINVYV
FT                   GYPDKSYKFSNPEGIPPTYDPTARPWYKQAVEAGKPVVTPPYVSVSTGQLVVTFAVPIL
FT                   EGSTLKGVIGGDVAMDSVIANVKAIHPTPASFGFLVNAAGKIVAHPNDKLTLKPVTDLS
FT                   AGLNEATLASLAQAEKPVEVAVDGAAKLLYRQGVKGTDWGLVVALDKSDATAGMRSLVM
FT                   TSIGALVGVAIVAALIVGAMTSRAFRRLSMIRDAMDEIGSGSGDLTKRLPSDGEDEVAQ
FT                   IARSFNTFADKLTAVMQQIRLGSDSVRSAAQEIAAGNADLSQRTEEQASSLEETASSME
FT                   ELTSIVKQNADNARQASQLAVTASDVATRGGDVVGQVVQTMGGINESSKKIADIIGVIE
FT                   SIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRSLAQRSAGAAKEIKALIHDSVDRV
FT                   SNGTALVDQAGVTMAEIVDAVKRVTDIMGEISAASEEQSSGIEQVNQAVNQMDQVTQQN
FT                   AALVEQAAAAAESLEEQAHNLNEAVGQFRLSH"
FT   gene            complement(552751..553419)
FT                   /locus_tag="Rpic12D_0524"
FT   CDS_pept        complement(552751..553419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0524"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   bac:BamMC406_3382 glutathione S-transferase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61830"
FT                   /db_xref="GOA:C6BCW9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCW9"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ACS61830.1"
FT                   /translation="MPQDRHLILYHSPRSRSRGARMLLEELGADYEVHAFDLTAGEHKT
FT                   PAFLAINPLGKVPTLRHGDAVITEQVAVYLYAAELYPEAGLSPAVGDPLRGAYLRWMAF
FT                   HGACFEPAIVDRSMKREPAAYSMSPYGNFDAMLDTLTAQLEKGPYLLGERFTAADVLWG
FT                   AALAWTTMFKLIPDTPLVRGYIDRVMARPAMQRAQAADLALAQAQDKAKAEATNAAPAP
FT                   "
FT   gene            complement(553604..555361)
FT                   /locus_tag="Rpic12D_0525"
FT   CDS_pept        complement(553604..555361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0525"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: bxe:Bxe_B2626 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61831"
FT                   /db_xref="GOA:C6BCX0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCX0"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS61831.1"
FT                   /translation="MDRRFGASVAIVLVPVLSLSCWLLGYAWLAYGRADDAARSVQALR
FT                   MALLAMEKVSAERGPTNGVLGEDLPVPAERSAALQRMRAVSDEHIAKLLDALGPEHCPG
FT                   CKADINTARRAQTYLTAARANIDRLTALPLHARSSDDLADGVNRMIAVIPEFLPIVNAR
FT                   TANITRGDPDVLNCLTLARLAADLREYAGQLGSRFTGALAMHRALTLEEQLAIERTQGR
FT                   IDQLRSMIETRVATPSTLNQHAVATLGAQYFGDGLRYVAAARAKASQPGGVDITPAAFA
FT                   ERYVPTMRAITDFRDIVLGLADDDIRQHRREMLLVLVGSAGAVLSLLGALAWMTLSFRR
FT                   NVVGPFVNATRLIDGIARGNLSVHIPTSFARREIRAMFEAIRVLRINSIERRRLEVERA
FT                   HLMQELARMAETDPLTQLLNRRAFEDRASAMCNAPHPKARLVALIMFDIDHFKRINDTY
FT                   GHAVGDEALRTVAGLCRAEGPSADMVARIGGEEFAVMIWADSLAQARAVADHLRHRIAE
FT                   VTVPTGTDLPCRMTASFGVAVAPAADGPKLESLLRRADRLLYAAKLAGRNCVMTDRPPG
FT                   SSDLSVAAD"
FT   sig_peptide     complement(555299..555361)
FT                   /locus_tag="Rpic12D_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.554 at
FT                   residue 21"
FT   gene            complement(555709..555990)
FT                   /locus_tag="Rpic12D_0526"
FT   CDS_pept        complement(555709..555990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0526"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   bac:BamMC406_5978 antibiotic biosynthesis monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61832"
FT                   /db_xref="GOA:C6BCX1"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCX1"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACS61832.1"
FT                   /translation="MAHIDILAGKQREFEAAVQQALPLFARAKGCHGAELHHIVERDTS
FT                   YVLLVRWNTVEDHMVEFRESDDFQEWRKLVGPFFAKAPEVVHSEVAVK"
FT   gene            556245..557294
FT                   /pseudo
FT                   /locus_tag="Rpic12D_0527"
FT   gene            complement(557325..558569)
FT                   /locus_tag="Rpic12D_0528"
FT   CDS_pept        complement(557325..558569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0528"
FT                   /product="Saccharopine dehydrogenase (NAD(+),
FT                   L-glutamate-forming)"
FT                   /EC_number="1.5.1.9"
FT                   /note="PFAM: Saccharopine dehydrogenase; KEGG:
FT                   bur:Bcep18194_C7476 putative saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61833"
FT                   /db_xref="GOA:C6BCX2"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCX2"
FT                   /inference="protein motif:PRIAM:1.5.1.9"
FT                   /protein_id="ACS61833.1"
FT                   /translation="MPAPDYDVVVFGATSFVGQILTRYLSEHLSGDGEALRWAIAGRSE
FT                   AKLLDVKRALGAAGESLPIIVADAANEAQLRALCAQTRVVVSTVGPYALYGEPLIKVCA
FT                   ESGTDYCDLTGETQWIKRMIDKYEATAQRSGARIVHCCGFDSVPSDMGVYFLQQHAMRQ
FT                   WGTPVTQVKLRVKTLKGGASGGTVASLVNVVQEAAADPALRRELADPYALCPRGHGFTA
FT                   RQRSVRGAAFDADFNVWIAPFVMAAINERVVHRSNALSGNAYGNPFLYDEAVITGAGLS
FT                   GRMKAMTMVAGLAAFMLGIVIKPARIVMQRFLLPKPGEGPTPAAQLAGRYDLRLFGRTD
FT                   QGNTLRVKVTGDRDPGYGSTGKMLGQAAISLALDHTKDGLKTGRPGGFWTPATMFDDRF
FT                   IERLTRHAGLRFERI"
FT   gene            559016..560602
FT                   /locus_tag="Rpic12D_0529"
FT   CDS_pept        559016..560602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0529"
FT                   /product="isocitrate lyase and phosphorylmutase"
FT                   /note="PFAM: isocitrate lyase and phosphorylmutase; KEGG:
FT                   bcj:BCAM1588 putative lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61834"
FT                   /db_xref="GOA:C6BCX3"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCX3"
FT                   /inference="protein motif:PFAM:PF00463"
FT                   /protein_id="ACS61834.1"
FT                   /translation="MAQYQDDIKAVAGLKETYGSAWNAINPEYAARMRAQNKFKTGLDI
FT                   AKYTAKIMRADMAAYDADPSKYTQSLGCWHGFIGQQKMISIKKHFKSTERRYLYLSGWM
FT                   VAALRSEFGPLPDQSMHEKTSVSALIRELYTFLRQADARELGGLFRELDAAKDPAAKAA
FT                   IQEKIDNHVTHVVPIIADIDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQ
FT                   DGKVTVPHEDFLAKIRAIRYAFLELGVDDGIIVARTDSLGAGLTKQIAVTNTPGDLGDQ
FT                   YNSFLDCEELSADQLGNGDVVIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCITSLQ
FT                   NGADLLWIETEKPHIGQIGGMVKEIRKVIPNAKLVYNNSPSFNWTLNFRQQVYDAMKEA
FT                   GKDVSAYERGQLMSAEYDDSELAKLADEKIRTFQADASREAGIFHHLITLPTYHTAALS
FT                   TDNLAKEYFGDQGMLGYVAGVQRKEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKA
FT                   AGKDNTMNQFH"
FT   gene            560872..562167
FT                   /locus_tag="Rpic12D_0530"
FT   CDS_pept        560872..562167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0530"
FT                   /product="metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS)"
FT                   /note="TIGRFAM: metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS); PFAM: General substrate transporter;
FT                   major facilitator superfamily MFS_1; KEGG:
FT                   bch:Bcen2424_6665 major facilitator superfamily
FT                   metabolite/H(+) symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61835"
FT                   /db_xref="GOA:C6BCX4"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCX4"
FT                   /inference="protein motif:TFAM:TIGR00883"
FT                   /protein_id="ACS61835.1"
FT                   /translation="MHPPSSLSTGQSKAAAVFRVTAGNFLEQFDFFLFGFYATQIANVF
FT                   FPTESEFASLMMTFAVFGAGFLMRPLGAVVLGAYIDDVGRRKGLIVTLSIMASGTVLIA
FT                   FVPGYATIGLLAPALVLLGRLLQGFSAGAELGGVSVYLAEMATPGRKGFFTSWQSASQQ
FT                   VAIVVAAGLGFALNQWLSAPAIAAWGWRVPFFVGCMIVPFIFVLRRNLEETQEFKARRH
FT                   RPSMREVFGTLLQNWGVVVAGMMLVAMTTTSFYLITVYAPTFGKTVLHLSTADSLLVTL
FT                   CVGVSNFVWLPIGGALSDRIGRRPLLIGMTVLTIATAYPALSFLAHTPSFMNMLLVLLW
FT                   LSFMYGIYNGAMVVALTEVMPVQVRVAGFSLAYSLATAVFGGFTPAISTAVIHMTGDKA
FT                   APGYWMSFAAVCALLATLTLYRRRAVTLAPAH"
FT   gene            562230..563012
FT                   /locus_tag="Rpic12D_0531"
FT   CDS_pept        562230..563012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0531"
FT                   /product="extracellular solute-binding protein"
FT                   /note="KEGG: bcm:Bcenmc03_6262 extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61836"
FT                   /db_xref="UniProtKB/TrEMBL:C6BCX5"
FT                   /inference="similar to AA sequence:KEGG:Bcenmc03_6262"
FT                   /protein_id="ACS61836.1"
FT                   /translation="MKTLLLKLCAAALVATSAVAANVHAAELHVMSSGGFTAAYKVLGP
FT                   KFAAQTGNSLNTALGPSMGKSPEAIPNRLERGEPADAVIMVGYALDDLIKQGKVIPESR
FT                   VELADSRIGMVVREGAAKPDISSPEALKHVLLHAKSIAYSDSASGVYIERELFKKLGIE
FT                   EQVKAKAKMIPRIPVASVVATGDCEVGFQQVSELLPVPGATFVGKIPESLQSVTRYAAG
FT                   IPVGAQHPKEAKALLDYLASPAVQADVKSTGLDSVPVH"
FT   sig_peptide     562230..562307
FT                   /locus_tag="Rpic12D_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            complement(563049..563966)
FT                   /locus_tag="Rpic12D_0532"
FT   CDS_pept        complement(563049..563966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0532"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bam:Bamb_5626 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61837"
FT                   /db_xref="GOA:C6BDA2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDA2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS61837.1"
FT                   /translation="MGINFDLTDLQAFRAVVELGNFRKAAEAISISQPALSRRIDKLES
FT                   ALGVPLFERTTRSVTLTTVGRVFARSAEQLLDDLDVALLGIRDVSSSRLGQVTIACVPS
FT                   VAYYFLPNLIANYHRRFPRIRVKLLDASANEVLGAVISGEADFGLSFMGSQEPEIEFKM
FT                   LLQDRFVAACRRDHPLARKKRVTWKELYAHEYVSVDKTSGNRLLLDQALSAVAPRAPSV
FT                   CETRHVTTMLGLVEAGLGVAAVPSMAMPGHDHPILTSVPLVEPVVKRRVGIVKRRGRAL
FT                   TPAAEEFHQMIIDAKRSGVTTGDA"
FT   gene            complement(564165..565607)
FT                   /locus_tag="Rpic12D_0533"
FT   CDS_pept        complement(564165..565607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0533"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: bph:Bphy_5179 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61838"
FT                   /db_xref="GOA:C6BDA3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDA3"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS61838.1"
FT                   /translation="MLIIGTGYDDFKNGRSGCRDSLNRETAIEHAHDTSKNVAAVLASH
FT                   ISRTVESADQSLQTLIGALDKPGIRNLDPQVRHDLLFSPTASARYVTGMGVTDDKGQLV
FT                   DGCCSLTHRWDFSDRDYFIVHRDHANVGLYVSGVYKARSRAGVEAIALSRRMDRRDGTF
FT                   AGTALVAIDLDYFKQLLEKLDVGPRGVTAIVRTDGTLLARNPPPSAARAPDLNKSLTFP
FT                   RMVNQESGFYVAPSSSDGVLRLYTFQRVPGTPFIAVVAPAMSDALAPWQRLSWIVGLSS
FT                   LSVSLAFCAGVWLLAFALRGRVMAENHLRELTQTDPLTGLKNRRALDVALENEWDRLQR
FT                   NDSRLSVLFIDADHFKRYNDAHGHAQGDVALQYLAQCISKHARRRGDLAARYGGEEFVV
FT                   LLPDTGEAGATRIAEAIRAEVEGAGAPVGDTGLAPFTVSVGCATARRASFPSLNALTKA
FT                   ADDALYEAKRKGRNRVDYATVG"
FT   gene            565718..566008
FT                   /locus_tag="Rpic12D_0534"
FT   CDS_pept        565718..566008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0534"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: cti:RALTA_A0685
FT                   chaperone HSP10 (GroES), part of GroE chaperone system"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61839"
FT                   /db_xref="GOA:C6BDA4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDA4"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ACS61839.1"
FT                   /translation="MNLRPLHDRVIVKRLDNETKTASGIVIPDAAAEKPDQGEVLAVGP
FT                   GKKDDKGNAIALDVKVGDRVLFGKYAGQGVKVDGQEVLVMREEDIMAVVQK"
FT   gene            566110..567753
FT                   /locus_tag="Rpic12D_0535"
FT   CDS_pept        566110..567753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0535"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: rso:RSc0642 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61840"
FT                   /db_xref="GOA:C6BDA5"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDA5"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ACS61840.1"
FT                   /translation="MAAKDVVFGDAARAKMVEGVNILANAVKVTLGPKGRNVVLERSFG
FT                   GPTVTKDGVSVAKEIELKDKLQNMGAQMVKEVASKTSDNAGDGTTTATVLAQSIVREGM
FT                   KYVAAGMNPMDLKRGIDKAVTAAVEELKKISKPTTTSKEIAQVGAISANSDESIGQRIA
FT                   EAMDKVGKEGVITVEDGKSLADELDVVEGMQFDRGYLSPYFINNPEKQVVQLDNPFVLL
FT                   FDKKISNIRDLLPVLEQVAKAGRPLLIIAEDVEGEALATLVVNNIRGILKTAAVKAPGF
FT                   GDRRKAMLEDIAILTGGQVIAEEVGLTLEKATLNDLGQAKRVEIGKENTTIIDGAGDAR
FT                   NIEARVKQVRAQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LHATRAAVEEGIVAGGGVALLRARALISGLKGANADQDAGIKIVLRAMEEPLRQIVTNA
FT                   GDEASVVVSKVIEGKGNYGYNAATGEYGDLVEMGVLDPTKVTRTALQNAASVASLMLTT
FT                   DCAVAELPKDDTAPAMPGGMGGMGGMDGMM"
FT   gene            567984..569066
FT                   /locus_tag="Rpic12D_0536"
FT   CDS_pept        567984..569066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0536"
FT                   /product="protein of unknown function DUF898 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF898
FT                   transmembrane; KEGG: rso:RSc0643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61841"
FT                   /db_xref="GOA:C6BDA6"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDA6"
FT                   /inference="protein motif:PFAM:PF05987"
FT                   /protein_id="ACS61841.1"
FT                   /translation="MNDITREPVLGSAPGGPTAAAPQPLRLRFTGSGSEYFRIWIVNLL
FT                   LTIVTLGIYSAWAKVRTLQYFYRNTQLAGSSFDYHGSPIAILKGRAIIFVLAFAFNLLG
FT                   HSSPLLGLALLIVMAAAFPWLLVRSLRFRMANSSYRGLRFAFTGKDAEGYMVFLVWPIL
FT                   SVLSLYLLAPLAHQRFKRFQHTNTRFGTAQFDFSGTPGNFYGVYLRTFGLAILALVVAS
FT                   CLALLLGVSLHRAPDVGQIFGFIVIGLFMYAAMLFLTPYFLSRLQNLIWNQTTLGAHRF
FT                   QSQVGAGKLFWIFVSNAVLILITIGLFTPFARVRTARYKLDSVTMLAAGSLDTFVAGET
FT                   TNVGALGDATVDWYDIDIAL"
FT   gene            569095..570189
FT                   /locus_tag="Rpic12D_0537"
FT   CDS_pept        569095..570189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0537"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: rso:RSc0644
FT                   putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61842"
FT                   /db_xref="GOA:C6BDA7"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDA7"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACS61842.1"
FT                   /translation="MILATYFDGRTSRAQPVRLAVEAGEAVLFEPEGTVLRRAPLSTLR
FT                   VSERVKHAPRLITFEDGAFCEINDPAEQTSLNALLHRTGYREGWVVVAQNSWKLALGSL
FT                   LATVVVLALGYRYGLPWGARVVANMVPQRAEAQLGRSTLKAMDERWLRPSKLPVAQQDR
FT                   IRARFAALHRPPQATHTYHIVFRDADIGANAFALPGGDIVVTDALVKLVGEGDGLTGVL
FT                   AHEAGHVEYRHGLRQVIQSSAIGATAALLFGDVSTILSGVPAALLTLRYSRDYERDADR
FT                   YAALLLQENGLSVGAFADVLQALEDTHGGARKADAADAAKKPEAASDDDASAFFSSHPL
FT                   TRERIDTLRRFDRTHGGSDSGDAD"
FT   gene            complement(570209..570637)
FT                   /locus_tag="Rpic12D_0538"
FT   CDS_pept        complement(570209..570637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0538"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: rme:Rmet_0658
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61843"
FT                   /db_xref="GOA:C6BDA8"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDA8"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ACS61843.1"
FT                   /translation="MRHAESSVMSTLAGVLPLPDRMLLIRVFRFGVSGVVATGVHVAIA
FT                   TALISGVSATQVTANGAAFVCANVCSYLLNALWSFSAKPARANFLRFYAVSLLGLALTL
FT                   AISWCAQTLGLSYWIGLAGILSTVPPLTFVLHRFWTFR"
FT   gene            complement(570657..571730)
FT                   /locus_tag="Rpic12D_0539"
FT   CDS_pept        complement(570657..571730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0539"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   rme:Rmet_0656 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61844"
FT                   /db_xref="GOA:C6BDA9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDA9"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACS61844.1"
FT                   /translation="MQPNHQDPHDAPLLSLVAPFYNEGEALHLFFARVVPILESIDGMQ
FT                   FEIVCVNDGSADDTLPKLVAVSHADPRVRVVDLTRNFGKEAALTAGLDEAQGDAVIPID
FT                   ADLQDPPELIPTLVAHWRKGAEVVLAQRANRACDSFLKRVTAAAYYRIHNRLSDLKLPE
FT                   NVGDFRLMDRAVVNALKQLPERHRFMKGLFAWVGFSTVIVQYEREKRSAGTSKFSGWRL
FT                   WNFALEGITSFSTLPLRSWTYLGALVAALAFCYGAFIILRTMIFGVVVPGYASELSLML
FT                   FFGGLQMIGLGMIGEYVGRIYDEAKGRPIYLVKRRYQERRPRTRVPSINNRQVIPIASA
FT                   RPRQPQGERQRSHAARR"
FT   gene            complement(571787..573103)
FT                   /locus_tag="Rpic12D_0540"
FT   CDS_pept        complement(571787..573103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_0654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61845"
FT                   /db_xref="GOA:C6BDB0"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDB0"
FT                   /inference="similar to AA sequence:KEGG:Rmet_0654"
FT                   /protein_id="ACS61845.1"
FT                   /translation="MHQGKIMRHQHPSQAIKPQRHWINADTVRMGSTAMLLLILALFSI
FT                   GAWVSDGFTDRRITGVGSDFSVFWGASYIALHDGTLQAYDLNRMMAVIHQFGTLASGSD
FT                   RLLPWLYPPTFLLVVLPLALLPFWPSYLVFMLATGLFYVKATLGLLGNRVMPHHRAWVT
FT                   VVGSPAVFVTVLMGQNSMLTAGLAAMAVTWQDKRPVLAGVAIGLLAIKPQLAMLFPIVL
FT                   LASRAWRTLASAAATVLGFAGVSIAVCGWKTVPAFLESVRWAQENMIDDGGASWYVMPT
FT                   FLAAARAAGLGVSVAHAIQMTAAIIAVGALVYVWRRISDNGLRIAMLATATMLTSPYLR
FT                   AYELTWLLVAVAGVVSHGTRFGLSGRERFVLVLAWLLPLFEFVNPLCKLPQIGPLVFVA
FT                   MAVLVVRRATMYAEHGAALASPLQTNLRARATQPAKPNR"
FT   sig_peptide     complement(572954..573103)
FT                   /locus_tag="Rpic12D_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.621) with cleavage site probability 0.556 at
FT                   residue 50"
FT   gene            complement(573108..574142)
FT                   /locus_tag="Rpic12D_0541"
FT   CDS_pept        complement(573108..574142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0541"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: rso:RSc0648 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61846"
FT                   /db_xref="GOA:C6BDB1"
FT                   /db_xref="InterPro:IPR018705"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDB1"
FT                   /inference="similar to AA sequence:KEGG:RSc0648"
FT                   /protein_id="ACS61846.1"
FT                   /translation="MNIRTYRTCARRQRGVVGVMAPVLMLVILSIGAIAIDLGYLYVIR
FT                   NELQNAADAAALAGAAGLYPASPKPNWSNGVSQGTSAIKLNASSGATLKDGSVQAGYWN
FT                   LTGSPAGLQAQTITPGANDVPAVQVTISRSSGKNGGPVGTWLASIFNGAAASVQTTAVA
FT                   VIAAPGTANAGALFPVALNKCLFDLYWNSSTGQPVNDPSTGQPFVIDINSSYPPGSATC
FT                   ASGEWTGFGGATDASTEKSLVTSGNPTPVSIGSNINISNGVKASVYDAISYPTTVTMPV
FT                   VTTVSPGATTPVYAFAGFVITNVVKHGNKSYIEGHFTANQRVVNSGGGSGPYYGAYVPP
FT                   RLAN"
FT   sig_peptide     complement(574035..574142)
FT                   /locus_tag="Rpic12D_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.737) with cleavage site probability 0.709 at
FT                   residue 36"
FT   gene            complement(574181..574654)
FT                   /locus_tag="Rpic12D_0542"
FT   CDS_pept        complement(574181..574654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0542"
FT                   /product="TadE family protein"
FT                   /note="PFAM: TadE family protein; KEGG: rso:RSc0649
FT                   putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61847"
FT                   /db_xref="GOA:C6BDB2"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDB2"
FT                   /inference="protein motif:PFAM:PF07811"
FT                   /protein_id="ACS61847.1"
FT                   /translation="MHPLNHPVIRHVPANYRPARPIRAHRMQGAAIVEFSLIFPILLLT
FT                   IFGVVEFGIALYDKAVITNAAREAARYGVAFTSPARTNSQVQGVATSYCQNRLVTFGSA
FT                   ANCTVASVTPCAGSGNPLTVTVSYSFTGLALAKALAPFTGSISLNSQTTMLCE"
FT   gene            complement(574679..575620)
FT                   /locus_tag="Rpic12D_0543"
FT   CDS_pept        complement(574679..575620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0543"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   rso:RSc0650 putative tight adherence TadC-related
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61848"
FT                   /db_xref="GOA:C6BDB3"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDB3"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACS61848.1"
FT                   /translation="MQIAHTLLLAGTFIVVFGAVLIALFVVRPTILQQRLGQIDRESPG
FT                   LAPKQAPSDWLRKLGRLARPLARASLPKEGWEDSALKARFVHAGWRSPEAVPIYFGIKT
FT                   ALAGGIPLVLSLLLVRRFDSDHETAYLAALLAGALFGFYLPNVVLAMKIKRRKRDIFEA
FT                   FPDSLDLIMVCVEAGLGLDSAVLRVVEDMRDARPAMAHEYELLTLELRAGLAREKALRN
FT                   FAARTGVEDVSMLVAMLIQADRFGTSVAESLRVHSDMLRTKRQMLAEERAAKIGTKVLF
FT                   PLIFCLFPALYVVLLGPAGIQIMAGLRSVINN"
FT   gene            complement(575671..576648)
FT                   /locus_tag="Rpic12D_0544"
FT   CDS_pept        complement(575671..576648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0544"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   rso:RSc0651 putative tight adherence TadB-related
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61849"
FT                   /db_xref="GOA:C6BDB4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDB4"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACS61849.1"
FT                   /translation="MDPLVIGFALSVFIAMMLAVLAVYLWWDTRHSSAARRFSHRLKMA
FT                   LASSVSHGGTDSILKQRMLSESPEVAAMLGRLPRIQTLDRRLLQSGLDWSVSRFFALTL
FT                   MVPAMIAIVFSLFDPPPMTLLVFVLAGASLPALYVMHRRTRRLLKLEAQLPEATDLISR
FT                   ALRAGHSLPAALEMAGTELPAPIGAELAIVFSQINFGVSMSDAFAGLTDRVPVDDLRYL
FT                   VIAILIQRESGGNLAEILDNVGKLIRKRLQLLDKVRVLSAEGRLGGWILTLLPPVMGLA
FT                   IYLLNPELMSTLWTTDAGIRLLWFAITMTCLGMLWIRQIVRIHI"
FT   sig_peptide     complement(576580..576648)
FT                   /locus_tag="Rpic12D_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.938 at
FT                   residue 23"
FT   gene            complement(576660..578024)
FT                   /locus_tag="Rpic12D_0545"
FT   CDS_pept        complement(576660..578024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0545"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase; KEGG: rso:RSc0652 secretion ATPase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61850"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDB5"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACS61850.1"
FT                   /translation="MSLREQLFQQAGEALPQRVAQANGASMPASPAYQQVAMDVHQIII
FT                   DRVELGRLQQLAPDQIKRELAQLVERIVDEGKHQLNEAERRRLVNDVQDEMLGYGPLET
FT                   LLADPTVSDILVNTYKRVYVERRGKLELTSVTFLDDAHLMRVIEKMVSRVGRRIDESSP
FT                   MVDARLPDGSRINAIIPPSAIDGPLLSIRRFAVNPLTIDDLVGFNTLTPAMAQLIDAMV
FT                   KAKLNILISGGTGSGKTTLLNILSGYIPPDERIVTIEDAAELQLRQNHVLRLETRPANI
FT                   EGRGEITQRALVKNALRMRPDRIILGEVRGAEALDMLHAMNTGHEGSLATIHANTPRDA
FT                   LTRLENMISMAGMQLPPRTMRQQITSALTVVLQVSRLTDGFRKLMSVQEITGMEGEVVN
FT                   MQEIFAFRRKGIDQDGRIRGHFCATGVRPKFSERLKMFGIQLPETLYDPAVLHEI"
FT   gene            complement(578066..579259)
FT                   /locus_tag="Rpic12D_0546"
FT   CDS_pept        complement(578066..579259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0546"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: rso:RSc0653 putative pilus assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61851"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDB6"
FT                   /inference="similar to AA sequence:KEGG:RSc0653"
FT                   /protein_id="ACS61851.1"
FT                   /translation="MAKIALVSADESHLQHLAGLITQAANHVVQRTRATPSQALTRPDL
FT                   GQGNDLLILEASRFSSDDLQQLRRLSSEHPETLCMLLTEAPSADLLMRAMRAGVQCVLP
FT                   WPPEAQEFRDEVQRCTSHALSSSHNDGQVVSFLSCRGGSGTTFIAANFAHVLSARHGKR
FT                   VLLIDLCQQYGDAAFLLTDQSPPATLANVCNQIDRLDAALLDACLTHVSQDFDVLAGAG
FT                   DPIKSGEIKATHLERILALAASMYDVVVFDVGQDINPASIVVLDHSNVIYPVLHLSLPY
FT                   LRAGRKLMEICHSLGYRAERLRLVINQYDKHMPISQNMMESAFGMPVAHILPYDPGPVR
FT                   DATTQGMPVLQLAENSPIARALADMARQLFPGSQHRRDGLLRKLFRHASQVPAPVRA"
FT   gene            complement(579319..579627)
FT                   /locus_tag="Rpic12D_0547"
FT   CDS_pept        complement(579319..579627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0547"
FT                   /product="lipoprotein"
FT                   /note="KEGG: rso:RSc0654 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61852"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDB7"
FT                   /inference="similar to AA sequence:KEGG:RSc0654"
FT                   /protein_id="ACS61852.1"
FT                   /translation="MNTISMLARVGLCSGLALALAGCMSSTPVYDKHFGEAVHTVRVMQ
FT                   TLNPNASMNSDPVSGVDGRAATSAMDRYNTQYRAPQSDASAFTVGVSSGNSLDSMGK"
FT   sig_peptide     complement(579550..579627)
FT                   /locus_tag="Rpic12D_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.645 at
FT                   residue 26"
FT   gene            complement(579660..581471)
FT                   /locus_tag="Rpic12D_0548"
FT   CDS_pept        complement(579660..581471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0548"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein;
FT                   transport-associated; KEGG: rso:RSc0655 outer membrane
FT                   channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61853"
FT                   /db_xref="GOA:C6BDB8"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR032789"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDB8"
FT                   /inference="protein motif:PFAM:PF00263"
FT                   /protein_id="ACS61853.1"
FT                   /translation="MDRLVHRSAKRCIGPYLTRKAFAAAALGVLCVGMAHGQVGVESAI
FT                   LTNNAAAPAKPLKMAASGPIQLTIGSPATAEANRDSAGKGPNCTGPMRSHSEVTVPVGK
FT                   STMVQLPEPVRSRTVGNPNVVQAMLVSPQTLYVLGLEVGSTNMIVQGRSGSCSVVDVAV
FT                   GADPGGLQSTLRKLMPEARNVQVSAAADSLVLGGSVSDSVQAQKVVDIANAFVMRRTRG
FT                   PNEGEQNATGQGGQQLHTAGPGAPLRSPRIINMMTVEAPQQVMLEVKVAEVSKTLIDQM
FT                   GAAFNANGAFGSWSFGAIANFLSGSSDIVNFSKANHLPLKFALDAQKGDGLVKVLAEPS
FT                   LMAISGQEASFLAGGKVFIPVAQGAAANGVATIVLQEETFGVGLRFTPTVMENGRINLK
FT                   VSPEVSELSPTGVAVTAPNSNNTSILPLITTRRASTTLQVHDGQSFAIGGLIKNNITGS
FT                   LKALPGIGELPIIGSLARSTSFQQDQTELLFVVTPRLVKPLPAQYPLPTDSFGTINRGE
FT                   LYLNGNMEGHVQAPASQPTAVAAPAANPEKAAAEPAAAPGPSAQAPTPTNVPAAPAAPV
FT                   TPVAPAASTAPRDTRRFVATGEQSTGN"
FT   sig_peptide     complement(581358..581471)
FT                   /locus_tag="Rpic12D_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.969 at
FT                   residue 38"
FT   gene            complement(581590..582441)
FT                   /locus_tag="Rpic12D_0549"
FT   CDS_pept        complement(581590..582441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0549"
FT                   /product="Flp pilus assembly protein CpaB"
FT                   /note="TIGRFAM: Flp pilus assembly protein CpaB; PFAM: SAF
FT                   domain protein; KEGG: rso:RSc0656 pilus assembly
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61854"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017592"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDB9"
FT                   /inference="protein motif:TFAM:TIGR03177"
FT                   /protein_id="ACS61854.1"
FT                   /translation="MKNLRILSMLLIATIAALAAVAFASRWLTQQSGSGITKIAVAATD
FT                   IDLGQRLSPEAIKLVDWPASSLPPGAINDPHALDGRVVRASLTRGEPVLDSKLTPVGTA
FT                   GGLSAVIAEGKRAITVRVNDVVGVAGFALPGSYVDIIVNTQQDSREAKPGADRNDQSIS
FT                   KIVLEKILVLAVAQEVNRDDTKPKVVNAVTLEVTPEQAEKIDLARSVGNLSLVLRNQVD
FT                   SQHDVTAGATKSTLLKEPVVSTAVAVPVVKTVQIVHRVAERRSAGNCVGVINGVQHSQE
FT                   CF"
FT   sig_peptide     complement(582367..582441)
FT                   /locus_tag="Rpic12D_0549"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.809 at
FT                   residue 25"
FT   gene            complement(582799..583338)
FT                   /locus_tag="Rpic12D_0550"
FT   CDS_pept        complement(582799..583338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0550"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   rso:RSc0657 prepilin peptidase transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61855"
FT                   /db_xref="GOA:C6BDC0"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDC0"
FT                   /inference="protein motif:PFAM:PF01478"
FT                   /protein_id="ACS61855.1"
FT                   /translation="MTTSTHLSLANLALILLVLTAAAYDVRTRRIPNWLVGMGLVSALV
FT                   AQGMAIGVGAGCLAWLGGAAVGIGLCFGFFVLGGMGAGDVKLMGAIGAFMGPFGAFHVA
FT                   LVSFLAGGVLALVMVLLRREARRSAAGVSALLLSIPFGSKTVHAEGQGPKHGGTIQLPY
FT                   AVAFAAGTLLVKWGAM"
FT   sig_peptide     complement(583267..583338)
FT                   /locus_tag="Rpic12D_0550"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.965 at
FT                   residue 24"
FT   gene            complement(583467..583643)
FT                   /locus_tag="Rpic12D_0551"
FT   CDS_pept        complement(583467..583643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0551"
FT                   /product="Flp/Fap pilin component"
FT                   /note="PFAM: Flp/Fap pilin component; KEGG: rso:RSc0660
FT                   putative pilin transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61856"
FT                   /db_xref="InterPro:IPR007047"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDC1"
FT                   /inference="protein motif:PFAM:PF04964"
FT                   /protein_id="ACS61856.1"
FT                   /translation="MKAMIKRFVREEDGAAGVEYALLLAFVALVMVASGPTVKAAVGSI
FT                   WSTIATQLSTAAA"
FT   gene            complement(584120..584233)
FT                   /locus_tag="Rpic12D_0552"
FT   CDS_pept        complement(584120..584233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0552"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61857"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDC2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61857.1"
FT                   /translation="MTATATTETETETETETAMVTTVTEAGKRRASKHLMW"
FT   gene            complement(585060..585584)
FT                   /locus_tag="Rpic12D_0553"
FT   CDS_pept        complement(585060..585584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0553"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   rso:RSc0662 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61858"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDC3"
FT                   /inference="protein motif:PFAM:PF04536"
FT                   /protein_id="ACS61858.1"
FT                   /translation="MASTTRHHHGARRALTHLLTTSSHARRAFPPADLQKLEAAVREGE
FT                   QHHRGEVRVVIESSLPVRDAWAGMSPRHRARTLFGLLEVWNTREHVGVLLYINLADHAV
FT                   EILADHGIAAKVDAHAWRAICETITRGFAQRVTMAPVLDALAQINDLLAAHVPSDGTPR
FT                   TNELSDRPVVQ"
FT   gene            complement(585600..586463)
FT                   /locus_tag="Rpic12D_0554"
FT   CDS_pept        complement(585600..586463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0554"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   rso:RSc0663 putative glycine rich transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61859"
FT                   /db_xref="GOA:C6BDC4"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDC4"
FT                   /inference="protein motif:PFAM:PF04536"
FT                   /protein_id="ACS61859.1"
FT                   /translation="MSMRARACFAFLLTAALWLAAALPARAQSDMVAVPPLAARVTDLT
FT                   GTLSAEQKSALEQVLADYEQQRGSQIFVLMVPSTAPEPIEAYGIRVADAWKAGRKGVDD
FT                   GAIILIAKDNPTSLRKMRIEVGRGLEGALTDAQSKHVLQDVMAPHFRQGDFYGGLSAGI
FT                   SAIQTVITQESLPPAERAKRQQSGGGIGDWLPVLFPLAIIVFFVLSAAMRSGGRVTGSL
FT                   PGRPGSRVVMGNRGWGPGTIGGLGGGLGGGWGRGGGDFGGGGGGGGGFSGGGGGDFGGG
FT                   GASGNW"
FT   sig_peptide     complement(586380..586463)
FT                   /locus_tag="Rpic12D_0554"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 28"
FT   gene            complement(586477..587103)
FT                   /locus_tag="Rpic12D_0555"
FT   CDS_pept        complement(586477..587103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0555"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: rso:RSc0664
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61860"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDC5"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ACS61860.1"
FT                   /translation="MTPALTFRSTRFSVLRWLALSLAVLAAPFLSACGYNDFQAKDEAT
FT                   KAAWAEVVNQYQRRADLIPNLVNTVKGYASHEKDTLEAVTKARAAATSFQITPEVLNDP
FT                   AAFQKFQQVQGELSSALSRLMAVSENYPQLKADQSFRDLQSQLEGTENRITVARQRYIK
FT                   SVQDYNVLARSFPTNLTAKVMGYQVKPNFTVENEKGISTAPAVKF"
FT   sig_peptide     complement(587005..587103)
FT                   /locus_tag="Rpic12D_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.796 at
FT                   residue 33"
FT   gene            complement(587210..587413)
FT                   /locus_tag="Rpic12D_0556"
FT   CDS_pept        complement(587210..587413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61861"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS61861.1"
FT                   /translation="MSNVSVNRCSVAHLTEQRSGQTSGCLVAFLARASVDTTDRLNAGA
FT                   VLIDEEREIARMKIVKKVLIPY"
FT   gene            587506..588414
FT                   /locus_tag="Rpic12D_0557"
FT   CDS_pept        587506..588414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0557"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: rso:RSc0665
FT                   dihydrodipicolinate synthase-like transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61862"
FT                   /db_xref="GOA:C6BDC7"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDC7"
FT                   /inference="protein motif:TFAM:TIGR00674"
FT                   /protein_id="ACS61862.1"
FT                   /translation="MLENSSTNLSTRERPSYAGIWVPIVTPFADDAARSVDHGALYTLV
FT                   VRYRELGVAGFVACGSTGEAAALTDQEHADVLDTVRAAADGLPVVMGVSGSALASVRER
FT                   MLRLVEHRPAAFLIPAPSYIRPSQDGIIEYFTALADASPVPVLLYDIPYRTGANIDTET
FT                   LLALAAHPNIHGIKDCGGDADKTQRLIADGRLQVLAGEDAQVFGTLCAGGVGAIIAAAH
FT                   VRTELFVEMARAVQEQRLNDARRLHHALAPVIRLLFAETNPGPLKAWLAAEGLIRNVLR
FT                   APMMMASEGLGRELGEVVGRV"
FT   gene            complement(588507..589808)
FT                   /locus_tag="Rpic12D_0558"
FT   CDS_pept        complement(588507..589808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0558"
FT                   /product="glutamate-1-semialdehyde-2,1-aminomutase"
FT                   /note="TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase;
FT                   PFAM: aminotransferase class-III; KEGG: rso:RSc0666
FT                   glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61863"
FT                   /db_xref="GOA:C6BDC8"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDC8"
FT                   /inference="protein motif:TFAM:TIGR00713"
FT                   /protein_id="ACS61863.1"
FT                   /translation="MSTPSRSAALFERAQKTIPGGVNSPVRAFRSVGGTPRFIAKAAGP
FT                   YLWDADGTRYIDYVGSWGPMIVGHAHPEVVRAVQDVAADSFSFGAPTEAEVVMAEEICK
FT                   LVPSIEQVRLVSSGTEATMSALRLARGFTGRDLIVKFEGCYHGHADSLLVKAGSGLLTF
FT                   ADTTQNAPSSAGVPEDVVKHTMVLPYNDVAALREAFARHGKEIAAVIVEPVAGNMNLVR
FT                   GSHEFHQAMRALCTEHGAVLIFDEVMTGFRVALGCAQALYGIKPDLTCLGKVIGGGMPA
FT                   AAFGGRRDIMGFLAPLGNVYQAGTLSGNPLAVAAGLTTLRLIAADGFHDRLAAQTRKLV
FT                   DGLADIAREVGVPFAADSVGGMFGIYFREGVPTSFAEVTKSDVGRFNAFFHAMLDQGVY
FT                   LAPSAFEAGFVSATHDDGILDATFEAARKAFKGI"
FT   gene            590024..590206
FT                   /locus_tag="Rpic12D_0559"
FT   CDS_pept        590024..590206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0559"
FT                   /product="Rubredoxin-type Fe(Cys)4 protein"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein; KEGG:
FT                   rso:RSc0667 rubredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61864"
FT                   /db_xref="GOA:C6BDC9"
FT                   /db_xref="InterPro:IPR018527"
FT                   /db_xref="InterPro:IPR024922"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR024935"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDC9"
FT                   /inference="protein motif:PFAM:PF00301"
FT                   /protein_id="ACS61864.1"
FT                   /translation="MEQQIEYKTWMCLICGWIYDEEQGAPDDGIAPGTKWEDVPINWTC
FT                   PECGARKEDFEMVQI"
FT   gene            590499..590996
FT                   /locus_tag="Rpic12D_0560"
FT   CDS_pept        590499..590996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0560"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rso:RSc0668 twitching motility
FT                   two-component response regulator transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61865"
FT                   /db_xref="GOA:C6BDD0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDD0"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS61865.1"
FT                   /translation="MSWRPVVAHCENMMQSARVEQLADSQPLANSPLAHSLTGCKVLVI
FT                   DDSSTIRRTAQIFLTQAGCQVVLAEDGFDALAKVGDLKPDLVFCDILMPNLDGYQTCSL
FT                   IKKSPKFHATPVIMLSSRDGIFDRARGKSVGAVDHLAKPFSKEALLEAVQTHLPVAQAA
FT                   AQ"
FT   gene            591027..591395
FT                   /locus_tag="Rpic12D_0561"
FT   CDS_pept        591027..591395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0561"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: rso:RSc0669 putative twitching
FT                   motility two-component response regulator transcription
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61866"
FT                   /db_xref="GOA:C6BDD1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDD1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS61866.1"
FT                   /translation="MAIKKVLVVDDSPTEALHLSEILGKNGFKVTVAADSEQAMTKLEA
FT                   ETFDLILMDVVMPGQNGYQATRAIKKDERFQGIPVIMCTTKGLETDRVWGMRQGASDYI
FT                   VKPVKAEELLEKIAKLAQ"
FT   gene            591472..592017
FT                   /locus_tag="Rpic12D_0562"
FT   CDS_pept        591472..592017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0562"
FT                   /product="CheW protein"
FT                   /note="PFAM: CheW domain protein; SMART: CheW domain
FT                   protein; KEGG: rso:RSc0670 putative twitching motility
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61867"
FT                   /db_xref="GOA:C6BDD2"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDD2"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ACS61867.1"
FT                   /translation="MNEQRTNLTSRQRLHEYQAMLARRLQEARAKSATEGFLGVQIGEH
FT                   HWLLSLTETGEVLDYQPPARVPLTQPWYLGLVNARGNLLGVIDFGLFCGEAPTSSGSGA
FT                   KIVVLSKDPQRACAILVPRVAGLRSLSDLQPAEATAEEGRPWLGRAWSDAQGTQWRELD
FT                   VRQLLADPAFLQVGRSRT"
FT   gene            592280..594517
FT                   /locus_tag="Rpic12D_0563"
FT   CDS_pept        592280..594517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0563"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: rso:RSc0671 putative
FT                   twitching motility transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61868"
FT                   /db_xref="GOA:C6BDD3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDD3"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS61868.1"
FT                   /translation="MGFKWFNAGRRAGEAGAPEVAAEGASAASVQLAQLDNASHTDDDN
FT                   PAGTPTQLGRSPMDAVVGWMERVPFAAQQRVFTIGLVVGLLALLISVYLDNRQANNGSV
FT                   QIEIAGDTLMHSQRLAKAVPVALLGNTNAFAQLKESRARLQENLDALKNGNSERGVRAS
FT                   GGDAEALLDKSIEEWKRSDKSAQAILAQEKTLVAVGKTLNVFNASNPELLEEAEQISSM
FT                   KLQTNAPAREVAASSQLVMLTQRLGKNMNEFLAGEGVNPETAFLLGKDTNTFRETLNGL
FT                   LNGSEALRLSAATDAETKGYLQELSTRFDNVQKTTQIILENLPGLIAAKRAQQQIFNDN
FT                   EKLRADLSDLQSAYAGSVRSRPVTLGAVVLSAILTVVCLAGLAALYLRDSRVRTMEAEA
FT                   RQREAEERRMVEKRNNDSTQAAILRLMNELQDIADGDLTKQATVSEDITGAIADSVNYT
FT                   VEELRELVGRVQQTAEQVTQASSAVQTTSESLVAASEEQSRQIRQTGQSVVEMADRITQ
FT                   VSRGAAESANVARASLAAAEQGQQAVQNAITGMNDIRDQIQETSKRIKRLGESSQEIGE
FT                   IVELISDITEQTNVLALNAAIQAASAGEAGRGFSVVAEEVQRLAERSAEAAKQIGALIR
FT                   TIQTDTQDAVHAMERSTAGVVEGAKLSDNAGAALVEIGRVSRQLAELIESISQTTSHEA
FT                   TLASDVAQNIEQILHITEQTSTGTRQTAQSVRQLTQLAEELRDSVARFRIA"
FT   gene            594607..600645
FT                   /locus_tag="Rpic12D_0564"
FT   CDS_pept        594607..600645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0564"
FT                   /product="CheA signal transduction histidine kinase"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; Hpt domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: response regulator receiver; Hpt
FT                   domain protein; CheW domain protein; ATP-binding region
FT                   ATPase domain protein; KEGG: rso:RSc0672 putative composite
FT                   two component regulatory (sensor histidine kinase and
FT                   response regulator hybrid) transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61869"
FT                   /db_xref="GOA:C6BDD4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDD4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS61869.1"
FT                   /translation="MRHQSAAEPAQSHPASLEATGGPAVRPKAAVPARDLSALAWVAPN
FT                   MRAALDDAVREFGEYAADVIADPEVIGARDTTSLRLAGQYLHQAAGALLIVGLRGVDVY
FT                   CQAAKRLLEAVDAGTVAADAQTLDVFSRAVQALQEYVADLMAGMGEEPLRLFQPYQAVL
FT                   TRLGEERIHPADLWADELRHLPALLLPSRDLPGLARLRRKFELALLTALRAPASNADGA
FT                   VVDPSAAAAAYAPLEDILHGIRALEREPRRAGDDLHRDLWLVLALTFGALRAGLVPADM
FT                   TAKRLAARVNLLLRQYSHNNVHLPQGLLTDALYLLAGMAYSNAPATPVGDDTLGPDIVA
FT                   CVQAFAIPPTHAPAGALHTRQYYALLPTDASDTLQRVGRSLETLSQQPAPAADELDAAL
FT                   QTLALHADALGQPALSELSNRLTEAAGQDVAPTLQFLSRMLARPWALHGESGDLRSAWF
FT                   AARCSELAEHARVAQDGQAVPAPAWLTLLAGEAAQRRTRAEQVRALQTQLASAETHLDA
FT                   FEREGEESGGLQEAARLFGEMQNAFAALDAYEAVHATEAAQSTINALQAAGEGATADRE
FT                   RYLAALAANVSGLQALLDALSAGTELTGGQVDEIVIEGRLTPNARETAWREFVFDTESG
FT                   MLARREPQSETQSGADAANADAASPLQSLLDRLLAKQPVDPTDPLAAELRTALQEARDA
FT                   AAIDDDPARRRRLEEALAQFDAWQVGSPGALERMQAALAAPVAAPAAAAPAPTAARDTQ
FT                   SIDAELLDIFLSEAEEVLAGVRADLQGLQAAADMGTGGLAAGSDLDLLTQLRRAFHTLK
FT                   GSGRMVGLTRYGEAAWAIEQVMNVWLAESRVPTSDLAALLTRAESELSTWAAAIAQSPQ
FT                   ADHAIEPLVAAAERVRHGGPFVWLEAVPASEPAKGAPAAEYAEPHPVEAPAAETASHDA
FT                   VAEPSLELAAPDAPVAEAADPVALTWDDEPAEPEAEAPVSDATAPVVEHDAVEPVAEHV
FT                   EEAHQEAAAEPVAADSDAKVIPFPFAQTGEPEEVPHDDGVKEIGPVRISVALYNVYLQE
FT                   ADDLIRRLGVDFSEWRHEGRTPPSELALRAAHTLQGSSAVVELEPVRQLAGALEQVLLN
FT                   LNSRPVAMHPGDFRLLDQAVERMRGMLHQFAASLWPDTDEPLRRSLDELCERLLVRPRL
FT                   PLEPAPAAFSEAEPAENETAGSAGEPEFDPAPVAPTFVPVHESPVVEPAVGELVRQAPA
FT                   DALDPALLEIFLEEAHVALPELGQHLRAWEAAPQDRNAAGLLLRNLHTVKGSARMAGAM
FT                   TLGQAAHEMESAIEGGLRQNRVDDALFRKLYVWFDRIQAHVDALGAGNLLPLDAGLADA
FT                   ADATQASSETQTPSGTSMLPAMATTSVDLAGTRSPEAEALEVAERQRAMVRVQARALDS
FT                   LINDAGEVGAARARLESEVDALKTYLSELNDNVARLRSQVREIEIQAETQMESRIADAA
FT                   AHDESFDPLEFDRFTRLQELTRMMAESVNDVATVQQNLFRGFDQASLDLETQARLTRGL
FT                   QRSLMRARMVQFDTVADRLYRVARQAAAETGKEVRLFIKGGTVELDRSVLDRMGGPLEH
FT                   MIRNAVAHGIESADERRAKGKAPAGELTLEVQQEGNEVVLHFVDDGAGLNLDRIRARAL
FT                   ERQLLAADEEASDARLTEMIFTPGFSTADQVSELAGRGVGMDVVRAETVALGGRISLQT
FT                   TPEVGTRFTIHLPLTTAITQVLLVRVSERVYAIPSGMIDHVQQLRPQALAEAYNAAALQ
FT                   LPTGPVPFHYFGALLEEATSVTSGRKYSPAVVVRNGADRAAVHVDEVIGNREVVVKHIG
FT                   PHLARLEGIAGATTLGDGEIVLIYNPVVLTQRFEREAVARSLSDPEATGAVAELQRDGS
FT                   TDAVPGLATQPIVMVVDDSLTVRKVTQRLLTRSGYQAVLARDGVDALRQLQEITPDAML
FT                   VDIEMPHMDGFDLTRNVRADERIGATPIIMITSRTADKHRRYAAEIGVNVYLGKPYNEE
FT                   ELLQHLRNLIGERAPAAKAG"
FT   gene            complement(600715..602271)
FT                   /locus_tag="Rpic12D_0565"
FT   CDS_pept        complement(600715..602271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0565"
FT                   /product="Deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /note="PFAM: DNA photolyase FAD-binding; DNA photolyase
FT                   domain protein; KEGG: cti:RALTA_A2399 deoxyribodipyrimidine
FT                   photolyase (photoreactivation), FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61870"
FT                   /db_xref="GOA:C6BDD5"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDD5"
FT                   /inference="protein motif:PRIAM:4.1.99.3"
FT                   /protein_id="ACS61870.1"
FT                   /translation="MPSTAPSRQPYNIGAHFQRGLVWFRRDLRHVDHAALHYALRHCRE
FT                   VYCVFVFDRDILDALLARGLKADRRVEFIRASIEELRGALREAGGDLIVVHDHPRHAIP
FT                   EIARQLNVEAVFANHDEEPSAQARDEAVRKALAQQPCAWFDFKDQVIFERDEILNGQGK
FT                   PYGVFTPYKNAWLAALTPLDLRAYPTEPYFGALARPPEALAQPTPALEAMGFARTNLSE
FT                   IALPSGMSGGQTLLDEFEERMDDYHARRDFPAVRGPSYLSTHLRFGTVSIRTLAARAHA
FT                   AMLRGSRGAATWLSELVWRDFYFMILHHRPDLADGAAFHPEFDRIRWVDGDTGDARFEA
FT                   WKAARTGYPLVDAAMLQIFQSGYMHNRLRMVAASFLIKDLGIDWRRGEQYFADVLNDFD
FT                   FAANNGGWQWAASSGCDAQPWFRIFNPVTQSEKFDPQGRFIRKYLPQLAKLPDKYIHAP
FT                   WTAPANVLKEASVVLGETYPLPIVDHAAARAATLDRYAVTKAHRTSGAEAAALTKAGAD
FT                   D"
FT   gene            602351..603097
FT                   /locus_tag="Rpic12D_0566"
FT   CDS_pept        602351..603097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0566"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; RNA-binding S4 domain
FT                   protein; KEGG: rso:RSc0674 ribosomal small subunit
FT                   pseudouridine synthase A protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61871"
FT                   /db_xref="GOA:C6BDD6"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDD6"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACS61871.1"
FT                   /translation="MADSSRLPLYRILQSQGFGTRRYCKDLVLAGLVCINGVEMESPDA
FT                   LVDTAGLVLDVDGERWAYHARAYLMLNKPAGVECSQKPKHHPSVYTLLPVPLRERAVQC
FT                   VGRLDQDTTGLLLLTDDGQFVHTITSPRHQVPKVYEITTAEPVTEAQIAQLCAGVLLAD
FT                   ENENVAAAWAERVGTHHLRMALTQGKYHQVKRMVAAAGNHVVGLHRSAIGGLSLGDLAP
FT                   GEWRWLEAADLEALNTTPPHATGSSA"
FT   gene            603194..603766
FT                   /locus_tag="Rpic12D_0567"
FT   CDS_pept        603194..603766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0567"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   rso:RSc0675 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61872"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDD7"
FT                   /inference="protein motif:PFAM:PF02622"
FT                   /protein_id="ACS61872.1"
FT                   /translation="MASPDALINLTNQFLIAMPGMADSTFSGTVVYMCEHNERGALGLV
FT                   INRPIDIDLATLFDKIDLKLEIHPLAEQSVYYGGPVQTERGFVLHDATGAYSSSLAVPG
FT                   GLEMTTSKDVLEAVAQGGGPHRFILTLGYAGWSAGQLEDEISRNGWLTVQADPEIIFNV
FT                   PPEARFAAALNLLGINPAMLSGEAGHA"
FT   gene            603759..604190
FT                   /locus_tag="Rpic12D_0568"
FT   CDS_pept        603759..604190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0568"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: rso:RSc0676
FT                   Holliday junction resolvase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61873"
FT                   /db_xref="GOA:C6BDD8"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDD8"
FT                   /inference="protein motif:PFAM:PF03652"
FT                   /protein_id="ACS61873.1"
FT                   /translation="MPEPARPAPVPMPADGTLLAFDYGEKRIGVALGNSITRSARALET
FT                   IPNRSVDFRFAQISRLVGEWQPVGFVVGMPVHPDGEEQPMIKLAKRFGNQLHGRYGLPV
FT                   TWVDERYSSIAAQDAGASDDVLDAEAARIILQQFFDEHA"
FT   gene            604187..604705
FT                   /locus_tag="Rpic12D_0569"
FT   CDS_pept        604187..604705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0569"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: rso:RSc0677
FT                   pyrimidine regulatory protein PyrR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61874"
FT                   /db_xref="GOA:C6BDD9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDD9"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ACS61874.1"
FT                   /translation="MTSQQIDAEALYQSLVAQLRTRLADGHTWSAAGIVSGGAWIAKRL
FT                   AHDLGLPEYGVVNVAMHRDDYAKKGLHAKAQPTTLPFDVNERRILLVDDVLASGRTIRA
FT                   AINELFDYGRPAAVELAVLVDRGERQLPVAPDYIGERLTLPANESLVLSEAGEGAAARF
FT                   TFTREPKGA"
FT   gene            604767..605738
FT                   /locus_tag="Rpic12D_0570"
FT   CDS_pept        604767..605738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0570"
FT                   /product="aspartate carbamoyltransferase"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region; KEGG: rso:RSc0678 aspartate
FT                   carbamoyltransferase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61875"
FT                   /db_xref="GOA:C6BDE0"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDE0"
FT                   /inference="protein motif:TFAM:TIGR00670"
FT                   /protein_id="ACS61875.1"
FT                   /translation="MPKTFANPQLTKNGELKHLLSIEGLSRDILTHVLDTAQQFVSVSD
FT                   SDREVKKVPLLRGKSVFNLFFENSTRTRTTFEIAAKRLSADVINLNINASSTSKGESLL
FT                   DTINNLSAMQADMFVVRHASSGAPYLIAEHVAQHVHVINAGDGRHAHPTQGLLDMFTIR
FT                   HYKKDFSNLTVAIVGDILHSRVARSDIHALTTLGCAEVRAIGPRTLLPGGLEHMGVRVF
FT                   HNMEEGLKGVDVVIMLRLQNERMSGALLPSAQEYFKAYGLTQDRLALAKPDAIVMHPGP
FT                   MNRGVEIDSAVADGVQSVILNQVTFGIAVRMAVMGIVAGNND"
FT   gene            605747..607024
FT                   /locus_tag="Rpic12D_0571"
FT   CDS_pept        605747..607024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0571"
FT                   /product="dihydroorotase, multifunctional complex type"
FT                   /note="TIGRFAM: dihydroorotase, multifunctional complex
FT                   type; PFAM: amidohydrolase; Amidohydrolase 3; KEGG:
FT                   rso:RSc0679 dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61876"
FT                   /db_xref="GOA:C6BDE1"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDE1"
FT                   /inference="protein motif:TFAM:TIGR00857"
FT                   /protein_id="ACS61876.1"
FT                   /translation="MKLHIKGGRLIDPANGIDAQQDLYIAASKVVGVGHAPADFHANKT
FT                   IDATGLVVCPGLIDLSARLREPGFEYKATLESEMAAAMAGGVTSLVCPPDTDPVLDEPG
FT                   LVEMLKFRARNLNQAHVYPLGALTVGLKGAVLTEMAELTESGCVGFSQTDAPMADTQVL
FT                   MRALQYAQTFGFTVWLRPEDPYLGKGGVAASGPLASRLGLSGVPVIAETVRLHTIFELI
FT                   RSTGARVHLCRLSSAAGIELVRRAKAEGLPVTCDVNVHHISLTDVDIGYFNSQMRFVPP
FT                   LRSGRDRDGIVRALADGTIDAICSDHTPVDDDEKLLPFAEATPGATGLETLLPLTLRWA
FT                   TEHKVELSKALARITSEPARVLGLHAGSLEVGAMADVCVFDPDATWKLEPRALRSQGKN
FT                   SPYLGFELAGRVRATMVAGHLAYDGH"
FT   gene            607011..607808
FT                   /locus_tag="Rpic12D_0572"
FT   CDS_pept        607011..607808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0572"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: rso:RSc0680
FT                   1-acyl-sn-glycerol-3-phosphate acyltransferase
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61877"
FT                   /db_xref="GOA:C6BDE2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDE2"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACS61877.1"
FT                   /translation="MTGIDQRVASAPAEASTPQRKHVLRKLRLLVHLVEGLVTCALLFW
FT                   WIKPHTKQALIQRWSRKLLALFRVSLVVHGEPVAGKELAGSMLVSNHVSWIDIYAINSW
FT                   YPPRFVAKSEIRSWPVIGWLCAQTGVLFVERARKRDAHRIMHVIADAMRSGDAICVFPE
FT                   GTTSDGLQLLPFHANLFQAPVSAGAPIRPLALRYRIAATGELTTIPAYIGDLSMMDTIN
FT                   AMLNGPPLVVEVFVGPAVAPEMDRRALAAHSQEAVANLIARAG"
FT   gene            complement(607818..608708)
FT                   /locus_tag="Rpic12D_0573"
FT   CDS_pept        complement(607818..608708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0573"
FT                   /product="bis(5'-nucleosyl)-tetraphosphatase (symmetrical)"
FT                   /EC_number="3.6.1.41"
FT                   /note="KEGG: rso:RSc0681 diadenosine tetraphosphatase;
FT                   TIGRFAM: bis(5'-nucleosyl)-tetraphosphatase (symmetrical);
FT                   PFAM: metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACS61878"
FT                   /db_xref="GOA:C6BDE3"
FT                   /db_xref="InterPro:IPR004617"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDE3"
FT                   /inference="protein motif:TFAM:TIGR00668"
FT                   /protein_id="ACS61878.1"
FT                   /translation="MIALGHHPHTDDIFRAMSPPHAIGDLQGCCCPLQTLLAALPPNAP
FT                   LRFVGDLINRGPESLATLRQVIALCETGRARTVLGNHDIHLLAVAAGVRKPGKRDTLGD
FT                   ILSAPDSDQLITWLRHQPLAIFENGFLMVHAGVLPQWTTGDVLELAGAVERELRSPHWK
FT                   AFLADAFGNHPDKWSNDLVGMDRLRLTINALTRLRFCKPDGTMEFDTTDADGAPDGHMP
FT                   WFDVPGRRTRGTPIVFGHWSTRGLVMRDDVMGLDTGCVWGGKLTAAKLSLAPAGRDVIQ
FT                   VDCEQAQDPLAHKKK"
FT   gene            608829..609893
FT                   /locus_tag="Rpic12D_0574"
FT   CDS_pept        608829..609893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_0574"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; Male sterility domain;
FT                   3-beta hydroxysteroid dehydrogenase/isomerase;
FT                   polysaccharide biosynthesis protein CapD;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: reu:Reut_A0712
FT