(data stored in ACNUC7421 zone)

EMBL: CP001647

ID   CP001647; SV 1; circular; genomic DNA; STD; PRO; 273136 BP.
XX
AC   CP001647; ABDZ01000000-ABDZ01000044;
XX
PR   Project:PRJNA18937;
XX
DT   23-JUN-2009 (Rel. 101, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 2)
XX
DE   Ralstonia pickettii 12D plasmid pRp12D02, complete sequence.
XX
KW   .
XX
OS   Ralstonia pickettii 12D
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Ralstonia.
OG   Plasmid pRp12D02
XX
RN   [1]
RP   1-273136
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Meincke L., Brettin T.,
RA   Detter J.C., Han C., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Ovchinnikova G., Marsh T., Richardson P.;
RT   "Complete sequence plasmid 2 of Ralstonia pickettii 12D";
RL   Unpublished.
XX
RN   [2]
RP   1-273136
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Meinche L., Brettin T.,
RA   Detter J.C., Han C., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Ovchinnikova G., Marsh T., Richardson P.;
RT   ;
RL   Submitted (17-JUN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 13e2b25b0f215457664005ba7aee3178.
DR   BioSample; SAMN00000034.
DR   EnsemblGenomes-Gn; EBG00001008016.
DR   EnsemblGenomes-Tr; EBT00001532141.
DR   RFAM; RF01757; sbcD.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003027
CC   Source DNA and organism available from Terry Marsh (marsht@msu.edu)
CC   Contacts: Terry Marsh (marsht@msu.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Ralstonia pickettii 12D
CC   GOLD Stamp ID         :: Gi01352
CC   Greengenes ID         :: 243860
CC   Isolation Site        :: Copper-contaminated sediment from a lake
CC                            in Michigan
CC   Isolation Country     :: USA
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: Nosocomial infection
CC   Habitat               :: Fresh water, Host, Soil
CC   Phenotypes            :: Pathogen
CC   Energy Source         :: Heterotroph
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..273136
FT                   /organism="Ralstonia pickettii 12D"
FT                   /plasmid="pRp12D02"
FT                   /strain="12D"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:428406"
FT   gene            complement(135..1505)
FT                   /locus_tag="Rpic12D_5098"
FT   CDS_pept        complement(135..1505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5098"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: rso:RSp0654 two component sensor histidine
FT                   kinase transcription regulator protein; TIGRFAM: heavy
FT                   metal sensor kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5098"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66332"
FT                   /db_xref="GOA:C6BQH4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQH4"
FT                   /inference="protein motif:TFAM:TIGR01386"
FT                   /protein_id="ACS66332.1"
FT                   /translation="MRRLSLTARLTAYFSLSSAAVLLGLGILIALAMEEHFAVEDFTAL
FT                   GENVNVIRRVVESSSAAEVSTRLNDVLQHRTDLIVRVQAPQGQPLFATPNFDFAEVLRV
FT                   LRKAGRHSGALVWQQGEEQYRGVHMQVPLRDGDALDVLVGINTEIHAHFLRAFRKTLML
FT                   YIALAALASGLFGWWAARRGLLPLRAMASRAKSVTADRLNERMPVDMVPVEVADLGVTL
FT                   NGMLARLQGDFQRLTDFSTDIAHELRTPITNLLTQTEVALSQTREPAKYRDVLASNVEE
FT                   LQRLARMVSDMLYLAKMEHNLTLPSAEMIELADEVRALFEFYDAFAEDKAVQLQVEGQA
FT                   QVRGDRLMLRRAFSNLLSNAIRHTPRCGRVIVSIKPGEEDLAVTIDNDGEAIAPDVLPF
FT                   IFERFFRADKSRARPESDGAGLGLAITKAIVLAHGGIISVTRAHDRTRFTVRLPIRS"
FT   sig_peptide     complement(1407..1505)
FT                   /locus_tag="Rpic12D_5098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 33"
FT   gene            complement(1505..2191)
FT                   /locus_tag="Rpic12D_5099"
FT   CDS_pept        complement(1505..2191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5099"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="KEGG: rso:RSp0655 two component response regulator
FT                   transcription regulator protein; TIGRFAM: heavy metal
FT                   response regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5099"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66333"
FT                   /db_xref="GOA:C6BQH5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQH5"
FT                   /inference="protein motif:TFAM:TIGR01387"
FT                   /protein_id="ACS66333.1"
FT                   /translation="MKLLVVEDESKTGEYLQQGLSEAGFVVDLARNGMDGRHLAMTGDY
FT                   DLLILDVMLPDLEGWQILHALRSAELAVPVLFLTARDSVADRVKGLELGADDYLVKPFA
FT                   FAELLARVRSLLRRGSAPSLAERIQVADLVLDLTRRRASRGGQRIALTSKEFSLLELLA
FT                   RRHGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDNFEPKLIHTVRGMGYVLE
FT                   GPEDGE"
FT   gene            2379..4301
FT                   /locus_tag="Rpic12D_5100"
FT   CDS_pept        2379..4301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5100"
FT                   /product="copper-resistance protein, CopA family"
FT                   /note="TIGRFAM: copper-resistance protein, CopA family;
FT                   PFAM: multicopper oxidase type 3; multicopper oxidase type
FT                   1; multicopper oxidase type 2; KEGG: rso:RSp0656 copper
FT                   resistance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5100"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66334"
FT                   /db_xref="GOA:C6BQH6"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="InterPro:IPR034284"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQH6"
FT                   /inference="protein motif:TFAM:TIGR01480"
FT                   /protein_id="ACS66334.1"
FT                   /translation="MRSNRAMGVVLPNLPRRRFVQGLAAGGVIAGLGLSGMPARASQPQ
FT                   GAAFGTAPVLRGTEFDLVIAETPVNFTGKPGMATTINGMLPGPTLRWREGDTVTIRVTN
FT                   RLPEPTSIHWHGIILPFQMDGVPGISFSGIAPGETFTYRFKVQQSGSYWYHSHSGFQEM
FT                   TGLYGGIVIDPAGEDRVRADRDYTVLLSDWTDEDPMRVLTKLKIQGDYYNYNQPTVVDF
FT                   FRDVSREGWTSAMDKRRMWNQMRMNPTDLADLSSATLTYLMNGVTPAGNWTGLFSPGQT
FT                   VRLRFINGAGNTFYDVRIPGLKMKVVQVDGQDIEPVSVDEFRFGPGETCDVVVAPTDEA
FT                   HTVFAQTMDRTGYARGTLAVRPGVQAPVPAVDKAEWLTMADMMGDMGDMSGMSGMSGMS
FT                   GMSGMSGMSGMSGMSGMSGMSGMSGMSGMSGMSGMSGMSGMDHGAMVMDHSQHGTMQGN
FT                   VANSLKVPSKKARHARTEYGPSTDMHVDMARTNLDDPGIGLRNNGRRVLVLQDMHTIGG
FT                   PMDARSPQREVELHLTGNMERYAWSLDGVEFGKSTPVHFRYGERLRVILHNDTMMTHPM
FT                   HMHGMWSELEAPDGTFLARRHTIPVQPAQRVSFLVTADALGRWAWHCHLMLHMDAGMFR
FT                   EVIVA"
FT   sig_peptide     2379..2504
FT                   /locus_tag="Rpic12D_5100"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.978 at
FT                   residue 42"
FT   gene            4321..5586
FT                   /locus_tag="Rpic12D_5101"
FT   CDS_pept        4321..5586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5101"
FT                   /product="copper resistance B precursor"
FT                   /note="PFAM: copper resistance B precursor; KEGG:
FT                   rme:Rmet_6113 copper resistance B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5101"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66335"
FT                   /db_xref="GOA:C6BQH7"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQH7"
FT                   /inference="protein motif:PFAM:PF05275"
FT                   /protein_id="ACS66335.1"
FT                   /translation="MTTHKHVKTALAVALAVVGINAASAQESTATYDAMAPSSGASTRP
FT                   TAHGSMQGMDHGSKQGMDHGSMQGMDHGSMQGMDHGSMQGMDQGSMQGMDQGSMQGMDQ
FT                   GSMQGMDHGSMQGMDHGSMQGMDHGSMQGMDQGSMQGMDQGSMQGMDQGSMQGMDQGSM
FT                   QGMDHGSMQMQGGSPPPDARDPNAYSGGYQLGVGKFALGNTRQLMMADEHNFGSFLIDR
FT                   LEWVRGPNSNAASYEAQAWYGSTYDKVVLKAEGDVKKGRLEEARTELLWGHAITTFWDT
FT                   QLGIRNDVGSGRPARNWAAFGVQGLAPYWFNIQATAYVGNSGRTALRLSTEYELLLTQR
FT                   LILQPRVEANLYGKNDPALEIGSGLSSASVGLRLRYEFSRQFAPYIGVERYQTFGNTAN
FT                   MIRADGGRSGETRFVAGLRVWY"
FT   sig_peptide     4321..4398
FT                   /locus_tag="Rpic12D_5101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 26"
FT   gene            5621..6007
FT                   /locus_tag="Rpic12D_5102"
FT   CDS_pept        5621..6007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5102"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   rme:Rmet_6114 copper resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5102"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66336"
FT                   /db_xref="GOA:C6BQH8"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQH8"
FT                   /inference="protein motif:PFAM:PF04234"
FT                   /protein_id="ACS66336.1"
FT                   /translation="MLTPRYIASIAVAASAIFASTAAFAHPKLLSSTPADKAEVAAPAK
FT                   IELKFSENLSTQFSGANLVMTEMPGMSSHDAMKVAAKVAADDDPKTMVITPAQPLMTGT
FT                   YKVEWRAVSSDTHPMTGNFSFKVK"
FT   sig_peptide     5621..5698
FT                   /locus_tag="Rpic12D_5102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            6012..6941
FT                   /locus_tag="Rpic12D_5103"
FT   CDS_pept        6012..6941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5103"
FT                   /product="copper resistance D domain protein"
FT                   /note="PFAM: copper resistance D domain protein; KEGG:
FT                   rso:RSp0659 copper resistance D transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5103"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66337"
FT                   /db_xref="GOA:C6BQH9"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQH9"
FT                   /inference="protein motif:PFAM:PF05425"
FT                   /protein_id="ACS66337.1"
FT                   /translation="MADDWLNIALRFALYVDLTILFGVSLFGAYALRPDHRSSAIARRY
FT                   VCAIGVAAASGIVLSLWSIVVTAKAMTGAAEYAELSSHVFGMMLSSTAVGIGWLVRIAA
FT                   LAACLIIVMCVRRMPTLHFDIFAVLGAVALATVAWAGHGAMHDGSRGYVHITADIAHLL
FT                   AAGAWVGSLTAFVLLARAQQAASLESVEILNHTSNGFARLGTLIVATLLATGVVNYLLI
FT                   VGPTIDGLATSAYGVLLLAKLALFGLMLGLAAANRYLLSPQLEIAMRSGDHAGAVMTLR
FT                   RSLLTEASLAVVILALVAWLGVLSPPGT"
FT   gene            7026..7463
FT                   /locus_tag="Rpic12D_5104"
FT   CDS_pept        7026..7463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5104"
FT                   /product="protein of unknown function DUF411"
FT                   /note="PFAM: protein of unknown function DUF411; KEGG:
FT                   bte:BTH_II0365 RC180"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5104"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66338"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQI0"
FT                   /inference="protein motif:PFAM:PF04214"
FT                   /protein_id="ACS66338.1"
FT                   /translation="MVGLALLPAIALAQKSEPKPTFQVWKTPGCGCCKDWLSHLRDNGF
FT                   DVVTHDVEDTVEARRKTGIPDRYASCHTAAVQGYAVEGHVPAREIKRLLRERPKAIGLA
FT                   VPSMPIGAPGMDGPAYGNRRMPYNVLLIGLDGTSTVFQAYS"
FT   gene            complement(7854..9119)
FT                   /locus_tag="Rpic12D_5105"
FT   CDS_pept        complement(7854..9119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5105"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66339"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQI1"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6120"
FT                   /protein_id="ACS66339.1"
FT                   /translation="MTDLTRTLIERWKPDRDGTFQTWFLWPERLKNFRSIRRGISTVVN
FT                   EIQAGTFGNAYRGSSLETVVSAIAEQRQIFKGADHAFLWKPKLRIPDIYENADHQRAFA
FT                   RLLHTCNCCDTEQEVVQAIQQLNRHGIKGLGPAVANLLYFIHPTLAVPFNTAIVNGYNA
FT                   LTGSRVKLGKWDHYLAMREGVLSLNGRYRDLLSNDLGAIAGLLFDIGMERYPAPPQEGG
FT                   ATTIAEWEKDLAKAREEAASFAKQLQAGRTDDASHTEVQGWLRDLGKALGFAVWVATND
FT                   RSRPYNGGVLSEGCLATLPNSLLVSGADTVPLIDVVWLNAVSLEVEAAFEVEHTTSIYS
FT                   GIVRLLDLALGTDQATRKHLFLVAPDAREADVRAQLARPAFRRVAELGIRYVPYTSLTE
FT                   HRDSIARFGVGIKPIEAIARTL"
FT   gene            complement(9881..10363)
FT                   /locus_tag="Rpic12D_5106"
FT   CDS_pept        complement(9881..10363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5106"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   rme:Rmet_6116 blue (type 1) copper domain"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5106"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66340"
FT                   /db_xref="GOA:C6BQI2"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQI2"
FT                   /inference="protein motif:PFAM:PF00127"
FT                   /protein_id="ACS66340.1"
FT                   /translation="MNRFSRSILALSFAPLAAFGAANQLEGLGSNSSEPAPKAGQPGDP
FT                   QKVTRTINVTMSDDMRFQPTTLTVKVGETVRFVVENIGKVHHELVIGTAADLKEHAEMM
FT                   RKMPEMSHHTIGKHLALEPGQQGALIWRFDEPGMVDFACLVPGHYEAGMIGKIVVK"
FT   sig_peptide     complement(10301..10363)
FT                   /locus_tag="Rpic12D_5106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.752 at
FT                   residue 21"
FT   gene            10740..11147
FT                   /locus_tag="Rpic12D_5107"
FT   CDS_pept        10740..11147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5107"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66341"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66341.1"
FT                   /translation="MSIRYPVITEGGYVLRACSALALAAMVSGCTTAYEGKYEYAEGWR
FT                   LGVIVRTGTLADMAPVEAMCSLADQSSTARFAYVQFIFGPTHGKFLYSGPHQRHVIVPL
FT                   PQGGGLHEGARVYINLQDCNQAAVPASATTP"
FT   sig_peptide     10740..10841
FT                   /locus_tag="Rpic12D_5107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.724 at
FT                   residue 34"
FT   gene            complement(11200..12102)
FT                   /locus_tag="Rpic12D_5108"
FT   CDS_pept        complement(11200..12102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5108"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bur:Bcep18194_B0394 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5108"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66342"
FT                   /db_xref="GOA:C6BQI4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQI4"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS66342.1"
FT                   /translation="MNHRQIEAFRAIMLTGTTARAAQYMHTSQPAVSRLLAQLEASLQM
FT                   RLFERERSRLRATPEAKLWFAEIERAYAGLDHLQQYATQLRSGSGGSIAVACLPALGLG
FT                   LMPRIIAALRKDFPDVLVRFEIGSSVQVRDQVARGQCDIGFAADEVELEGLTATPIVTT
FT                   NAVVAMPVNHPLARQRRVKLSDLCDHPFIALSRRDTTRRQLDELLAVDGRTLRLACETP
FT                   YSITVASLAKNGVGIGLVNPLALSELDARGAAFRPLDKKIRFRTLALQAASVPLSLPAQ
FT                   AFMAHARRILAAAAKEAGS"
FT   gene            12188..13345
FT                   /locus_tag="Rpic12D_5109"
FT   CDS_pept        12188..13345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5109"
FT                   /product="Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG: mag:amb1294
FT                   cystathionine beta-lyase/cystathionine gamma-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5109"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66343"
FT                   /db_xref="GOA:C6BQI5"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQI5"
FT                   /inference="protein motif:PFAM:PF01053"
FT                   /protein_id="ACS66343.1"
FT                   /translation="MPPNTTPNFMTSSPRFSALTVPVHRASTLVFDTTAQFLARKGQLF
FT                   DGYSYGLYGTPTTRALETEVASIEGGSRTVLVPSGLAALTHPMLALLSAGDHVLVADCV
FT                   YGPTREFCNSVLRKIGVAVTYFAADAATIDAHLQSNTRLVLLESPGSFTMEIQEIAAIS
FT                   REAHTAGALVMLDNAWGFGNSAMFEHGVDIVCTALSKYAAGHSDVCLGSITVRSERLFR
FT                   QIKTFVSGVGTGVSSDDAFLVLRGLRTLSVRLAEHAQRGLDLTQWLRGRREVASLVHPA
FT                   HPEDPQHQRFKRYFSSGNGLLTILLHSQDLERISAMLDGLKHFRIGASWGGTDSLIAIA
FT                   DLTASRIVQPWPPGRYALRLHIGLEPLEPLYADLEAGFTRLNGQA"
FT   gene            13389..14276
FT                   /locus_tag="Rpic12D_5110"
FT   CDS_pept        13389..14276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5110"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   bte:BTH_I1225 glutamate/aspartate ABC transporter,
FT                   periplasmic glutamate/aspartate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5110"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66344"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQI6"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS66344.1"
FT                   /translation="MIRLLAFAALATVLGSATAQETGTLAKIKQTGVMTLGAREASIPF
FT                   NYLDDHQRQAGYAWELSTRIADAVKRQLKLPKLEIKEINLTPQTRVALVANQTVDLECS
FT                   STTNNLERQKQVAFSNTFFIVGARLLVRKNSGIQHWADLIGKNVVVSAGTTGERLLRKL
FT                   NVENRWGINIILAKDINENFLTVETGRAVASMQDDIILYSNIARAKDPSMWEVVGMPQQ
FT                   REAYGCMLRKDDPAFKKLVDDTIAAMMKSGEMEALYKRYFQSTIAVKGGLRIDRPLSPE
FT                   MLDLFKHPNDKAFQ"
FT   sig_peptide     13389..13448
FT                   /locus_tag="Rpic12D_5110"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 20"
FT   gene            14305..15042
FT                   /locus_tag="Rpic12D_5111"
FT   CDS_pept        14305..15042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5111"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: cti:RALTA_A0429
FT                   glutamate/aspartate transport protein; ABC superfamily,
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5111"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66345"
FT                   /db_xref="GOA:C6BQI7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030202"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQI7"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS66345.1"
FT                   /translation="MNYSWDWLIYFKPSVTGEGLYGAMLLTGLGWTLLISLLSWTLALA
FT                   LGTLFGVARTLPQRWVRWPSAAYVHCFRNTPLLVQLFLWFYVLPELLPVDWGNAIKQMN
FT                   PTLNQFLTVVLCLTLYSAAKCAEQIRAGIESIAAGQRAAGLALGLSTGGIYRHVILPQA
FT                   FRIIIPPLTSDFMNVFKNSAVALTIGLMELTGQSRQLSEFSAQPFESFLAATVIYMLVT
FT                   LLVVWLMHVIEARSRLPGMVGSH"
FT   gene            15050..15739
FT                   /locus_tag="Rpic12D_5112"
FT   CDS_pept        15050..15739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5112"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: met:M446_4545 polar
FT                   amino acid ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5112"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66346"
FT                   /db_xref="GOA:C6BQI8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR030205"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQI8"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS66346.1"
FT                   /translation="MSYQFDWSSIPRAWPYLVEGLATTGGLVAASITAGIALGTVLAIG
FT                   RLFGPRPVTMTVAAYVNVFRSIPLILTIFWFFFLVPAMLRAVTGDPYLTVGPIWAALAA
FT                   FILAESAYYCEIIRAGIGSVKTGQLSAAKALGLTQWQALRHVILPQAFRNMTPSLINQT
FT                   IALLKDTSLVYVISLTDFLGAAGKIGQRDGRLVEMYLFSAAVYLVLCSFGVWLVAAVQK
FT                   KRMGARA"
FT   gene            15790..16524
FT                   /locus_tag="Rpic12D_5113"
FT   CDS_pept        15790..16524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5113"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rso:RSc0484 putative glutamate/aspartate transport
FT                   ATP-binding ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5113"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66347"
FT                   /db_xref="GOA:C6BQI9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQI9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS66347.1"
FT                   /translation="MINISDVSKWYGPFRVLTDCTTSIAPKDVVVICGPSGSGKSTLIK
FT                   TVNGLEPFQKGDIHVGGISVGAADTNLASLRARVGMVFQSFELFPHLTVLQNLALGQIK
FT                   VLKRNRAAAEAKALALLDRVGLVAHASKFPGQLSGGQQQRVAIARALAMDPEVMLFDEP
FT                   TSALDPEMVNEVLDVMIDLARDGMTMAVVTHEMGFARQVANRVIFMDQGQIIEDVPKAD
FT                   FFDCPDARTDRARQFLSKILSS"
FT   gene            16626..17069
FT                   /locus_tag="Rpic12D_5114"
FT   CDS_pept        16626..17069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5114"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66348"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQJ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66348.1"
FT                   /translation="MKNMMAAAVFGLASMAALAHNIDADITKFEKIHATKDPNSKEARE
FT                   AKVLIEQARAVYFHSDTVQLLRIRALLNDGFKFVGAQPAFLGSEIKRLEDAIASPKTSD
FT                   PAMTDAARKLLLQAKAEKAAYDVLHDSVGEKIDQAMKLIEAAK"
FT   sig_peptide     16626..16685
FT                   /locus_tag="Rpic12D_5114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 20"
FT   gene            17098..18105
FT                   /locus_tag="Rpic12D_5115"
FT   CDS_pept        17098..18105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5115"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: dac:Daci_0724
FT                   porin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5115"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66349"
FT                   /db_xref="GOA:C6BQJ1"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQJ1"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ACS66349.1"
FT                   /translation="MRIRTTVWKVAPAIIAMTSEVALAQSNVEVFGIVDTAVEWARSGD
FT                   GVNVNRLVSGQNSASRFGMRGSEDIGGGLKANFWLENGFNTDTGALSDSARLFNRRATV
FT                   GLSGPWGRVDLGRQFRPEARAVFGMDPFDGGSTASPSNTYSNTVFRTDNAVVYETPNVN
FT                   GFVGRLMYAFGEAPGAFNGANNDVGASLQYYNGPVYLAYAYDARTNATNSDKRRWHSLG
FT                   GAYDFGVAKLYAAYRTRKEGAVGLDESSYWLGVSVPLGAWTLSATATRVNDKTPADKGA
FT                   TGIGLGADYALSKRTTLYGRFGKVNNKNGATFNLDNGINGPSPSSLALGLRHKF"
FT   sig_peptide     17098..17172
FT                   /locus_tag="Rpic12D_5115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            18117..18559
FT                   /pseudo
FT                   /locus_tag="Rpic12D_5116"
FT   gene            18603..18989
FT                   /locus_tag="Rpic12D_5117"
FT   CDS_pept        18603..18989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5117"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   rme:Rmet_6114 copper resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5117"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66350"
FT                   /db_xref="GOA:C6BQJ2"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQJ2"
FT                   /inference="protein motif:PFAM:PF04234"
FT                   /protein_id="ACS66350.1"
FT                   /translation="MSNHHYIASIAFTASAMLASAAAFAHPKLLSSMPTDKAEGAAPAM
FT                   IELKFSESLFTQFSGANLVMTEMPGMSEHDAMKIAAKVTADDDPKAMVITPVQPLMTGT
FT                   YKVEWRAVSSDMHPMSGNFSFKVK"
FT   sig_peptide     18603..18680
FT                   /locus_tag="Rpic12D_5117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 26"
FT   gene            19043..19714
FT                   /locus_tag="Rpic12D_5118"
FT   CDS_pept        19043..19714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5118"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66351"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66351.1"
FT                   /translation="MAEKPGPGAARMTGRQALEDDDTKQANALCEFAPASLDTASCLMD
FT                   CSREREHFRSLVWRPVFMDIASEFSWDFLGACEDRGSPIAPQARADQYILGCRGAGSAA
FT                   IGLEKQVELQKGEGLLVGGGEAIGVDTVAVRVIRRRPVEFLQVWRATIGQLHKPRGGCF
FT                   SVGNQISSRTCVSNTGKVIALSGTSAAGFLSHASKLRLPQIRRHCFGAPRLRVKPSTLP
FT                   T"
FT   gene            20020..20274
FT                   /pseudo
FT                   /locus_tag="Rpic12D_5119"
FT   gene            complement(20279..23509)
FT                   /locus_tag="Rpic12D_5120"
FT   CDS_pept        complement(20279..23509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5120"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: rme:Rmet_6210 heavy
FT                   metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5120"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66352"
FT                   /db_xref="GOA:C6BQJ4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQJ4"
FT                   /inference="protein motif:TFAM:TIGR00914"
FT                   /protein_id="ACS66352.1"
FT                   /translation="MIHSILQGAVRLRWMVLFVTAVVAAIGAWQLNLLPIDVTPDITNK
FT                   QVQINTVVPTLSPVEIEKRVTYPIETALAGLNGVESTRSFSRNGFSQVTVIFKESANLY
FT                   FMRQQVSERLAQARPNLPEGAEPQMGPVSTGLGEVFHYSVEYAHPDGKGAAVKDGQPGW
FT                   QSDGSFLTDRGERLADQVAKLAYLRTVQDWIIRPQLRTTPGVADVDSLGGYVKQYVVEP
FT                   DAAKLAAYGISYSDLARALEDANLSVGANFIRRSGESYLVRADARIRTIDEIARAVVAH
FT                   RQNVPVTVGQVATVNVGGELRSGAASRNGYETVVGSALMLVGANSRTVAHAVGEKLNKI
FT                   GTTLPPGVVIVPTLDRSQLVVATVETVARNLTEGALLVVAILFWLLGNWRAAAIAALII
FT                   PLSLLMSAIGMNALGISGNLMSLGALDFGLIIDGAVIIVENTLRRLAERQHREGRTLTL
FT                   RERLDETVASSREMVRPTVYGQMVIFLVFVPCLTFQGVEGKMFSPMVITLMLALASAFV
FT                   LSLTFVPAMIAILLRSHVAEQEVRVIVAAKQRYRPWLQRAVARPLPFIGAGVAVLVLAV
FT                   AAFGLVGREFMPTLDEQNLNLSSVRIPSTSIDQSVAIDLPLERAVMSLPEVKTVYSKAG
FT                   TASLAADPMPPNASDNYIILKPKDQWPAGVTTKEQVIERIREKTAPMVGNNYDVTQPIE
FT                   MRFNELIGGVRSDVAVKLYGDNLDELAATAQRVAAVLRKTPGASDVRVPQTSGFPTFDI
FT                   AFDRAAIARYGLTVKEVADTVSTALGGKAAGQVFDGDRRFDIVVRLPGAQRDNLDMLGA
FT                   LPVMLPSADGQPRGSVPLRQLVQFRFTQGLNEVSRDNGKRRIYVEANVAGRDLGSFVDD
FT                   AAQRIAREVKLPTGSWIEWGGQFQNLQAATQRLAIIVPICFILIAAALYMAIGNAMLTA
FT                   TVLTAVPLALAGGVFALALRGIPFSISAAVGFIAVSGVAVLNGLVLISAIRKRMADGLA
FT                   PDAAVIEGAMERVRPVLMTALVASLGFVPMAIATGTGAEVQKPLATVVIGGLVTATVLT
FT                   LFVLPAICGIVLRRRAADSPGSPELARS"
FT   gene            complement(23506..24174)
FT                   /pseudo
FT                   /locus_tag="Rpic12D_5121"
FT   gene            complement(24348..26579)
FT                   /pseudo
FT                   /locus_tag="Rpic12D_5122"
FT   gene            complement(26755..27297)
FT                   /locus_tag="Rpic12D_5123"
FT   CDS_pept        complement(26755..27297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5123"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5123"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66353"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQJ5"
FT                   /inference="similar to AA sequence:KEGG:Pnap_4763"
FT                   /protein_id="ACS66353.1"
FT                   /translation="MSMSEFRRLATRMDQQMQQLAAEGVSDAHAVINRMMGYVPDLHRI
FT                   WVNTSDQQLMALSREFPGFYRYARIMEEASDAERNKASRPYDGMAEFSEQHKEMGAQLL
FT                   ATANTLERGYQALRAGGNLQAFQPHLKELGRLHRQWLSDLDSFKNSLRAQGAEPKVLEY
FT                   VNDAFGLMAERIKQLAG"
FT   gene            complement(27305..27631)
FT                   /locus_tag="Rpic12D_5124"
FT   CDS_pept        complement(27305..27631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5124"
FT                   /product="transcriptional modulator of MazE/toxin, MazF"
FT                   /note="PFAM: PemK family protein; KEGG: acr:Acry_3598
FT                   transcriptional modulator of MazE/toxin, MazF"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5124"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66354"
FT                   /db_xref="GOA:C6BQJ6"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQJ6"
FT                   /inference="protein motif:PFAM:PF02452"
FT                   /protein_id="ACS66354.1"
FT                   /translation="MKRGDIYLVSLDPTAGHEQSGSRPVLVVSPAEFNEATKLPVILPI
FT                   TNGGEFARRLGFAVPVTGIKTTGVVRCDQPRVIDLAARHARKVDTLPAPLMDEVLAKVA
FT                   TLFE"
FT   gene            complement(27628..27885)
FT                   /locus_tag="Rpic12D_5125"
FT   CDS_pept        complement(27628..27885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5125"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /note="KEGG: btr:Btr_0446 PemI protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5125"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66355"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQJ7"
FT                   /inference="similar to AA sequence:KEGG:Btr_0446"
FT                   /protein_id="ACS66355.1"
FT                   /translation="MHTTNLRKVGGSIMLAVPPAFLDQLHLQAGATVGLAVDHGCLVVN
FT                   PNPRPRYTLAELLAVSDYSQPQPADEREWVDAPAVGGELL"
FT   sig_peptide     complement(27817..27885)
FT                   /locus_tag="Rpic12D_5125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.604) with cleavage site probability 0.571 at
FT                   residue 23"
FT   gene            28046..28639
FT                   /locus_tag="Rpic12D_5126"
FT   CDS_pept        28046..28639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5126"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; KEGG: xcb:XC_2601
FT                   invertase/recombinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5126"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66356"
FT                   /db_xref="GOA:C6BQJ8"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQJ8"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACS66356.1"
FT                   /translation="MRTKGAAMALIGYARVSTESQHVDLQKDALRKAGCERVFEDIISG
FT                   AKKERQGLDAALAYLREGDALVVWKLDRLGRSMVHLVNTVQGLAARGVGLKVLTGQGAA
FT                   IDTTTAPGKLVFGIFAALAEFERDLIRERTKAGLTAAAARGRKGGRKPVVTADKLQRAR
FT                   EHIANGLNVREAATRLKVSKTALYAALQSGSEQR"
FT   gene            28636..29019
FT                   /locus_tag="Rpic12D_5127"
FT   CDS_pept        28636..29019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5127"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66357"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66357.1"
FT                   /translation="MSRKPSSAFVKTRKGFCYLTVKVGRSNYNIMRIRNYTLEPQDKRD
FT                   MRRLYPDYLFDWKKIGQQLAEKREVCRAYRSKRQAPRSAERTPEPFVMVSYDPRTRTVY
FT                   ASDACDSMALLDAVLHMERARKK"
FT   gene            complement(29190..29315)
FT                   /locus_tag="Rpic12D_5128"
FT   CDS_pept        complement(29190..29315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5128"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66358"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQK0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66358.1"
FT                   /translation="MPKKILIVAAAVIAIALSGCAGNGSYSGGHGGGASSGGHSH"
FT   sig_peptide     complement(29250..29315)
FT                   /locus_tag="Rpic12D_5128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.694 at
FT                   residue 22"
FT   gene            29488..29694
FT                   /locus_tag="Rpic12D_5129"
FT   CDS_pept        29488..29694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5129"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nha:Nham_4380 copper-translocating P-type
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5129"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66359"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66359.1"
FT                   /translation="MHEHHPITDPVCGMTVKPESSHRFDHAGREPAFAGRRCARIGCLA
FT                   VRENGVVILAAGRKAFGRQHAAA"
FT   gene            29703..29897
FT                   /locus_tag="Rpic12D_5130"
FT   CDS_pept        29703..29897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5130"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66360"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQK2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66360.1"
FT                   /translation="MASGDQQFDQAVGPSLPHLLEGVGQFPQVMGVTTSYFNNYFSICP
FT                   TVGQVNYGKRQWTLTSTSI"
FT   gene            29870..31123
FT                   /locus_tag="Rpic12D_5131"
FT   CDS_pept        29870..31123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo1681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5131"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66361"
FT                   /db_xref="GOA:C6BQK3"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQK3"
FT                   /inference="similar to AA sequence:KEGG:azo1681"
FT                   /protein_id="ACS66361.1"
FT                   /translation="MDPNVNEHLISFLTSLAIGLLIGVERERAGSAMGLRTSALAALFG
FT                   SIAALVGQSVGAPWFLPAALLAMTGIMVFGQTATGESESHAGPTTRMAILLSFTLGAMV
FT                   WLGHGRYAVMLAIAAAALLHFKAELRGLSSRITSRDLVSILQFATLSFIVLPLLPNVGY
FT                   GPYGAFNPHHVWMMVVLISGLSLAGYLAMRAVGDRFGPPLLGLLGGLVSSTATTLVYAR
FT                   HARQTPTMALTSSIVILMANLVLSVRLGMIAVAIAPSLMATLWPVLVGNLVAGGLAVLF
FT                   VWHRSRTGGPLLLPEVANPTELRVALSFGAMYAIILLLASWLSDWAGTRGLYLASAVSG
FT                   LTELDAIALSTLRLFGNGKLGAEVAANAIGLAILSNLCFKTGLLAWVAGRDFLLRCLPG
FT                   MMAIGIGIAIGMGWVGYA"
FT   gene            31174..31443
FT                   /locus_tag="Rpic12D_5132"
FT   CDS_pept        31174..31443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5132"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66362"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQK4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66362.1"
FT                   /translation="MSADLKGAVLRKLGDEPRWAGLRFRRELPLWLTEISAVPAYNPMH
FT                   GGTAGATSTDSYTTIGFSVKGGVPAQNSVITQKPTKPANNTSIE"
FT   gene            complement(31383..32102)
FT                   /locus_tag="Rpic12D_5133"
FT   CDS_pept        complement(31383..32102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5133"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: gme:Gmet_0228
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5133"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66363"
FT                   /db_xref="GOA:C6BQK5"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQK5"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ACS66363.1"
FT                   /translation="MGSVYYFLTLPAIVMVLGGWLASFWQPSKTLISNVQHVAAGIILA
FT                   AITIEVFPEMRQSTASPQALVGMFAFGVLFMFGVQRLGSWLEARAANTAPGSNSAQLNY
FT                   GLVITVFLDAALDGVTIGAGFAAGEKVGFALAIGLSAEMLFLGMSLVSEAIQGRRVLWV
FT                   CVALAATLLTTALVGYRSLSALPASTVAVVLAFSAAALLYLVTEELLVEAHVHEEKPYS
FT                   MLVLFAGFVGFWVITLF"
FT   gene            32391..32768
FT                   /locus_tag="Rpic12D_5134"
FT   CDS_pept        32391..32768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5134"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66364"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66364.1"
FT                   /translation="MVLVFDQVSAPFHQHHHDFGIDADAGLAALHSPSGDSLAFESHAE
FT                   DSHDGLQAGHPAIALRSQAASELSGVQSVSDALLSVAAFVVAFPAIEVDTPVPDWPDRG
FT                   PPQFTSFKSLPPAGRAPPLHA"
FT   gene            32829..34136
FT                   /locus_tag="Rpic12D_5135"
FT   CDS_pept        32829..34136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5135"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   rme:Rmet_6208 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5135"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66365"
FT                   /db_xref="GOA:C6BQK7"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQK7"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACS66365.1"
FT                   /translation="MSSQFPLRAPVQRQRGAGLASRRNVVSQPSLALCALALALTLSTT
FT                   TSQAADAPAFGVLLQQSLARAPILLEQQANAEAARLDAAQSRKWLNPKVDALSEDLNAP
FT                   SNGGQSPRQITFSISQPLELGGKRASRIAVSDRDSDVAEARRREAEVLWAAKLAVAYGT
FT                   VEAAQGRQRVAADELSRAGDDLRAARAQVEAGKEASVRVAQAEAGAAAARGAERAAAAD
FT                   LTQALEELSALVGSQERFTGIAGSLFSTAADAGAAADESPTLRVAQSEREASEARLQVE
FT                   ERRWIPDLSVTAGVRRYARTSQNGYVVGLSASIPLFDRNRDGVAAARQRVQAADARVLA
FT                   ARLETAAARRSAQAQLLAAEGQLEAALEGERASAEGYRLARIGYDAGRTPLVELLFARR
FT                   AYSEAQRSTIDARLARVRSLAALAQAQGRLAFGESQ"
FT   sig_peptide     32829..32978
FT                   /locus_tag="Rpic12D_5135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 50"
FT   gene            34133..35326
FT                   /locus_tag="Rpic12D_5136"
FT   CDS_pept        34133..35326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5136"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rme:Rmet_6209 membrane fusion protein cluster 2"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5136"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66366"
FT                   /db_xref="GOA:C6BQK8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQK8"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACS66366.1"
FT                   /translation="MTSKFKLNQVLIAACIAAGAGALGYGIASRSSSGAEPAPAAAAPK
FT                   PAATANAAKKDAPELKIPADYITAANITVENASGSDVRNELLLPAVVTAAPGAEAAVVS
FT                   RANGTLVRVLRRLGDTVKAGEVLASIESLEAATMVSDRRVAQAKVDLARKTLAREKSLF
FT                   DQGVTPRQALEAAQADVDVAEAEAQRAAAVAGAARVGSDGRSLNIVAPIAGRITSITAL
FT                   AGAHVTPDLELFRVGMPGAVQIEAPLTADDLRRVAVGDSATVLTRSGKPVPVTVRGLTP
FT                   GVSATTRAATVVLIPTAGPDAQSLLAGEGVQVRLQTRGQSTPQGVAVPEEAVQNIDGTD
FT                   VVFLRTPEGFRVQQVYVGLRSGGLAQIVTGLKSGQQVAVRNAFLLKAEAKKLAGDDE"
FT   sig_peptide     34133..34237
FT                   /locus_tag="Rpic12D_5136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.775 at
FT                   residue 35"
FT   gene            35323..38562
FT                   /locus_tag="Rpic12D_5137"
FT   CDS_pept        35323..38562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5137"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: rme:Rmet_6210 heavy
FT                   metal efflux pump CzcA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5137"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66367"
FT                   /db_xref="GOA:C6BQK9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQK9"
FT                   /inference="protein motif:TFAM:TIGR00914"
FT                   /protein_id="ACS66367.1"
FT                   /translation="MIQALLQGVVRARWMVLFLTALVAAFGAWQLNLLPIDVTPDITNK
FT                   QVQINTVVPTLTPVEVEKRVTYPIETALAGLNGVENMRSFSRNGFSQVTVIFKESANLY
FT                   FMRQQVTERLNQARASLPEGADPVLGPVSTGLGEVVHYSVEYKYPRGEGAPAPAEGKAG
FT                   WQKDGSFVTDEGERLPDSVSQLAYLRTVQDWIVRPQLRMTPGVADVDSLGGFVKQYVVE
FT                   PDLTRLAAYGLDWSELGRALEDSNLSIGANYLRRSGENYLVRADGRLRSVDQIANTVVA
FT                   QRNGVPVTVGQVATVKIGGEIRTGAASRDGNEAVVGSALMLVGENSRTVAAAVVEKLGE
FT                   IKKTLPEGVVLEPTLDRSQLVVATIKTVAKNLTEGALLVVAILFALLGNWRAAVIAALV
FT                   IPLSLLMSAIGMNSFGISGNLMSLGALDFGLIIDGAVIVVENALRRLAHRQALEGRLLT
FT                   LGERLQEVMASSKEMIKPTVYGQLVIFLVFLPCLSFQGVEGKMFSPMVITLMLALASAF
FT                   VLSTTFVPAMLAVVMTKHIEEREVKVIQATKNRYLPVLQRTVANPWPSIVTGLVIVAAA
FT                   AVTFRFVGKEFMPTLDEQNLNLSSVRIPSMSIEDSAALDLPIERTLLTLPEVKTVYSKA
FT                   GTASLAADPMPPNASDNYVILKPKNEWPEGVTTKEQVVERIREKMSAIVGNAYDATQPI
FT                   EMRFNELIGGVRSDVAVKIYGDDLDQLAATGQRIAALLKKIPGAVDTRVAQTSGFPTFD
FT                   IEFDRVAIARHGLTLKEVADTVSAALAGRPSGQIFEGDRRFDLVVRLPGDQRNNLDQLR
FT                   GLPVTLPAVDGKPRASVPLGSLVQFKFTQGLNEVSRDNGKRRLYVEANVSGRDLGSFVA
FT                   EAQKRIDAEIKLPTGAWIEWGGQFQNLQAASKRLAIIIPACLVLISAVLYLAIGSAALT
FT                   ATVLATIPMAVAGGVFTLAIRDIPFSISAAVGFIAVSGVAVLNGLVMISAIRKRLEDGM
FT                   ATSAAVIEGAMERVRPVLMTALVASLGFIPMAFGTGTGAEVQRPLATVVIGGLITATVL
FT                   TLLVLPALCGLVLKRSDQAKPEPEPEPLPQA"
FT   gene            38628..39413
FT                   /locus_tag="Rpic12D_5138"
FT   CDS_pept        38628..39413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_2506 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5138"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66368"
FT                   /db_xref="GOA:C6BQL0"
FT                   /db_xref="InterPro:IPR032809"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQL0"
FT                   /inference="similar to AA sequence:KEGG:Bpro_2506"
FT                   /protein_id="ACS66368.1"
FT                   /translation="MFQRLARPLLAVGLLLSAAAAWAHGISEADKQRMLDGGYLQYIGL
FT                   GASHMLTGYDHLLFLFGVVFFLTKFTDVAKFVTAFTLGHCITLIFATFLKITWNFWLVD
FT                   ALIAISVIYKGFDNNGGFQKYFNRPSPNLLRVVFAFGLLHGFGLSTRLQQLPLGDDNFS
FT                   MLMRILSFNVGVEIGQIAALVVMVALLSLWRKRESFQRFSTFSNNALMTLGALLLLMQL
FT                   HGYHHDFDAENLRFPEEEHKHLHEDMDIDKSTRTGRESL"
FT   sig_peptide     38628..38699
FT                   /locus_tag="Rpic12D_5138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 24"
FT   gene            39463..39813
FT                   /locus_tag="Rpic12D_5139"
FT   CDS_pept        39463..39813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_2507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5139"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66369"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQL1"
FT                   /inference="similar to AA sequence:KEGG:Bpro_2507"
FT                   /protein_id="ACS66369.1"
FT                   /translation="MKKLFVSMAAMAAFSLSAPAFAGGDGDCHFHGNTPAKAETVSGCA
FT                   VKRQQALIAGGKLDKSWQSIKPGTPEQVDGQKGKEWKVTFKDPAAADKSKANLYMFFTP
FT                   QGNFIAANFTGN"
FT   sig_peptide     39463..39531
FT                   /locus_tag="Rpic12D_5139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            39888..41207
FT                   /locus_tag="Rpic12D_5140"
FT   CDS_pept        39888..41207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5140"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pol:Bpro_2492 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5140"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66370"
FT                   /db_xref="GOA:C6BQL2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQL2"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS66370.1"
FT                   /translation="MLDVLANRTYRHLFFAQVIALVGTGLATVALGLLAFDLAGADAGA
FT                   VLGTALAIKMVAYIGVAPIASAFADRVPRRTLLVALDLVRAAVALVLPFVTEIWQVYVL
FT                   IFVLQSASAGFTPTFQATIPDVLPKEADYTKALSLSRLAYDLESLASPALAAALLTVVS
FT                   FHSLFLGTVVGFVASAVLVVSTVLPKAKQPPRRSIYERTTRGSRIYLSTPRLRGLLALN
FT                   LAVASASAMVIVNTVVLVQSQLQLNQRFTAGALAAFGGGSMLIALGLPKLLERLPDRRV
FT                   MVFGASVLTIGLLLGPLATGNYAALVVLWLLLGMGYSLAQTPSGRLLRRSASEQDRPAL
FT                   FAAQFALSHACWLITYPVAGWLGAKAGLNASFIALGILAGVTTFASLWLWPKDDPVEVP
FT                   HTHGDLKEGDEHLQSPAVDDARQHSHAYVIDDQHQRWPRS"
FT   gene            41212..41757
FT                   /locus_tag="Rpic12D_5141"
FT   CDS_pept        41212..41757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5141"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_1327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5141"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66371"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQL3"
FT                   /inference="similar to AA sequence:KEGG:Ajs_1327"
FT                   /protein_id="ACS66371.1"
FT                   /translation="MDRRAVLAWMSCVTGSLLLPGCASFLRGSSVGPQCYRARNGPGIK
FT                   AICTPEAVPDEEAESRAKRFEPVAGQLTIYLVRHRWGDAANRVKVGIAGERLVTTIPAS
FT                   LIRIAVPPGKHLLVFNWAKGHGVLQVQGDAGQVLFVDLVGSLWIWNEWYRLEMGDPSFR
FT                   DRAMKSRLVADVKLGVRE"
FT   gene            41754..42152
FT                   /locus_tag="Rpic12D_5142"
FT   CDS_pept        41754..42152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bid:Bind_3015 integral membrane sensor hybrid
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5142"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66372"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQL4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66372.1"
FT                   /translation="MTQKLLLDVGTQVAESDFPPESAAAHFEAIGKGINDVDVIVQALL
FT                   ERLPPSKPWQRQLRSHLRDADRHVEILRLEISLEHDSSEIHAAALKLKHVLEIANFHIA
FT                   GGRAEGWIRNALAVAYRNASLVSKLLAP"
FT   gene            42309..42611
FT                   /locus_tag="Rpic12D_5143"
FT   CDS_pept        42309..42611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5143"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66373"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR021634"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66373.1"
FT                   /translation="MTDMQCLNLLAPIAMEERTVSALVSSGVCRTYLCSPVYAHGFEHF
FT                   DLDDDGGLAGGIAALAKAIVPAERMEELLKHLQFELALTGVRFWISPVIRQGEFA"
FT   gene            complement(42630..42776)
FT                   /pseudo
FT                   /locus_tag="Rpic12D_5144"
FT   gene            43681..44688
FT                   /locus_tag="Rpic12D_5145"
FT   CDS_pept        43681..44688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5145"
FT                   /product="transposase Tn3"
FT                   /note="KEGG: pol:Bpro_2486 transposase Tn3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5145"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66374"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQL6"
FT                   /inference="similar to AA sequence:KEGG:Bpro_2486"
FT                   /protein_id="ACS66374.1"
FT                   /translation="MASVERTAYPRFPRLLTPQKLRKLFTPSKDEVEWVAASSRGEDRR
FT                   LSLTVQLKCFQYLHFFQPAESIPPEVVEHVAVCLGFAPQQQLRYPEASGNGALYRDHDK
FT                   VRAFLKIRPYSGPKPRAEAVRIARRASSVVNTVVDVINALTTELVIKDYELPSFSTLHK
FT                   IAEKEHEAAEQAIFDGVERKLTNDQRRWLDELLISELSNWQTRYNELKRSAKKASRQHL
FT                   DELLEQLGWLESLPDSDSLLEGLTQPRLKYLCDLATTRDAGEMKDFSQAKRHTMTLALI
FT                   RQMRVRARDDIAEMFIRRLTACHNAAQEELKELQARQRELSEELVAGVSSFSVQ"
FT   gene            complement(44805..47720)
FT                   /locus_tag="Rpic12D_5146"
FT   CDS_pept        complement(44805..47720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5146"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   rme:Rmet_1544 transposase Tn3"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5146"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66375"
FT                   /db_xref="GOA:C6BQL7"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQL7"
FT                   /inference="protein motif:PFAM:PF01526"
FT                   /protein_id="ACS66375.1"
FT                   /translation="MQGWHTTFLGMRGLPRDISDFEMKAFFTFDGAERDAINARRGDSH
FT                   KLGLALHIGFLRMSGRLLGAFRVIPVALWRHLGNELGIAAPEVASLRAMYERGRTLFDH
FT                   QQVACTVLGFQWMSEHQRRSLVRELRDEVARCADRDQLLVRARQWLYKNKLVIVHERAI
FT                   RTLIAAALAQLEVETGTAIAASVDPATLDRWRASVSELRPDGQTQQSWLWAAPAKHSTR
FT                   QISEVLERIDLLYTLDVHKHLADIPDLILRRYARRLVSRPPSAGAKIKEPARTVEVACF
FT                   LRYCLFTTTDQLILMVQRRIADLWRQAAADVPATVNWAAMYKTLLGELVALSAQGAVPD
FT                   AELRARLEALITETQKRKPPSRASLVREGLIDGIRPVRSLLVAIAKLPWQATGEHPAIE
FT                   YLAKLQALYLKGSRKLPVEVVAPSLGMIWQVSISSPDRERAFQALEVATLFALRRAVRN
FT                   GSVWIEHSLSFRGRARLFFTDERWQAESKKHYARLSLPSKAATFLKPLLARVTAGVDAV
FT                   AAAARSGVLRVDDELHLSPLPAEDEDPEVTKLRAALDHRIGEVQLPEVILAVDAQVRFS
FT                   WIMLGREPRSTDELLMVYAGIMAHGTSLTAVECARMIPQLSATSIRQAMRWARDERRLS
FT                   QACQAVLEFMQRHPIAATWGRSDLASSDMMSMETTKRVWQARLDPRRNTPSIGIYSHVK
FT                   DRWGIFHAQPFVLNERQAGVAIEGVIRQEKLETSQLAVDTHGYTDFAMSHARLLGFDLC
FT                   PRLKELKQRHLFVPRGTKVPAEIAAVCEANVDVALIEKHWDSLVHLAASVMSGHASAVA
FT                   ALARFGSAAQGDPIYEAGVQLGRLLRTAFLADYFVKDAFRNELRRVLNRGEAVNALKRA
FT                   IYTGRISPAQAKRVDEMQAVADALSLMANIVMAWNTSQMQAVLDRWSNRRQVIPPELIG
FT                   KIAPTRLESINLRGVFRFPVDRYADQILPSRPNASITGTNG"
FT   gene            complement(47835..48341)
FT                   /pseudo
FT                   /locus_tag="Rpic12D_5147"
FT   gene            complement(48338..49645)
FT                   /locus_tag="Rpic12D_5148"
FT   CDS_pept        complement(48338..49645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5148"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   rme:Rmet_6208 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5148"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66376"
FT                   /db_xref="GOA:C6BQL8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQL8"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACS66376.1"
FT                   /translation="MAASTNTLREIPGLPTRRSTISTAIYDFHRKAAGLLLAFAAMPGS
FT                   AAEAPPYTALLRQSLAHAPMLREQAANVAAAGADAAQARAWLNPRVDTVYENLGAPQSG
FT                   GVSQRQNTYTITQPLEIGGKRSARVEAGQRGLVAAEARERQTRVTYAAELAVAYATAEA
FT                   MLGRKALAAEDRLRATDDLRAARALVQFGKEAALRAAQAQASVAAAQAAEQAATAEATQ
FT                   ALEHLAVLAGSDEPYTTLPTSLLAAAGPAPANTTKPDETPAVLTAQAERDALNAQVQVE
FT                   RKKWIPDVGVSAGLRRYGWTNASGYVVGLSATIPLFDRNDAATTAAVEREAAAEARLDS
FT                   VRLEAAAARRSALAQAAASEKRLAAAAEGERAATEAYRLGRIGYDAGKTSLIELLATRR
FT                   ALFEAKGLTIDASLARVRALAALAQAEGRLAFEETP"
FT   sig_peptide     complement(49505..49645)
FT                   /locus_tag="Rpic12D_5148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.558 at
FT                   residue 47"
FT   gene            49813..50091
FT                   /locus_tag="Rpic12D_5149"
FT   CDS_pept        49813..50091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5149"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   bxe:Bxe_B0049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5149"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66377"
FT                   /db_xref="GOA:C6BQL9"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQL9"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ACS66377.1"
FT                   /translation="MSHTVQEKQKLLNRVRRIRGQLDAIERALEDEHGCVSVLQQITSC
FT                   RGAMNGLLAGVLEDHIRTHLTEVDAEHEHANGSAKDQLIEVVHSYFK"
FT   gene            50099..51376
FT                   /locus_tag="Rpic12D_5150"
FT   CDS_pept        50099..51376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5150"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   bam:Bamb_5056 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5150"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66378"
FT                   /db_xref="GOA:C6BQM0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQM0"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACS66378.1"
FT                   /translation="MSDFYDAPFASGHDHVFLGAGHEKNERKTWAVIVLCALMMAVEII
FT                   GGSVFGSLALVADGLHMSTHAGAMLIAALAYTYARRYAHDPRFVFGTGKLGDLAGYTSA
FT                   IILAMIALLIGYEAVARFFSPVPIHFAEAIPIAIVGLLVNIASAWLLSGGDHHGHSHGH
FT                   SHGHHHGAAHDDAHDHGEDVQHITTPAGVLALSIFEDGVPPVFRLAAEAAVLPNDAATV
FT                   TTIRPDGARQEFVLARKSDVLESTTDIPEPHAFTAVLKLGGQEHTVVFEEHDHGYGHEG
FT                   HHRDHNMRAAYVHVLADAFVSVLAIIGLLLAKTFGWLWMDPLAGVVGALVIANWSYGLL
FT                   RDTGGILVDMTPDKHIAGRIKIALEADGDTLLDLHVWRIGPGHLGAVVSVGTRQVQRGP
FT                   QFYHGLLRRFNTLSHVTVEVHPLPTK"
FT   gene            51588..51734
FT                   /locus_tag="Rpic12D_5151"
FT   CDS_pept        51588..51734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5151"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66379"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQM1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66379.1"
FT                   /translation="MFWGGLTVVHSQHASGVVAQGSKPFRTASLVGELFVRRSHVIIRH
FT                   YHV"
FT   gene            51819..52811
FT                   /locus_tag="Rpic12D_5152"
FT   CDS_pept        51819..52811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5152"
FT                   /product="putative cointegrate resolution protein T"
FT                   /note="KEGG: cti:pRALTA_0657 putative cointegrate
FT                   resolution protein T"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5152"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66380"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQM2"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0657"
FT                   /protein_id="ACS66380.1"
FT                   /translation="MARAGLSRLDIKRARDSLLAQGQHPSIDAIRIALGNTGSKTTIHR
FT                   YLKELEEEEGTALKRAGTTSDAILDLVGRLAARLHEEGQAVVDQQVAAATAQRQQVRAE
FT                   ADKLSADLAALRAELAQAHATIANVRAAQSDTQTALQQRTIEAERSAQQLQDLTARLAE
FT                   HEGFRRSLEDKLQHAHQALEHFRNASKEQRDQDARRHEQQVQQLQAEIRQANQTLIVKQ
FT                   GEITQLNKDGARLVTEAGTAAKRVRELEMRGEQAQLALDQARADRARMEAERDALRATV
FT                   QAQVGELAAARTERENMVGELAKLSALLEAQQVMLTDYRAQLGVAGPAA"
FT   gene            53252..53830
FT                   /locus_tag="Rpic12D_5153"
FT   CDS_pept        53252..53830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5153"
FT                   /product="2'-5' RNA ligase"
FT                   /note="TIGRFAM: 2'-5' RNA ligase; PFAM: Phosphoesterase
FT                   HXTX; KEGG: rso:RSc2364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5153"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66381"
FT                   /db_xref="GOA:C6BQM3"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQM3"
FT                   /inference="protein motif:TFAM:TIGR02258"
FT                   /protein_id="ACS66381.1"
FT                   /translation="MSNFRLFIALDPTPETVAVLRRAQVCLRDVHWSGARWLPPEQWHA
FT                   TLRFLGATPEDQVQHWKHTLQQFDMLARDAAPLPIDGVAIWPAPAHPRVIVVTAKFAIW
FT                   AQDMATRLEALAREAGYRAETRAFHPHVTLARVGAHAATARCLAAVDNAARALDGAHLQ
FT                   FGSVSLFVSRSPAEGPAYERLATMEFRPN"
FT   gene            complement(53930..54823)
FT                   /locus_tag="Rpic12D_5154"
FT   CDS_pept        complement(53930..54823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5154"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   cti:pRALTA_0147 integrase/recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5154"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66382"
FT                   /db_xref="GOA:C6BQM4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQM4"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACS66382.1"
FT                   /translation="MDTLWLNNPERAYADWQEREAEGVDGQHFSARSRAQHQAMFEKFL
FT                   RYLRETGRDLANYGDEHVAAFCESVGARSAATRMRYLKLLDRVGRQLVRADVRVSNPAS
FT                   EQLRTGHWPDEDQPLFLPEDKDALLQAYTQPAPDDGLREVRGRAVVALYLATGVTLSEG
FT                   IATELDDLQLDATLPYLHIKAKAARGARTVPITPFAIPALRTWLTRRAAEGTQGQALLT
FT                   LHTDGSRINEASVGRIVKSALTTIDFVASDMSPRVLRNTVCRRLLLDGVDYVEVNRILG
FT                   LSSVRTVDRIAATIER"
FT   gene            complement(55000..55293)
FT                   /locus_tag="Rpic12D_5155"
FT   CDS_pept        complement(55000..55293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5155"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; SMART: histone family protein
FT                   nucleoid-structuring protein H-NS; KEGG: cti:RALTA_B0237
FT                   histone-like nucleoid-structuring protein H-NS"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5155"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66383"
FT                   /db_xref="GOA:C6BQM5"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="InterPro:IPR037150"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQM5"
FT                   /inference="protein motif:PFAM:PF00816"
FT                   /protein_id="ACS66383.1"
FT                   /translation="MTSYKDIVKQIAALQKEAEALRQKEMQAAIVDIHEKIDLYGLTAL
FT                   DLGFKGDGAARSKPPAKYRDEAGNSWTGRGKRPGWLVAHLSAGRQIEEFLTA"
FT   gene            55594..55692
FT                   /locus_tag="Rpic12D_5156"
FT   CDS_pept        55594..55692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5156"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66384"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66384.1"
FT                   /translation="MPAEKITDFNKAFSQVVDAQGDALQTTIKALL"
FT   gene            55878..56399
FT                   /locus_tag="Rpic12D_5157"
FT   CDS_pept        55878..56399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5157"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66385"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66385.1"
FT                   /translation="MALPTQTAPRHYAVAIRDTELYLALRISRSASGVYVIFPRPQNPI
FT                   GGTKRNPHASYHRDGRRHQKSWGMPWFKAQRQPLDNHFRGSETIVATVLQPSHPQDPHC
FT                   DPKDFSAVLEIPLTDIRPNGSTSVSVDLAEPGVSPTSLLPGAVIVRQQAYADGWFPCLV
FT                   VTIYDSPTSS"
FT   gene            complement(56482..56775)
FT                   /locus_tag="Rpic12D_5158"
FT   CDS_pept        complement(56482..56775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5158"
FT                   /product="histone family protein nucleoid-structuring
FT                   protein H-NS"
FT                   /note="PFAM: histone family protein nucleoid-structuring
FT                   protein H-NS; SMART: histone family protein
FT                   nucleoid-structuring protein H-NS; KEGG: rso:RS00711
FT                   putative HNS-like transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5158"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66386"
FT                   /db_xref="GOA:C6BQM8"
FT                   /db_xref="InterPro:IPR001801"
FT                   /db_xref="InterPro:IPR027444"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQM8"
FT                   /inference="protein motif:PFAM:PF00816"
FT                   /protein_id="ACS66386.1"
FT                   /translation="MATYKQLLAQKAKLDLQIEAAHLAEKAAAIARAREIVEAYGLTAA
FT                   DIGLKARAGKSEQAKSIVPPKYRDPKTGATWSGRGRAPAWIGKNRDRFLIEA"
FT   gene            complement(56888..57988)
FT                   /locus_tag="Rpic12D_5159"
FT   CDS_pept        complement(56888..57988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5159"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sbm:Shew185_3893 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5159"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66387"
FT                   /db_xref="InterPro:IPR024524"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQM9"
FT                   /inference="similar to AA sequence:KEGG:Shew185_3893"
FT                   /protein_id="ACS66387.1"
FT                   /translation="MKFYIDESGNTGGATSTGKAYDFDGQPTFALAAIGLHDQAAIAAV
FT                   VEEIRSAHRVPAGELKSKSLTGKPEFVRDLVDAICDRAPPCFIEVVDKRFYLVMNMVSS
FT                   HVLPPSTGILGNPQAHFVQNAFADFLYHFTPAEVFDAFIAACQAPSDATLRSSFGALLD
FT                   FLDRFPAGEVSAACREMTNLSFSDYEEMLADEVPTAYAQFLPSPDTGKRGKPVSMLPNL
FT                   SSLTNIYARINLHYQRDLSTIELVHDEQLQFDQILSNNKQAAEALGGQAANFFTPHADY
FT                   NFGASAPLTFAKSHDSIGLQLADVIAGFCMRYIKDWLSDPRNISGAAHATFARLCRLSD
FT                   SGTVCGVNLTATNELAHRVFSPVWRG"
FT   gene            complement(58083..58991)
FT                   /locus_tag="Rpic12D_5160"
FT   CDS_pept        complement(58083..58991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5160"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpt:Rpal_3157 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5160"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66388"
FT                   /db_xref="InterPro:IPR041304"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQN0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66388.1"
FT                   /translation="MSLIRSIQADAIEVSTSVSSLLRKCKLLASRVGHTQLEQWVDLEL
FT                   RGYPEGADLPPYRVTPVVSYGSFVGPFGMNAPRLQVPVFLLPEHLREWHSIARLAQAVS
FT                   TYENLVQGNKPSYVKTDWNVALAIKYASKLTPDMQCVEAWMEIPIGAIDRLLDCIKTAV
FT                   LGYAIELEKLSPDAGELPVGSKPISEERLTQIFNTHIGGNVGNIANAGTGVTQTANVQV
FT                   GQGDWEALSLYLQSLGLLEADFAGLKHDLDAERAAGSGTSEKSKSWIGQLVGKAFNKAT
FT                   GVGVEAIAGGIAQAISGYLGQ"
FT   gene            59222..60115
FT                   /locus_tag="Rpic12D_5161"
FT   CDS_pept        59222..60115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5161"
FT                   /product="mucin-associated surface protein"
FT                   /note="KEGG: pna:Pnap_4761 mucin-associated surface
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5161"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66389"
FT                   /db_xref="InterPro:IPR021104"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQN1"
FT                   /inference="similar to AA sequence:KEGG:Pnap_4761"
FT                   /protein_id="ACS66389.1"
FT                   /translation="MARQGISYEQVVDAAKALVAEQLKPTLSAVRERLGSGSMNTIHRH
FT                   LTAWQGQQKPGARKIGDPNPRLLAALGTEFSRVAEDAAADAEAALAQVMSENAMLASTG
FT                   EALEAERDALTQELQQVATERDKLAGKAAEQTAEIERLNAESERERGELASVRRALAQV
FT                   ELRLEALPHLERELSELRAQLATEQAARVAADRTAAVADAQREAADIARIQANERLANA
FT                   ESREHQVRAQLAEAQAAHERTREKLTEVVGLEAGAQAELRMLREQIEAAKPTPESAPDQ
FT                   QTGQPPSKPNSRRKGA"
FT   gene            60220..61170
FT                   /locus_tag="Rpic12D_5162"
FT   CDS_pept        60220..61170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmr:Mmar10_3077 GumN family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5162"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66390"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQN2"
FT                   /inference="protein motif:COG:COG3735"
FT                   /protein_id="ACS66390.1"
FT                   /translation="MLRSFGLVDQFRTLAAFVCAATLASTPAIAQDGVPALAITAPNGA
FT                   KSVLVATLHVPYQGMRQPAMSVLQGATSFVIESSRAQGPQPVELQGADLLDPEVFAGRA
FT                   SRAPWARSLTDTQVEFLQLRAKCAAPQRPDLAIEMLQHKSPRMAAAYAWIPCTELSNLS
FT                   RDAIFAIAALRYNVAIVPLEDQTDLENRRRAVPDRIYWRLLMGGLNIARQREDFRQAVI
FT                   AFNRGDYERIAALASLGNESPEDAAIYHRLMVHDRNLSWMPRLRQALDAGGAVVAVGAA
FT                   HLPGSDGLIALLRADGYQVNDILLPNDTAMEMQAP"
FT   sig_peptide     60220..60312
FT                   /locus_tag="Rpic12D_5162"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            61182..62036
FT                   /locus_tag="Rpic12D_5163"
FT   CDS_pept        61182..62036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5163"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66391"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQN3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66391.1"
FT                   /translation="MHRAQDVVYGQDQAAQMRKAPGLARIRAAASDSSCTVLDQSVWKR
FT                   TELGPVLDLLTTEGSTQRVYVDVPIAAVVGLTHRNFSKALTWRGMLQDLHGFGWDERVI
FT                   DYCESEIGHQSFPAPEAAYELKLAAYGGAVTCTNGVHRLVAAVNWLGATQGEHAVLRKV
FT                   SVWYRPTDASLVSALRALEQQGARLRLGCARDDAGIRRMWFIESTTAHRVSYFHVTPGR
FT                   CTPIQVGPRWVAKARAWAGLEADAVHFVSEWFDIPPTVLDTVVKDAWIDAQIRAPRYEA
FT                   PLD"
FT   gene            62156..62548
FT                   /locus_tag="Rpic12D_5164"
FT   CDS_pept        62156..62548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5164"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; KEGG:
FT                   cti:pRALTA_0149 putative histone-like DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5164"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66392"
FT                   /db_xref="GOA:C6BQN4"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQN4"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ACS66392.1"
FT                   /translation="MATKSKTAAKKAAPAKKTAAAAAPTIKPLKDTFTKASLVSHLAEQ
FT                   TELEAKAVKSVLLHLENTILSALHKKGAGEFTLPGLFKVVSVKVPATKRRFGKNPFTGQ
FT                   EQWFEAKPASVRVKVRPLKKVKDAAQ"
FT   gene            62634..63395
FT                   /locus_tag="Rpic12D_5165"
FT   CDS_pept        62634..63395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5165"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66393"
FT                   /db_xref="GOA:C6BQN5"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQN5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66393.1"
FT                   /translation="MSLFPQRSADVRRYKFINWNVVLKPALQEKFEKVITAAEQAGYLE
FT                   RLYVRVEREHRTVTLFPGQHPVGASLRKQGSTAAEHGAALVFSQAKTGNVAVLLYPYES
FT                   EFMRQPEKLIVWRVFVGPNDVTQSVIDAAVADAFRYWRVSSVLDGGSRWDRWRIGMLRR
FT                   RDRYQSAEKAMTTRPSLVARAVGAFLAWWPVAAFVAFSALVTVVTGWHDFSDKFGAAFH
FT                   STSTAAKESTTTSKTGRASEAAAAPSTAQDR"
FT   gene            complement(63410..63559)
FT                   /locus_tag="Rpic12D_5166"
FT   CDS_pept        complement(63410..63559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5166"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66394"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQN6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66394.1"
FT                   /translation="MSHPNAEALAKWVRDHSDELLDCWARAVDVYYSYYPKTGMPRPPV
FT                   RLNP"
FT   gene            complement(63540..64265)
FT                   /locus_tag="Rpic12D_5167"
FT   CDS_pept        complement(63540..64265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: atc:AGR_pTi_214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5167"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66395"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQN7"
FT                   /inference="similar to AA sequence:KEGG:AGR_pTi_214"
FT                   /protein_id="ACS66395.1"
FT                   /translation="MKFYHFTSVSYAETILSMGISRGHVKHGDGSIRNSVVWLTTDPDA
FT                   DGHGLTTGDKTLTARDMEYLTRVDGVAPKNGIVMNKTRVRLTVEMSADTATLMPFVEYY
FT                   ARRGEKPDEAKLMGLSAYVENPWRLPLTRRRHLLKSTTTKEGTWWLSFAPITASEITRV
FT                   EYNSPAGFVDYDFEAHGRQHFHDAGFVVPSAATLQSLHPLVPCDYPFEKAKAFAFCLDT
FT                   KRVRRGDWCAGVRNEPPER"
FT   gene            complement(64655..67054)
FT                   /locus_tag="Rpic12D_5168"
FT   CDS_pept        complement(64655..67054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5168"
FT                   /product="restriction endonuclease"
FT                   /note="PFAM: restriction endonuclease; KEGG: bcj:BCAS0716
FT                   putative restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5168"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66396"
FT                   /db_xref="GOA:C6BQN8"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQN8"
FT                   /inference="protein motif:PFAM:PF04471"
FT                   /protein_id="ACS66396.1"
FT                   /translation="MPADQNPPAKQFPRNERVPVARAVATTIEHATAAQVKALAEPFKG
FT                   TSVGQRFFGPGWIGEDGVACIVFIAQDRDTIQRLRRQRTCVAIGWRWNNTPSMVFSFTL
FT                   MTEGKNPHPHTRWMRPSADPVVAAIRQRGRFRMIAVSPEGYQTVWFEAQLHSGFGETAP
FT                   SLQGMEQQWQHPVPGLQGSREGQRFDPFERERKADTTDAAPAIPLWAEPASDVWSELNY
FT                   DGPWAGDLNATDKARVAWGRQVYRNRRLAAGFVRGIAERQAYDRVPPVVTEEGNWLGEG
FT                   IIAEQGRVLVARAPLIGRWLAALAGPAPDAEAAYRACVEVLHDTYALFCLLDKLIPLLN
FT                   DAGDQMLSEAARWTFEAALLDDKITQGGTHRPWFANTGQHGLELRSAPFNLEASLSDIE
FT                   EMWRSGLDMLDLIDAGQRLGPNDFPVPLSDVCEAMRGVALDGTEDEAEATIQAMLREAQ
FT                   EARQWTIPWGARVEVAFGPFVAVRIFENQGEFACQFLDAAQRYHHVAIGIASDPPRATG
FT                   GRLIRPRDDDGEVTWNTDAELSLQLIAAAIIRDFLVVEERESLFGTRTTTRRSRGRDLT
FT                   TVVYLPRVRYSRPNLRQATQHAHESGRAPHAVTQHLRRAATTSATQRFLAQRYGMHLPE
FT                   GFTFVRPHTRGAMAEAERVRVYRSRSASRMIYEEVSTAPEGARPAWFEFERDCMQLLRE
FT                   RGLRVIHQAASRDGDGGVDLYAVDESGQSWIVQCKCWAAHRSVGPEIVRELHGAIAFAD
FT                   RGSSGTSKGIVITTSRFTSGAAEVGREFGFELIDGQQFAQWRQNRH"
FT   gene            complement(67071..67925)
FT                   /locus_tag="Rpic12D_5169"
FT   CDS_pept        complement(67071..67925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5169"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5169"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66397"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66397.1"
FT                   /translation="MTASVLNHDLSGDFERLLTLVMQLVESQAGQQIPVDQLWMNDAQV
FT                   LGKKFCYHVASLRLIAQPVQIDIAGYGADLHIDHSSVMILARAALETYLTFAYIYGSKD
FT                   VEVRQFRHMIWRRAGLLDRQAYPARAPEHQQKLADEKTRIDQLQIEIEAHGVWQQYSEP
FT                   MRKKVLKGEWRAGQSWIDTGIAAGFHPVYIRQIYSFLCGYAHSSWLSILQIRDAQALCD
FT                   QEAMAARFVSVALVFMSFFATSYVALFPQAEAVLASNTEAANLAQRWHLTADRQSALYG
FT                   TTN"
FT   gene            complement(67980..68165)
FT                   /locus_tag="Rpic12D_5170"
FT   CDS_pept        complement(67980..68165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5170"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66398"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66398.1"
FT                   /translation="MKPTARKIRRQALLAEKPEQVAARLAVFAKLTREQAVARRSVVEP
FT                   KVAGSVLAGRRVRVAG"
FT   gene            complement(68162..68749)
FT                   /locus_tag="Rpic12D_5171"
FT   CDS_pept        complement(68162..68749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5171"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvy:VVA0688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5171"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66399"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66399.1"
FT                   /translation="MAAQRQDWDTAESRCAERRELAGAAASAAVAVEEGVTVRFRPIGR
FT                   TDVDAADRWTFGGYAPGWLWSRELTRARRRPRRVEAAVYAELPDHTHVLCGLILGRISN
FT                   RHVVASIHLLSRAPAPNPLQGRFAKIAVRYLEFCAAAFDCTTASLQRPIPELVDFYKSL
FT                   GYSRVVEKKGKIERLERDLGAVLSAMRKGDQP"
FT   gene            68967..71081
FT                   /locus_tag="Rpic12D_5172"
FT   CDS_pept        68967..71081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5172"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: rme:Rmet_6086
FT                   phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5172"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66400"
FT                   /db_xref="GOA:C6BQP2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR022169"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQP2"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACS66400.1"
FT                   /translation="MDPLDPDHNPEPPPSLETLQSEIKRTRPTRRRVVVRRHLHRGHFA
FT                   FLRAVVQGLDARPMWARYLAIDGELEAQAELTQETFVAHPKVRRMTAWLRAELAAAVRR
FT                   AGHYGKVRLIRIDLSGLAQRGPALPALEEFALENGLDDFSIEEQLEAYRERFGDAVQRA
FT                   ERRTKLMERQLRLLADLEQVLAEPVRVDDHCHAWLAAGVADRLEAAGVATIGTLIDRIN
FT                   SLGGGWFRALRGVGEKKAHAIERFLRANADTLARKLGEHARIPRRQLTAHERDRVVASG
FT                   TGLLPLEKIVVPAALDGSNGRFRRPPVECLLDAQNDYEAVLTWLRSKPGLPPAEIARRR
FT                   TGRRDVITEPGPLDWLHYLSNTQRSYRKEAERFLLWAIWIRRKPLSSMTTEDCVAYRDF
FT                   LADVPDDWCAPRSRERWTPSWKPFEGKLSPESQAYALTVLQNLYRYLNDKNYLSGNPWG
FT                   GVRATNGGKPQLDVGRSLTEDQWAFVVERLFLLERTSSNLRLQVALPLLYATGLRLAEI
FT                   VGATTADLAWRSLALPRSGERMDGWWLTVVGKGSRVREVPVPDEVVHALGAYLDSRGFP
FT                   SDPAQIREPVALLGHATDQAERAPWAKRDTASPAAPLTPGVLYRQIKRFFQACATELEA
FT                   TDPQGAARLNEASTHWLRHSHASHAIAAGTPVEIMQQNLGHKSLDTTTVYVTSEEAIRM
FT                   KELRGFWKRS"
FT   gene            71800..72498
FT                   /locus_tag="Rpic12D_5173"
FT   CDS_pept        71800..72498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5173"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   bcm:Bcenmc03_6670 cobyrinic acid ac-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5173"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66401"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQP3"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACS66401.1"
FT                   /translation="MSAFTIAIANQKGGVGKTTLSLNLASAFQSGGTDVALVDADPQNT
FT                   SLRWATSGEEPLKISVASLAPAGSKIGNEIQKLQGKYDLVVVDCPGNLEDPRTPEVLGI
FT                   ADFCLIPMGPSPADLFSTLAMINEIKNIKRRINPELASALMLNNINGRTRMREEILSLL
FT                   NQQDVGTHLLQSQIAQREIYRQLFALGTTAHECGRYMKGLKEARAEIESLVLELTQHIT
FT                   QSRSQKVENV"
FT   gene            72491..73567
FT                   /locus_tag="Rpic12D_5174"
FT   CDS_pept        72491..73567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5174"
FT                   /product="parB-like partition protein"
FT                   /note="KEGG: bam:Bamb_6001 ParB-like partition proteins;
FT                   TIGRFAM: parB-like partition protein; PFAM: ParB domain
FT                   protein nuclease; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5174"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66402"
FT                   /db_xref="GOA:C6BQP4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQP4"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ACS66402.1"
FT                   /translation="MSKNTKDTKVQGASTTKGQPIPKLTLASGLIKGFKNEQQAIQTRE
FT                   REQEPPPASPQEQESQPVTETTANTVEPAAGPTASAVGGRKSIAIADCVSNPYNPRVFY
FT                   PEAKIQELALTLQREGQIEAIKFTRLPQFPGKYVIIDGERRLRAKRSLGETHIDAEERH
FT                   DVLPIDLYTTAYRANNDHERQSIFDDAIAWQQLIEQQVVADQNSLAEKVTKDKAYVSKV
FT                   LSLNALPRAILERMAESADRVGLQAAYCLKLIFDRVGEEGADRHLTAVIEGKRTVRELE
FT                   LILRNLQGPGATAKRSRTRYHQLFDFKADGVQRGQLKTFPDGRISLELKEIPADKQEAL
FT                   AEKLKALVDQELVEPSAG"
FT   gene            74537..75844
FT                   /locus_tag="Rpic12D_5175"
FT   CDS_pept        74537..75844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5175"
FT                   /product="replication protein"
FT                   /note="KEGG: bmj:BMULJ_05368 replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5175"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66403"
FT                   /db_xref="GOA:C6BQP5"
FT                   /db_xref="InterPro:IPR000525"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQP5"
FT                   /inference="similar to AA sequence:KEGG:BMULJ_05368"
FT                   /protein_id="ACS66403.1"
FT                   /translation="MARVPEAKKGSQIALFQQQEAPEPFKKAVQAIHVSPVGSALSLQQ
FT                   RRIFNALIKNAIEQRLAGRETNNTFQVSIPQMMAALDLTTKDNAYIKETAKSLMRTVVD
FT                   WDQLNSDGTSTWTGSTLIAGAKIVGSVLSYSFAPQISEELLDPQRYAMIDMRIAKLFRR
FT                   SYSLALWENTVRFERIGLTARIPLATFRNLILGREESETKYKEYKIFKRAVLTPSIAEI
FT                   NDVSDHEIELIEHKVGRTVGEIQFKISRKVSALEEEPHQDLVNTVVKFGVPHSEAKRLV
FT                   RTFGAERILEAISYTRARQAKKGVPPLDNIPAYFRKSLTEDWGKGAGKAESAGAGQQQQ
FT                   KPLARSPKNEEDARAQYLAARIPHAQGYFGELSADDQSAMLSRYNDQCSVKELKVVAGK
FT                   KPSKAAESNFFEWVAHETWGEPNAGEILNFVLSGKV"
FT   gene            complement(75849..77570)
FT                   /locus_tag="Rpic12D_5176"
FT   CDS_pept        complement(75849..77570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5176"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: cti:pRALTA_0230
FT                   putative ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5176"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66404"
FT                   /db_xref="GOA:C6BQP6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQP6"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACS66404.1"
FT                   /translation="MPTSILDELNPSQREVADLRLHCVAVACPGAGKTKTIATKAAILL
FT                   ADPACRVGAVTFNKEAATELQERIRALAGPASKARLLAGTFHGLAFKQLTPKGCKQQDI
FT                   ANEGDQLALVAQALKEADLDWKEEAALAAIEAIKMDFGRVPPGSVEERLYSAYQQALAR
FT                   NGKLDFQDMLCMAIEGMERGTISPYPFTHLLVDEFQDTDPLQYQWVAQHARSGSIVTVV
FT                   GDDDQSIYGFRAALGFRGMESFIKEFDARPVILGENYRCKSEILAAADNVIRNNKERIR
FT                   KDLVAARGPGGHISFRRFDDEYAEAVNAVEALAASMRASKSAAILARTNRILDPVEAVC
FT                   RSHGVKYFRASGKSILSRAEAALMCNLLELIQKTKTNGLDAVLAFAGVGAQDLKTLHSR
FT                   IGPSLEQRPRKELVEMGLAESTADTYRELMKRLAEWRGLCDRKFYPLVLEGVYEWMAQR
FT                   AKADTAKRAVTTTYDVLSRLNGPFSDRIAFLRRENNVPAADALILTTMHNSKGLEWDHV
FT                   CIIRAEETVVPNEKSTESEERRLFYVAMTRARDRLEMSTAKKNPTSRFVLEAGVSK"
FT   gene            complement(77678..78151)
FT                   /locus_tag="Rpic12D_5177"
FT   CDS_pept        complement(77678..78151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5177"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_5587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5177"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66405"
FT                   /db_xref="GOA:C6BQP7"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQP7"
FT                   /inference="similar to AA sequence:KEGG:Bmul_5587"
FT                   /protein_id="ACS66405.1"
FT                   /translation="MNSQATLTKLSVAWTLVRHIAFWGGWAFRLLVVVPSVAFCLLLAI
FT                   HSDFSFSAIPRELLQSVADRAKYPAAPAGYITMQTCKDTTSAVKGLPPPQALCKTFGFE
FT                   QQSIDASAREAGMNLALMYSIFALLGWGWYLFSGSFNDSLRAFRSSLQKVRRA"
FT   gene            complement(78288..78590)
FT                   /locus_tag="Rpic12D_5178"
FT   CDS_pept        complement(78288..78590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5178"
FT                   /product="flagellar transcriptional activator"
FT                   /note="PFAM: flagellar transcriptional activator; KEGG:
FT                   rso:RSp1413 transcriptional activator FlhD"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5178"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66406"
FT                   /db_xref="GOA:C6BQP8"
FT                   /db_xref="InterPro:IPR023559"
FT                   /db_xref="InterPro:IPR036194"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6BQP8"
FT                   /inference="protein motif:PFAM:PF05247"
FT                   /protein_id="ACS66406.1"
FT                   /translation="MEATSLLSEIRSLNIAYLRLARRLLATDQALATTALGISQSMGEA
FT                   LLTLDEEACVRMAQTNLFLCRIHFDDRVLAALLAGPRLELLESPASAGKAAPAIA"
FT   gene            complement(78739..79605)
FT                   /locus_tag="Rpic12D_5179"
FT   CDS_pept        complement(78739..79605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5179"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5179"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66407"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQP9"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6313"
FT                   /protein_id="ACS66407.1"
FT                   /translation="MQNTIDKVAGADNSDVAVTTNGDTLPNDEVESSAAANTAGATTPS
FT                   DVEQELNEMESAVDALQRDSLISAADADSQKGEVARTRKMFREMSPDDRAKIVSRRREL
FT                   GRQILTRQLAGASVVETMVKLNHTRLKPLFEQWWPFMNRMTINLTRFGHSTFTASELST
FT                   ITKHFETQMANLEAYVDEQLRVAEGYRAAREKDMESSGAMIWKPSVTKPSMEMVVEAYS
FT                   PFSMRALGVLNKFDRAMDHFDFMVWNAIRDQSDVNEEVNRFLRKFQPLAIRCYTTHLRL
FT                   MTTVRNI"
FT   gene            complement(79665..80282)
FT                   /locus_tag="Rpic12D_5180"
FT   CDS_pept        complement(79665..80282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cti:pRALTA_0228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5180"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66408"
FT                   /db_xref="GOA:C6BQQ0"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQQ0"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0228"
FT                   /protein_id="ACS66408.1"
FT                   /translation="MADSRFASHLRLWTLVAPIMLAVGCPFLEGDTTFEISDAELASVE
FT                   LNLGDTAATRAADRTNTQFRHWFVESGAMKAWTSTLPNSTDISDAGATDMSNAWLRHFW
FT                   MSIYRGIFRANVALSWAFGAFVFGMAMMNDGAVSRRIKAAAAGFASPVAFHVAAHATVI
FT                   TLGLGTSALLFPFSLNTMWWSVGALVLGVLGWRMAASFHVGR"
FT   gene            complement(80282..80530)
FT                   /locus_tag="Rpic12D_5181"
FT   CDS_pept        complement(80282..80530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_6799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5181"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66409"
FT                   /db_xref="GOA:C6BQQ1"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQQ1"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_6799"
FT                   /protein_id="ACS66409.1"
FT                   /translation="MSLKNSLIAKVSRLDLDTVGRIELAARGYLQELAEIPPEYARGRE
FT                   ALCFALQSVALRRPALFWFGLASVIVTPALLILRVVL"
FT   gene            complement(80502..81008)
FT                   /locus_tag="Rpic12D_5182"
FT   CDS_pept        complement(80502..81008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5182"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cti:pRALTA_0226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5182"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66410"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQQ2"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0226"
FT                   /protein_id="ACS66410.1"
FT                   /translation="MPSLFRQVVNQYKLSSKLAPVFIAFPELDDSCKRVVDFLGVNFRV
FT                   REEPLVAEMLMDALSAYRQARKEGDANIAFVRGLFTRSHEIFSMRYAAFKGEKYHVWAP
FT                   LQEPIPDFEARQSAGYQCRMVDEPCPDDVTPRSAAMQMAARVLSGHVFCRYFEEYDVAE
FT                   EFAHR"
FT   gene            complement(81016..82872)
FT                   /locus_tag="Rpic12D_5183"
FT   CDS_pept        complement(81016..82872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5183"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5183"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66411"
FT                   /db_xref="GOA:C6BQQ3"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR022458"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQQ3"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6309"
FT                   /protein_id="ACS66411.1"
FT                   /translation="MNYVSHFRPIFEARAAVGWLIGLILLPLSGMPHAWAFAVICALFL
FT                   VARAYQVRKALAFRMSISTRWLTLIQIDVLLRTSARMRADLDAMYFGNGFEWTQRHCQI
FT                   AHDILRMPSTEIPGLPKWLPPKVAKRIETAFAPPNSVPDTAPQGKSWIHGMEPNKIEVP
FT                   LHYKALGGHTAVSGTTGAGKTKTYELIATQVIHSPNKDVLIIVDPKNDKDFKKRVEREC
FT                   KRAGRKFLYWKQAAPSESIRMNPVENWSQPSEIASRVSQLMEEGPFRDFAFLFIDRAVK
FT                   GELYVGDKPNLRSILNYAQSGINGLLDRCLRRFFPEAGMLDWEDEARGFLQRIAQKGGV
FT                   DPLQGMVQLYVDNFAKKGLGHETIDGLVATFVHDREHYMRIIASALPLLQMLATGETGL
FT                   MLAPKADDFTDDREIWDIERVIKQKAVLYVGLDSMSNSIVAKAIASMLLADVASVAGAI
FT                   YNFYETPPDIVLLVDEVAEAINEQVIQILNKGRGAGFRSFVAFQSRSDLEAKLGSAAKM
FT                   LQVLGNLNNQIILRLEDTDTAQWFSDKVGETAIRNIVVSSSASTGSESHVGEFSGSVSR
FT                   STQLEKAPLIPPRLITELPNLQYFMRISGGSVYQGRIPIIQG"
FT   sig_peptide     complement(82762..82872)
FT                   /locus_tag="Rpic12D_5183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.803) with cleavage site probability 0.531 at
FT                   residue 37"
FT   gene            complement(82869..84131)
FT                   /locus_tag="Rpic12D_5184"
FT   CDS_pept        complement(82869..84131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5184"
FT                   /product="type IV secretory pathway, putative conjugative
FT                   relaxase"
FT                   /note="KEGG: cti:pRALTA_0224 type IV secretory pathway,
FT                   putative conjugative relaxase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5184"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66412"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQQ4"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0224"
FT                   /protein_id="ACS66412.1"
FT                   /translation="MNHTPMPIAALTATLGSRLDLVRQYANESSSADFERKWLSVLETC
FT                   ADWYSSMPLRPEQHPEPGGAFRATVETVYYALRLSGGQKFGADQPSERRRKLEPQYLYA
FT                   VFLAACCTWLDEPFRHFQFYRLRDQAEWSPAAHGAFSAWLEGGEYRVQRREAPLPIERM
FT                   RTALLARSILGNTRLELLESMVQTDLFGAINPESRPAGTESLLHKVLRQAVAVTCDTED
FT                   KARRARFAPDTTPIPPAKTLEDGFAAHAQPAPAAEKRPSQPKAKAAKSEPSAADSVSAL
FT                   FEQAKATPTSTASASPETPAPTSEKPNTQSSLFDLDSMQVPKEPTVKQEDPFAEILSSA
FT                   STLMREFFRALVQDVESGKVAVHWAEKGLVLQKRILGSYGIASETLVDNLRKLNLLASS
FT                   QGADIVLVERIGSLILARPQQ"
FT   gene            complement(84136..85206)
FT                   /locus_tag="Rpic12D_5185"
FT   CDS_pept        complement(84136..85206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5185"
FT                   /product="TrbL/VirB6 plasmid conjugal transfer protein"
FT                   /note="PFAM: TrbL/VirB6 plasmid conjugal transfer protein;
FT                   KEGG: cti:pRALTA_0223 type IV secretory pathway, conjugal
FT                   transfert protein, putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5185"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66413"
FT                   /db_xref="GOA:C6BQQ5"
FT                   /db_xref="InterPro:IPR007688"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQQ5"
FT                   /inference="protein motif:PFAM:PF04610"
FT                   /protein_id="ACS66413.1"
FT                   /translation="MSFPRLMGLMRIALLVCLAALSTGATAQADATFPVTTPSTPSPTG
FT                   SAGSGADNQSGPNLAGPKGAVGEAISSALKKFTDSTAQVINAAVGISHTITPEAAKFAA
FT                   ALGIITIVLAAMRFAGAHHPVTAWTNFLEEMATLGIFAAIYVGYERFAPGIYQYFNTMA
FT                   TSIAGGDLSPGATLATTAGNLWDSYGNALNAATWYQKIGVALALIPLLLAFAVTVATSV
FT                   IYNFYISLGQIQVAIGIVVGQLAVALGFSEFTRKYFLAWFDYMVSGSLYAVVAAIMSKL
FT                   VTASFASSLGDVNSIGTDTMAGACYALVLSIFLLFISFEIPSIAGKLFGNGAGISGGAV
FT                   KGGIKAAWGLGKRMAG"
FT   sig_peptide     complement(85123..85206)
FT                   /locus_tag="Rpic12D_5185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.552 at
FT                   residue 28"
FT   gene            complement(85218..86009)
FT                   /locus_tag="Rpic12D_5186"
FT   CDS_pept        complement(85218..86009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5186"
FT                   /product="type IV secretory pathway, entry exclusion
FT                   protein A (putative protein precursor)"
FT                   /note="KEGG: cti:pRALTA_0222 type IV secretory pathway,
FT                   entry exclusion protein A (putative protein precursor)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5186"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66414"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQQ6"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0222"
FT                   /protein_id="ACS66414.1"
FT                   /translation="MLKTTFSATLRKMRGTFVVAASAVVLSSPAHASGWPVFDAANFLK
FT                   NTISAAQALKTEVYENTNIIYQYKMMLNQLQQAVGLDDIKNQAQIDSILADVKRYSDYG
FT                   QVLQQLYGAVSSDASFLDKVNGLVVVSGKSPAQWFEDQRTLLTSGNKTAQALFDAGTDV
FT                   AKNIAHLAQRRQDLQSQMTLSPTAQATAQTTNQYLDLLSSQNADLIKLIGTKVQADAVK
FT                   DRKENADTEEKTAAMQSVISSQDAQLQKLRQSVYTRSSTAQ"
FT   sig_peptide     complement(85911..86009)
FT                   /locus_tag="Rpic12D_5186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 33"
FT   gene            complement(86066..86638)
FT                   /pseudo
FT                   /locus_tag="Rpic12D_5187"
FT   gene            86702..87034
FT                   /locus_tag="Rpic12D_5188"
FT   CDS_pept        86702..87034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5188"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mca:MCA0906 ISMca2, transposase, OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5188"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66415"
FT                   /db_xref="GOA:C6BDJ6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDJ6"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACS66415.1"
FT                   /translation="MSEKQVRAQYTREFKLEAVRQVRSGQPIAVVAKVLGIPKASLGNW
FT                   VRLSAKGELDGAGGGDKSIQVSPEKMEIARLRAENARLRMERDVAKKAAAYFAQDTLRG
FT                   TPGFTK"
FT   gene            87031..87900
FT                   /locus_tag="Rpic12D_5189"
FT   CDS_pept        87031..87900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5189"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: mca:MCA0907
FT                   ISMca2, transposase, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5189"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66416"
FT                   /db_xref="GOA:C6BDJ7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDJ7"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACS66416.1"
FT                   /translation="MRKLYPVSVSCGVLEVSASGYFNWLRRGESGHGGPGRRYSDEALL
FT                   AHIRAIHAQVKGEYGWPRMHKELLARGIRVGKDRVRKLMQQHAIKARTKRKFVVTTDSR
FT                   HSLPVAPDLVQRRFKPEEPNQLWSGDITYIQTDEGWLYLAAVIDLFSRQVVGWSLQPHM
FT                   QAGLVKDALAMAWWRRRPPPGVIFHSDRGSQYCSAEFQQALKNWGIQSSMSRKGNCWDN
FT                   APTESFWGRLKTASVHGCKFATREQASQAVMDWMAFYNHRRLHSSLGYLSPMQYEQRWY
FT                   EAQRKKAA"
FT   gene            complement(87990..89039)
FT                   /locus_tag="Rpic12D_5190"
FT   CDS_pept        complement(87990..89039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5190"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   cti:pRALTA_0218 type IV secretory pathway, conjugal
FT                   transfert protein; putative chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5190"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66417"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQQ9"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACS66417.1"
FT                   /translation="MTANHDPYSNQLTPLEESAVKMFFESLKPIQPVLEEATVAEVMIN
FT                   HHNSVWVERKGRLERLDLMLEPKKLEGAIRALASSVEKSAVKGTDQGIINAGHKGLRIA
FT                   AVMRPTAIDGHALSIRRHREKNLTLSDYTAMGAFSSSVARNPDDDQIIFPPDVSDDGLA
FT                   HALSTMVRQRKNVLVAGGTSSGKTTFLNALVGEIPHEERIISIEDTQELKLSVPNCVRL
FT                   LSNPDKKVTTQQLVALSLRFRPDRVLVGEVRGGEAFDFIQALNTGHDGGMGSLHANNGR
FT                   TALSRLESLAMLGIPLGSRWDLSDMRKLIADCFHYVVHMRRTGEMRHVSEILEIQGYAN
FT                   NDYVIKRVF"
FT   gene            89461..90174
FT                   /locus_tag="Rpic12D_5191"
FT   CDS_pept        89461..90174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5191"
FT                   /product="type IV secretory pathway, conjugal transfert
FT                   protein (putative precursor)"
FT                   /note="KEGG: cti:pRALTA_0217 type IV secretory pathway,
FT                   conjugal transfert protein (putative precursor)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5191"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66418"
FT                   /db_xref="GOA:C6BQR0"
FT                   /db_xref="InterPro:IPR007430"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR035658"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQR0"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0217"
FT                   /protein_id="ACS66418.1"
FT                   /translation="MGLFKSKKSEQAKVLSPHPGMYAEKSIAQAVFDQTTAVKVDRNHW
FT                   KIAFLIASLTALVAVATREPAPSVVKSYGVSSDANGQPLVRVLQPYEPKGRDLTVGFKD
FT                   LITRWFTIEPMLTPVVEDARMYKSIKSAKEQMVGTARKQFDQWFDEDAPFRAVTSSPTL
FT                   TREPEIKNIAPLPDNTVAVEFIATTNEEGQKPKRMRYAITFRYEIKPPQSDAEALGPNP
FT                   FGIYPVFFTLQKTPA"
FT   gene            90171..91052
FT                   /locus_tag="Rpic12D_5192"
FT   CDS_pept        90171..91052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5192"
FT                   /product="Conjugal transfer protein TrbG/VirB9/CagX"
FT                   /note="PFAM: Conjugal transfer protein TrbG/VirB9/CagX;
FT                   KEGG: rme:Rmet_6300 conjugal transfer protein
FT                   TrbG/VirB9/CagX"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5192"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66419"
FT                   /db_xref="InterPro:IPR010258"
FT                   /db_xref="InterPro:IPR033645"
FT                   /db_xref="InterPro:IPR038161"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQR1"
FT                   /inference="protein motif:PFAM:PF03524"
FT                   /protein_id="ACS66419.1"
FT                   /translation="MTMSLLRTTSSALACACLALAVVGGAWAAAERPAKRAEPVIPPLN
FT                   LGSMADAMNPMNPFNGGAEPLAMPGDSRLVVFTYSKDQIYRVLTAPLKGTTIEFPDDEQ
FT                   IVSEPAWGDSVRWESSTDNGNHLYLKPHAAGLVNTLSVTTNKRSYEFTLVSSPLGGIFY
FT                   QKVRFRIPETVMAKIKARADGEAREQGERPANTVGVSPDKLNFDYSTSGSADFKPDAVF
FT                   DDGKLIWMRMPATASEWPVALVKDGSDFVVANFIRRGDYLVLQRLAETVALRSGSTEVI
FT                   VRRGRGRFLGLF"
FT   sig_peptide     90171..90257
FT                   /locus_tag="Rpic12D_5192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            91063..92274
FT                   /locus_tag="Rpic12D_5193"
FT   CDS_pept        91063..92274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5193"
FT                   /product="conjugation TrbI family protein"
FT                   /note="PFAM: conjugation TrbI family protein; KEGG:
FT                   cti:pRALTA_0215 type IV secretion system, conjugation
FT                   efficiency factor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5193"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66420"
FT                   /db_xref="GOA:C6BQR2"
FT                   /db_xref="InterPro:IPR005498"
FT                   /db_xref="InterPro:IPR042217"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQR2"
FT                   /inference="protein motif:PFAM:PF03743"
FT                   /protein_id="ACS66420.1"
FT                   /translation="MAKQVEDVTDARERVSKGKIPKGIIYVAAGIAAVLIGTLAFYYQS
FT                   KTDAEVKEASEEQRAEKMKSRATAGEASQNLGQQIRAQQQAAKDEASRQEASAVRADSG
FT                   QRAPVMSAKDFTTGRQGTEVMGKKNEEDSIFTAPLYKAGMNKVRDNARPKVDLQGTLDP
FT                   ASMRAMQQAAAAAANATGAPPADAAPVNSDQQFLKQTAATKYERTGIAGRLPSCTVSQG
FT                   FVIPATFVGGNNSDKPGEFRAMVSQNVWDTVDGTCLAIPAGSMLVGTYSSDISIGQERL
FT                   LVAFTRLQLPNKKWVPLGSMQGADTNGYSGVSGDVNNHFFKIFYGAVVIAVLEQRFNNQ
FT                   QTATTSNSNGLTTYGNAAGQVATQTAQTILNRNQNIRPTITTEPAQKLLVQVKQDIVLE
FT                   PYRE"
FT   gene            92294..93067
FT                   /locus_tag="Rpic12D_5194"
FT   CDS_pept        92294..93067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5194"
FT                   /product="type IV secretory pathway, putative lytic
FT                   transglycosylase; putative exported protein"
FT                   /note="KEGG: cti:pRALTA_0214 type IV secretory pathway,
FT                   putative lytic transglycosylase; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5194"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66421"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQR3"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0214"
FT                   /protein_id="ACS66421.1"
FT                   /translation="MAACVSAHAVVVDAVISPTAYVVRDGGQVRLQTLPGKPVLYCGLG
FT                   AFETWAQRLVGQEFQIGSARQPDGVTHAETLVSVVAGAGWLRPASLDDAGQAAIVERKG
FT                   GWACAPKAAPFAEFSDRVDPTILAGIALNESSYQGRPWPWTLNVAGRGYYFATRDDAYG
FT                   AIRRLIEAKRCDFDVGIMQVNWCYHGQRFASPWDALSPASNIRVAETILLENRQRSGSP
FT                   MKAVAWYHSADPARGGPYFARFLNHLKRLDSANSP"
FT   gene            93064..94314
FT                   /locus_tag="Rpic12D_5195"
FT   CDS_pept        93064..94314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5195"
FT                   /product="conserved hypothetical protein; putative
FT                   PilL-like protein; putative exported protein"
FT                   /note="KEGG: cti:pRALTA_0213 conserved hypothetical
FT                   protein; putative PilL-like protein; putative exported
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5195"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66422"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQR4"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0213"
FT                   /protein_id="ACS66422.1"
FT                   /translation="MTKFRHLALLLPVLSVQAFAADTDPLDFDYQVVAPSTARPAMIFN
FT                   DGSSTYIQPRAGQTIVADNGQSSGPYIMVDGVPDVLHFTANGQMVTARWKRSNAITREP
FT                   ANPSGDLPHGFTGFSGRIAMVGEHGNLQLVRPGSVTQPLAQIVKAIAPSGWTGTAQKTI
FT                   ALTEETTFVTRDAENWLQALGRLLDQKGLYAEVDFGRRNIALRVEPPKSIAVGVAVASS
FT                   DASNGANVGNTGAPATVPNDQGSGDGGVASSLLAEAFDAQAIRDTKAGTIQIRFATKPE
FT                   GLQIRNSEGSKQGLTWLDGDRVVAFDTVDRFTVSAAGKAVEVRRAAEIRYDFAADNAAG
FT                   LESVFEKDNATYLVFRTSKANVSARNDNGEGSGELKDRYFKFNGIAERLTVVADGRSVI
FT                   VERVPEVRFYERKARVE"
FT   sig_peptide     93064..93126
FT                   /locus_tag="Rpic12D_5195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            94311..94787
FT                   /locus_tag="Rpic12D_5196"
FT   CDS_pept        94311..94787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5196"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   cti:pRALTA_0212 putative lytic transglycosylase, invasion
FT                   protein (PilT homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5196"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66423"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQR5"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACS66423.1"
FT                   /translation="MSGSRLRVRDVSGAKRLFAFFALLLALASLARADCLDDAANYYRL
FT                   DPTLVRAIAWHESGMRPLAVNRNSNGSVDVGLMQINSSWFPTLARVGIAPEHLWNPCVN
FT                   AYVGAWILSSNIARLGPNWKAVGAYNATSPDKQLRYANQIYARWQALQRAGASH"
FT   sig_peptide     94311..94412
FT                   /locus_tag="Rpic12D_5196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.847 at
FT                   residue 34"
FT   gene            94805..95329
FT                   /locus_tag="Rpic12D_5197"
FT   CDS_pept        94805..95329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5197"
FT                   /product="putative pilus-related protein"
FT                   /note="KEGG: cti:pRALTA_0210 conserved hypothetical
FT                   protein; putative pilus-related protein (BfpG homolog);
FT                   putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5197"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66424"
FT                   /db_xref="InterPro:IPR018927"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQR6"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0210"
FT                   /protein_id="ACS66424.1"
FT                   /translation="MRSLLSHKRMAVIAMAACTFVSSVHAGTRTQSVDGDGWQPLGSSV
FT                   RKASVAGQANRNGASDPNTLVAAASALASTSPEPAVSVTSVPSNRPFELIADESVEQQL
FT                   LEWARRAGWKVLWRVQDAWVVPGNKSYGDDFESAVKRVTEDLAANGTDVLGDSWRGNHT
FT                   IVITQNGAAEQ"
FT   sig_peptide     94805..94885
FT                   /locus_tag="Rpic12D_5197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            95326..97017
FT                   /locus_tag="Rpic12D_5198"
FT   CDS_pept        95326..97017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5198"
FT                   /product="type IV secretion pathway protein"
FT                   /note="KEGG: cti:pRALTA_0209 type IV secretion pathway,
FT                   outer membrane lipoprotein, putative precursor (PilN
FT                   homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5198"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66425"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQR7"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0209"
FT                   /protein_id="ACS66425.1"
FT                   /translation="MRIFYQPKLIAGAVATVLSLSGCGIAEVRGIQKDAMRDTRAQLDA
FT                   APSSRPVFQIHEGAWLLGEKVKATKPQPELFNKPVSYNDARDRISTLADVADWIARTYN
FT                   VRVVIDPSVNAPFPSAQSIVTTGATGAVKGPQLPAGLATSLAGAPNATLAAPGGMQSGA
FT                   AAMPTQSPLHYVGDFKGFMRTNEQRYNVYSRFRDGTLTFFRVETRNFTLPDMGAFASMS
FT                   GTISSDGNLSSSSGGTSASTTSSTSGGSSGSGTGGQTASQSLEVKPWKRLEEIAKQIAG
FT                   NGAEVIADPNLGTVTVTGTPPQCDRVEDWVRTLDAMFGKQVAIDVRIYEVRLNQEDNYG
FT                   LNLSLGYKSGNGHTGATFTGVAPPTVSSNATPMSVGATIVGGKLDGTKVAVQALSTLGN
FT                   VTQVVSRSGVTQNGKVMAMQSATLQDYIPSSQTTLASNVGSTSSMQTAPDISGFTSTFT
FT                   PKVVNGRILIMFDMTLSNLNPLQEQTQGSGASLSKVQLRTKPLARFQQTVGLKPGESLV
FT                   LTGLRDQTTSTTNNGVGSPYVPVTGGGVDAAKRETMIAVVITARLL"
FT   sig_peptide     95326..95406
FT                   /locus_tag="Rpic12D_5198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.895 at
FT                   residue 27"
FT   gene            97435..97740
FT                   /locus_tag="Rpic12D_5199"
FT   CDS_pept        97435..97740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5199"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:PHG350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5199"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66426"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQR8"
FT                   /inference="similar to AA sequence:KEGG:PHG350"
FT                   /protein_id="ACS66426.1"
FT                   /translation="MQAATSVTPGQAGEPGVVPSLVVPGNVTKPPIPLPAAKHGKPRLV
FT                   HIGGADGVYSALIEINGITISDAVAGTQLGDGWQVIGVDAKQVRVGRGKQVLKLAV"
FT   gene            97742..98995
FT                   /locus_tag="Rpic12D_5200"
FT   CDS_pept        97742..98995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5200"
FT                   /product="putative type IV pilus biosynthesis protein"
FT                   /note="KEGG: cti:pRALTA_0206 putative type IV pilus
FT                   biosynthesis protein; putative PilO homolog; putative
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5200"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66427"
FT                   /db_xref="InterPro:IPR009663"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQR9"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0206"
FT                   /protein_id="ACS66427.1"
FT                   /translation="MAQVLNLPGIKGTYAVGLTWRHEDARPSRAALRKKARDLQARWSV
FT                   VHQTRTGHVQAGFCAGLEGAASNWRTKPLAALVADSHPQPWCGFYRISADLYWYIAVRD
FT                   GQEVLPDGDRTGTLEELEQLHALHKASGDWNVVRGTEAELADIVRTSRSVKGLTDLEPG
FT                   PRRYVLPVAGVLTVAALAGVGTWWYQQRQAEAQRAADLARQRAAQAMHAAKQAKQQIPP
FT                   WTLQPVPSAVVDACRSAWHGRALATKGWLLTGWSCQFGSPVTVNVAAQWERDGGVAEDA
FT                   PGTLLDDGNHSRSTEVKPYTFTIQPTGIDDFEVAKRIVWSVSHRKAFQLKLAATQPAAL
FT                   PGANGPDAPEPAPWIGNAADFTLAMAPWFSGASAFDQVPGLRLTEVSVDLRDGQWHAKG
FT                   TLYVNRFPGATAALKVGS"
FT   gene            98997..100583
FT                   /locus_tag="Rpic12D_5201"
FT   CDS_pept        98997..100583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5201"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   reh:PHG348 putative traffic warden ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5201"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66428"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQS0"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACS66428.1"
FT                   /translation="MVALVERFRAFSRVDAHVEPMRLPPVPATLMQHVVWAGVGEKIQV
FT                   DGRYAGGSAFLTWLADLKRHGLEPVVESLAPQELAQARESTSDGQSGDAYLEFLEMSRR
FT                   RHVEAAELGASDLHVLQREDHAEFQLRIDGELWTVPEWELNAAQGEAFVRATCVGLATV
FT                   KEPTFNPLEFQEAQISGNKLPETDIESVRITRGPAYPIEAGGGVMVNRLQPRRHTATLQ
FT                   RRETPASRLRLVRPEAPAGKVDFERMGFTTLQLAMFEQVVLMPDGLFIQTGPTGSGKTT
FT                   TGYEMLRYKGQISPELRQITREHPVEYPREWAVQLLSTGQNSSYLVERMLRMDPDIIDI
FT                   GEIRTGNEGVAAVQAAQTGHLVFGSLHVLDPFELIGRLQMLDHTLLSKELMCNHKIIAG
FT                   FMGQRMVPVLCTECREPLAKHLDAMPGILLDRIKTWGNIEQVHVRGKGCPHCFGRQIRG
FT                   REAVAEVVLSTEELMEDFLRGTSLARRNHRLREGSDKSMLGNVMERVLAGRIDPRDAQK
FT                   NVPIEAYREGV"
FT   gene            100580..101653
FT                   /locus_tag="Rpic12D_5202"
FT   CDS_pept        100580..101653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5202"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   cti:pRALTA_0204 putative type IV secretion apparatus
FT                   component (PilR homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5202"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66429"
FT                   /db_xref="GOA:C6BQS1"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQS1"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACS66429.1"
FT                   /translation="MNLQKALQWLKGNPLPWKLRKRLYERASTHLANDVTLERVLTRFG
FT                   AGLLRRRKRRAAAAIDAVTQGVRNGQTLAAAMDSSLTNLERTVLDAGDRAGKLPEAMKL
FT                   VIEVRELVDRIFWKLILGFAPALVYVYALYKVLGFIGADVVPEFAGILPAEKWTGWARV
FT                   LYLMGVFAQSAAMPLATYGLLTYALWCAWALPNWAGRGRAFFDRWVFPFPLYREIAGFS
FT                   WLLSFLALQRAGIPEVESLAAQVRTASPWLASRLLAISSGTRNGFDLATSMMRTGHDFP
FT                   SVDLIDEIGEYMGKADSSEKLANVARENAAYVERKVLAIGGGMALTLSLLVYAAMFVMQ
FT                   FGSNALSSALTSSMRQM"
FT   gene            101690..102190
FT                   /locus_tag="Rpic12D_5203"
FT   CDS_pept        101690..102190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5203"
FT                   /product="putative prepilin type IV pili"
FT                   /note="KEGG: cti:pRALTA_0202 putative prepilin type IV pili
FT                   (PilS homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5203"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66430"
FT                   /db_xref="InterPro:IPR014911"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQS2"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0202"
FT                   /protein_id="ACS66430.1"
FT                   /translation="MERIIGALVAIALAILAVGNTLSNSGQAKSDQKSGGAATDIGYVM
FT                   TKARAGFAQSNTGFANFSNANLGGLINGGTFPPTMVKSGGIFDKWGNPITLSSANSGTS
FT                   GVISFGGGGSQTTDECTSTVTSLSGYDLLTVGGQSFTRSNMPDTSQAGAVCSATATIVV
FT                   TFH"
FT   sig_peptide     101690..101761
FT                   /locus_tag="Rpic12D_5203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.386 at
FT                   residue 24"
FT   gene            102213..102689
FT                   /locus_tag="Rpic12D_5204"
FT   CDS_pept        102213..102689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5204"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /note="KEGG: cti:pRALTA_0201 conserved hypothetical
FT                   protein; putative exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5204"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66431"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQS3"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0201"
FT                   /protein_id="ACS66431.1"
FT                   /translation="MAFALLPLAAVMLLFGLGIQAFQLADSVPGAGPAGQMETRSVVSS
FT                   QQAAMFGTACVSTAIAQRGAISPNMTVTLPAGVLLPAGAVCMTTANGSGRNVYGYLPAA
FT                   PGAAGKLLADAQGGNNWFVIRAAGVAVSLAGGNTMSVPTTIPVSSLLNWVQTSS"
FT   sig_peptide     102213..102278
FT                   /locus_tag="Rpic12D_5204"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.512 at
FT                   residue 22"
FT   gene            102702..104000
FT                   /locus_tag="Rpic12D_5205"
FT   CDS_pept        102702..104000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5205"
FT                   /product="putative adhesin precursor"
FT                   /note="KEGG: reh:PHG343 putative adhesin precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5205"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66432"
FT                   /db_xref="InterPro:IPR007001"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQS4"
FT                   /inference="similar to AA sequence:KEGG:PHG343"
FT                   /protein_id="ACS66432.1"
FT                   /translation="MDAILGYMIAIALSLLSVGQFYQWQASGMTNVQTAAAASQQVIYN
FT                   KAAAQYVQDNGTSIAAIATPTVPVTITTAMLISSGYLPNGFSTTNVFGQTWQLQVLQPT
FT                   AGTLQSVVQSVGGRAIADTVQLVQIAAQAGAQGGFVPYAGQNGDATMTPANAYGAYGAW
FT                   KLPLTNFTNPGSGHLVSLLAFTGVSANNSYLYRVQVPGHPELNNMQTDLGMTDQGGALH
FT                   NISGAQQISSQSLQALSGGSLAVPSITTANGKVVTWEQVGEGGVLGLKGSNGTSIYLES
FT                   LNGTFRIVNNPWTQSIFSVDQSGDVVAAGTQRLGNVASPNTACAQNGTQAGNADGSGQQ
FT                   LVCLYNVWKPIGGSLQRFGYYTAQHGSGIPRPTCPAGGTPMIVVTPANFAVDPTTVVNY
FT                   GAWGSGPWTVYIMDGSNAGIGGATATVGTYCGY"
FT   gene            104013..104654
FT                   /locus_tag="Rpic12D_5206"
FT   CDS_pept        104013..104654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5206"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_6557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5206"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66433"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQS5"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_6557"
FT                   /protein_id="ACS66433.1"
FT                   /translation="MRMLLRVLSVIVLLAGSRLAMANPVLCSPGYQDSTCPSPIARGPV
FT                   PAPQCSSGAGWTTTSSPVWKGSYWSAPGCNYQPPPSCPSGYYAASGPSWNGSSWVGLNC
FT                   QPTAPPPPPPPAGHVLVATYTTNSCGNLGPFNGYADGTYDASNSDWGGQTFSGTWDQMY
FT                   YNGVAYMNSNYARYIAPAYISQPSDPATATQYLSRVFFVYNPWACGGGVG"
FT   sig_peptide     104013..104081
FT                   /locus_tag="Rpic12D_5206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            complement(104762..105745)
FT                   /locus_tag="Rpic12D_5207"
FT   CDS_pept        complement(104762..105745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5207"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SCP-like extracellular; KEGG:
FT                   bvi:Bcep1808_7071 allergen V5/TPX-1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5207"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66434"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQS6"
FT                   /inference="protein motif:PFAM:PF00188"
FT                   /protein_id="ACS66434.1"
FT                   /translation="MTNKLSLLAIAAASTLALTACGGGGDGGTSTTGGSTGGTTTPPAQ
FT                   TVTGTQTTPQYGSTSAQLAAFNTLNQYRTQCGFPALSENTVLDTAAQAHAAYMSTNGVV
FT                   ADSETAGKTGFTGVTYQDRAVAAGFPNQYVGGVSGGYYTNATLTDAQYGQQHIIGWLSG
FT                   VYHIAAGVWPSSIVGIGVSKTLFNGFPDVRASMSFDAPKTMPGNMPLTFPCQGTTGVAY
FT                   SSNGETPAPPNTSGSWGIPVAVAANPSDTVVLTSGTMTDNASHTVTLQLLNSSTDPNKL
FT                   VPAFEAVAYPTAPLQPNTPYTVNLSGTINGTPFTRSFTFTTGNVVG"
FT   sig_peptide     complement(105677..105745)
FT                   /locus_tag="Rpic12D_5207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.631 at
FT                   residue 23"
FT   gene            complement(105894..106337)
FT                   /locus_tag="Rpic12D_5208"
FT   CDS_pept        complement(105894..106337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5208"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_6554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5208"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66435"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66435.1"
FT                   /translation="MTTFCKFDIPAFTATVRKKAKLLLAIAATAIITACGSSTSDIVGE
FT                   YSVQGKNGLEPTLRIEKADGKLAVQEFHNGNWRAIQGPVNDLTKEQAQALFGRAVSESV
FT                   SGISTKDFALVHVPSNWSNKDFPTTTGYLLVSMLGPVELHKVK"
FT   sig_peptide     complement(106215..106337)
FT                   /locus_tag="Rpic12D_5208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.844 at
FT                   residue 41"
FT   gene            complement(106448..106807)
FT                   /locus_tag="Rpic12D_5209"
FT   CDS_pept        complement(106448..106807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5209"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5209"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66436"
FT                   /db_xref="GOA:C6BQS8"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66436.1"
FT                   /translation="MRHLASRFVSGTASLFGTALTGASLVGKSHAGTAPALVLGLALMI
FT                   FFAPRWYRLYRFRTHTFFWYRKKHPGLVSDAGTITCDRCSSKHLSVHALRRAPGTRAHF
FT                   CKTCGKTLYFSAEGC"
FT   sig_peptide     complement(106712..106807)
FT                   /locus_tag="Rpic12D_5209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.990 at
FT                   residue 32"
FT   gene            complement(106954..108135)
FT                   /locus_tag="Rpic12D_5210"
FT   CDS_pept        complement(106954..108135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cti:pRALTA_0193 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5210"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66437"
FT                   /db_xref="GOA:C6BQS9"
FT                   /db_xref="InterPro:IPR007944"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQS9"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0193"
FT                   /protein_id="ACS66437.1"
FT                   /translation="MTRSTALSAKDSLILPDRITDRIRSINYQLADFMGTCMLRHREVA
FT                   PVFGVRPEELAMLAQNAAGQRQLMGTPFLVVTPMFKNVEDWRSLIKKTTPTLAIDKVKA
FT                   EFGNLDPSLKMSLFHQNKDYVWMVVDLLHSTPVAAQLLGMPQDLADYLVTVSQHELELA
FT                   IFGANFPMFRWRFENPMFWLEYSANLISEETICHHVMNAGDSRAPRPLQRERWGNFRVG
FT                   RAQMERYTEALIGLRCRASSVASMFPGTAATARALYRQIHGESSPCGLMPSSSSWYVES
FT                   VSSRIQSTTLIWLYWSALAARANEPEAFITALDTVGRLFGDAARLTPDRAFHLARSVST
FT                   GSDLSMSSCRTCSTHYLTCNTTPKIELAASFYCPSCTGALTAPRKGKPRKQLA"
FT   gene            complement(108186..109310)
FT                   /locus_tag="Rpic12D_5211"
FT   CDS_pept        complement(108186..109310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6283 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5211"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66438"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQT0"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6283"
FT                   /protein_id="ACS66438.1"
FT                   /translation="MDLDESSIGRIAQATEEIWQSQNRVVAEFIAIGARLVHIDGIIMG
FT                   SLTRTLGDETVARKRGSAMLSSYASTVLRMTDSRVALYINIYRKFANNSRAITNLTLGE
FT                   MKILARKDITDDEVDKVIEHKLKTDSFKREDIRPIIEKLRKTEEDLTNTGLQLQVTQEE
FT                   LNENLNNNRDLEAQIRTLAAQLTVSQEEVANRQRAMDEAQLQVTRSSSTVSTLQQEIDR
FT                   LTRERNALAARAESGQPAAVKETVEVHVLPPGLQTLDDALQEANRRLEAANEDVKRKQD
FT                   ELDRLNLEIAQQQDDINSSADARAKMITLVADIESVAHKYQSAQLTAIFANASAECRPI
FT                   LEGLAGVLTKFLGEVNAALATTETTNRVSRRTRT"
FT   gene            110141..110455
FT                   /locus_tag="Rpic12D_5212"
FT   CDS_pept        110141..110455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5212"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66439"
FT                   /db_xref="GOA:C6BQT1"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQT1"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6281"
FT                   /protein_id="ACS66439.1"
FT                   /translation="MESLLKFVNTPFRLFCTMLVLYMAAHSHAIAVVVGIVFLSVIWHS
FT                   LKSEKAAPIPAAPVIIPPKPAQAEADKAAPAVRPAANTARYAKSAVVTPMLRPKAATRP
FT                   "
FT   sig_peptide     110141..110230
FT                   /locus_tag="Rpic12D_5212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.613 at
FT                   residue 30"
FT   gene            110553..110981
FT                   /locus_tag="Rpic12D_5213"
FT   CDS_pept        110553..110981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6280 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5213"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66440"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQT2"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6280"
FT                   /protein_id="ACS66440.1"
FT                   /translation="MNTNAVAWQLDFFGDAAAVTPTQHKQDPLPDPAYWSDSVKEKMVD
FT                   ALISLACDSRRGDNMPESLIDCADMLRARMRGTLYDLEDYRMTLGWIFHYWDGALPYLY
FT                   VCAVTGVNPEVLQDVILNQPRLKKDLDELRHSFCGTLL"
FT   gene            110990..111757
FT                   /locus_tag="Rpic12D_5214"
FT   CDS_pept        110990..111757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:PHG336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5214"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66441"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQT3"
FT                   /inference="similar to AA sequence:KEGG:PHG336"
FT                   /protein_id="ACS66441.1"
FT                   /translation="MTFLESLVKVLLPKADNPQRHADAEPIKVGAGGNNETQMTISGEP
FT                   HLFRDEGDRVAHFVALFESRLTETPFGPKLLPALIPHWSLKAVHEGLKVTEVVAQVIQG
FT                   GVQPSSVKQEPTRSAAAPRRAVPETTEEAPVEADAQARRARAPEARSRATYHGRIKSWG
FT                   EERFPDRKRPGKSYKNFALKLEMASGMETLQGEGLKDAISEAGCKLGDAVEVKRLRKIK
FT                   VPAFDEKSGDPVLDENGNQKVHDKWLWSISVAH"
FT   gene            111775..112308
FT                   /locus_tag="Rpic12D_5215"
FT   CDS_pept        111775..112308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5215"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: rso:RSc0422 single-strand DNA-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5215"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66442"
FT                   /db_xref="GOA:C6BQT4"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQT4"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACS66442.1"
FT                   /translation="MASVNKVIIVGNLGADPETRYMPSGDAVTNIRVATTDRFKDKGSG
FT                   EMREATEWHRIAFFGRLAEIAGEYLKKGSSVYIEGRLKTRQWEKDGQKQYSTEIVAEQM
FT                   QMLGGRQGAGGESEGGGGYSRGGDDTSGGHGGSRSQAGGMSRSAGGSGQGSSARRQPAP
FT                   SNGFEDFDDPDIPF"
FT   gene            112546..113622
FT                   /locus_tag="Rpic12D_5216"
FT   CDS_pept        112546..113622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5216"
FT                   /product="P4 alpha zinc-binding domain protein"
FT                   /note="PFAM: P4 alpha zinc-binding domain protein; SMART:
FT                   P4 alpha zinc-binding domain protein; KEGG: cti:pRALTA_0187
FT                   putative DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5216"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66443"
FT                   /db_xref="GOA:C6BQT5"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQT5"
FT                   /inference="protein motif:PFAM:PF08273"
FT                   /protein_id="ACS66443.1"
FT                   /translation="MKKLSEIVQNWTPTQWDALVNQYLPAAFLTESFWKGRPGPCPICG
FT                   GHDRFTYDNKRGRGDWVCRKCNAGSPKAGDGIELVCRATGMSYHELTCRLNGEPVHPIG
FT                   PLVNRPVACRQKKSADPVWKKRRIHKQWDEAVSLTPGDHVMHYLAARVPGLRAPRPQSL
FT                   RVAMQDYLFEDEVIGRYLTIIAKFTLPDGQMATVHRTSLDPVKPMKATIISKDGEVLPA
FT                   KRNDVSALPLAGGAVRLMTPRNGEIGIAEGLETSYAAYMLFGVPMWYCLNRVLVSQFVV
FT                   PEGLGIHTVHIFADFDAVDPKTGKSPGMSDALTLAKRLRAEGFTVVIHRPKLRGTDFCD
FT                   EWCAEYQSRAVHHEAVAA"
FT   gene            113718..113930
FT                   /locus_tag="Rpic12D_5217"
FT   CDS_pept        113718..113930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cti:pRALTA_0186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5217"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66444"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQT6"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0186"
FT                   /protein_id="ACS66444.1"
FT                   /translation="MPMKGFIQVVGKLQIHAMRIVDSLEVPAGKSDAQCYHVFRRSDGG
FT                   SMEFVGKDSDLDFVETFCLQRASLH"
FT   gene            complement(114012..114149)
FT                   /locus_tag="Rpic12D_5218"
FT   CDS_pept        complement(114012..114149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5218"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5218"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66445"
FT                   /db_xref="GOA:C6BQT7"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQT7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66445.1"
FT                   /translation="MADFFAHLNYVNTAKFWLIAGTGMAILEAARVVLGRFAQRPVGHE
FT                   "
FT   gene            complement(114267..114653)
FT                   /locus_tag="Rpic12D_5219"
FT   CDS_pept        complement(114267..114653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5219"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:PHG331 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5219"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66446"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQT8"
FT                   /inference="similar to AA sequence:KEGG:PHG331"
FT                   /protein_id="ACS66446.1"
FT                   /translation="MDKLSIKVTLTPVTAPTLFPYLAGILDSKQRAHALRHMAELGYTA
FT                   FLARQAVQTNLVPAQAIAPAVATLVSAAPAPFALAESVARPNPSPAPAFDPAALSESDS
FT                   PSPDGLPTAMAEHLGEAMARFFPN"
FT   gene            complement(114673..115671)
FT                   /locus_tag="Rpic12D_5220"
FT   CDS_pept        complement(114673..115671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:PHG330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5220"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66447"
FT                   /db_xref="InterPro:IPR022389"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQT9"
FT                   /inference="similar to AA sequence:KEGG:PHG330"
FT                   /protein_id="ACS66447.1"
FT                   /translation="MKAATVAVDVGYGNTKFAFSMGSETKLNMFPSLAPQAAPRALANH
FT                   GNGFFKARDVITIAIDGVEYEVGPGVSLSSAYGQTGRTLSEDFVTKDEYAALLGGALRL
FT                   AQVSEVGQLILGLPVHTTQKYASYLRDRFTGTLDFGGEPVEIGSVICLPQPLGALVTFM
FT                   RQQNTKFDADNAHLVIDVGYFTTDWVVAQGFTMDDNRSGGVPGGSSKIYQQIASLIEQD
FT                   EGEPVTGIERIDKCLRDKKPMLFFDKEIDLTPYLEKARSVCQLAVKEIQTRVGRTEDIR
FT                   AIILAGGGSALYVPAIRAAFPRTPIHALSSPCFANVSGFYDIGSTRPVKQK"
FT   gene            116851..118038
FT                   /locus_tag="Rpic12D_5221"
FT   CDS_pept        116851..118038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5221"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix Fis-type; KEGG: rme:Rmet_6273
FT                   helix-turn-helix, fis-type"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5221"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66448"
FT                   /db_xref="GOA:C6BQU0"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR024456"
FT                   /db_xref="InterPro:IPR024457"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQU0"
FT                   /inference="protein motif:PFAM:PF02954"
FT                   /protein_id="ACS66448.1"
FT                   /translation="MQTRINLKPILANYSLPERFKSEFAVLAGENLHKPHSQTRVSGRA
FT                   LSSISQKQRAQMLLSLAVELREGGFTIMSPYNLAEKHLRWLVQRWVTERNLAVGSVELR
FT                   LSHLRALCSWMGKTNMVGGIDDYVERPAGYTRSYAAETDRSWDGNNIDALAKIEEIAQT
FT                   DAHVAIQLKLEAAFGLRAKESWRLRPARDLLPSGYLHVQDGTKGGRPRQVLIEFDWQYD
FT                   LLAEAAELAACTNPERGSLIPATYTQVQWRRRFYTVLEKHAVTKRGDGVTAHGLRHQFL
FT                   QQMYQRLTGEQAAIKGGARVLDREAHKDAMTRVVEAAGHSRKEKANAYLSTHSAIAARS
FT                   RPVVTREMAVAAVAAANGVKLKAAEALGISRPALYRLLAKPAEAGTAAGHRHFTG"
FT   gene            118048..119205
FT                   /locus_tag="Rpic12D_5222"
FT   CDS_pept        118048..119205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5222"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_7376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5222"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66449"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQU1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66449.1"
FT                   /translation="MTEDDAMADGDWDTYLFPEPELRACTDEELYTLIRENLPNATAET
FT                   DGTDLLTDVAIDHAQDLIEQARDLLLARGAAISPQWRAALRFLRWPLSPAEVTANQARR
FT                   LREIEEDRLRRAHAAKLGVDILQAIRTVMDGGRLPLSLSLEGVTVSIGWGLRTSDGERR
FT                   SISPSGAEVVRMRDALAAAGCCHCQIHGASQDGIPFEEAPTPEWSLNFSVPTNRAGWDL
FT                   LKQWWKEGRFSHAPHVWMYRPELGDPEFFWHWPLDACWPGSAPAWRRLYGHLGYVDLPW
FT                   VRFHRRVHGNCWERDEVRVEWAAGELRYIECAEEADREAQRLITSGEILAYKISARAAM
FT                   DAHAGAGAGAGPAPVVRSRLAELLARVCGMLGRSCSSGAADPTKN"
FT   gene            complement(119285..119407)
FT                   /locus_tag="Rpic12D_5223"
FT   CDS_pept        complement(119285..119407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5223"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5223"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66450"
FT                   /db_xref="GOA:C6BQU2"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66450.1"
FT                   /translation="MKAQQPYGSPQTLGRRVSFWLIAVAVALYLSYIAGTSPPF"
FT   gene            complement(119433..120350)
FT                   /locus_tag="Rpic12D_5224"
FT   CDS_pept        complement(119433..120350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5224"
FT                   /product="DNA/RNA non-specific endonuclease"
FT                   /note="PFAM: DNA/RNA non-specific endonuclease; SMART:
FT                   DNA/RNA non-specific endonuclease; KEGG: rme:Rmet_6268
FT                   DNA/RNA non-specific endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5224"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66451"
FT                   /db_xref="GOA:C6BQU3"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR018524"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQU3"
FT                   /inference="protein motif:PFAM:PF01223"
FT                   /protein_id="ACS66451.1"
FT                   /translation="MLKKTLLFVALSAFLQVAGASPDHCGASVADGAQPKVLSSKHAGA
FT                   SHLLCYRAYAVLVSSATRTPLWSAEHLTAQAVNQARELPRESDFFEETSLPATARATLQ
FT                   DYHGSSHVQIDRGHMSPSGDFGDLASQQESFSLANVVPQNSVSNRRMWSHLETSTRRLV
FT                   RQTGEAYVVTGPAFTDGKARYLNEHVRVPDYLWKAIYVPGVGAAAYIAPNDATPKYAVV
FT                   SIAKLAQFTGVDPFPRLPAATRDQAMELPPPTPHPHEKAGRQTTLNDLLSRAPAAEVED
FT                   VGPTAVARVPNVWRLARAISAAVR"
FT   sig_peptide     complement(120288..120350)
FT                   /locus_tag="Rpic12D_5224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.626 at
FT                   residue 21"
FT   gene            complement(120592..121086)
FT                   /locus_tag="Rpic12D_5225"
FT   CDS_pept        complement(120592..121086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cti:pRALTA_0174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5225"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66452"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQU4"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0174"
FT                   /protein_id="ACS66452.1"
FT                   /translation="MCTQCGIGTPPVQIGTSKEAAYDELALIWNRRVEYRPTDQHELAS
FT                   IARRQLTPVDIPMLLDAIARNAMDWETRGPIFAAMAAQLSRPASPAAAEVPMATVLEDA
FT                   GRYRKLVRLAKVIYVDGRPWIRFEPLDAFDAELVEGEENAFARMDVFVARAVDALEPQL
FT                   D"
FT   gene            complement(121245..121487)
FT                   /locus_tag="Rpic12D_5226"
FT   CDS_pept        complement(121245..121487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5226"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66453"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQU5"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6266"
FT                   /protein_id="ACS66453.1"
FT                   /translation="MPPADLSSEFPHPETIIAVRGALSIGLQQGPDSPGGHWLHEFWAF
FT                   GRARAEAEAIIQGFMESAAIRILATSHAYFGAAAT"
FT   gene            complement(121798..122661)
FT                   /locus_tag="Rpic12D_5227"
FT   CDS_pept        complement(121798..122661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rso:RSc1656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5227"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66454"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQU6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66454.1"
FT                   /translation="MQQTNENASPATTQHEAMTLLADLVLSVQWWAGQEDGIPDTVRPA
FT                   FDRAQKALGWPQGESTTTPAATAMPEAPCASCHGFGSELTVYKGKVPCRACQKSNNAAP
FT                   WLPPGWEISVADDDGSTWVTLRRCTSDRKVLAQSVYAHKRGSLDSHVWHALRHSLDITR
FT                   PQIAELDHWRARALNAEQLLNSPELHDFARGVVQEAAHQRQRWGTAKDADKSPADWVFL
FT                   VGHLETRSMMYLQAGNVDKALHHTITTAAALANWHTNISGADSSMWPSLPGQPHASAPV
FT                   GGGGHA"
FT   gene            complement(122645..122977)
FT                   /locus_tag="Rpic12D_5228"
FT   CDS_pept        complement(122645..122977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5228"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5228"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66455"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQU7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66455.1"
FT                   /translation="MWGFHIHLDIEGFVRSSTYPDDYIGLFRDATGRSLTPAEARTKLT
FT                   IDKARGHKVLPMSKECGAALCPHATDGCSGFDYSGGGCPGYQRGNGKAAPHSTATTTEV
FT                   NDAADE"
FT   gene            complement(122977..124884)
FT                   /locus_tag="Rpic12D_5229"
FT   CDS_pept        complement(122977..124884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5229"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5229"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66456"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66456.1"
FT                   /translation="MNTSASSSPAVACGPDGRARANATLTMAKWILLSRDRTLDHACVE
FT                   CVPDGALVVPGFRCGYHSALNAVTAVDDADRQEPAYAPVQAVVDQFVSGYQLHGTLGSH
FT                   VPTPRERGLIANAIAGLLADTVFLREFDKWRRADAPQASMPPAAAVPADCAGAGEPSTL
FT                   RNMLAAIRVVGQIDGHDVIRRLSMLDLVDRERRAAEEEAPAGAIALSDAHAKGVMDALR
FT                   GVHELFVHEDGCGALPPDSPFQNGDQPFGRTSRKPQRTSAMLSEKHHNPHRSGTEAYLA
FT                   TEHHNEGWNGALAAVRKVLGSSLAAAIHYPGCWDTAAYPTIESALAEMGEEFQCTNDDC
FT                   PHHSDLQQGEPRAFDVAVSGYKVLLVRTRSEADDTAKHFRGRGCEVEVYPLYGGQRFHT
FT                   LKATDFYELDPDRNGEPGTEPARNVTHLMPEPWPPALSGAPVVPATLEVDNAALAAEID
FT                   WCLDEGHCGPRTRAVLQRIRDHQTAGITPARRPMLLITLRQAESLQQFFGGHDAEVAVV
FT                   PYKDGLLAWDVECPGEGSQWLGPTAVDDELADKGRPDTSRPAIWKTTHPAVCVPITDSK
FT                   AIADDWKEHGYDVVEFYPGPQELRLCADGVGTANADADGHTVLRDTPGAASIDADEGPR
FT                   "
FT   gene            complement(124986..125756)
FT                   /locus_tag="Rpic12D_5230"
FT   CDS_pept        complement(124986..125756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5230"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66457"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQU9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66457.1"
FT                   /translation="MAEQLIDAAQSTLAKALSALSRRADRVHSQLCAAQRIRTAYLAAQ
FT                   VGILVPAVSRSVVRSLQVRLPAFMTSDVIAEFHRGRKFLAVFPRKQTRESLSILQYALT
FT                   AYLSQIRYQELKEFDAEIAHLRAYLTDLERAREQASDLLRVLQVVQDRAAPVPSEAQPL
FT                   LARMAGAGDRHCRRSNAGTDGRRRAASALDDQDTNLCAFVLAELPSRLGELLTRDKSAA
FT                   FDASTERPRAGPTTGSPRLPVPALDTLDAQLATA"
FT   gene            complement(125796..127163)
FT                   /locus_tag="Rpic12D_5231"
FT   CDS_pept        complement(125796..127163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5231"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amr:AM1_F0154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5231"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66458"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66458.1"
FT                   /translation="MKTPLNRSADGARMQPGAPLSSLKSPAMTGNIVNKEPPMQDTQCL
FT                   AIRDWLFDQHDRVTGTARLFRYVAVVPNDSDVKSATVHYALARPVPITGTFAAEPDDIV
FT                   RELLAQSPFRSAELHLAEHDVLKDSWPVKWGLTAKDSLSNWPVLVLSERDDKSVYGVVM
FT                   RSPNLESNALRFASLYCDPEEVGLILDLLMLMQPDDAFLGWFKESEIAASDLEQALAAT
FT                   PQTDAGQKFVLLYRTDEWLSGIWNADRPIVERINLTSLADFHGIPVSLAKKRRRADLEQ
FT                   ACDNQTVTGDYDALVKALTAAGGEMPSRGSDYEADPAVRVLCDWWNGAAPDGMRHAGAL
FT                   RIYVWSDERRVFLPGDPEEPGLPADVLATQPTYALFQEPGKPTVAVVFLRGREHNVALP
FT                   NGSTQIQFANGNPCYVIALPISVANEAFYSAQGLRAVRRFMVTRVPALAAGDLQVA"
FT   gene            complement(127163..128383)
FT                   /locus_tag="Rpic12D_5232"
FT   CDS_pept        complement(127163..128383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:PHG322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5232"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66459"
FT                   /db_xref="InterPro:IPR009553"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQV1"
FT                   /inference="similar to AA sequence:KEGG:PHG322"
FT                   /protein_id="ACS66459.1"
FT                   /translation="MIKIRIGPSDFDLAEVLENPGRYTTQLERAKRIQGFAECGCTEHA
FT                   PRPKLVIRRLRSAFILARWPDANYKHRQGCPFQERKGHATATARTKGPFQTRNGKHLIQ
FT                   LDLSLEVTQPGTGQPGPRSPQASSAPRAHRRSAPLLAFLEYAWEAAGLHAWADQGYRGW
FT                   NACWSMLSAEFADAKINGRPAADVLHIMRRWDPEHKAEILAEFDAFVARLTTAGTTTHR
FT                   GLIIGEVGEFKPSAHGGMLVLRQSHQRYFMSNALFQKVSRSYATALAGLGRKDLRSVAV
FT                   LAVEKTANGYLHVADMAAMLTNSSFLPCDSSHEAVMADHLIRLQRRFEKPLRHVGAAAV
FT                   HPDFEVKDVDQRTVIEVLGMTGNREYDRRMQEKREYYATNGIRLVEWNPNKHPVADTRL
FT                   PPTHRDR"
FT   gene            complement(128395..129855)
FT                   /locus_tag="Rpic12D_5233"
FT   CDS_pept        complement(128395..129855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5233"
FT                   /product="putative helicase superfamily I"
FT                   /note="KEGG: reh:PHG321 putative helicase superfamily I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5233"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66460"
FT                   /db_xref="GOA:C6BQV2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQV2"
FT                   /inference="similar to AA sequence:KEGG:PHG321"
FT                   /protein_id="ACS66460.1"
FT                   /translation="MQPTEEQTAVVDASLDGEPLKVDARAGAGKTSTLGLVSTAKGRAR
FT                   GVYLAFNRLIAEEAKRKFPLSVRCGTVNSQAYRSVSADITRKLRNPLEPNYLLAERFGL
FT                   QPIKVPTTIGKNLELTSAKLGRMVRDGLARFCGSAKPTPLDWHIPVDPLITEQAAEALR
FT                   HALLPSVVKLWEESQNPQSPGAISHDVYVKLWQLSRPTIPADYILFDESQDANGLMLSV
FT                   LRRQSAQVIYVGDPYQQIYEWRGAVNAMDHIKAQKRALTLSFRFGEPIAALATRILRTM
FT                   DEEVPVRGQASIASRIHKDISPSELKVNAVLCRKNATVLSYVADGLQRGEKVAIRANIR
FT                   DIMAFLDGAERLMCGQRTDYPTALSLFANWSEVQDYADSFAGRDLKPFVKLIDDEGIPY
FT                   VRQLLSTVSPESEADYVVSTIHQVKGLEYDSVRIAGDFRFKTDDDGKYTMDTEEKRLLY
FT                   VALTRAKRNLDITAIQVDMHRMFRDAGV"
FT   gene            complement(129857..130291)
FT                   /locus_tag="Rpic12D_5234"
FT   CDS_pept        complement(129857..130291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5234"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cti:pRALTA_0165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5234"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66461"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQV3"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0165"
FT                   /protein_id="ACS66461.1"
FT                   /translation="MRFTRYLRYYPIDFTSRREAAFARKQARERARYPLFPEHIAESQR
FT                   TVADEIALRQRRSDSLELRMRALQAKHWRKGRSMYFAQPAAVRAHIQEAWRAWRGPTTP
FT                   NNFIYVVEQQTGEGERRRAAIRERDAAFRASLVDTQLTLA"
FT   gene            130464..130952
FT                   /locus_tag="Rpic12D_5235"
FT   CDS_pept        130464..130952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5235"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66462"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQV4"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6246"
FT                   /protein_id="ACS66462.1"
FT                   /translation="MREVEIGGRPKAEPCSQFGEAEDQALASIEAQAFARMLDRVFWFP
FT                   EPHVLRFEARVHSDSQGIHHTVVGVVGHGGEAWFSEDLIPARWDYVAFKEIGWSVSKLL
FT                   RNKLIADGVLREDAPGLLAGLMPDFSGMQEPEEKDHYRWAVVNRLRSAAMTRPMPGRW"
FT   gene            131304..131678
FT                   /locus_tag="Rpic12D_5236"
FT   CDS_pept        131304..131678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:PHG316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5236"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66463"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQV5"
FT                   /inference="similar to AA sequence:KEGG:PHG316"
FT                   /protein_id="ACS66463.1"
FT                   /translation="MFNAVIQRFKEAQLKAFESYLVVARFEQEALPILDPSLRATRIRK
FT                   EAEVTHEFELFCVRIARAVVETVRSNASTSVASTIDVESELRVAEADIKAALAIGAVPD
FT                   MDAFCASLNQRFNVRVGALQ"
FT   gene            131675..132607
FT                   /locus_tag="Rpic12D_5237"
FT   CDS_pept        131675..132607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5237"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66464"
FT                   /db_xref="GOA:C6BQV6"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQV6"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6243"
FT                   /protein_id="ACS66464.1"
FT                   /translation="MSRAAQRRHLETADEHQKALVDLIKAFGYRHRASDVFSDFVEMSA
FT                   LSLSNAVDLAQRDGREARYMEIVKKYTKEEVDQFPKMLGHLVLTYERRMTDVLPGSPAP
FT                   VRVAGGFGDVLGHTYMLLELGNDRAGQFFTPYSVSSMMAAMQVNDHDPDVAEHGFITVM
FT                   EPTCGAGGMVIAMAEAMHQAGHNYQTAMHATCIDIDPRCVHMTYVQLALLHIPAVVILG
FT                   NSLMLEEREVWYTPAHVLGGWNRKLAARERSQETSPPVDSERNFVPAEMGTVLSILEAI
FT                   EPPQAPAIIEAVPQQHAEIARQREQLSLF"
FT   gene            132874..134538
FT                   /locus_tag="Rpic12D_5238"
FT   CDS_pept        132874..134538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5238"
FT                   /product="parB-like partition protein"
FT                   /note="KEGG: rme:Rmet_6241 ParB family protein; TIGRFAM:
FT                   parB-like partition protein; PFAM: ParB domain protein
FT                   nuclease; SMART: ParB domain protein nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5238"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66465"
FT                   /db_xref="GOA:C6BQV7"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR022396"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQV7"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ACS66465.1"
FT                   /translation="MQENQQSVTVKLGQIRPGKNPRKYFDPAKMAEITESIREDGVIQP
FT                   VLVRPLEDGTYELVAGERRYRGAKAACGDDYDMPVVIREMTEGEARRLALIENVQRADM
FT                   APSEEAVAAADIVGDLKGDRDEAARQLGWPRSTLDRRLALMNCSPAVLDALNTRSIQLG
FT                   HAELLATLTKEKQDLFLPIILQEKKTVADLKKAIEQAACNLKDAIFDKSECATCAHNSE
FT                   LQSVMFSEAISSGSCTNPTCYKGKTETQLEGISYGLKDEYPVIRIVRAGDNHTRVQLQV
FT                   EGPTGVGAEQAKACHGCQNFGAAVSGLPDSLGKVFRGQCFDPSCNAKKVAARIKAERAE
FT                   APSTVKGPKAAPAKEGADKGGKAEHAATSIAESDKVKTYRQGVWRKALRREVAANEATA
FT                   NHYLLALSLSGHARTITSDKMGTLFERIADETSSPTDLSKNLISVAGLATDKRLNLTIS
FT                   LALAAIEGIDVPVLTSLCKYHALDLTKHWNLQKSKDFLELLTKSELKALADELGMRNAL
FT                   GDRFSKLFNQSKLEVIEALLKVDGFDYTGKVPKVLKF"
FT   gene            134583..135068
FT                   /locus_tag="Rpic12D_5239"
FT   CDS_pept        134583..135068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5239"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5239"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66466"
FT                   /db_xref="InterPro:IPR022273"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQV8"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6240"
FT                   /protein_id="ACS66466.1"
FT                   /translation="MFQELVPLVKASDKVVITLSMQGDEMTVVVAPTVSKPDDAALVAP
FT                   IALTATPAELDAEFANAIGGVTQARQGLAEQVESTKAVIQAATAAQSNKATKALATSNR
FT                   ANPKLPAPKSKGMDDDDDDGVVDVEVTETTSGSTSSSAKDAQGDKKSSGTSLADLLG"
FT   gene            135078..135296
FT                   /locus_tag="Rpic12D_5240"
FT   CDS_pept        135078..135296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5240"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5240"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66467"
FT                   /db_xref="InterPro:IPR022289"
FT                   /db_xref="InterPro:IPR032866"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQV9"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_7095"
FT                   /protein_id="ACS66467.1"
FT                   /translation="MAITINTVKREFSYNGMTLADPGTQFTPDQVRDMYTAQYPELTTA
FT                   AVEGPEYKGENAVYKFVRAAGAKGNHA"
FT   gene            135396..136532
FT                   /locus_tag="Rpic12D_5241"
FT   CDS_pept        135396..136532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:PHG309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5241"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66468"
FT                   /db_xref="InterPro:IPR022283"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQW0"
FT                   /inference="similar to AA sequence:KEGG:PHG309"
FT                   /protein_id="ACS66468.1"
FT                   /translation="MLFDSCQGLSGFSESLTGGAACRFDSPAGHRAADGFLTLPAISQC
FT                   VPAIARLRHTDEGDLTGLIRAHFEAGPLSPRDARSSGNAGDMFAEAMFAWLRRRTPTCK
FT                   RLLFGFALLDQAAARDQVDQFGWETDLSAPLYLAIELPHEQIFEIGARMHPLQRAHPGL
FT                   LCSVMALINEASCNSLFLRTPSYFLEMFARWWWDWDEGVSDENARESLADRLGADSEDI
FT                   ERYLPSNVRPVLAPEEMFPERGKRKGRKGPRRSVLKRSEVLELARSSSRWIQRVCRAML
FT                   QLEDALQRAKGSKLFEHSQWAEPAYSAASIAVFSEEWIGELLDDHFECISNSGEATMYQ
FT                   VLIPLASDPQQVPKQYEDLSRMFEIVKALDQLLTIISR"
FT   gene            136541..137263
FT                   /locus_tag="Rpic12D_5242"
FT   CDS_pept        136541..137263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5242"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66469"
FT                   /db_xref="InterPro:IPR022280"
FT                   /db_xref="InterPro:IPR032787"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQW1"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6237"
FT                   /protein_id="ACS66469.1"
FT                   /translation="MAKILTASRSHDVALQGAILLYGPAEGQFTYSTAHRITHEAGTRK
FT                   PAIGPGVPLNRRALIHAVTQVALSALPKGEFLTPNVLSVSTRAVTWWCPPAIRRVFFQC
FT                   KELGTRSAVVPHPGLVFQAANDGFSVFALMEDVRPTPESMLHEPPYFNTWDVGRICIGS
FT                   AQVPKQIDVASIAGWEEAFFSSAFTHPNRGAQRVKFERGVYAFWKEMLDGNFAEYPKEV
FT                   LIPLKKSLGDLIAGKVGG"
FT   gene            137265..137906
FT                   /locus_tag="Rpic12D_5243"
FT   CDS_pept        137265..137906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:PHG307 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5243"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66470"
FT                   /db_xref="InterPro:IPR018560"
FT                   /db_xref="InterPro:IPR022499"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQW2"
FT                   /inference="similar to AA sequence:KEGG:PHG307"
FT                   /protein_id="ACS66470.1"
FT                   /translation="MHPMDMTLQASFPTIMVPKFGSLTPLSGSGERLLVGTNGVFLEVV
FT                   RPWLRVVRKIASYEVETAVPYGTVNEETELPCGQLPAELVGQFGEMARASMPNETGAWI
FT                   VWNGVSCEFRLVPVAILDHGSGHLRYDRPVLQENEHLVMDCHSHGTFEAFFSGTDNQDD
FT                   RHDVKFAFVLGNCASIRPSMALRLCVKGIFERVHDIPAAWRQKFGIREVV"
FT   gene            complement(137957..138388)
FT                   /pseudo
FT                   /locus_tag="Rpic12D_5244"
FT   gene            complement(138392..138979)
FT                   /locus_tag="Rpic12D_5245"
FT   CDS_pept        complement(138392..138979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5245"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66471"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQW3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66471.1"
FT                   /translation="MPAPGMSSRWDESQDAPKNVARPVGSTVWRGIDAREARDKKAGYS
FT                   MQRNTHQRHVLRTPRQPRAAAAAQHPGRLSMPLRKKKGHPSEDGHVQSSSNSRRLLRLA
FT                   HTRHVPESRPCLRVYRERTRAPRFEIYKHTAVLQRPGAEQCPKQIEGLHCNRLVDDQRL
FT                   LAQRILHRTRRRRVLCIALRINQLRKQVADVR"
FT   gene            139440..139634
FT                   /locus_tag="Rpic12D_5246"
FT   CDS_pept        139440..139634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5246"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66472"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQW4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66472.1"
FT                   /translation="MLLQLPWGSKRWLSRQMTVSGATPDTFEILSKRGREMIEEAKSEN
FT                   APSFFLPPGGSSYCRTRPR"
FT   gene            139886..141961
FT                   /locus_tag="Rpic12D_5247"
FT   CDS_pept        139886..141961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5247"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: fps:FP0707 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5247"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66473"
FT                   /db_xref="GOA:C6BQW5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR017037"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQW5"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACS66473.1"
FT                   /translation="MDYLLGHIWQIVGAIAVISIAAAYRQVLWLFGVIIVPDDSIGVVT
FT                   KKFVLFGSNRSLPDGRILALTGEAGYQADTLAPGLHWALWPWQYAVELKKFVTIPVGKV
FT                   GVVEACDGHPLPSGRILAKRINCDMFQDARQFLEGDGQRGPQIDVIPPGTYRVNPLLFK
FT                   VTLADTITIPPSQIGVVEARDGSPLPAGRVIAKQVVCDSYQDGASFLENGGERGPQSGI
FT                   IAPGSYRINPVLFDVNVAEVVDIPDNKVGIVTTREGKPLGRGEIAGPEVPDHNMFQNPQ
FT                   AFIQNGGCKGLQEQVLLAGRYFINPRFATVDVVDMTEVPIAHVGVVIAYVGNEGRDVSG
FT                   DSFKHANLVSRGEKGVWAEPLDPGKYPINPYTHKIRNVPTANVVLNWAAGKSEAHKLDA
FT                   NLSTITVRSADGFKFNLDVSQIIHIPRNDAPKVIARFGDMSALVTQVLEPTIGNYFRNS
FT                   AQASDIIDFLRERSKRQDDARKAIGDALAEYNVGAVDTLIGDIVPPEQLMQTLTDRKQA
FT                   EQERVTFETQKQAQAVRQELEQATALANTQAKVVDAERQVSISEFNARAAVKQAEGEAQ
FT                   AKTINAEADAKVVRLVGEAEAAKVEAIGTAEASVIKQKIDSMESGNYAVVQVAEALAGS
FT                   GMKLVPDVVATGGSGSGGGTLVEVLLANLIRDGMHKGSGLPLNGESAVKPEALPAP"
FT   gene            141971..142357
FT                   /locus_tag="Rpic12D_5248"
FT   CDS_pept        141971..142357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5248"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66474"
FT                   /db_xref="GOA:C6BQW6"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQW6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66474.1"
FT                   /translation="MNAGRHNIGTEHWRGAGAPFLRQRAKRGLGRLLLTALMSAPSVAL
FT                   VLADQLVSATHELELVLFNTLLASTPGPIAEEVYRAIAGAESTIRVLQRSMFAALVVAT
FT                   GLGAVGVFQVWRGPRKRADEPRRA"
FT   gene            142496..142879
FT                   /locus_tag="Rpic12D_5249"
FT   CDS_pept        142496..142879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5249"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5249"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66475"
FT                   /db_xref="GOA:C6BQW7"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQW7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66475.1"
FT                   /translation="MNPEPKPKKPLRWRILALMVQCAAVAIALNAVLVLFGVISNPAEQ
FT                   RREVDAVTYRILADGYTAGSPVYRAAVRDAVKERGAIMLADRERLMGMWAKAAPVGYGV
FT                   PAAIGPRETERARLLRLVKGESN"
FT   sig_peptide     142496..142591
FT                   /locus_tag="Rpic12D_5249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.398 at
FT                   residue 32"
FT   gene            143199..143624
FT                   /locus_tag="Rpic12D_5250"
FT   CDS_pept        143199..143624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5250"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66476"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQW8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66476.1"
FT                   /translation="MSIANNSTDPQHLLGHLASQPVAAPFKVDLSKPTDLVEAMFGPGA
FT                   KIVHPCDAFARRAGCADWASAVQAMKAGKVLVAQGPKVGKSMMDLMMFIEQVRSEGLHS
FT                   YADDLGRIWLGLKENFPQSVLDRQEQEQHLRDLLIGR"
FT   gene            143877..144041
FT                   /locus_tag="Rpic12D_5251"
FT   CDS_pept        143877..144041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5251"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66477"
FT                   /db_xref="GOA:C6BQW9"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQW9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66477.1"
FT                   /translation="MNAKYALPGLVDAVGSLLWMQVDRYSFSSYWWVSTLIALLVAMAW
FT                   MVADGKAEG"
FT   gene            144057..144353
FT                   /locus_tag="Rpic12D_5252"
FT   CDS_pept        144057..144353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5252"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5252"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66478"
FT                   /db_xref="GOA:C6BQX0"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66478.1"
FT                   /translation="MREHVEMQLGEWFVRLFCKLIALGAAICGAGGFAIIGMRTILPLL
FT                   DDGRYVETACAAIACVAVLYGLTPLALAVDGSLLHAFGMEPLKGLRQDPNQER"
FT   gene            144731..145114
FT                   /locus_tag="Rpic12D_5253"
FT   CDS_pept        144731..145114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5253"
FT                   /product="putative outer membrane lipoprotein
FT                   transmembrane"
FT                   /note="KEGG: rme:Rmet_6233 putative outer membrane
FT                   lipoprotein transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5253"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66479"
FT                   /db_xref="GOA:C6BQX1"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQX1"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6233"
FT                   /protein_id="ACS66479.1"
FT                   /translation="MEVMRRGDAEQVTVVRVRNVTITGDDGYMSASSGMPGLIGAGISA
FT                   FLGGRSIGNGNGRYVAGAVSGAVGGVITQQVSQVLNKRPGVEVIVRTDAGRTLVVTQDA
FT                   TQQFVARERLYMISSAAGFRLTR"
FT   gene            145185..145421
FT                   /locus_tag="Rpic12D_5254"
FT   CDS_pept        145185..145421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5254"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66480"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66480.1"
FT                   /translation="MATPTTDDLAVYRRDHRTLEVFSHLTRGRCSTVFFFEFSSHPSIV
FT                   PFLIPSYMQGITTELIREAGQQFLQREAAVLPV"
FT   gene            145432..145665
FT                   /locus_tag="Rpic12D_5255"
FT   CDS_pept        145432..145665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6920 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5255"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66481"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQX3"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_6920"
FT                   /protein_id="ACS66481.1"
FT                   /translation="MSEQNLIRCTSSKYPNPGEASDALSGSSCVPGFRFGYVDQDHRVV
FT                   VFFDDAHPEKPLPERKGLLRVTARVPLPQLQR"
FT   gene            145847..146227
FT                   /locus_tag="Rpic12D_5256"
FT   CDS_pept        145847..146227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6232 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5256"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66482"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQX4"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6232"
FT                   /protein_id="ACS66482.1"
FT                   /translation="MKIPQSFTRSRCPSNTAAGAILQRDASRVLRRVANDLALRQREYS
FT                   IRTRRQRRRLVDVFALHTDALYFEISHAPADPKVLVRYRTCAGRHDLGGGRNNAVCLES
FT                   LASPEGYSQLLANLRFVAGRRG"
FT   gene            146240..146710
FT                   /locus_tag="Rpic12D_5257"
FT   CDS_pept        146240..146710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:PHG302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5257"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66483"
FT                   /db_xref="GOA:C6BQX5"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQX5"
FT                   /inference="similar to AA sequence:KEGG:PHG302"
FT                   /protein_id="ACS66483.1"
FT                   /translation="MSKLIKVILRSTSGDETSGRAAIQADTDVVVLPNRLVQQIESAKA
FT                   AGEAYVLVAAEDGYEMPLVHVEAATFRLNRKGRARKSLWSVVRSALLAPTRDQRQQYGR
FT                   FAHTLSAAALIGAASYFSGSRAWTLGAVSDVATLIAVTVVLFVVGAVLSKGD"
FT   gene            146713..146808
FT                   /locus_tag="Rpic12D_5258"
FT   CDS_pept        146713..146808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5258"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66484"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66484.1"
FT                   /translation="MTLGMFAAVVTTLIAAYLLWADRRGRQLNND"
FT   gene            146928..147437
FT                   /locus_tag="Rpic12D_5259"
FT   CDS_pept        146928..147437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_6938 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5259"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66485"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQX7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66485.1"
FT                   /translation="MISIRSPECQALAYNCKLDPLGASVLMSLSRVLSSVDPIGSRELQ
FT                   ERAEWAAELAGMQAIDSDRIPVFVADGGSLEMHFRDGRRQGKEDDEYAERHPPTVWFGR
FT                   WRMDFDGLRETRASVAQSPAGYLPGLEVSYQGGDCDVHYGEAVPTLEEAVAVAKERESN
FT                   WHQADD"
FT   gene            147560..147940
FT                   /locus_tag="Rpic12D_5260"
FT   CDS_pept        147560..147940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:PHG301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5260"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66486"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQX8"
FT                   /inference="similar to AA sequence:KEGG:PHG301"
FT                   /protein_id="ACS66486.1"
FT                   /translation="MGHQVVGAGLASFPAGVTIAVQLYTDMHVAVHLHAADDGLRYASL
FT                   STNIRHAPLADDEFAFSSGLVPQDMCQALLHTGAFADTGRVIRSGYATFPIWRIADEQL
FT                   IGQVVAMRVDAAAATKRRRKSH"
FT   gene            148026..149564
FT                   /locus_tag="Rpic12D_5261"
FT   CDS_pept        148026..149564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5261"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5261"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66487"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQX9"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6228"
FT                   /protein_id="ACS66487.1"
FT                   /translation="MYIITINHTKTETRTTMAGVLALLNADKSIPRKFTADSFTVHTVE
FT                   NGPIPVVGLPRGRIGLRPDGTVHEILLHVITEVERIILKPDGKLLRPYEVSFESWEAVL
FT                   AASALAYESEYLIDPERLKEGSLFSEFQVESPQRFITDELLRRFGFGTGGPHAYPGGGA
FT                   CKGHEWHVAYALQRGERVKDCILNFYRHTSTAIPHGLEWLNALIEFPVLRGALPAETLR
FT                   DLCDVLRREKMAMTEQNVSKLLAIVRALPVGSSYIDIDDAFYDAKILGPLTAPTLQLAE
FT                   GPDAEPLSPLAKRVTECVNESVYEKTVARLRQEREDGNLSKRRFELQMMMAERQRNCRN
FT                   YHYGNMIASLLLERNVAGLLEILDQPNNKSSKRAIREVIGVNLLTVTGAARRRAIFSMC
FT                   GFAQQEQDVWEQHAAEAKAEKRRIEAMEQAKKTAESVRYSVGGGQVMTGKQYVDLCIAE
FT                   GFSQIVPSRRGNAVSYLFVDPKRDLGRPLKVKDGTLDYARACLSTPAERVPAYA"
FT   gene            149845..150909
FT                   /locus_tag="Rpic12D_5262"
FT   CDS_pept        149845..150909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5262"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: bac:BamMC406_6512 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5262"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66488"
FT                   /db_xref="GOA:C6BQY0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQY0"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACS66488.1"
FT                   /translation="MDNTLTDQVTPLTNQVSPSQLETLLAAYIPAHLPVLVTGAPGVGK
FT                   SDIAAAAAERAGYDLLISHPVVEDPTDSKGLPFPGADGQSARFLPFGDLERVLHAKEPL
FT                   VWFFDDLGQASQAVQAAKMQLLLARRIGEHKLPEHVTFLAATNRRTDNAGVSGILDPVK
FT                   SRFATIVELVPNVDAWAAWAVKSQLPAELIAFLRFKPDLLVAKERTRDIENLPSPRGWG
FT                   AVGKQMPVVPAGLEAIVFTGAVGAGAATEFQAFRETFRSLPSVASVLFAPDTASIPEEP
FT                   SARIGIATAVASQTTVANIDRVLVYADRMQAGGDGDCATMMISDAIRRDESIVSVPAFI
FT                   AAQSGWIGAAMDGR"
FT   gene            150986..151909
FT                   /locus_tag="Rpic12D_5263"
FT   CDS_pept        150986..151909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_6511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5263"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66489"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQY1"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_6511"
FT                   /protein_id="ACS66489.1"
FT                   /translation="MNILNVHERVMLASLGISVWRARRFDTRATEEVEKNHATKDIGRF
FT                   NKKLLTDDAISYKSVCSIATQARAFFNAHTLEYDQLGVRLLPTAVYLKVADRLREFQDE
FT                   FREATSAFLAEYPALKEQAKGALNGLYTEADYPTLEALSTKFGIRLSPLPFPDASQFGI
FT                   NLPANVLDGIKADMDERVFSAVKTANEDIVGRLYDAVQHFANRLYAGRNVRLGVVDKVR
FT                   ELCDLLPTLNFTQDPALTDILNETRNHLACYTGAELKDSADLRQKVAEKAMEIEAQMAV
FT                   YMTGALSTPAAPALGDSSALSFLLAS"
FT   gene            151919..153136
FT                   /locus_tag="Rpic12D_5264"
FT   CDS_pept        151919..153136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5264"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bac:BamMC406_6510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5264"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66490"
FT                   /db_xref="InterPro:IPR018698"
FT                   /db_xref="InterPro:IPR025154"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQY2"
FT                   /inference="similar to AA sequence:KEGG:BamMC406_6510"
FT                   /protein_id="ACS66490.1"
FT                   /translation="MLERIIKQRGQLVLNHPFFGALALRLKPVEDPTCHTFWVDGRALG
FT                   YNAQFVATLDDLELRGCLAHEVLHPASGHCWRRGNRDQKLWNAACDYAVNPVVLAANLK
FT                   LPKGALLEERFTGKSAEEIYAVLRQERPPEAPQEPQAQGARGTGAGLPSRDPNASDAAQ
FT                   GQGAAEGGNADGSPTYEPGDIRKDRGNDQASTETQWKVAAMKAAQVAKMRGKFGADLQT
FT                   VVDQLVTPAVDWRAALARFASESAQADYSWSIPNRRFTHLGLYLPALHSRRVGDAVFVR
FT                   DSSGSVFDETQRQFASEIHRVFDEVKPSRLIVIDCDARVTQVQVFEPGDALELAPVKGG
FT                   GGTCFAPPFEWVEEQGFRPAFLAYLTDMYGTFPEVPPEYPVLWASTTPLRRIHTPPFGD
FT                   CIEVIV"
FT   gene            153283..153684
FT                   /locus_tag="Rpic12D_5265"
FT   CDS_pept        153283..153684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5265"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B3485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5265"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66491"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQY3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66491.1"
FT                   /translation="MDKEEPIDIESLPRAADLGWIGRWKQAVEEGGTDLGFDDWFESAL
FT                   IGAAGGRDGQPVQYRQGSVIFELQHGADFEIEQGGSAKRRFHCLMDGHVPFVSFYGDGD
FT                   AERRPWISISRLFTAEELHTLILVPGPAA"
FT   gene            153697..153834
FT                   /locus_tag="Rpic12D_5266"
FT   CDS_pept        153697..153834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5266"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66492"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQY4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66492.1"
FT                   /translation="MAKGLMREAAFCGFILNAVNACVRTHPMVGVQTKGAKCPLFLFLS
FT                   "
FT   gene            complement(153859..154146)
FT                   /locus_tag="Rpic12D_5267"
FT   CDS_pept        complement(153859..154146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5267"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66493"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66493.1"
FT                   /translation="MEPVSTLIDWIDCRERKPSPPETPYKEYLVWVVQLLPNAAGGMYL
FT                   LQFSRERNDWMPLPYGPAGAPMVVTHYSEVLDVLGSPDPKPYGPRGREYL"
FT   gene            complement(154267..154956)
FT                   /locus_tag="Rpic12D_5268"
FT   CDS_pept        complement(154267..154956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_7370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5268"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66494"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66494.1"
FT                   /translation="MRKISTLTVALVLLSAAQVADAGRGGAGGSSTASRSAGGISRSAG
FT                   ASKPGTYRPATNSLAQTSTPGARARGTRRSLLEGGAQPSAHLAQVIRERESSGPGWLGT
FT                   AFLVALLSRHDLSDSDRHWLQAKIDALADDEADDQSGLEPPLVPTVTFLYAGLQGNFMT
FT                   GRGSTIRVTAHGTPVNPIPVSCTMPEARISTEGPAAVIVWEPRAPAAYVLTCQAGGQRD
FT                   RRLLKAG"
FT   sig_peptide     complement(154897..154956)
FT                   /locus_tag="Rpic12D_5268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.356 at
FT                   residue 20"
FT   gene            complement(154967..155698)
FT                   /locus_tag="Rpic12D_5269"
FT   CDS_pept        complement(154967..155698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5269"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_6926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5269"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66495"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66495.1"
FT                   /translation="MHLASRYAALIPVAALCLGLAACSDKTTDTAKQINREIETTKTIS
FT                   DPVSALAKLDPLQGSGRDALTGCEVVCGDIVQAMANLDDARTARIKQAMDRLTPAKLAE
FT                   YFEGDSMLPLRDDMAPRILAAAQASTGTAVNSRLLRVAGQIVRDGKYVIRSSDKAAELF
FT                   ARAWLAGDPTAAANNAQLYDSLHDLNNAYLWALRCRAECHPDDGYRPVNAESLRSRLST
FT                   AAIRQAEQAALDPTVLSLAGR"
FT   sig_peptide     complement(155624..155698)
FT                   /locus_tag="Rpic12D_5269"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.599 at
FT                   residue 25"
FT   gene            complement(155709..155801)
FT                   /locus_tag="Rpic12D_5270"
FT   CDS_pept        complement(155709..155801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5270"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66496"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQY8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66496.1"
FT                   /translation="MKITDGVMDRHEMPRFQLFGCLTSRTNKPN"
FT   gene            complement(155858..156241)
FT                   /locus_tag="Rpic12D_5271"
FT   CDS_pept        complement(155858..156241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5271"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   bac:BamMC406_6794 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5271"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66497"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQY9"
FT                   /inference="protein motif:PFAM:PF04519"
FT                   /protein_id="ACS66497.1"
FT                   /translation="MKEQMEISIINEGMAIHGNVDMDHGGSILGLVNGNVVSSGGLLHI
FT                   GPAAVIKGSVTGQFVLIQGAVEGDVNAQVSLKVEGAVKGEIRYAGTIRLGPHANLEGRI
FT                   TRIPRLSAAAPAPPVEDALESST"
FT   gene            complement(156252..156932)
FT                   /locus_tag="Rpic12D_5272"
FT   CDS_pept        complement(156252..156932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5272"
FT                   /product="hypothetical protein"
FT                   /note="KEGG:."
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5272"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66498"
FT                   /db_xref="GOA:C6BQZ0"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66498.1"
FT                   /translation="MDIREIYRLHQQYSHSPVTIDMGTAEDHAAAPALTYAAGGKRRWD
FT                   QHKPALKVTAICCAFIVLATIAGLGLGDLYAKKGRAGSAAAAGPEQVTHAVQTQAPAAP
FT                   ASAPEPAVAANQATPAAIGSSTPSAPVAASVTAAPTAPVAQPQRAALSAAEVAPRERVP
FT                   APEKVETAPAQPAARRTERTAPDQAPVTRPAPAPQPTATAPRAATPPARTTEANRPSGD
FT                   VKMF"
FT   gene            complement(157126..157713)
FT                   /locus_tag="Rpic12D_5273"
FT   CDS_pept        complement(157126..157713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5273"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66499"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQZ1"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6223"
FT                   /protein_id="ACS66499.1"
FT                   /translation="MVAAQHPQELEAPLGAPQPSTSNSGLKPIARLVGENRIKRIVPET
FT                   AASAQVTYSSVYVRDFLRSAYNFCSSKFSVARSGKTRALDEKFREAELWFEKAIAWHAN
FT                   KSQTPIPIETDTVEVQVTHPLSGRLIRLLNQHDRLFALAIFARVANSISALEFEGTMKV
FT                   AGSKIASIHQSCIPDNDRFAADGAQDGDTPAG"
FT   gene            158354..158671
FT                   /locus_tag="Rpic12D_5274"
FT   CDS_pept        158354..158671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5274"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66500"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQZ2"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6222"
FT                   /protein_id="ACS66500.1"
FT                   /translation="MALEMTLQSQIKAQIAELIHARRPKYKDQPYSWKNFCEAAHVASL
FT                   SDAARAAYLNEVTTQRGADAALHLGDRAETLRSKVVQYLNNRSVSCTQSQPTQASRPRA
FT                   A"
FT   gene            158623..159900
FT                   /locus_tag="Rpic12D_5275"
FT   CDS_pept        158623..159900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:PHG292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5275"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66501"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQZ3"
FT                   /inference="similar to AA sequence:KEGG:PHG292"
FT                   /protein_id="ACS66501.1"
FT                   /translation="MHAIPTHPGFATPRSIIEERPLRPPVIGKIRPGIKVLTKKARENP
FT                   QAVQIHDALLAQGLSFEDIGSEIERKTGLSYALIPRNTPYFTCRGSDFTNPAIAEEILT
FT                   RYGEDRGDGLKLWRFPVVFAFDDWLRNIPNELAVFNGTGKVFWSQYGADGLRQCKTYAP
FT                   VERSDRARRAKRIFGGRTIILRQDDAIPDGVCDPQVCPQYQDRHCNLTASFLFAILDIR
FT                   GLGLIELPTNSIYVLQKAHAAMQTVAIARGGRLVGTRFWLSKQEVEISRIDDNGLPVRQ
FT                   KQWLTTLDAEIDLGALLDGADHIGAAIEVGTQTVALLEHPTTEPAATATPTSGEEGGQP
FT                   GAQSEPPVGGSIAEQFERLIVALGMEGQETREHLRVYAHSKFGKGWTKREQDMRALIDE
FT                   MGVALVSPPAFREKVKAEFDGSLFSA"
FT   gene            160022..161434
FT                   /locus_tag="Rpic12D_5276"
FT   CDS_pept        160022..161434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5276"
FT                   /product="DNA repair exonuclease-like protein"
FT                   /note="KEGG: rme:Rmet_6220 DNA repair exonuclease-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5276"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66502"
FT                   /db_xref="GOA:C6BQZ4"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQZ4"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6220"
FT                   /protein_id="ACS66502.1"
FT                   /translation="MPNDGESLHVGHFSDLHYSTERLVEADRCFGFAVEDAVARGCHVG
FT                   IVSGDATDHRLDAHTPALRVLAERIHALSGHMPVLMLQGTFSHEPPGTLDLFRLIGSRH
FT                   PVYVADRIHQVALVGSTFLPSAGPLFTVEELETLLQEGTPSAVFTCVPTVNKAVLAGIV
FT                   GAMDAATAVGEHLTVFLGAAGKVNRLLRSKGIRTIGVSHGTVNGCYTEHGVPMAGFDHE
FT                   FSLGALFEAECDAFMLGHIHAMQLWEREGRLVGYAGSIGCFHYGEKGKKGYLSWQIKPG
FT                   RAEAVQVETPARETVCVDFDGPPDMERLANIAEQTQDKFVRVRWTIDEEHRQLVDREAI
FT                   RTLFAGAAELKLDPRVLPAVRSRAEGISRAATLGEKVQRWCGLTDVKPDALLERLSILE
FT                   ALEPQDIADRVVASLESGSAADNGETVASATAEPVTVQPAWQDADQVQNQSSLDWLTDD
FT                   LFAADAAQPLNV"
FT   gene            161579..162091
FT                   /locus_tag="Rpic12D_5277"
FT   CDS_pept        161579..162091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:PHG290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5277"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66503"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQZ5"
FT                   /inference="similar to AA sequence:KEGG:PHG290"
FT                   /protein_id="ACS66503.1"
FT                   /translation="MILYPAGSQWTRCFEADLPASELAARLVGKHEFTRAMLFQPFGHG
FT                   RGAVIATRGHMLVMAVETDGERTVFTVAPTVQVQNLLWSLSNGYTSQWSEAELKALTAC
FT                   TTFPEVLDLARTQFFAAVRSFERALAGKPEVDVVVTYDDSREVLEIPGDYYMTGFSGEG
FT                   APCDLSN"
FT   gene            162073..164397
FT                   /locus_tag="Rpic12D_5278"
FT   CDS_pept        162073..164397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:PHG289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5278"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66504"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQZ6"
FT                   /inference="similar to AA sequence:KEGG:PHG289"
FT                   /protein_id="ACS66504.1"
FT                   /translation="MRPLKLTLSGFRGILDGMHRDSVTVDLRELPTGLIAVMGPNGAGK
FT                   TTIMDNLHPYPLMPSHASKMSADAFSYWDHLTGTRAEKDLEWEHDGQQYRSQFAFRNSG
FT                   KTRKAEYYLFVLGSDGVWQPVQLADGSLSDGKAETYNRCVESVLGSSEAFFTSVFSAQN
FT                   RRPIAGYQTSEIKKLLAELLGLERMRELSGKAMDVAKCLGRALDVVQHNITSLVGRRDR
FT                   VARLSLEIEQAEASLVETRQARDRELEANAQMVQERATLAAKQASSTVAEARMRELGQQ
FT                   KVAQEARRRTLDNDERAAVQRTEAQAKELGAVISSRRAILASSTAILAAATSRDALQLT
FT                   VTQRQSEAIRLQEGIAQLEKVVPDQSRIIGELQNMAGQGESKAVLEKSLKGQADVIESV
FT                   PCRDNPMHSTCPLLAQARRASTDLTEVRISLAELRTGYRDKLKLKTALDEQLAPLAGQR
FT                   ASLRALQGQVAADQRELQRLTELAAQKPLLDDAQETLAKAERDLVELNAEAAARKERYQ
FT                   RDVVATDDQLATINREVTSLQSADVTGKIADFDRQVASSRERIAQFEGRIEALIRTQTA
FT                   LSTERQGLLVDLEALPVVQRKAERISDEISSWKLLGKALGNDGVIALSIDDAGPEITKK
FT                   VNDLLLACYGPRFTIGIHTQTELANGDKREGFEIRVHDAQADSEKEFAVMSGGQKVWIN
FT                   ECLTRGIALYRAQGAGTAFQTLFTDEADGPLDPERKREFMKMKREVLRQGGYEREFFIS
FT                   QTPDLVDEADAVIDVVALATQ"
FT   gene            164490..164735
FT                   /locus_tag="Rpic12D_5279"
FT   CDS_pept        164490..164735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5279"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cti:pRALTA_0151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5279"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66505"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQZ7"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0151"
FT                   /protein_id="ACS66505.1"
FT                   /translation="MLNGFSHRKKEVHTFIRSLGWMGADVTREKALAAFKASVRVDLSD
FT                   EADMFDHQLVVAMDGLRTFVETDQQALATLFPQFAG"
FT   gene            164893..167826
FT                   /locus_tag="Rpic12D_5280"
FT   CDS_pept        164893..167826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5280"
FT                   /product="transposase Tn3 family protein"
FT                   /note="PFAM: transposase Tn3 family protein; KEGG:
FT                   cti:pRALTA_0655 transposase, Tn3 family"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5280"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66506"
FT                   /db_xref="GOA:C6BQZ8"
FT                   /db_xref="InterPro:IPR002513"
FT                   /db_xref="InterPro:IPR025296"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQZ8"
FT                   /inference="protein motif:PFAM:PF01526"
FT                   /protein_id="ACS66506.1"
FT                   /translation="MPGLEFRYVGRDSLPTRLPEFDVEHYFALTASDVAAINQKFRRAS
FT                   RPGVAIQLVFLRASGRTLDQLNTLPRQLLRYIGEKLAVETPTIASLRTIYQRYPTLYEH
FT                   QVWALQYLGLTRLDDEQWAGLEAWMRQDAAESLTVEELLQHAHYWLYERRILIPSTRAL
FT                   QDLARSIWAGIERDLLAMIDVVVSREQILRAEAAVFAQHATSGTTVLEWLKTPPARHSP
FT                   STMTEMLAKISFLKDLGAHTWTFDAVPIEKQRAYGQRIQARRPAKIRELKASTRTLELV
FT                   FFLRVTLLELTDAMVYQSGRRISDLVRQAYNKTTTKQARSAIEYRQQLVEIKALVDDTR
FT                   RSAEDRLADIGKLLKGLSSRPPASHAASVRETLTEDHHRLRNLLTPLRALEFASHGNDP
FT                   AMRQLDLVGGLHDRGMTELPPDCNVPVSASWRDLVDGEDRQRALRALEASAVMSLRKGL
FT                   RRGTVWINHSLSFRERDQLLIPPAQWEVDRDRHLSSLGLPSQARLYLDRLTEHLKAGLA
FT                   ALDEAREAGHFTIDADGILHLSPLEAQTTDTTPQRTRDLLFKDIGSAQFADMILEMDAR
FT                   TNFSEVLLARKARDAHELVSLYAALIAHGTELDAKGVAAMIPQLDLAHVSTAMRSLEMP
FT                   GRLRRANERVVEFQRTHPITDLWGTGQLASSDSMSLDTSPHLFYARADPRRRTHAAGVY
FT                   THVLDQHGIVYNQPMVLNERQTGAAIEGVMRHNETRADGGLLRLAVDTHGYTNVGMAVA
FT                   KLLGFDLCPWLRNLSERKLYLPRALSVTEGLSAAVSHEVSLKAIRDGWDGLLRLVASIH
FT                   AGRVSAIVALQRFGSAAQGDPIHRAADHLGKLLRTLFLCDFFSNIEFRRELRTLLNRGE
FT                   SVHHLQRAIYMSKVQHERGRRQDEMIAISGALSLLTNLVIAWNTERMQTTVDTWQRKGQ
FT                   RIDDDWLRRMGPAHFAHVNFRGVLSFKIHQFQDALLEAAPRRRASQA"
FT   gene            complement(167926..168888)
FT                   /locus_tag="Rpic12D_5281"
FT   CDS_pept        complement(167926..168888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5281"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   cti:pRALTA_0656 putative cointegrate resolution protein S /
FT                   recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5281"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66507"
FT                   /db_xref="GOA:C6BQZ9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6BQZ9"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACS66507.1"
FT                   /translation="MADIDRYLQAATRDHTRRSYQSAIRHFEQEWGGFLPASADSVARY
FT                   LAEHAQTLSINTLRQRLAAIAQWHVSQGFPDPTRAPHVRKVLKGIQALHPAQERRAKPL
FT                   QLAQLEQLVASLDAQIATASSEGNAHQLQVHTRNKALVLIGFWRGFRSDELSRLQIEHI
FT                   TVEPGRGMTIFLPRTKTDRNHVGTTHKAPALSRLCPVAAYEAWLAASGLTEGPAFRRID
FT                   RWSRIAADGLQASSIVPLLRALLHRAGLPQSDRYSSHSLRRGFATWANSNQWDLKMLME
FT                   YVGWKDVRSAMRYIDAADPFAQHRIETALSVAPRPGIAV"
FT   gene            complement(168913..170841)
FT                   /locus_tag="Rpic12D_5282"
FT   CDS_pept        complement(168913..170841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5282"
FT                   /product="iron permease FTR1"
FT                   /note="PFAM: iron permease FTR1; cytochrome c class I;
FT                   KEGG: rme:Rmet_5945 iron permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5282"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66508"
FT                   /db_xref="GOA:C6BR00"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR00"
FT                   /inference="protein motif:PFAM:PF03239"
FT                   /protein_id="ACS66508.1"
FT                   /translation="MQLQRVVTLILFYLLTSVSSAYADTLSTQDKTKQVWQLLDYLAVD
FT                   YGRSVKDGQVANADEYAEMQEFAHAAQRQIAELPAGPQTQALLKDAGALRTLIADKAAP
FT                   TVVGEQAHKLADSLLAAYPVPMAPSKVPDLKHGATLYQSQCASCHGNTGHADGPLAAKL
FT                   SPPPIALADHQRAQERSVFALQQIITRGVEGTSMPSFAQLTDDDRWALAYFASTLSYSD
FT                   ADRQAGAKLWASRPELHSAVPTLAKLSQTPEALLAKTISPDAARQLTAYLRSAPDVLNA
FT                   SNADSLAIAKDKLKESVAAFDQGDKATASRLALSAYLDGFEPVEPALAAKNQSLFQDIE
FT                   KMMGLYRNAITTGQAEQVRDIAQHLQTMLTEAQDALGGTNDPLSTFLGALTILLREGLE
FT                   ALLVVVAMMAFLKKAERTDVLPYVHAGWIVALAAGGLTWAVATYLVDLSGASREMTEGF
FT                   SAIFAAVVLLGVGMWMHQKSLAGRWQAYVKQKLSSALNKRSAIMLFVLSFVTVYREVFE
FT                   TVLFYAALWSEGNGIYLLAGLGSGIAILAIIAVVLLRSSARLPIRQFFAFSSALVAVLA
FT                   VVLIGKGVAALQKVGFLHITPISMPRIDVLGIYPSMQTVIAQVAILLIIVLSFAYNLRS
FT                   QKASSKA"
FT   sig_peptide     complement(170770..170841)
FT                   /locus_tag="Rpic12D_5282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 24"
FT   gene            complement(170986..171417)
FT                   /locus_tag="Rpic12D_5283"
FT   CDS_pept        complement(170986..171417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5283"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: grail3.3073000201; .; TIGRFAM:
FT                   Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM:
FT                   Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5283"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66509"
FT                   /db_xref="GOA:C6BR01"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR01"
FT                   /inference="protein motif:TFAM:TIGR02047"
FT                   /protein_id="ACS66509.1"
FT                   /translation="MNIQIGEFAKRTACPIQTIRYYEREGLLPPPDRSSGNFRLYSERH
FT                   IERLQFILHCRSLDMPLNDVRTLLRYRERPDEDCGAVNTLLDKHIEEVERRIEALGVLK
FT                   HHLCALRETCSDGRAAEACGILQGLSEGSGTCTGDGTHR"
FT   gene            171505..173907
FT                   /locus_tag="Rpic12D_5284"
FT   CDS_pept        171505..173907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5284"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; cadmium-translocating P-type ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: ajs:Ajs_1242 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5284"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66510"
FT                   /db_xref="GOA:C6BR02"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR02"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACS66510.1"
FT                   /translation="MSDCGSKGCGCAATNVVTPADGDAAAVDLKRSRYRIDNMDCPTEE
FT                   TLIRNKLAALPGVVNLEFNLMQRSLAVQHRLPSPAPIEQALAAVGMRAVRADESPAGQS
FT                   TVLTIRQMDCPTEETLIRGKLAGMAGVSDMQFNLVQRTLAVQHAADALPQVLAAIQSLG
FT                   FDAEVRDRSAAAPLPEQDAAPTKWWPLAIAGANAVLAEVVYWLNGGNHWVVVILALAAI
FT                   LTGGLSTYKKGWIALKNRNLNMNALMSIAVTGAMVIGHWPEAAMVMVLFALAEVIEARS
FT                   LDRARDAIRGLMDLAPETATVQRSDGSWSDVDAKTVAVGSRVRVKPGERIALDGTILQG
FT                   RSSVNQAPITGESLPVEKAAGDSVFAGTINESGSFEYRVTAAASDSTLARIIHAVEAAQ
FT                   GSRAPTQRFVDQFARLYTPIVFAVALAVAIVPPLVFGATWLDWIYKALVLLVIACPCAL
FT                   VISTPVSIVSGLAAAAKRGILIKGGVYLEEGRKLKWLALDKTGTITHGKPAQTDVVAWN
FT                   GADASAAQILAASLAARSDHPVSLAVARAAQDQGLALRDVTDFAALPGRGVRGHVNGAL
FT                   YHLGNHRLVEELGVCSPALEAQLAVLETQGKTVVMLIGQDGVRALFGVADTIKDSSRQA
FT                   IKELHALGIKTLMLSGDNPHTAEAIAQQVGIDEARGNLLPEDKQREIERRSAQGTIGMV
FT                   GDGINDAPALARADIGFAMGAAGTDTAIETADVALMDDDLRKLPAFVRLSRSTAGVLKQ
FT                   NIALALGIKVVFLALTFTGQATMWMAVFADMGASLLVVGNGLRLLRK"
FT   gene            173904..174509
FT                   /locus_tag="Rpic12D_5285"
FT   CDS_pept        173904..174509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5285"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; SMART:
FT                   phosphoesterase PA-phosphatase related; KEGG:
FT                   shn:Shewana3_4320 signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5285"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66511"
FT                   /db_xref="GOA:C6BR03"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR03"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACS66511.1"
FT                   /translation="MNWKFLVYDWGGWNVALFHAINSGMPSALDPVAWCFSLIGNYWTA
FT                   PLLLLGLWRWSISASNPARACAVRQRLVTFGLAFALALLAASALKWWLDFPRPPAVLGH
FT                   LVHVIGEPELHYSLPSGHSTFAALVVGALWPLVGFRGRLALVFYAALVGWSRVAAGMHF
FT                   PADVVAGWMLGASSVAIAGLLRSALMSRQGALVKGLSG"
FT   gene            complement(174561..174899)
FT                   /locus_tag="Rpic12D_5286"
FT   CDS_pept        complement(174561..174899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5286"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS05404 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5286"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66512"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR04"
FT                   /inference="similar to AA sequence:KEGG:RS05404"
FT                   /protein_id="ACS66512.1"
FT                   /translation="MNYVSAVVFALTLASTPAAFAATPMEGMDMKPAGQTKQAPKPVAA
FT                   EVRKIYLDTGKVTLKHGAIDNLGMGAMTMTFAVKDKASLQHFKEGQAVWAVFDMVDGQP
FT                   TVVDLRSK"
FT   sig_peptide     complement(174834..174899)
FT                   /locus_tag="Rpic12D_5286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(174896..178063)
FT                   /locus_tag="Rpic12D_5287"
FT   CDS_pept        complement(174896..178063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5287"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: rso:RS05405 cation
FT                   efflux system transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5287"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66513"
FT                   /db_xref="GOA:C6BR05"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR05"
FT                   /inference="protein motif:TFAM:TIGR00914"
FT                   /protein_id="ACS66513.1"
FT                   /translation="MIARLILASIRNRFLVLLATVMLTAWGLWAARSTPLDALPDLSDV
FT                   QVIIRTPFPGQAPQIVENQVTYPLTTTMLSVPGAKTVRGYSFFGDSFVYVLFEDGTDLY
FT                   WARSRVLEYLNQVQSRLPAAAKPALGPDATGVGWIYEYALVDKTGRHDLAQLRALQDWF
FT                   LRFELKALPNVAEVASVGGMVKQFQVVLQPDRLRAFNLTQAKVLAALKGANQETGGSVL
FT                   ELGEAEYMVRASGYLKTLDDFRQIPLMTNDAGIAVHLGDVATVQLGPEMRRGIAELNGQ
FT                   GEVAGGVVILRSGKNALETIEAVKAKLATLRTSLPEGVEIVPVYDRSGLIKRAVDNLTH
FT                   KLIEEFIVVAVVCLVFLFHLRSALVAIVSLPLGVLAAFLVMRYQGVNANIMSLGGIAIA
FT                   VGAMVDAAVVMIENAHKHLEHWLEDNPGRELTGHERWNVIGESAAEVGPALFFSLLIIT
FT                   LSFIPVFTLEAQEGRLFSPLAFTKTYSMAAAAGLSVTLVPVLMGYLIRGRIPSEQSNPL
FT                   SRWLIRLYQPMLSKVLAYPKATVAIAIVLLGATAWPILRTGGEFMPPLDEGDLLYMPSA
FT                   LPGLSAGKAAQLLQQTDRLIKTVPEVASVYGKAGRADSATDPAPIEMFETTIQFKPHDQ
FT                   WRPGMTTDKLVEELDRVVKVPGLSNIWVPPIRNRIDMLATGIKSPVGIKVAGTDLKEID
FT                   RLTTRIEETVKTVPGVTSALAERLSGGRYIDVDINRQAAGRYGLNIDDVQSIVSSAIGG
FT                   DNVGEVVDGLARFPINLRYPRDYRDSVEQLRRLPIVTDRGQQIVLSDVADIRVVQGPPM
FT                   LRSENARLSGWIYVDIRGRDLRSAVKDMQAAVTKAVPMPAGYALSWSGQFEYLERASAK
FT                   LQVVVPFTLLIIFVLLYLVFGRIDEALLIMGTLPLALIGGFWLLYLLGYNLSVAGVVGF
FT                   IALAGVAAEFGVIMLLYLKHAWTERQENGQTSTQALLEAIQEGAVLRVRPKAMTVAVIL
FT                   AGLLPIMWSDGTGSEVMQRIAAPMVGGMITAPLLSLFVVPAVYLLLRRRGSGQSIPQPP
FT                   SHDKVSR"
FT   sig_peptide     complement(177971..178063)
FT                   /locus_tag="Rpic12D_5287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.824 at
FT                   residue 31"
FT   gene            complement(178060..179610)
FT                   /locus_tag="Rpic12D_5288"
FT   CDS_pept        complement(178060..179610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5288"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; KEGG: reh:H16_A2186 cobalt-zinc-cadmium resistance
FT                   membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5288"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66514"
FT                   /db_xref="GOA:C6BR06"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR06"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACS66514.1"
FT                   /translation="MNRTIFARIAASLVLASLGMGATYYLGVRQGQRSAPTQAAASAQA
FT                   ADAPLKAGDIDPKTGKRILYWQDPMAPGQRFDKPGKSPFMDMPLAPVYENGAGGSAAVT
FT                   VDGRVAQNLAVRTAEVKTGRLDAMLEVPGNIAINERGIEIIQARAAGFVERAYAKTTLD
FT                   PVKRGQPLIVVYAPEWVAAQEEYLAVSRTANALQGDLRSAALLRMRQAGMTEAQIRLVE
FT                   STGKPQPRLAISSDIDGVITEVGVRDGMAVAPGMTLFKIADLSTVWVLAEIPESQASAI
FT                   RPGQAVTATATAIAGHALTGKVDAILPDVNANTRTVKVRVELQNRDRRLLPGMFANVRF
FT                   GAQAGPDKLLVPTEALIRTGTRTIVMVDAGNGGFNPIEVKTGAEANGQTEVTDGLSAGQ
FT                   KVVVSGQFLIDSEASLRGTAQRMASPPAASAPAAAAIEHEGVGRIEAVTSEGLTISHGA
FT                   IPSAHWSAMTMDFAAPPSGLPKRFKPGDRVRFRFQLHDDGMAVLSSVEPAGADQGGKP"
FT   sig_peptide     complement(179545..179610)
FT                   /locus_tag="Rpic12D_5288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.675 at
FT                   residue 22"
FT   gene            complement(179607..180911)
FT                   /locus_tag="Rpic12D_5289"
FT   CDS_pept        complement(179607..180911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5289"
FT                   /product="outer membrane efflux protein"
FT                   /note="KEGG: rme:Rmet_6134 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5289"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66515"
FT                   /db_xref="GOA:C6BR07"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR07"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6134"
FT                   /protein_id="ACS66515.1"
FT                   /translation="MLLRFPPRGGRLLALAVLLLLSSHLAYSQTDALSLQEAIGLASSR
FT                   SADAETSRAGVQSALDMAVAAAQLPDPVLKFGVNNVPADGSDRFSIGTDFMTMRSVSVM
FT                   QELTRTEKRRARAERFNAEASAAETQRVAALAAVQRSTAQAWLDRWYAARTVQLLAEQT
FT                   ASVALQVEAAEAAYRGNRGSRADIVAARLERQQLQDRTDEARATEASAKAMLRRWVGDA
FT                   SSRPPAAPPRFDVPQWLDALDDAAIDTLPDVAAASAQAAMADAEGRVSRAAKTPDVTVE
FT                   LMYSQRGPAYANMVSLNVSLPIPWDQKNRQDREVSAKLAQANAARAQAEVLRRNMVGQI
FT                   LGKRETLRLNQRRLDRYQTTTVPLARAQTEAALTSYRTGSGSLAAVAEASRKALDLALE
FT                   RLKLEASTAQLWAELAFLKPLPTANQPTSNVGVQP"
FT   sig_peptide     complement(180825..180911)
FT                   /locus_tag="Rpic12D_5289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 29"
FT   gene            complement(180983..181276)
FT                   /locus_tag="Rpic12D_5290"
FT   CDS_pept        complement(180983..181276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5290"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RS05408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5290"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66516"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR08"
FT                   /inference="similar to AA sequence:KEGG:RS05408"
FT                   /protein_id="ACS66516.1"
FT                   /translation="MADATDAGAMVQSCPEMAMQAQQDVHQHDGLCLEHCQSGTKSANH
FT                   VSPQIPIFLPVLIRMITAEPVIMADGQSVLLADVAPRAPPPPIPILNCCFRT"
FT   gene            complement(181553..181753)
FT                   /locus_tag="Rpic12D_5291"
FT   CDS_pept        complement(181553..181753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B1270 hypothetical membrane associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5291"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66517"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66517.1"
FT                   /translation="MKKVILSAVGLAAVLTSLTAIAGPDWQVIEKARNAKLAQIRAAQA
FT                   QKSAGMPAMPQPCQDMIQAPK"
FT   sig_peptide     complement(181685..181753)
FT                   /locus_tag="Rpic12D_5291"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(182360..182860)
FT                   /locus_tag="Rpic12D_5292"
FT   CDS_pept        complement(182360..182860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_7265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5292"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66518"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR10"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_7265"
FT                   /protein_id="ACS66518.1"
FT                   /translation="MTNNKHVGFLVAGALLIASASVWAVDEHHPAAASQPSAATPAKTA
FT                   PATANSADTEKRFEQARQQMKKMQAQMDKIHQTKDPKERQRLMAEHMQAMQDTMQTMHG
FT                   MGGPMMMDMMGGQGMGAGGAAPMMGGSGMPMEQRMNMMENRMDMMQMMMDQMLKQQEPS
FT                   KKP"
FT   sig_peptide     complement(182786..182860)
FT                   /locus_tag="Rpic12D_5292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            183046..185499
FT                   /locus_tag="Rpic12D_5293"
FT   CDS_pept        183046..185499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5293"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: reu:Reut_C6196 ATPase, E1-E2
FT                   type:copper-translocating P-type ATPase:heavy metal
FT                   translocating P-type ATPase; TIGRFAM: heavy metal
FT                   translocating P-type ATPase; copper-translocating P-type
FT                   ATPase; ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC; PFAM: E1-E2 ATPase-associated domain protein;
FT                   YHS domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; SMART: TRASH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5293"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66519"
FT                   /db_xref="GOA:C6BR11"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR11"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACS66519.1"
FT                   /translation="MPSDSIGHHRGDQVVGRQSALRIAQPVVDAGRVRDPVCGMEISPA
FT                   QAAASTEVGHQRYWFCSRHCEKTFLADPARYLSHDAHDAHDHDGAAHDHAPTGVAAVSA
FT                   STKQLAKDPICGMMVDKATALSAERGGRKYYFCSESCLHTFESPESELKAMKTRVTIAL
FT                   TGVLALAVLRAGAFLALAAGATLLTWAPIPALPWFTWGIWLFLLVTPVQFIGGWSFYKG
FT                   AWNAVRTRNINMDFLIALGTSVAYFYSVVVLFFPSWLPVKVAERDVYFEVSAVIIAFVL
FT                   LGKYMEEIIKKKSSAAVRRLLDLKPAVAHVIRDGKEVEIPAESIMVSELVVVRPGEKIP
FT                   TDGKVTDGQTSVDESMLTGESMPVDKKPGATVIGGTLNRSGAFTFQATRIGADTALAQI
FT                   IKMVEDAQASSAQIQRLADQVTGYFVPAVVGVALLAVIGWTLAGHFPQGLLAFIAVLII
FT                   SCPCALGVATPAALMVGVGKGADAGILIRGGEVLERAEKLTTVVFDKTGTITRGEPTVT
FT                   DILPLGTHQEAELLSIAAAVESGSEHPLGEAIVRAAQHRELATRKANNIQALSGMGIQG
FT                   AIDGQQAWLGNRRMLAQQAISVDTIEATLAGLEADGKTAMLAGIGHELLGIIAVADTVK
FT                   PEASEAIAMLKSRGIKVVLLSGDNQRTAQAIGRQVGIERVIAEVMPEDKVKTIQGLQKD
FT                   GEVVAMVGDGVNDAPALAAADIGVAIGSGSDVAKETGSIILIRNDVRDVAASIELSRAT
FT                   MRKIKQNLFWAFFYNTIGIPVAAFGLLNPILAAAAMSLSSLSVVANSAMLKRVRLTSKA
FT                   QEVPA"
FT   gene            185496..185714
FT                   /locus_tag="Rpic12D_5294"
FT   CDS_pept        185496..185714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5294"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5294"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66520"
FT                   /db_xref="GOA:C6BR12"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR12"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66520.1"
FT                   /translation="MKPAVWFCAAVATALAAAILYWYGISLFSVLVALILLACPVWVIW
FT                   MSLRLSRQTRREVEAAVERELKSRRKS"
FT   sig_peptide     185496..185546
FT                   /locus_tag="Rpic12D_5294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.431 at
FT                   residue 17"
FT   gene            185729..186028
FT                   /locus_tag="Rpic12D_5295"
FT   CDS_pept        185729..186028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5295"
FT                   /product="YHS domain-containing protein"
FT                   /note="KEGG: bvi:Bcep1808_7285 YHS domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5295"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66521"
FT                   /db_xref="GOA:C6BR13"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR13"
FT                   /inference="similar to AA sequence:KEGG:Bcep1808_7285"
FT                   /protein_id="ACS66521.1"
FT                   /translation="MTWLSQNLIWIVLGGLVVVFLWRSQAMRSRGGEGAGMMHGAPDAN
FT                   SDPVTGNRVDPTHAITANFEGKTFYFESEQSRAVFQQNPSRFVHQHHRHHGGCC"
FT   gene            186073..186324
FT                   /locus_tag="Rpic12D_5296"
FT   CDS_pept        186073..186324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A1977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5296"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66522"
FT                   /db_xref="GOA:C6BR14"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR14"
FT                   /inference="similar to AA sequence:KEGG:H16_A1977"
FT                   /protein_id="ACS66522.1"
FT                   /translation="MNDQMNPEDGPHAAHRTVFRSRWVLIGFLLVIAYFLFTEHRAHVI
FT                   PFLPFLLLATCPLMHLFMHHGHQDEGGEPSTHVHPKGE"
FT   gene            186327..186989
FT                   /locus_tag="Rpic12D_5297"
FT   CDS_pept        186327..186989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A1978 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5297"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66523"
FT                   /db_xref="GOA:C6BR15"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR15"
FT                   /inference="similar to AA sequence:KEGG:H16_A1978"
FT                   /protein_id="ACS66523.1"
FT                   /translation="MQHDTQSGYGLWSLVIINSAIFIIFAFSFTKPKTSRDWRSFGAFS
FT                   AFLVALFTEMYGFPLTIYLLLPWLSKHFPGIDFLSHDAGHLLEVMFGWRANPHFGPFHI
FT                   LSNLLIFGGFIMLASAWRVLYLAQQQHRLATGGLYTRMRHPQYVAFVLIMLGFLLQWPT
FT                   LLTLIMFPVLVWMYVHLALTEERDALAEFGRAYEAYCERTPRFIPRWSSGASKASSH"
FT   gene            complement(187405..189288)
FT                   /locus_tag="Rpic12D_5298"
FT   CDS_pept        complement(187405..189288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_1470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5298"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66524"
FT                   /db_xref="InterPro:IPR024501"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR16"
FT                   /inference="similar to AA sequence:KEGG:Ajs_1470"
FT                   /protein_id="ACS66524.1"
FT                   /translation="MTDRTVQRKRRPARSAPGVAAPALRLVSEPDHQAEPQPAPAEPPL
FT                   EQGWDYWVDVTQRWILFIDILRQRANNMLAHEEAGLPPPLHFDYELLLDARTFERPANY
FT                   ALLRITRCGTDHLERQVRADATPVIVIDPRAGHGPGIGGFKRDSEVGMALAEGHPVYFV
FT                   SFFPAPCRGQTLGDVLNALRTFVEEVARRHDGQAPVLYGNCQAGWEVMLLSAHCCERVA
FT                   CPAVLNGSPLSYWSGEAGVNPMRLLGAFTGGVWSANFLADLGNGRFDGAWLVQNFEALK
FT                   PESALWTKLYTVFADPDGEGDRFLEFERWWNGFYFLSREELVATIQDLFVGNKLETGEV
FT                   HVDGKCTVDLRRICKPIVIFASYGDNITPPHQALGWIPVVYESTEALVAAGQRIVYLTN
FT                   PHVGHLGIFVSASVARHEHRAILQSLDAIEALPPGLYEMKLSEHSDAPPQNNSQRGVTF
FT                   EPRRVEDIQFPYPRALFEHVRAVSEINERLYDQFWSPTVRALATPWSAEWLKWSHPMRW
FT                   TRYAWSERFQPWLLLVAAMAAGVRASRRKAGEDNIWRASEEALSATLTHTLETGRSVRD
FT                   LVAETAFQWLYGPSWPYSFAQSYIPASDHRDCDVGEATVRQACSACDTDVR"
FT   gene            complement(189475..189720)
FT                   /locus_tag="Rpic12D_5299"
FT   CDS_pept        complement(189475..189720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_2269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5299"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66525"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR17"
FT                   /inference="similar to AA sequence:KEGG:Daro_2269"
FT                   /protein_id="ACS66525.1"
FT                   /translation="MNRKTILSALLLATAASMSAGVFATDNDMPMASEASGAHKMKPHS
FT                   HVAEKAGASAASAPAAAPAEDTKGRDKSKHFHPDTK"
FT   sig_peptide     complement(189646..189720)
FT                   /locus_tag="Rpic12D_5299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            190211..190435
FT                   /locus_tag="Rpic12D_5300"
FT   CDS_pept        190211..190435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: smd:Smed_0214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5300"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66526"
FT                   /db_xref="GOA:C6BR18"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR18"
FT                   /inference="similar to AA sequence:KEGG:Smed_0214"
FT                   /protein_id="ACS66526.1"
FT                   /translation="MMVHGFDMAGYGLAHWITFAVMAVVLLYPIGRILMRIGLSPFWAI
FT                   LVLVPFFNLIGLWVLAFVEWPRQGSGRPG"
FT   gene            190475..191248
FT                   /locus_tag="Rpic12D_5301"
FT   CDS_pept        190475..191248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vpa:VPA0557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5301"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66527"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR19"
FT                   /inference="similar to AA sequence:KEGG:VPA0557"
FT                   /protein_id="ACS66527.1"
FT                   /translation="MVRKAIPSLVSACLVAFAAACMVGGAWAEEPDGRTLVDRVDTLLW
FT                   GKTLQGEFQMTITTPRWQRALDLRAWMERPRRSFIRVLAPAKEAGIGSLRIGSEMWNYL
FT                   PNIERTIKIPPSMMLQPWMGSDFTNDDLVKQSSAVDDYTHRVLRTEVLNGAASYVIESI
FT                   PKPDAAVVWGKILYWIRQADTIPLKQYYYNERNELVRVLTFSDVGPMGGRTIPTKWEMR
FT                   PVNDPGHATVIVVKAARYDQPIDDERFTQRNLQKP"
FT   sig_peptide     190475..190561
FT                   /locus_tag="Rpic12D_5301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            191245..191949
FT                   /locus_tag="Rpic12D_5302"
FT   CDS_pept        191245..191949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5302"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: pca:Pcar_2375 ABC-type transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5302"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66528"
FT                   /db_xref="GOA:C6BR20"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR20"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS66528.1"
FT                   /translation="MNAAADTVVKLVGVSRLYRQGASVVHALQHINLEIRKGDFAVLVG
FT                   PSGSGKTTLLNVIGGLDSPTEGHVWVDGSEIGTLGKAALSDIRLRKIGFVFQEFNLIPV
FT                   LSALENVEFVMLLQGVPEMQRRDRAMTLLKELGLEGMEHRRPQQLSGGQQQRVAVARAI
FT                   AAEPIIVLPDEPTANLDSKAGAALMDMMKAMNERRGVTFVFSTHDPMVVERARRVIRLR
FT                   DGRIEADERRPP"
FT   gene            191946..194438
FT                   /locus_tag="Rpic12D_5303"
FT   CDS_pept        191946..194438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5303"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   pca:Pcar_2373 ABC-type transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5303"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66529"
FT                   /db_xref="GOA:C6BR21"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR21"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACS66529.1"
FT                   /translation="MMLLPLAVRNVLRNRRRSAITISSIAIGLAAMIFNWGFTAGMNRE
FT                   MVENTTRYFAGDAQVHLKGYHDDPILDLAMPDSAPILHAVRNEAGVAAASIRLETKALA
FT                   SRGDKSRGLMLVGVEPADEAQVTMLSDAIVAGQPLTTGAPGVLIGEMLAEALAVRPGQN
FT                   IVFVGQGYDGSISSGKYPVRGIFRSKIDDLDGYVAVMPLPVVREFLSAPGGATAIALRL
FT                   RERSRLEPVSAGLAERLGDRYEVVGWPRLLPMVAVSSRFHEVTTYVVLLVFFVVVVFAV
FT                   ANPVLMSVMERTREFGIMLAVGMSRTRVLRLVLYESILLGIVGLIVGNAVGWTVTAYFA
FT                   RAGIHLHGFEAGLRTMPGLSDVVYPVVSAERGVVLSVAVFVIAGLAALYPAAKAVQLRP
FT                   IEAIRGLPAAMRVSSRNTGDSRLPVFVLLALRNLLRNPRRTALMAAGAAFGIVGFVFIL
FT                   GFFDGFFDQTIENSTRYLTGHIQVERKGFRKDYAPELAIDDAVSLLQAVRGTPGVIAAA
FT                   PRTQVQALASTASKSEGIMLIGIDPVAEAKVTFISRTVVQGRALIPGADREVMIGRRLA
FT                   DKLGVRLGEKIVVMAQAANGELGTAAYGVGGIFSTESASFDGAFAFVTLPAAQSLLALG
FT                   SRVSTINVRLEDRAHVSAAVALLRARIGGTDVTLIPWQELLPQLEDMVRLLRVVSSIIL
FT                   AVLLLVITTSVINTVFMAVTERTREFGVMLALGTSPAALRRMVVYESIALLLIASAVGY
FT                   GAGIALVLYLGHAGMDLSSFFAGYSAIPGLTGIVYPRIFGATVVPPGIALLIAGVLVSL
FT                   YPAAKAARLDPVQAIRHV"
FT   gene            194431..195576
FT                   /locus_tag="Rpic12D_5304"
FT   CDS_pept        194431..195576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vpa:VPA0561 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5304"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66530"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR22"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66530.1"
FT                   /translation="MFKQAVPFGLLAALAFGASAQETSQSGLKFSGYYKSLLEESETIV
FT                   PGGQRYLLDLNRLRLQLQGKLSEHVAVDLQYDNELLFGSYLHTAQFASQSSLAPDQYLD
FT                   LDGNYLRGGSYYGQHRLYRGNVTLSSGDTDVRIGRQRIAWGTGRFWSPLDLLNPLNPTA
FT                   IEREERVGVDAVLAEHKLGPISRISAVYAPGHGGADSSAAFNWHANTHGVDYSIVGGRF
FT                   GNEQVAGFDLAGQIGTAGIRGEFTQVRAKTGSTYQRAVLALDYAFANTLTLSAELYYNG
FT                   AGTTNAAAYDFTSLLTGKIRSVAKHYAGGYMSYEITPLLKWEGYVVVNLDDHSRFVSPL
FT                   LTYSIKTNLDWQIGAQFFMGSSGSEFGHFHHIYYTQIQWFF"
FT   sig_peptide     194431..194493
FT                   /locus_tag="Rpic12D_5304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            195673..197370
FT                   /locus_tag="Rpic12D_5305"
FT   CDS_pept        195673..197370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5305"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: bvi:Bcep1808_7271
FT                   2-octaprenylphenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5305"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66531"
FT                   /db_xref="GOA:C6BR23"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR23"
FT                   /inference="protein motif:PFAM:PF03109"
FT                   /protein_id="ACS66531.1"
FT                   /translation="MGVITHANPEPAVRERVPAELPRLLYILRALAGAGWAHYVERLRI
FT                   GRDALEASVEAVQATDQDAKRLRATLEGLGPAFVKFGQLLSLRRDMLPEVYIEELQRLQ
FT                   DDVAVFPGEQAREIVERELGKSVHALFTSFDETPLAAASIGQVHTAQLIDGTSVVVKVQ
FT                   RPGIEPIIHADVRIMRFLARQLERYVPESRRFGPGDLVEEFARLINEELDYQVEARNGD
FT                   LLRENLQDDKHVFVPRIFWEQTSRRVLTMERSFGKKLTHIPSSEQESRRRVAQALMASF
FT                   LKQVFEDGFFHGDPHPGNVFLLEDGRLCFHDFGIMGRLSAYDQEALAQLILAVSSGEVS
FT                   WMVDAYFEMGVATEGVDREAFTRDASQALDAYYEAAGKGYSFGEIVRQFALLSQRHRIK
FT                   LPRQFLLVSKAFMLVESQALTLAPDFNALASLREYAPHLLGRKLLQGANVQTEFSRGFR
FT                   TLRALHHAAALLPDILNRTVEALSSGKATLHIKHDQLQGLEAHIDRASNRLSLSLIIAS
FT                   VVIGSSIVMAFHSGPHYAGIPVLGLLGFVVASVMGLAWAVAILRSGKF"
FT   gene            complement(197421..198605)
FT                   /locus_tag="Rpic12D_5306"
FT   CDS_pept        complement(197421..198605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5306"
FT                   /product="Methionine adenosyltransferase"
FT                   /EC_number="2.5.1.6"
FT                   /note="PFAM: S-adenosylmethionine synthetase (MAT); KEGG:
FT                   reh:H16_A1975 S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5306"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66532"
FT                   /db_xref="GOA:C6BR24"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="InterPro:IPR042543"
FT                   /db_xref="InterPro:IPR042544"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR24"
FT                   /inference="protein motif:PRIAM:2.5.1.6"
FT                   /protein_id="ACS66532.1"
FT                   /translation="MRTVGEIALSISTTSTLEATQTEIAEHKGFGHPDSLCDGAVEAAA
FT                   CALSRAYLQAYGAIQHFNLDKALLIGGISQPRFGGGKVLRPARLIVCGPVTELPSASAT
FT                   SLVEQSIREYLVATLGKAGNDIGIELVLRPSAPNLQRVIQQAALPLANDTSFGVGYAPR
FT                   SRLEDTVLCAARVLRSNEFRSAFDAAGADFKIMGHRLGAHFGLTVALALVDRDVGSIED
FT                   YFTLKGRLAAYLAGCLPTACHIGINTLDDPATLDESGIYLTVTGLSAEHGDDGEVGRGN
FT                   RVNGLITPYRPMSLEAAAGKNPAAHVGKLYNVLAHRLAASIHADIEGVDEVTVRLLSAI
FT                   GHPVDQPQLVAIDLAAAGGFSAARQRQVRELTAQHLAALPALIRELATGAIAVF"
FT   gene            198860..199483
FT                   /locus_tag="Rpic12D_5307"
FT   CDS_pept        198860..199483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5307"
FT                   /product="LemA family protein"
FT                   /note="PFAM: LemA family protein; KEGG: reu:Reut_C6198
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5307"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66533"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR25"
FT                   /inference="protein motif:PFAM:PF04011"
FT                   /protein_id="ACS66533.1"
FT                   /translation="MRAAWSVVVAVILAISLSGCGYNTIQAQDEQVKAGWSEVVNQYQR
FT                   RADLVPNLVNTVKGYASHEKEVLTEVTEARARVGAIQASPALLNDPQAFARFQSAQQQL
FT                   TGSLSRLLAVSENYPQLKADAGFRDLQAQLEGTENRITIARNRYIQSVQSYNVTVRSFP
FT                   SNLTAKAFGYQEKPNFTVANETAIAKPPQVEFGSPSASAPGSSK"
FT   sig_peptide     198860..198943
FT                   /locus_tag="Rpic12D_5307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.711 at
FT                   residue 28"
FT   gene            199480..200361
FT                   /locus_tag="Rpic12D_5308"
FT   CDS_pept        199480..200361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5308"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   reh:H16_A2010 beta-propeller domains of methanol
FT                   dehydrogenase-type (homolog)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5308"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66534"
FT                   /db_xref="GOA:C6BR26"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR26"
FT                   /inference="protein motif:PFAM:PF04536"
FT                   /protein_id="ACS66534.1"
FT                   /translation="MNLLKIARGLLVAAAALVSFGAVAEVAVPPLTARVTDQTGTLTPG
FT                   QLAELEQTLQAFENKKGVQIAVLIVPSTLPEAIEQYSLRVVEQWKLGRKRVDDGALLII
FT                   AKDDRTLRIEVGYGLEGVLTDATSKRIISEVISPRFKTGDFYGGVKDGVQSMQAVIEGE
FT                   ALPPPSRSTRDGGVSVRSYMPVILVLTLVFGGALRDFLGRFPGAVAAGGAVALVAWLLS
FT                   GAIFVAFTAGVIALIYTLLGPGMVGHGGSWSTGSRSGRGGFGGGSGGFGGGSGGFGGGG
FT                   GGFGGGGASGKW"
FT   sig_peptide     199480..199554
FT                   /locus_tag="Rpic12D_5308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 25"
FT   gene            200361..200861
FT                   /locus_tag="Rpic12D_5309"
FT   CDS_pept        200361..200861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5309"
FT                   /product="protein of unknown function DUF477"
FT                   /note="PFAM: protein of unknown function DUF477; KEGG:
FT                   reu:Reut_C6200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5309"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66535"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR27"
FT                   /inference="protein motif:PFAM:PF04536"
FT                   /protein_id="ACS66535.1"
FT                   /translation="MENIKRILSHLLTTHWRVRRAFPRKAMRAIGQAIAQSESSHVGHL
FT                   CFAVEGALSFSALWKGVTARERALEVFSQLRVWDTEQNNGVLIYLLLADRSVEIVADRG
FT                   IHARVGAQGWQAICSQMEAACRRAEYERGVIDGIRSITLRLTQHFPARDRREQRLPGKP
FT                   VIL"
FT   gene            200913..201389
FT                   /locus_tag="Rpic12D_5310"
FT   CDS_pept        200913..201389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_1493 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5310"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66536"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR28"
FT                   /inference="similar to AA sequence:KEGG:Ajs_1493"
FT                   /protein_id="ACS66536.1"
FT                   /translation="MLSLRSFVPYAAVICVLALPSVETLAQARLEREGVVLYWGLIPAA
FT                   IASERLDLEESHGAPSPGGGRPHHLLVALFRADGSRITDAVVRAQLKEVGIVDSPPKYL
FT                   TPMVINGQVSYGQVFTSVLSGRVYFRVLVKLVDRTNDIEYRISVSPPHIGGSEP"
FT   sig_peptide     200913..200993
FT                   /locus_tag="Rpic12D_5310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.828) with cleavage site probability 0.764 at
FT                   residue 27"
FT   gene            complement(201546..201794)
FT                   /locus_tag="Rpic12D_5311"
FT   CDS_pept        complement(201546..201794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_0477 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5311"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66537"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR29"
FT                   /inference="similar to AA sequence:KEGG:Rmet_0477"
FT                   /protein_id="ACS66537.1"
FT                   /translation="MNHTKKTVLIAAALISLGANISSAATSSNGALAQRDVYTDGARAA
FT                   DARDPYTDGAKAGKFEIYSDGAWTGDTRYPATGGSSS"
FT   sig_peptide     complement(201720..201794)
FT                   /locus_tag="Rpic12D_5311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.857 at
FT                   residue 25"
FT   gene            202143..203003
FT                   /locus_tag="Rpic12D_5312"
FT   CDS_pept        202143..203003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5312"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   ajs:Ajs_2697 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5312"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66538"
FT                   /db_xref="GOA:C6BR30"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR30"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="ACS66538.1"
FT                   /translation="MAKGKSKKKTTSSDAEHVTGLSSSQARVDAAKGVQGREDYEAQLH
FT                   LLQIELVKLQRHFIGCGDRILVLLEGRDAAGKDGSIKRIIEFLSPRETRVVALGKPSDR
FT                   ERTGWYFQRYVPHLPLAEEFVLFNRSWYNRAGVESVMGFCTAEQYDEFMYSVPHFEEML
FT                   VNSGIKLLKYYLDISKAEQARRLAERRRDPLKQWKTSPVDAVALKHWDAYTTARNAMLM
FT                   HTHTAAAPWHIVLADDKRTARLNLIRHILSRLHYAGKKNKLVAPDPEVVFEFSKECLDA
FT                   KRLAS"
FT   gene            203080..203685
FT                   /locus_tag="Rpic12D_5313"
FT   CDS_pept        203080..203685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5313"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_2687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5313"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66539"
FT                   /db_xref="GOA:C6BR31"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR31"
FT                   /inference="similar to AA sequence:KEGG:Ajs_2687"
FT                   /protein_id="ACS66539.1"
FT                   /translation="MLRLSLQSGLLRALTRRADSRAFPLVVAGAALAAELSMSVPFASL
FT                   LMAAVLLAPRRWVSIATLASLGAAVGALVLYLVFHHLGWNRLFAAYPDVVRSTAWRDAT
FT                   HWLEHYGVVSLSVIAALPVPLTPALMFAAISRLPVAEVIAALWLGKLAKYHVYAWLASR
FT                   FPDRLVRHGRRHVDTLRAVLGNGTKADGGTTPTRGGRR"
FT   sig_peptide     203080..203181
FT                   /locus_tag="Rpic12D_5313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.960) with cleavage site probability 0.603 at
FT                   residue 34"
FT   gene            complement(203798..205888)
FT                   /locus_tag="Rpic12D_5314"
FT   CDS_pept        complement(203798..205888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5314"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /note="KEGG: reu:Reut_C6194 FtsH-2 peptidase; TIGRFAM:
FT                   ATP-dependent metalloprotease FtsH; PFAM: peptidase M41;
FT                   peptidase M41 FtsH extracellular; AAA ATPase central domain
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5314"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66540"
FT                   /db_xref="GOA:C6BR32"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR32"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ACS66540.1"
FT                   /translation="MKVNLGDFQASILGTHTNARLSGAYPGRPPTFPALETRLTFNKVD
FT                   LEKNPMEPRQQQFSLWYVLVTILAMLAIQTLFVSGHVETIPYSDFKVLLKAGKLKDVAI
FT                   GEQAISGTFSTEGIDNLLAKQQIEEIRREAKGDHAFSTLRVADPELVQELEAAKVRFVG
FT                   QPDNKWLSTILSWVVPAVIFFGIWSFLIKRVGGAAGSMMEIGKSKAKVYMQKETGVTFA
FT                   DVAGIDEAKEELSEIVSFLKDPQRYQRLGGKIPKGVLLVGAPGTGKTLLAKAVAGEAGV
FT                   PFFSMSGSDFVEMFVGVGAARVRDLFKQAETKAPCIIFIDELDALGKTRALNAVGGNEE
FT                   REQTLNQLLVEMDGFDSNKGVIIMAATNRPEILDPALLRPGRFDRHVALDRPDLKGREQ
FT                   ILKVHVKGVVLAPEVDLTKLAGRTPGFAGADLANLVNEAALLAARKSKQMVEMADFDEA
FT                   LDRIVGGLEKKNRVMNPKEKETIAFHEAGHAIVAEHRPLADRVSKVSIIPRGVAALGYT
FT                   QQTPTEDRYLLKRSELLDRLDVLLGGRIAEQLIFGDVSTGAQNDLQRATDMARQMITQF
FT                   GMSDQLGLATYENMPNPLFAGTGLMQRERNEYSESTAQMIDAEVRKLLAEASHRVQATL
FT                   EGQRTKLDALAQLLLEKEVVDRQDLDMFLSAKVTPMPPPKPVANIEESTATGKPDQKTQ
FT                   GT"
FT   gene            206072..209003
FT                   /pseudo
FT                   /locus_tag="Rpic12D_5315"
FT   gene            complement(206271..207164)
FT                   /locus_tag="Rpic12D_5316"
FT   CDS_pept        complement(206271..207164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5316"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   rme:Rmet_6074 integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5316"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66541"
FT                   /db_xref="GOA:C6BM77"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6BM77"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACS66541.1"
FT                   /translation="MRYAFIERNRRYWPVSVLCELLGVSPSGYHQRKQRTVSTDRPDRG
FT                   RLSDDALLAHIKAIHAGVKGEYGWPRMWKELLARGVRVGKERVRKLMALHGIRARHKRK
FT                   YIATTNSNHDLPVAPNLLQRDFSPAAPNQVWTSDITYVATAEGWLYLVVIIDLFSRQVV
FT                   GWSMQPHMKAELVTDALRMAWFRRRPEAGVIVHTDRGSQYCSHLFQDALKAYGMRSSMS
FT                   RRGDCWDNAPTESLWGSLKVARLHGRQFATRRAAMDEVIDWLGFYNASRLHSTLGYVSP
FT                   MTFEKNWSAAQQHRAA"
FT   gene            complement(207161..207457)
FT                   /locus_tag="Rpic12D_5317"
FT   CDS_pept        complement(207161..207457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5317"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   rme:Rmet_6073 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5317"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66542"
FT                   /db_xref="GOA:C6BM76"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C6BM76"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACS66542.1"
FT                   /translation="MTSKTKRAQYTLEFKLEAVRLVKSGQSMAVVSATLGIRAQTLHNW
FT                   VKAEREGKLTGAGMKPVSPEQMELARLRAEVARLKMERDILKKAAAYFAKESV"
FT   gene            209144..209521
FT                   /locus_tag="Rpic12D_5318"
FT   CDS_pept        209144..209521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lch:Lcho_0146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5318"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66543"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR35"
FT                   /inference="similar to AA sequence:KEGG:Lcho_0146"
FT                   /protein_id="ACS66543.1"
FT                   /translation="MLLVWLLGLAVGIANACAVADAGKAAAPASGHVSAHSHGHHADAD
FT                   DDGCDDSGKIACHSFCEKSSTSIPRVLSDHDKPLIPVAVPLPMSMASTPEVDRCSVHRQ
FT                   SNPRPADKFASIPIVFLRLTL"
FT   sig_peptide     209144..209206
FT                   /locus_tag="Rpic12D_5318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.751 at
FT                   residue 21"
FT   gene            209775..210068
FT                   /locus_tag="Rpic12D_5319"
FT   CDS_pept        209775..210068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5319"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: ajs:Ajs_1492 heavy metal transport/detoxification
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5319"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66544"
FT                   /db_xref="GOA:C6BR36"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR36"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /protein_id="ACS66544.1"
FT                   /translation="MDTIELKIKGMSCGSCVSSVTHALQRVPGVDAVDVDLARGIARVS
FT                   GNAQAAPAMLAALAAAGYEAESLSTGAGAKTEHAHHGDVPTGTAHKSGGCCH"
FT   gene            210142..210456
FT                   /locus_tag="Rpic12D_5320"
FT   CDS_pept        210142..210456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5320"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_6005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5320"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66545"
FT                   /db_xref="GOA:C6BR37"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR37"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66545.1"
FT                   /translation="MSSLRSLSRHRQSGRIGSGAIFIAFALIALFFLFTEHRAHLFGWL
FT                   PFLLLLACPLLHLFHGHGGHGGHAGHEDQPRGSDSGSSRPSGSTASEQPPVQGAQHHHH
FT                   "
FT   gene            210480..211145
FT                   /locus_tag="Rpic12D_5321"
FT   CDS_pept        210480..211145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5321"
FT                   /product="protein-S-isoprenylcysteine methyltransferase"
FT                   /note="KEGG: pzu:PHZ_p0147 protein-S-isoprenylcysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5321"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66546"
FT                   /db_xref="GOA:C6BR38"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR38"
FT                   /inference="similar to AA sequence:KEGG:PHZ_p0147"
FT                   /protein_id="ACS66546.1"
FT                   /translation="MDQSTPPAYGLWSLVIINSLVFIIFAFSFAKPQSPRDWRSFGAFS
FT                   AFLVALFTEMYGFPLTIYLLSGWLSAKFPGVNFMSHDAGHLLEVMFGWRANPHFGPFHL
FT                   LSAIFIGGGFWLLSAAWAVLYHNQRSHTLATTGAYSRIRHPQYVGFVLIMFGFLLQWPT
FT                   ILTLLMFPVLVVMYVRLAITEEKWAEREFGEEWAHYASHTPRFIPNFGDKQADRHHHA"
FT   gene            211162..212526
FT                   /locus_tag="Rpic12D_5322"
FT   CDS_pept        211162..212526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5322"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   RNA-metabolising metallo-beta-lactamase; KEGG: ajs:Ajs_2691
FT                   beta-lactamase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5322"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66547"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR39"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACS66547.1"
FT                   /translation="MKLSFHGAAGTVTGSKYLVEHQGQRLLVDCGLFQGYKQLRLLNWE
FT                   PLPFSAADIDAVVLTHSHLDHAGALPLLVKQGFRGRILATPSTIELCGLLLPDSGRIQE
FT                   EDAAYANRHHTSKHATALPLYTEDDARRAMEQLHRLPFDQCVDVVPDVTVTLRPAGHIL
FT                   GAASAELTAGQTTVLFSGDVGRPDDPVMRAPAPAPKADYIVVESTYGDRLHEPVPNAQA
FT                   VLGEAIARTAHRGGMVVIPAFAVGRAQLLLHLIHKLKQQGAIPDLPVFLDSPMAIDATE
FT                   IYHRHHAEHKLSLEDCLGMYKAARMIRTPEESRALAGLALPAVIISASGMATGGRVLHH
FT                   LKHLAPDRRNTIILAGYQAGGTRGARLQAGERSLRIHGEDVAVRAEVISLQGMSAHADA
FT                   SQLIEWLGSAPAAPRSVFVTHGEPGPADAMRQRIERELGWSASVPLLGQHVEFDV"
FT   gene            212523..214037
FT                   /locus_tag="Rpic12D_5323"
FT   CDS_pept        212523..214037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5323"
FT                   /product="thymidine phosphorylase"
FT                   /note="TIGRFAM: thymidine phosphorylase; PFAM: Pyrimidine
FT                   nucleoside phosphorylase domain; KEGG: reu:Reut_B4704
FT                   thymidine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5323"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66548"
FT                   /db_xref="GOA:C6BR40"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013466"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR028579"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR40"
FT                   /inference="protein motif:TFAM:TIGR02645"
FT                   /protein_id="ACS66548.1"
FT                   /translation="MRNPRHRASLAVRRMGIETQQEYVVYMHRDCHVCRSEGFEAQTRV
FT                   LISLNGRSIIATLNVVDPTLLELGEAALSNSAWRALAPAPGDRITISHAPTLDSMSQVR
FT                   AKIYGHRLDASALDSIISDVAAGSYPGTHIAAFLSACAGGRMDLQETIDLTRAMLAAGK
FT                   RLDWGHAPIADKHCVGGLPGNRTTPIVVSIITAAGLTMPKTSSRAITSPAGTADVIETM
FT                   TPVALDLEQMRRVVQREGGCFVWGGSLALSPADDMLIRVERPLDLDSDAQLVASVLSKK
FT                   IAAGATHSVIDVPVGPTAKVRSDADYECLKQMLEQVAQAFDLHLQVVRTDGTQPVGRGI
FT                   GPSLEAHDVLAVLQRAERAPEDLSVRAVALAGQLLEFCGHSEPGTGVLVAQRLLDSGAA
FT                   WAKFQAICKAQGGLREPQRARLREPVLAERDGMVREIDSRRLARVAKLAGAPKAPAAGL
FT                   ELHVKLGDRVERGMPLFTVHAEALGELDYAFDYLEAHPLIDVGDSR"
FT   gene            214034..214939
FT                   /locus_tag="Rpic12D_5324"
FT   CDS_pept        214034..214939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5324"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: mmr:Mmar10_0190 phosphoribosylpyrophosphate
FT                   synthetase; TIGRFAM: ribose-phosphate pyrophosphokinase;
FT                   PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5324"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66549"
FT                   /db_xref="GOA:C6BR41"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR41"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACS66549.1"
FT                   /translation="MTPLIFAMPGNEAMAEKLASALGAERGTTTVRRFPDGESYVRVES
FT                   AVEGRRVAIVCTLDRPDDKLIPLLLLAAAARENGATDVGLVAPYLAYMRQDSCFQPGET
FT                   VSARHFAAWLSRGFDWLATVDPHLHRITKLSQVYVIPTRHVHAAPAVAAWLRAHVTRPA
FT                   LVGPDEESNQWVADVASRADAPMVVLHKVRKGDRDVEVSVPDVERWRDHTPVLVDDIVS
FT                   TGRTMAETIGHLRRAGLAAPVCIAIHAVFSGNAVQDLESTGAGLVVSCDTVVHPTNGIS
FT                   VAPDLASAVRELMQDPGGAT"
FT   gene            214936..215085
FT                   /locus_tag="Rpic12D_5325"
FT   CDS_pept        214936..215085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5325"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66550"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR42"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66550.1"
FT                   /translation="MSAKTPHVHFEIDLAGFCKAAIPMSGWRFIVSIGGEDRDEPSTQR
FT                   EGKR"
FT   gene            215082..217731
FT                   /pseudo
FT                   /locus_tag="Rpic12D_5326"
FT   gene            complement(215473..216342)
FT                   /locus_tag="Rpic12D_5327"
FT   CDS_pept        complement(215473..216342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5327"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: mca:MCA0907
FT                   ISMca2, transposase, OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5327"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66551"
FT                   /db_xref="GOA:C6BDJ7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDJ7"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACS66551.1"
FT                   /translation="MRKLYPVSVSCGVLEVSASGYFNWLRRGESGHGGPGRRYSDEALL
FT                   AHIRAIHAQVKGEYGWPRMHKELLARGIRVGKDRVRKLMQQHAIKARTKRKFVVTTDSR
FT                   HSLPVAPDLVQRRFKPEEPNQLWSGDITYIQTDEGWLYLAAVIDLFSRQVVGWSLQPHM
FT                   QAGLVKDALAMAWWRRRPPPGVIFHSDRGSQYCSAEFQQALKNWGIQSSMSRKGNCWDN
FT                   APTESFWGRLKTASVHGCKFATREQASQAVMDWMAFYNHRRLHSSLGYLSPMQYEQRWY
FT                   EAQRKKAA"
FT   gene            complement(216339..216671)
FT                   /locus_tag="Rpic12D_5328"
FT   CDS_pept        complement(216339..216671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5328"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   mca:MCA0906 ISMca2, transposase, OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5328"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66552"
FT                   /db_xref="GOA:C6BDJ6"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C6BDJ6"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACS66552.1"
FT                   /translation="MSEKQVRAQYTREFKLEAVRQVRSGQPIAVVAKVLGIPKASLGNW
FT                   VRLSAKGELDGAGGGDKSIQVSPEKMEIARLRAENARLRMERDVAKKAAAYFAQDTLRG
FT                   TPGFTK"
FT   gene            217736..218386
FT                   /locus_tag="Rpic12D_5329"
FT   CDS_pept        217736..218386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5329"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66553"
FT                   /db_xref="GOA:C6BR45"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR45"
FT                   /inference="similar to AA sequence:KEGG:Pnap_4542"
FT                   /protein_id="ACS66553.1"
FT                   /translation="MCFSATASFGSGTLLLAIGTVTLRMARCPAERPYAAIPLLFAIQQ
FT                   LVEGVVWLSFGGPAWLNFVATQVYSFFSHVLWPVYVPLAAWLLEPRGPRRRGLLAFVVM
FT                   GLAVGAYLLYSLVVNPIQARPMAGHVDYQSPHFYIVASMTLYLLSTTVSLLLSSHVWVK
FT                   VFGALTLAASFTAYVFYAHWFISVWCFFAALLSGAVALHFIALRSIPQQRIPS"
FT   gene            218383..220827
FT                   /locus_tag="Rpic12D_5330"
FT   CDS_pept        218383..220827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5330"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: rpt:Rpal_1042
FT                   copper-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5330"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66554"
FT                   /db_xref="GOA:C6BR46"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR46"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACS66554.1"
FT                   /translation="MSTTNTFEVAGLLSPLAARGVEKHLAQMPGIEHVSVNAVAGSATV
FT                   TYDQGRIDPERIRAAIQDCGYHCAGEMLPRHMCGPMEHAVAPAHAHGHIQHEHPERHVH
FT                   AAGGPATAEAPVAHDHAAMAHGGMDAMAHEMGHGPGMDAKGMARDMRNRFWVCLAFTVP
FT                   IFLYAPMGMDFIKLKPPFGLDLGLWLFLLATAAVIYPAWPFFVAAARALRNGVLNMAVL
FT                   VVLSVGTGYVFSVGSTFIFGGAQFYEAVSVLLVFILLGHWLEMRARAGASEAIRALMDL
FT                   APPKATVLRAGKEVTVATAEVLLDDIVLVRPGDKIPVDGEVLEGGSQVDESMLTGESMP
FT                   VKKMVGDKVIGATINKSGSFRYRATKVGADTALAQIVKLVQEAQNSKAPAQLLADQASQ
FT                   WLVVIAFLIGVATFAVWYFVLGQPVLLALTLTITVFVIACPDALGLATPMAVMVGTGLG
FT                   AMNGILFKNAAALEDATRLNVVIFDKTGTLTLGEPEVVDIAVARDVTPDDLLRVSGSVE
FT                   KLSEHPLAVAILKRAGALASEAVTDFTNIDGQGTQAVVAGRLALLGNRRLMEANGVDLG
FT                   ALKADADRLQGQGRTVVHVAHGGRLIGLIAIADAVRPSSAETIKALHGRGVQVAMLTGD
FT                   NRSTAERIAKELGIDIVLADVLPGDKAAKVKELQGQGKKVGMVGDGVNDAPALTQADVG
FT                   FAIGAGTDVAMESADVVLMKSDPLDVVGAIELSRATLRKMHQNLWWAVAYNVVAFPLAA
FT                   GVLYPFTISPEVAAITMSGSSALVAINALMLKRTRLTGIRRASAATVHNGVTAPVAAHG
FT                   AG"
FT   gene            220835..222142
FT                   /locus_tag="Rpic12D_5331"
FT   CDS_pept        220835..222142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5331"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   xau:Xaut_4848 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5331"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66555"
FT                   /db_xref="GOA:C6BR47"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR47"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS66555.1"
FT                   /translation="MLNQSSATPAPLDARAVRPALVVLLALVFVVSLGYGVGLPLLQLY
FT                   LAQYLPGATRQTLAWHVGMLGGIYTLALFIFAPWWGRQSDHRGRAAALTTGFAMFVLGT
FT                   AMVALIPSLMAIYGGRLIAGAGAAAIVPGAQAYVTDISNTEDRSRRFVLIGSASFVGFL
FT                   AGPAFGSWLAGPLMGMPAGQMPSMVNWPALVVASVGLPLLLAVRRCLSTTKPILLDSGS
FT                   VQMTRQRKRFVAVSMLLALLASFAAGTFEVGFSLFGGQTLRLPNSMIAVMFVTCSLAML
FT                   AAQALLLLPAVRKHIDHRWVAGAFAGSAVALGFAALVPDAAALGLLIAVVATGVGMIGP
FT                   VLSYELLEGDRSFAGSLLARQAAAGNLGQALGSVSAGTLFGWNTFAPFWAAAAVLLLGS
FT                   VAALRWWGAARQAERQPEQRSFQAEGERQTREGRGA"
FT   gene            complement(222097..222672)
FT                   /locus_tag="Rpic12D_5332"
FT   CDS_pept        complement(222097..222672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5332"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66556"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR48"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66556.1"
FT                   /translation="MPCRYANHPGERRCLTKPIKNVSTPVTRVRSHACTVLWLASTSQA
FT                   RRNLPTVFAWISIARSCARLPLVIWHAAAAKPKPFAYYAQPSVRNAAQSARSMHTTTVK
FT                   LAHVRVRNARKPVELCNNGFEPQFNWKEQMALIGHIRRHVLHHPRIAGSVRCHWKAASK
FT                   AQCAHIARGIFIVVHAPRPSLVCLSPSA"
FT   gene            223212..223598
FT                   /locus_tag="Rpic12D_5333"
FT   CDS_pept        223212..223598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5333"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   reh:H16_B2183 copper resistance protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5333"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66557"
FT                   /db_xref="GOA:C6BR49"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR49"
FT                   /inference="protein motif:PFAM:PF04234"
FT                   /protein_id="ACS66557.1"
FT                   /translation="MSASRRALRGSVTVLFAILSEIALGHPKLVSSRPANNSEVAAPKR
FT                   IELRFSEELVFPPSGGNLVMAWLPGRALHGPMKIPAEVSRGGDAKTVVIQPTQPLMAGS
FT                   YRVDWQAVSSDGHPVNGRIVFRVR"
FT   sig_peptide     223212..223289
FT                   /locus_tag="Rpic12D_5333"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.862) with cleavage site probability 0.860 at
FT                   residue 26"
FT   gene            complement(223721..225118)
FT                   /locus_tag="Rpic12D_5334"
FT   CDS_pept        complement(223721..225118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5334"
FT                   /product="heavy metal sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: rso:RSp0654 two component sensor histidine
FT                   kinase transcription regulator protein; TIGRFAM: heavy
FT                   metal sensor kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; histidine
FT                   kinase HAMP region domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5334"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66558"
FT                   /db_xref="GOA:C6BR50"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR50"
FT                   /inference="protein motif:TFAM:TIGR01386"
FT                   /protein_id="ACS66558.1"
FT                   /translation="MGQFSLTTRLTAYFSLCSAAVLLGLGVVIALAMDQHFAVEDYTAL
FT                   RENVSVIEKIVESSPAEQVPERIREAIQHRTDLVARIQGSDGHMLYVTQDFDFQAATQA
FT                   LAQLRHTSETLVWAQGGQQYRGMHAAIPLRDGSSGELDVLLGINTDIHAHFLHTFRGTL
FT                   AFYIAVAALATGLFGWWAARRGLAPLRTMASRARTVTADKLDERMPVDTVPVEVADLAA
FT                   TLNGMLERLQNDFRRLSDFSTDIAHELRTPITNLLTQTEVVLSQPREGTKYRDVLTSNA
FT                   EELQRLARMVSDMLYLAKMEHSLTLPSAEDIRIADEIRALFDFYDALAEDKAVLLETRG
FT                   DGHVTGDRLMLRRALSNLLSNAIRHTPRHGRVVVSVSDDRDGMTVSVDNDGSEIAPQLL
FT                   PFIFERFFRADKSRARPESESAGLGLAITKAIVAAHGGTITVARIDGRTRFSIRLPRCI
FT                   DAAILSV"
FT   sig_peptide     complement(225020..225118)
FT                   /locus_tag="Rpic12D_5334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.992 at
FT                   residue 33"
FT   gene            complement(225118..225804)
FT                   /locus_tag="Rpic12D_5335"
FT   CDS_pept        complement(225118..225804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5335"
FT                   /product="two component heavy metal response
FT                   transcriptional regulator, winged helix family"
FT                   /note="KEGG: rso:RSp0655 two component response regulator
FT                   transcription regulator protein; TIGRFAM: heavy metal
FT                   response regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain protein; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5335"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66559"
FT                   /db_xref="GOA:C6BR51"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR51"
FT                   /inference="protein motif:TFAM:TIGR01387"
FT                   /protein_id="ACS66559.1"
FT                   /translation="MKLLVVEDEPKTGEYLQQGLTEAGFVVDLARNGTDGRHLAMSGDY
FT                   DLLLLDVMLPDVDGWQIVQSLRAAEQAVPVLFLTARDSVADRVKGLEMGADDYLVKPFA
FT                   FAELLARVRTLLRRGTGAVSSDRIQVADLVLDLARRRASRGGQKIPLTSKEFSLLELLV
FT                   RRRGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDHFEPKLIQTVRGMGYVLE
FT                   APEDAA"
FT   gene            225976..227871
FT                   /locus_tag="Rpic12D_5336"
FT   CDS_pept        225976..227871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5336"
FT                   /product="copper-resistance protein, CopA family"
FT                   /note="TIGRFAM: copper-resistance protein, CopA family;
FT                   PFAM: multicopper oxidase type 3; multicopper oxidase type
FT                   1; multicopper oxidase type 2; KEGG: rso:RSp0656 copper
FT                   resistance transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5336"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66560"
FT                   /db_xref="GOA:C6BR52"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006376"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034279"
FT                   /db_xref="InterPro:IPR034282"
FT                   /db_xref="InterPro:IPR034284"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR52"
FT                   /inference="protein motif:TFAM:TIGR01480"
FT                   /protein_id="ACS66560.1"
FT                   /translation="MRSNRASGLVLPNLPRRRFVQGLAAGGVIAGLGLGGFTSAASAAS
FT                   TALGTAPVLRGTEFDLVIDETPVNFTGKPAMATTINGMLPGPTLRWREGDTVTLRVTNR
FT                   LREPTSIHWHGIVLPFEMDGVPGISFHGIPPGETFTYRFKVRQSGSYWYHSHSGFQEMT
FT                   GVYGALIIDAAGGDAIRADRDYSVLLSDWTDEDPMRVLSKLKTQGDYYNYHQPTVVDFF
FT                   RDVSNDGWKAAMEKRAMWNQMRMNPTDLADLSSATLTYLTNGVTPAGNWTGLFTPGETV
FT                   RLRFINGSGNTFYDVRIPGLKLKVVQVDGQNIEPVTVDEFRFGPGETCDVLVAPKDDAY
FT                   TIFSQSMDRTGYARGTLAVCRGLQAAVPALDKVEWLSMADMMGDMGGMGGMSHGGMSGM
FT                   DHGAMSGMNHGGMPGMDHGDMQMMDDTGMTMMDSGGMQMMDHSQHAESGGAANSLKVPS
FT                   KTARHARTEYGPSTDMHVDMARTNLDDPGVGLRNNGRRVLVLADMHTIGGPMDKRGPER
FT                   EVELHLTGNMERYTWSFDGVEFGKSTPVHFRYGERLRVILHNDTMMTHPMHLHGMWSEL
FT                   EAPDGTFLARRHTIPVQPAQRISFLVTADALGRWAWHCHLMLHMDAGMFREVVVV"
FT   sig_peptide     225976..226107
FT                   /locus_tag="Rpic12D_5336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.922 at
FT                   residue 44"
FT   gene            227871..228845
FT                   /locus_tag="Rpic12D_5337"
FT   CDS_pept        227871..228845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5337"
FT                   /product="copper resistance B precursor"
FT                   /note="PFAM: copper resistance B precursor; KEGG:
FT                   rso:RSp0657 copper resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5337"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66561"
FT                   /db_xref="GOA:C6BR53"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR53"
FT                   /inference="protein motif:PFAM:PF05275"
FT                   /protein_id="ACS66561.1"
FT                   /translation="MLDFHSGLIMHKHVRTLLTVALAAAGIGVASAQEIQLMNGETTPA
FT                   SQSGAQNTGSSMQGMDHGSMQGMDHGSMKMQDGSAPPDARDPDAYSGGYQLGTGKYALG
FT                   DPRHMMMMADAHNFGSVLVDRLEWVHGNDANATAYELQARFGSVYNKAVLKAEGDVSKG
FT                   RFEEARTELLWSHAVTTFWDTQLGVRNDTGFGRPTRNWVAFGVQGLAPYWFDVEATAYV
FT                   GNSGRTALRLSSEYELLLTQRLILQPRIEANFYGKRDPDLAVGSGLSNATVGLRLRYEF
FT                   SRQFAPYIGVERSQAFGGTANMIEAAGGRRGDTRFVAGVRLWF"
FT   sig_peptide     227871..227969
FT                   /locus_tag="Rpic12D_5337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 33"
FT   gene            228878..229264
FT                   /locus_tag="Rpic12D_5338"
FT   CDS_pept        228878..229264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5338"
FT                   /product="copper resistance protein CopC"
FT                   /note="PFAM: copper resistance protein CopC; KEGG:
FT                   rme:Rmet_6114 copper resistance protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5338"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66562"
FT                   /db_xref="GOA:C6BR54"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR54"
FT                   /inference="protein motif:PFAM:PF04234"
FT                   /protein_id="ACS66562.1"
FT                   /translation="MFTSRFATKAIIGTSLALLASAAFAHPKLVSSTPADQAEVTAPTK
FT                   IELKFSETLTTQFSGANLVMTEMPGMSGHNPMKVGAKVSAGDDAKTMVITPAQPLTTGT
FT                   YKVEWRAVSSDTHPMTGNFTFKVK"
FT   sig_peptide     228878..228955
FT                   /locus_tag="Rpic12D_5338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            229269..230198
FT                   /locus_tag="Rpic12D_5339"
FT   CDS_pept        229269..230198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5339"
FT                   /product="copper resistance D domain protein"
FT                   /note="PFAM: copper resistance D domain protein; KEGG:
FT                   rso:RSp0659 copper resistance D transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5339"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66563"
FT                   /db_xref="GOA:C6BR55"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR55"
FT                   /inference="protein motif:PFAM:PF05425"
FT                   /protein_id="ACS66563.1"
FT                   /translation="MADDWLNIALRFGLYLDLTILFGVSLFGVQALRPDHRATAIARRY
FT                   VRAVGVTAALGIVLSLWSFVVMAKAMTGATEYAELTSHVFSMMLTTTAVGLAWMARLVA
FT                   LAGCLVAVARLRKHPAPHFGVCAGLGAVALLTVTWAGHGAMDDGVKGYLHLTFDIAHVL
FT                   AAGAWVGALAAFVLLASTRQAASSETVEILSHTSNGFARLGTLIVATLFATGTFNYFLI
FT                   VGPTINGLFTTPYGRLLLIKLALFALMLGLAAANRYRLSPRLAAAVRAADHVHAVIALR
FT                   RSLVMETSLAILILALVAWLGVLSPPGT"
FT   gene            230227..230718
FT                   /locus_tag="Rpic12D_5340"
FT   CDS_pept        230227..230718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5340"
FT                   /product="protein of unknown function DUF411"
FT                   /note="PFAM: protein of unknown function DUF411; KEGG:
FT                   bps:BPSS2003 periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5340"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66564"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR56"
FT                   /inference="protein motif:PFAM:PF04214"
FT                   /protein_id="ACS66564.1"
FT                   /translation="MMMKSPTAKPVSATRRSLIAGLLLLPAVALAQKAGSKPVIQVWKT
FT                   PGCGCCKDWLAHLRDNGFDVVAHDVEETVEARRKAGMPERYASCHTGIVQDYALEGHVP
FT                   AREIKRLLQERPKAIGLAVPSMPLGAPGMDGPAYGNRRMPYNVLLIGLDGQATVFRAYS
FT                   "
FT   sig_peptide     230227..230322
FT                   /locus_tag="Rpic12D_5340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 32"
FT   gene            complement(230762..232027)
FT                   /locus_tag="Rpic12D_5341"
FT   CDS_pept        complement(230762..232027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5341"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5341"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66565"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR57"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6120"
FT                   /protein_id="ACS66565.1"
FT                   /translation="MTDLTRTLIERWKADRDGTYQTWFLWPERLKNFRSIRRGIGAVVN
FT                   EIQAGTFGNAYRGSPLETVVSSIAEQRQIFKGADHAFLWKPKLRIPDIYENADHQRAFA
FT                   RLLHTCNCCDTEQELVQAIQQLNQHGIKGLGPAVANLLYFIHPTLAVPFNTAIVNGYNA
FT                   LTGSRVKLGKWDHYLAMREGVLSLNGRYRDLLSNDLGAVAGLLFDIGMERYPAPPREGD
FT                   AATIAEWESNLAKAREEAASFAKQLQAGRTDDASHTEVQGWLRDLGKALGFAVWVATND
FT                   RSRPYNGGVLSDGCLATLPNSLLVAGADTVPLIDVVWLNAASLEVEAAFEVEHTTSIYS
FT                   GIVRLLDLALGTEQPAKKHLFLVAPDGREADVRAQLARPAFSRVSELGIRYVPYTSLTE
FT                   HRETMARFGAGIKPIEAIAKTL"
FT   gene            complement(232372..233205)
FT                   /locus_tag="Rpic12D_5342"
FT   CDS_pept        complement(232372..233205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5342"
FT                   /product="putative cointegrate resolution protein S /
FT                   recombinase"
FT                   /note="KEGG: cti:pRALTA_0656 putative cointegrate
FT                   resolution protein S / recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5342"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66566"
FT                   /db_xref="GOA:C6BR58"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR58"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0656"
FT                   /protein_id="ACS66566.1"
FT                   /translation="MADIDRYLEAATRDHTRRSYQSAIRHFEREWGGFLPASADNIAQY
FT                   LAEHAQTLSINTLRQRLAAIAQWHISQGFPDPTRAPHVRKVLKGIQALHPAQERRAKPL
FT                   QLAQLEQLVAWLDAQIAADSAAGNVHPLQVHARNKALVLIGFWRGFRSDELSRLQIEHI
FT                   TVEAGRGMTIFLPRTKTDRNHVGTTHKAPALSRLCPVAAYEAWLGASGLAGGPVFRRID
FT                   RWGRMADDGLQASSIVPLLRSLFRDAGLAQAGSYSSHSLRRGFATWANGRDGRDS"
FT   gene            233324..233647
FT                   /locus_tag="Rpic12D_5343"
FT   CDS_pept        233324..233647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5343"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: rso:RSp1129
FT                   putative arsenical resistance operon repressor
FT                   transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5343"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66567"
FT                   /db_xref="GOA:C6BR59"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR59"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ACS66567.1"
FT                   /translation="MEENDVIRSLAALAHSLRLQVFRMLVVAGPTGMTPGAIAEQLDVP
FT                   GATLSFHLKELMNAHLVTQERDGRNLIYRAAYDHMDALLGFLTANCCQGEACLEADTTA
FT                   CKC"
FT   gene            233661..234143
FT                   /locus_tag="Rpic12D_5344"
FT   CDS_pept        233661..234143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5344"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: reh:H16_A2179 lactoylglutathione
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5344"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66568"
FT                   /db_xref="GOA:C6BR60"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR60"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS66568.1"
FT                   /translation="MKRFHVHVHVDDLGKSIAFYSKLFAAEPARVESDYAKWMLDDPRI
FT                   NFAISTRGSAAGVDHLGFQVDDAAELAELKARAEAADMALLDEGETTCCYARSDKHWIT
FT                   DPQGIAWEHFHSLGNIPVFSEGKKEEVATEGSACCAPRAPGGKPIGIAVKSGSSCC"
FT   gene            234154..234648
FT                   /locus_tag="Rpic12D_5345"
FT   CDS_pept        234154..234648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5345"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="PFAM: Protein-tyrosine phosphatase, low molecular
FT                   weight; SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: cti:pRALTA_0651 putative arsenate reductase
FT                   (arsenical pump modifier)(low molecular weight
FT                   phosphotyrosine protein phosphatase)"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5345"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66569"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR61"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ACS66569.1"
FT                   /translation="MADKTYNVLFICTGNSARSILAEGLLNHLGGDRFKAFSAGSHPAG
FT                   AVNPFALHALQQFGIPTDGFRSKSWDEFSQDGAPELDFVFTVCDKAAGEVCPVWPGQPM
FT                   TAHWGVVDPAAVEGSDERKQQAIRDAAITLKRRIELFLSLPIPKLDTVALQKAVRDIGQ
FT                   Q"
FT   gene            234663..235157
FT                   /locus_tag="Rpic12D_5346"
FT   CDS_pept        234663..235157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5346"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="PFAM: Protein-tyrosine phosphatase, low molecular
FT                   weight; SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: rso:RSp1128 putative arsenate reductase
FT                   (arsenical PUMP modifier) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5346"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66570"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR62"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ACS66570.1"
FT                   /translation="MTTNVLILCTHNSARSVLSEGMLNHWAQKLGKDVRAYSAGSAPSG
FT                   RLNPFALEALTNAGIDTAGYRSKSWDEFVADGAPQMRVVITVCDSAAAEQCPYWPGSPV
FT                   KVHWGYADPSNAPGGDEGKRQAFEVTRQAIGYRMLQLLALPLDTLSNAELQAQLERISQ
FT                   D"
FT   gene            235163..235867
FT                   /locus_tag="Rpic12D_5347"
FT   CDS_pept        235163..235867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5347"
FT                   /product="major intrinsic protein"
FT                   /note="PFAM: major intrinsic protein; KEGG: rso:RS05492
FT                   transmembrane ABC transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5347"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66571"
FT                   /db_xref="GOA:C6BR63"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR63"
FT                   /inference="protein motif:PFAM:PF00230"
FT                   /protein_id="ACS66571.1"
FT                   /translation="MVDLRSRLAAEALGTALLLAIVIGSGIMAERLAGGNVAVALLANT
FT                   AATVGGLYILIEVFGPISGAHFNPAVRAVMAARAELPGSALAPYIAAQLVGAVLGAWLA
FT                   HAMFDMTILQFSTKVRSGPGQWIAEAVATAGLLLVILRAPNGRASSMVAAYIGAAYWFT
FT                   ASTSFANPAAAFGRMFSNSFAGIAPSSVPGFVLAECAGAVLGLMLHRMLEPRLARRGHP
FT                   NVIESSGEHPAD"
FT   gene            235876..236319
FT                   /locus_tag="Rpic12D_5348"
FT   CDS_pept        235876..236319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5348"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ade:Adeh_1022 tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5348"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66572"
FT                   /db_xref="GOA:C6BR64"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR64"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS66572.1"
FT                   /translation="MSTPDFRPARPEDYPAIRALLIEEGLPSEDVAVGQVSRFHLAVQD
FT                   GELLACAGLELYGSDALLRSVAVAKCARQNGLGRALVGIAERDAFAIGVSRLFLLTTTA
FT                   AGYFTALGYERFDRRLAPGSLQSSSQFSLLCPASATCMTKNLL"
FT   gene            236529..237713
FT                   /locus_tag="Rpic12D_5349"
FT   CDS_pept        236529..237713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5349"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: reu:Reut_C6190 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5349"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66573"
FT                   /db_xref="GOA:C6BR65"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR65"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS66573.1"
FT                   /translation="MLGFVSLLMDISSEIIHSLLPVFMVTALGASAFYVGLIEGVAEAT
FT                   ALIVKVFSGALSDYLGKRKGIAVLGYALGALSKPFFALAPGVGVVLAARLADRIGKGIR
FT                   GAPRDALVADIAPPHLRGAAFGLRQSLDTVGAFLGPLIAIGLMFLWANDFRAVFWVAVI
FT                   PGILSVLLLLVGVREPDTHIGAKRTNPIKWANLVRLGRPYWQVVAIGALFTLARFSEAF
FT                   LVLRSQQVGLPLYLAPLVLVAMNVVYSLSAYPFGKLSDRLRHTTLLAWGLGVLILADLV
FT                   LAVSAHWAATLAGVAVWGLHMGMTQGLLATMVADTAPEDLRGTAFGFFNLASGLALLVA
FT                   SALAGLLWDQLGAAFTFYAGAAFCVATIALIILARYGARRLSSGETAGAGRMRR"
FT   gene            complement(237785..239707)
FT                   /locus_tag="Rpic12D_5350"
FT   CDS_pept        complement(237785..239707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5350"
FT                   /product="iron permease FTR1"
FT                   /note="PFAM: iron permease FTR1; cytochrome c class I;
FT                   KEGG: rme:Rmet_5945 iron permease FTR1"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5350"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66574"
FT                   /db_xref="GOA:C6BR66"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR66"
FT                   /inference="protein motif:PFAM:PF03239"
FT                   /protein_id="ACS66574.1"
FT                   /translation="MQLQRVVSLLLFYLLASVSSAYADTLSTQDKTKQVWQLLDYLAVD
FT                   YGRSVKDGQVANADEYAEMQEFAHAAERQIAELPAGPGTQALLKDAGALRSQIADKAAP
FT                   AAVGEQAHKLADSLLAAYPVPMAPSKVPDLKRGATLYQNQCASCHGSSGHADGVLAAKL
FT                   SPPPIALADHQRAQERSVFALQQIITRGVEGTSMPSFAQLTDDDRWALAYFASTLSYSD
FT                   ADRQAGAKLWASRPELHGAVPTLAKLSQTPEASLAKSTSPDAARQLTAYLRSAPDVLSA
FT                   STADSLAIAKDKLKESVAAFDQGDKATASRLALSAYLDGFEPVEPALAAKNQALFQDIE
FT                   KTMGLYRNAITTGQAGQVQEIAQRLQTMLTEAQDALGGTNDPLSTFLGALTILLREGLE
FT                   ALLVVVAMMAFLKKAERTDVLPYVHAGWIVALAAGGLTWAVATYLVDLSGASREMTEGF
FT                   SAIFAAVVLLGVGMWMHQKSLAGRWQAYVKQKLSSALNKRSAIMLFVLSFVTVYREVFE
FT                   TVLFYAALWSEGNGIYLLAGLGSGIAILAAIAVVLLRSSARLPIRQFFAFSSALVAVLA
FT                   VVLIGKGVAALQKVGFLHITPISMPRIDVLGIYPSVQTVLAQVAILLIIAGMIAYNVRS
FT                   ASNKA"
FT   sig_peptide     complement(239636..239707)
FT                   /locus_tag="Rpic12D_5350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 24"
FT   gene            complement(239868..240302)
FT                   /locus_tag="Rpic12D_5351"
FT   CDS_pept        complement(239868..240302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5351"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: grail3.3073000201; .; TIGRFAM:
FT                   Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM:
FT                   Transcription regulator MerR DNA binding; regulatory
FT                   protein MerR; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5351"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66575"
FT                   /db_xref="GOA:C6BR67"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR67"
FT                   /inference="protein motif:TFAM:TIGR02047"
FT                   /protein_id="ACS66575.1"
FT                   /translation="MTIQIGELAKRTACPVQTIRYYEREGLLPPPERSSGNFRLYGERH
FT                   IERLQFILHCRSLDMPLSDVRALLRYREQPREDCGAVNTLLDKHIHEVERRIEALAALK
FT                   RHLYALRESCSDGRAAEACGILQGLSDASYGCDADVTRQG"
FT   gene            240388..242787
FT                   /locus_tag="Rpic12D_5352"
FT   CDS_pept        240388..242787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5352"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; cadmium-translocating P-type ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: rme:Rmet_5947 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5352"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66576"
FT                   /db_xref="GOA:C6BR68"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR68"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACS66576.1"
FT                   /translation="MSECGPKGCDCAAVNVAPPAPDATGVDLKRSRYRIDNMDCPTEEA
FT                   LIRNKLATLPGVVKLEFNLVQRSLTVNHRLPSPASIEQALSAIGMQAVRAEETRSAQST
FT                   VLTIRQMDCPTEEALIRGKLAGVPGVAGLDFNLVQRTLAVRHAAHTLPQVLAAIQSLGF
FT                   DAEVRDTSAAAPASVPDAAPTKWWPLAISGANAVLAEVVYWLNGGNHWVVVVLALAAIL
FT                   TGGLTTYKKGWIALKNRNLNMSALMSIAVTGAMVIGHWPEAAMVMVLFALAEVVEARSL
FT                   DRARDAIRGLMDLAPETAMVQRSDGSWGDVDAKTVAVGSRVRVKPGERIALDGEVLQGR
FT                   SSVNQAPITGESLPVEKAEGDPVFAGTINESGSFEYRVTAAASDSTLARIIHAVEAAQG
FT                   SRAPTQRFVDQFARLYTPIVFAVALAVAILPPLLFGAAWLDWIYKALVLLVIACPCALV
FT                   ISTPVSIVSGLAAAARRGILIKGGVYLEEGRKLKWLALDKTGTITHGKPALTDVMAWNG
FT                   TDPSAAERLAASLAIRSDHPVSQAVARAAQDKGLTPGEVADFAAMPGRGVRGHIDGALY
FT                   HLGNHRLVEELGVCSPALETNLATLETQGKTVVMLIGPDGVRALFGVADTIKDSSRQAI
FT                   KDLHALGIKTVMLSGDNPHTAEAIAQQVGIDKARGNLLPEDKQREIEQLSAQGTIGMVG
FT                   DGINDAPALARADIGFAMGAAGTDTAIETADVALMDDDLRKLPAFVRLSRSTAGVLKQN
FT                   IALALGIKVVFLVLTFTGQATMWMAVFADMGASLLVVGNGLRLLRK"
FT   gene            242784..243857
FT                   /locus_tag="Rpic12D_5353"
FT   CDS_pept        242784..243857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5353"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="KEGG: shn:Shewana3_4320 signal peptidase II;
FT                   TIGRFAM: lipoprotein signal peptidase; PFAM: peptidase A8
FT                   signal peptidase II; phosphoesterase PA-phosphatase
FT                   related; SMART: phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5353"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66577"
FT                   /db_xref="GOA:C6BR69"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR69"
FT                   /inference="protein motif:TFAM:TIGR00077"
FT                   /protein_id="ACS66577.1"
FT                   /translation="MNWKFLLYDWGGWNVALFQAINSGTPGALDPWAWLFSLVGSYWTA
FT                   PLMLLGLWWWSTSASNPTRACAVRHRLVTFGVAFALALLAASALKWGLDFPRPPAVLGT
FT                   LVHVIGVAELRYSLPSGHATYAALVVGALWPLMGRRGHLALVCYAALVGWSRIAAGMHF
FT                   PADVLAGWTLGAGCVVVAGHLVPLLAATWRNRGTPNAVWYGVAACCFMADQAAKFAITR
FT                   MFAYGERVEITSTFNLVYVRNPGAAFSFLANEAGWQRYLFIGLGLAVSAWLAHTLRKRL
FT                   SRMEALAYSLILGGAAGNLTDRVWRGQVVDFLDLHWMQLHWPAFNLADMAISAGAASLM
FT                   LAVLTQRHGITAKTLSG"
FT   gene            complement(243913..244251)
FT                   /locus_tag="Rpic12D_5354"
FT   CDS_pept        complement(243913..244251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5354"
FT                   /product="putative signal peptide protein"
FT                   /note="KEGG: rso:RS05404 putative signal peptide protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5354"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66578"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR70"
FT                   /inference="similar to AA sequence:KEGG:RS05404"
FT                   /protein_id="ACS66578.1"
FT                   /translation="MKHIKTFAILLALTAAPAAFAAESMDGMDMKPAGHAKQSPKPVAA
FT                   EIRKIHLDTGKVTLKHGAIDNLGMGAMTMTFAVKDKASLKNFKEGQSVLAVFDMVDGQP
FT                   TVVDLRSK"
FT   sig_peptide     complement(244186..244251)
FT                   /locus_tag="Rpic12D_5354"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(244248..247418)
FT                   /locus_tag="Rpic12D_5355"
FT   CDS_pept        complement(244248..247418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5355"
FT                   /product="heavy metal efflux pump, CzcA family"
FT                   /note="TIGRFAM: heavy metal efflux pump, CzcA family; PFAM:
FT                   acriflavin resistance protein; KEGG: rso:RS05405 cation
FT                   efflux system transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5355"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66579"
FT                   /db_xref="GOA:C6BR71"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR71"
FT                   /inference="protein motif:TFAM:TIGR00914"
FT                   /protein_id="ACS66579.1"
FT                   /translation="MIARLILASIRNRFLILLATLMLTAWGLWAVRSTPLDALPDLSDV
FT                   QVIIRTPFPGQAPQIVENQVTYPLTTTMLSVPGAKTVRGYSFFGDSFVYVLFEDGTDLY
FT                   WARSRVLEYLNQVQSRLPAAAKPALGPDATGVGWIYEYALVDKTGQHDLSQLRALQDWF
FT                   LRFELKSLPNVAEVASLGGMVKQFQVVLMPDRLRAYNLSQAKVLAALKGANQETGGSVL
FT                   ELGEAEYMVRASGYLKTLDDFRQIPLTTNDAGIAVRLGDVATLQLGPEMRRGIADLNGQ
FT                   GEVAGGVIVMRSGKNALETIEAVKAKLATLQKSLPAGVEIVPTYDRSALINRAVENLTH
FT                   KLIEEFIVVALVCLVFLFHLRSALVAIVSLPLGVLAAFLVMRYQGVNANIMSLGGIAIA
FT                   VGAMVDAAVVMIENAHKHLERWHEENPNRELEGHERWSVIGESAAEVGPALFFSLLIIT
FT                   LSFIPVFTLEAQEGRLFSPLAFTKTYSMAAAAGLSVTLVPVLMGYMIRGRIPTEQSNPL
FT                   SRWLIRLYQPMLAKVLAYPKATVGIAAVLLIATAWPVMRIGGEFMPPLDEGDLLYMPSA
FT                   LPGLSAGKAAQLLQQTDRLIKTVPEVASVFGKAGRADTATDPAPIEMFETTIQFKPREQ
FT                   WRPGMTTDKLVEELDRVVKVPGLSNIWVPPIRNRIDMLATGIKSPVGIKVAGTDLKEID
FT                   RLTTRIEEAVKTVPGVTSALAERLSGGRYIDVDIDRMAAGRYGLNIEDVQSIVSSAVGG
FT                   DNVGEVVDGLARFPINVRYPRDYRDSVEQLRSLPIVTDRGQQITLADVARIQVVQGPPM
FT                   LRSENARLSGWVYVDIRGRDLRSAVKDMQAAVAKAVPMPAGYALSWSGQFEYLERASAK
FT                   LKVVVPFTLLIIFVLLYLVFGRIDEALLIMGTLPLALIGGFWLLYLLGYNLSVAGVVGF
FT                   IALAGVAAEFGVIMLLYLKQAWTERQEAGQNTIPALLEAIQEGAVLRVRPKAMTVAVIL
FT                   AGLIPIMWAHGTGSEIMQRIAAPMVGGMVTAPLLSLFVVPAVYLLIRRRQTKSSPLPTH
FT                   PSHQEESP"
FT   sig_peptide     complement(247326..247418)
FT                   /locus_tag="Rpic12D_5355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.737 at
FT                   residue 31"
FT   gene            complement(247415..248947)
FT                   /locus_tag="Rpic12D_5356"
FT   CDS_pept        complement(247415..248947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5356"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   rso:RS05406 putative cation efflux system transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5356"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66580"
FT                   /db_xref="GOA:C6BR72"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR72"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACS66580.1"
FT                   /translation="MKKLVIATAVGLVLIGTAIYGAYRVGVTQGARLAPSSMPASSASG
FT                   LKAGDVDPQTGKKVLYWHDPMVPGQRFDKPGKSPFMDMQLVPVYAEGDGGSGIAVDSRV
FT                   AQNLGIRTTEVKAGRLSAVLEAPGNIAIDERSVQVIQARTNAFVQHVAVRATLDPVRRG
FT                   QALVTLYSPDWVAAQEEYLAVLRQSAHGQADLAGAAKARMLQAGMTPGQVSAVEASGRL
FT                   QPSVGIASPIDGIVTEVAVRDGMTVSPGMTLFRLADLSQVWVIAEVPEGQARIISPGLA
FT                   VKVTPTGAVEPLVGKVDTVLPDVNPATRTIKVRIVLPNKGRHLLPGMFATVRFDSGEHQ
FT                   DVLTIPLEAVIRTGQRSIVMVDGGQSGFVATEIKTGREAGGMVEVLAGLKAGQKVVTSG
FT                   QFLIDSEASLRGTTERMAAPAAASEPAAATTEHEGVGRIEAVTGEGLTISHGPIPSIQW
FT                   GAMTMDFAAPSAGLPKGLKAGDRVRFRFHLDKDGMAVLSSVAPAGADQGGKP"
FT   sig_peptide     complement(248882..248947)
FT                   /locus_tag="Rpic12D_5356"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.851) with cleavage site probability 0.409 at
FT                   residue 22"
FT   gene            complement(248944..250245)
FT                   /locus_tag="Rpic12D_5357"
FT   CDS_pept        complement(248944..250245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5357"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   reh:H16_A2185 cobalt-zinc-cadmium resistance outer membrane
FT                   porin"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5357"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66581"
FT                   /db_xref="GOA:C6BR73"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR73"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACS66581.1"
FT                   /translation="MLFPRRLTLALLCAPAFGIAMSHAATSQSVPTLSVEETVALATAH
FT                   AGDAESSRGTIDAATQMAVAAGQLPDPVLKLGINNVPVNGPDQFSVSRDFMTMRSISVM
FT                   QEFTRPDKRRAKVARFEAEADAAEAQRAVSMANVQRNAVSAWLDRWYAEQTGTLLGHHG
FT                   HPLELALQAATAAYRSGRGTRADVLAMELEIQKLQDRLDENRAAVAASAVALERWIGPA
FT                   ATRPLSEPPRLDVPLPVERLARGELDTVPEVAAAQREVGLAESEIRAAAQAKKPDITVE
FT                   LMVSQRGSAFSNMGSVNVSFPLPWDQGNRQDREVAARLAQAQAARAKSEILRRDTQAMV
FT                   GAKLAELQRNLERLKRYDEKTLPLASTQAEAALTAYRANTGSLLAVAEANHRAIDTELE
FT                   RLALEAKTAKLWADLTFLVPLPTAQTESAIKERK"
FT   sig_peptide     complement(250171..250245)
FT                   /locus_tag="Rpic12D_5357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.818 at
FT                   residue 25"
FT   gene            complement(250316..250603)
FT                   /locus_tag="Rpic12D_5358"
FT   CDS_pept        complement(250316..250603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A2184 hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5358"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66582"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR74"
FT                   /inference="similar to AA sequence:KEGG:H16_A2184"
FT                   /protein_id="ACS66582.1"
FT                   /translation="MKAALTESCADMANGTDQGSSQDKDNGALCLAHCQADSKSADHVA
FT                   PQLPVFLPVLTGVIEPAPVAFANIRTVLRTQVAARAPPPPLAVLYCSFQT"
FT   gene            250966..251394
FT                   /locus_tag="Rpic12D_5359"
FT   CDS_pept        250966..251394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5359"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="KEGG: mpo:Mpop_2538 transcriptional regulator, MerR
FT                   family; TIGRFAM: Cu(I)-responsive transcriptional
FT                   regulator; PFAM: Transcription regulator MerR DNA binding;
FT                   regulatory protein MerR; SMART: regulatory protein MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5359"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66583"
FT                   /db_xref="GOA:C6BR75"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR75"
FT                   /inference="protein motif:TFAM:TIGR02044"
FT                   /protein_id="ACS66583.1"
FT                   /translation="MNIGQAASVSGVSAKMIRYYESIGLVASAARSAGNYRTYGDNDIH
FT                   ALRFIGRARALGFSMEQIRELLGLWENKRRASATVKAIALQRIQELDARIAALTGVRDT
FT                   LMYLAQHCDGDDRPACPILDAISSAVPERQPVAHATRH"
FT   gene            251407..253800
FT                   /locus_tag="Rpic12D_5360"
FT   CDS_pept        251407..253800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5360"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="KEGG: rme:Rmet_6119 heavy metal translocating P-type
FT                   ATPase; TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; YHS domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase; SMART:
FT                   TRASH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5360"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66584"
FT                   /db_xref="GOA:C6BR76"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR76"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACS66584.1"
FT                   /translation="MNDKRPHPHTSSPAPGHVGGDLCAQGGDHQHAMAKQLTLVTATED
FT                   RDPVCGMAVKLGTPYQSNYAGARYVFCSAACQRKFEAEPAKYVSAGDEASAAPGAVYTC
FT                   PMHPEVRQDHPGSCPKCGMALEPEMPSLDADENPELAAFRRRFWWTLPLTIATALLAML
FT                   GEHAWAMGPTVQSWVEFALSAPVVLWAGFPVYARCLQSFRNRSPNMWTLIGLGTGAAFV
FT                   YSVAATVAPDLFPRSFVVHGRIAVYFEAAAVIISLTLLGQIFELRARSQTSAAIKSLLG
FT                   LAPKTARRINPDGSEEDIPLTHVHVGDLLRIRPGEKVPTDGVVIEGVSAIDESMITGEP
FT                   LPVFKRAGDHVIGATLNTSGSLVMRSEKVGAQTVLSQIVQMVAQAQRSKAPMQRMADQV
FT                   AGVFVLVVVAIAVLAFFGWGLFGPEPSWVFGLVNAVAVLIIACPCALGLATPMSIMVAS
FT                   GKAATQGILFRDAAAIEHFRKVDTLIVDKTGTLTEGRPVFERALAVDSLDETTVLRLAA
FT                   SLDQGSEHPLAATIVAAARERGLTLAKVEHFASDAGMGVRGRVDGHQLILGNASLMRRE
FT                   QVDIESQALRANVLGQYGASVMYLAVDRKLAGLLTVSDPVKASTPEALAALKAAGIRVV
FT                   MASGDSIATTRAVAGPLGINEFHGEVKPADKLALVAKLQSEGHVVAMAGDGINDAPALA
FT                   KADVGIAMGTGTDVAMHSAQVTLVKGDLRGLARARELSQATIANMKQNLGFAFVYNALG
FT                   IPLAAGVLYPFTGWLLSPMIAALAMSLSSVSVISNALRLRTQVF"
FT   gene            254424..254654
FT                   /locus_tag="Rpic12D_5361"
FT   CDS_pept        254424..254654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5361"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo3114 hypothetical secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5361"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66585"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR77"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66585.1"
FT                   /translation="MHSILRIIVLVSLGVAAGAAFAGPNWDAINSARAAAKRSAAAPGA
FT                   ASAKDAMQKQCAEMMKSSADSASPKGPSEAK"
FT   sig_peptide     254424..254492
FT                   /locus_tag="Rpic12D_5361"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            254788..255093
FT                   /locus_tag="Rpic12D_5362"
FT   CDS_pept        254788..255093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet4577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5362"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66586"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR78"
FT                   /inference="similar to AA sequence:KEGG:Bpet4577"
FT                   /protein_id="ACS66586.1"
FT                   /translation="MRTRSVMATALALALLGAGGWSAAAGPSRATEGAKASPQDPMHSM
FT                   MMGHMMDGGMMGGCPMMGQLPPGNEKLSMQMHGEMMQAMGEILRKYADKIQTPSSK"
FT   sig_peptide     254788..254880
FT                   /locus_tag="Rpic12D_5362"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.738 at
FT                   residue 31"
FT   gene            255142..255387
FT                   /locus_tag="Rpic12D_5363"
FT   CDS_pept        255142..255387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5363"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet4578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5363"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66587"
FT                   /db_xref="GOA:C6BR79"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR79"
FT                   /inference="similar to AA sequence:KEGG:Bpet4578"
FT                   /protein_id="ACS66587.1"
FT                   /translation="MKCNTRTMVAVGAALVAILAVAYAVFPSVRAFVLGIGPYLLILVC
FT                   PLSMWLMMKGMQGQDDQRRSMREDTPERKQPFRIEK"
FT   sig_peptide     255142..255216
FT                   /locus_tag="Rpic12D_5363"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.544 at
FT                   residue 25"
FT   gene            255546..256208
FT                   /locus_tag="Rpic12D_5364"
FT   CDS_pept        255546..256208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5364"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: nha:Nham_4413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5364"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66588"
FT                   /db_xref="GOA:C6BR80"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR80"
FT                   /inference="protein motif:PFAM:PF04140"
FT                   /protein_id="ACS66588.1"
FT                   /translation="MSIMSSFSAHYGHWNLVAVLVGVVSWILYRYVAPQGWREWTGAGL
FT                   VQAFVIALYAEMYGFPLTIYLLTGFLGIDIPLTAYSGHLWATLLGYGMAGAMVEMVIAT
FT                   VFILPGLILLIWGWSTVYRACRAGRIAQEGPYGFVRHPQYLGIMLAVFGQLVHWPTLIT
FT                   VVLLPVIVFVYVRLARKEEQDMVSRFGAAYEAYRRRVPMFVPGRSQWKQLFSTHVGS"
FT   gene            256267..256596
FT                   /locus_tag="Rpic12D_5365"
FT   CDS_pept        256267..256596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5365"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   pol:Bpro_3498 nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5365"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66589"
FT                   /db_xref="GOA:C6BR81"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR81"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ACS66589.1"
FT                   /translation="MRTKWIIAIIPTELLESLERQLATAHAPGLTITKVKGYGEYKNFF
FT                   SSDLTTVHTKVEIFADEAEVEAITNAIVEVGKSTVPGAGIVAVVPVEGFLHLHVPPGES
FT                   AGPAE"
FT   gene            256737..258683
FT                   /locus_tag="Rpic12D_5366"
FT   CDS_pept        256737..258683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5366"
FT                   /product="Protein-disulfide reductase"
FT                   /EC_number="1.8.1.8"
FT                   /note="PFAM: Thioredoxin domain; KEGG: reh:H16_A3455
FT                   thiol:disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5366"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66590"
FT                   /db_xref="GOA:C6BR82"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR82"
FT                   /inference="protein motif:PRIAM:1.8.1.8"
FT                   /protein_id="ACS66590.1"
FT                   /translation="MGWSVAATRTGGGGRVRGVAPAQLVLLLLAVLWFCVAGSGGVAHA
FT                   AEEENLLPPEQAFRFAARQLDDRSIEVHFDIADGYHLFRERFVFAAQPAGVKLGTPEFP
FT                   PGQVKFDEALGKQMEIYHGGVTIRVPVAVVPADGEWLLTVTSQGCADKGICYPPMHSVY
FT                   KVGGGLLGGLFDKHRSSRPMTSPVPPAMPILPSLGEGQIGPAVPSAAPRNDDGDRVAHV
FT                   LAGHQLGRIATVFFGLGLLMTLTPGVLAMVPILSSIVVGEHVTRGRALVVSLAYVLGTA
FT                   VADAGVGVAAGLLGERFSTGLLTPWALGAFTMLAVALALSMFGLYELGRLPPMTASSNR
FT                   WSGGRIAVAAAAGVISALVVVRSVPVPLSGTLTDAEQTGDAIGSGGALFGMAIGMGAPL
FT                   VLVGVATGYLVPRAGHWLMVTKRFLGFLLLGEALWAVSPLLPPWALMAAWAMLLLIASA
FT                   FLGAFGSLGPEPRSLTRLGKGMGMVAALAGAILLVGLASGGRDLLQPLSHLRAGLMAPA
FT                   STAGPALVRFERIRSVAELDARLVQAAAAGKPVLLDFYADWCVSCKEMERLTFSDPRVQ
FT                   ARLADVVLLQADVTRNSADDRTLLKRFGLFGPPGIILYGADGRESPVRVIGFQSASLFL
FT                   DSLAKAFGDDGKH"
FT   sig_peptide     256737..256874
FT                   /locus_tag="Rpic12D_5366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.741) with cleavage site probability 0.741 at
FT                   residue 46"
FT   gene            complement(258763..259437)
FT                   /locus_tag="Rpic12D_5367"
FT   CDS_pept        complement(258763..259437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5367"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: pol:Bpro_3501
FT                   cytochrome c, class I"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5367"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66591"
FT                   /db_xref="GOA:C6BR83"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR83"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ACS66591.1"
FT                   /translation="MIQRPALHAIGIALASLAFGAPARAEGDPARGAQAARTCMACHSF
FT                   APSRHLTGPSLAGVLGRKAGTADGFARYSDALKQSGLVWDKRNLDAWLENPAALVPGNA
FT                   MTFPGIADARTRADLVAYIEAVSTGRVKVPDRGLPNLKESDAASRVTSIRFCGDTYRLT
FT                   TADRKAHVFWEFNLRFKTDGSAAGPAAGQPVLIGTGMQGDRAAVVFARPEEISAFIQRR
FT                   CP"
FT   sig_peptide     complement(259360..259437)
FT                   /locus_tag="Rpic12D_5367"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 26"
FT   gene            complement(259484..259846)
FT                   /locus_tag="Rpic12D_5368"
FT   CDS_pept        complement(259484..259846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5368"
FT                   /product="Secreted repeat of unknown function"
FT                   /note="PFAM: Secreted repeat of unknown function; KEGG:
FT                   bac:BamMC406_0743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5368"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66592"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="InterPro:IPR014558"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR84"
FT                   /inference="protein motif:PFAM:PF03640"
FT                   /protein_id="ACS66592.1"
FT                   /translation="MSRTLMMLALGAVASFPALAEPPEVMQGKLVDEHKMTLYVFDKDT
FT                   AAGKSACNGTCATNWPPALADSYDKASGDWSFITRDDGKRQWAYKGHPLYRWSKDQKPG
FT                   DTTGDGVIGAWHVARP"
FT   sig_peptide     complement(259784..259846)
FT                   /locus_tag="Rpic12D_5368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            260010..260348
FT                   /locus_tag="Rpic12D_5369"
FT   CDS_pept        260010..260348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5369"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66593"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR85"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66593.1"
FT                   /translation="MGAMVERFVTPINQMPTRPVKANLDAPPDDQTTTTGLATGDTLAF
FT                   DIGPNAELRLRRVGWRVPAAAFGDAMILLRTRCADLIKAAGLLQQRPTRQAGYMHADRF
FT                   NITNRGLQ"
FT   gene            261262..262128
FT                   /locus_tag="Rpic12D_5370"
FT   CDS_pept        261262..262128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5370"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: rme:Rmet_6131 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5370"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66594"
FT                   /db_xref="GOA:C6BR86"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR86"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACS66594.1"
FT                   /translation="MHICVSCHTPLRPFAWSCSACGWRATIRDGVACLAPEMLQDNDGF
FT                   HEPLFEEYQKLQADHFWFVHRRRLIVWALQRHFPQLQSFLEVGCGTAENLAAIADRFRH
FT                   AEVCGGEPSLNALQMARRHCGAKFLQMDARAIPFVEAFEVVGAFDVIEHIDDDRRALSE
FT                   MYKACRRGGGLILTVPQHPRLWSRVDDAAKHKRRYTRRDLIEKLRATGFRPLYVNSFMS
FT                   LLLPVMVLSRLHQKIARTEQEVDEGFRIGKTLNRLFSTVCNVESRLLTRGIHFPAGGSL
FT                   LAIAVKE"
FT   gene            262197..262592
FT                   /locus_tag="Rpic12D_5371"
FT   CDS_pept        262197..262592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5371"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: rme:Rmet_6129
FT                   GtrA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5371"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66595"
FT                   /db_xref="GOA:C6BR87"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR87"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ACS66595.1"
FT                   /translation="MTNRHRFYRYLASGGVSTAAHYLTLYALVQMGTEPVLGSTIAALV
FT                   GLVLNYSVSRRWVFDASAKIPETLARFALVWMLALLINAWALASLLALGFHYLVAQVTA
FT                   TGVLVLINFNLHRRWTFSGARVPPLDK"
FT   sig_peptide     262197..262280
FT                   /locus_tag="Rpic12D_5371"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.607) with cleavage site probability 0.408 at
FT                   residue 28"
FT   gene            262670..263077
FT                   /locus_tag="Rpic12D_5372"
FT   CDS_pept        262670..263077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5372"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5372"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66596"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR88"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66596.1"
FT                   /translation="MRKSTVISILATLASFPTIASAFVLHLEHGFGTHNPVVTLGGMQP
FT                   SSALPEEIDVSLKRGDILSKTLSSQQRYSMRLVNRGSVSVKLRLDIQDAGGIGALPGTQ
FT                   PIDLVLEPGEARELAMEAWTPMMVVVSTAAP"
FT   sig_peptide     262670..262738
FT                   /locus_tag="Rpic12D_5372"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.776 at
FT                   residue 23"
FT   gene            263223..263477
FT                   /locus_tag="Rpic12D_5373"
FT   CDS_pept        263223..263477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5373"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66597"
FT                   /db_xref="GOA:C6BR89"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR89"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66597.1"
FT                   /translation="MSPLQLFVILAGLTGQLFIARKDPRGYLAWIAGNMGLVFVYWETK
FT                   QFALIALQFVNTGIQVTALIAWRRAKRCNETSPAQPCEA"
FT   gene            complement(263494..263907)
FT                   /locus_tag="Rpic12D_5374"
FT   CDS_pept        complement(263494..263907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_5976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5374"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66598"
FT                   /db_xref="InterPro:IPR031560"
FT                   /db_xref="InterPro:IPR038674"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR90"
FT                   /inference="similar to AA sequence:KEGG:Rmet_5976"
FT                   /protein_id="ACS66598.1"
FT                   /translation="MNRNGLASLMLAVLFAASSAAWASDKFRGDGGDNWIEHVRQSPSA
FT                   PPSNMNKTALLFGSPAPASMAARTVVVKPGMKYINVDSGETIAFSTGTGTQAWTFIEAM
FT                   QSTSVDLGVLLPDAPEAKGVRVIIARSTWFTGS"
FT   sig_peptide     complement(263836..263907)
FT                   /locus_tag="Rpic12D_5374"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 24"
FT   gene            complement(264055..264975)
FT                   /locus_tag="Rpic12D_5375"
FT   CDS_pept        complement(264055..264975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5375"
FT                   /product="copper resistance B precursor"
FT                   /note="PFAM: copper resistance B precursor; KEGG:
FT                   tbd:Tbd_1325 copper resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5375"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66599"
FT                   /db_xref="GOA:C6BR91"
FT                   /db_xref="InterPro:IPR007939"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR91"
FT                   /inference="protein motif:PFAM:PF05275"
FT                   /protein_id="ACS66599.1"
FT                   /translation="MLPRVQRWLCLVAAPLALTVDAAGAQTAGSSMQAMPQKRQGMPDQ
FT                   VLSQGANMSASPERAANTEESGINVILKSDEPRVPMRDPKRGITMPGNTMADNDVYHQF
FT                   LFDRFEAIRAPAATGLAWDMHGWIGKDINRLWLKLQGMRLFGKTEDAKVEALWGHAFAP
FT                   FWDWQTGIRRDFGGGPARTWAAFGIQGLAPYWFDAEATLYVSNAGRVAARVRSTYDVRF
FT                   SQRIVLTPEIEANAYAKTDEAREIGSGLADLRLGLRLRYEVRRDFAPYIGVVWGKKMGK
FT                   TADFARAAGQSATDRQIIAGIRWWF"
FT   sig_peptide     complement(264907..264975)
FT                   /locus_tag="Rpic12D_5375"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.676 at
FT                   residue 23"
FT   gene            complement(264998..266853)
FT                   /pseudo
FT                   /locus_tag="Rpic12D_5376"
FT   gene            complement(266864..266986)
FT                   /locus_tag="Rpic12D_5377"
FT   CDS_pept        complement(266864..266986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5377"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66600"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS66600.1"
FT                   /translation="MVSEDNNAAVAPSALGMPHATDIESRWGLSFVTQDHNLPT"
FT   gene            267063..269348
FT                   /locus_tag="Rpic12D_5378"
FT   CDS_pept        267063..269348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5378"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   copper-translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: bac:BamMC406_3390 heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5378"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66601"
FT                   /db_xref="GOA:C6BR93"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR93"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACS66601.1"
FT                   /translation="MTRQHSHKEAASRQENANAPQTHNEYTHQRLCDSDDQHAHSPPVP
FT                   EAVESDKAGVSSTTEFAPTVYTCPMHPEIRQDHPGTCPKCGMTLEPVMPAVEEEENAEL
FT                   ADFRRRFWASFPLTAIVFVLAMAGHRLTRLDPAWQDRFELALATPVVLWAGLPFFRRCA
FT                   QSFVYRSPNMWTLIGLGTGAAYLYSAVAVVAPGVFPSTFAASGRVQVYFEAAAVIISLT
FT                   LLGQMLELKARSQTSAAIKSLLGLAPKTARRINADDSEEDVPIAHVHVGDLLRVRPGEK
FT                   VPVDGVVVAGASALDESMITGEPIPVSKRAGDHVIGATMNTSGALVVRSEKVGAQTVLS
FT                   QIVQMVAQAQRSKAPMQRMADKVAGVFVIGVVGIAVMTLFAWGIWGPQPSWAHGLINAV
FT                   AVLIIACPCALGLATPMSIMVASGKGAEHGILFRDAAAIENLRKVDTLIVDKTGTLTEG
FT                   RPSFDRAIGLNGFSDMDVLRLAASLDQGSEHPLAAAIVAQAREQGLALERPEDFESASG
FT                   IGVRGHVAGRSLALGNTSLMQAHAVAVDAASTEADAMRARGASVMYLAVDGVLAGLLSV
FT                   SDRVKTTTPQALTQLRADGLRIVMATGDGNVTAQSVAKQLGIVEFRGEVKPADKLALVA
FT                   TLQERGLVVAMAGDGINDAPALAKADVGIAMGTGTDVAMNSAQVTLVKGDLRGIARARA
FT                   LSEATIANMKQNLGFAFLYNALGVPLAAGVLYPFTGLLLSPMIAALAMSLSSASVVANA
FT                   LRLRATRL"
FT   gene            269432..270340
FT                   /locus_tag="Rpic12D_5379"
FT   CDS_pept        269432..270340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_3435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5379"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66602"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR94"
FT                   /inference="similar to AA sequence:KEGG:Bind_3435"
FT                   /protein_id="ACS66602.1"
FT                   /translation="MQGATKSTHWGKVWLAGALAWLCSTTALAGESPFGWIYTADVMPK
FT                   GRFEFEHQSFLQRGQSQGSYSGLLNREEVEYGVTDKFQLAGYFNWSYVNANRNGLDGTT
FT                   RGPLTDLGPNDDPTGRYRKTRFETVSLEAIYQLMNPVTDPIGLALYIEPELGPRERDLE
FT                   WRIILQKNWLDDRLIFAANILGAHERDKTAMGDIERASMLDLTAGVSYRLTDNLSLGME
FT                   ARNHREFQGYRYNRRDHSAWFLGPNLHYATKHWWVTAAWRHQLPVVKTYNEDQADVVAG
FT                   NRIFGDEHARNEFMVKVGFPF"
FT   sig_peptide     269432..269521
FT                   /locus_tag="Rpic12D_5379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            270368..270889
FT                   /locus_tag="Rpic12D_5380"
FT   CDS_pept        270368..270889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5380"
FT                   /product="FMN-binding domain protein"
FT                   /note="PFAM: FMN-binding domain protein; KEGG:
FT                   reu:Reut_A1179 FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5380"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66603"
FT                   /db_xref="GOA:C6BR95"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR95"
FT                   /inference="protein motif:PFAM:PF04205"
FT                   /protein_id="ACS66603.1"
FT                   /translation="MKWTPMAAVPLAVLVVPVQATEYLTVQQAQAQMFPGASFQAVPLQ
FT                   ITDQIRETLNERSGVHEPFNDKGVWKVSTGGWFIVDRVVGKHEKITYAVALDAKGAVRA
FT                   VDILTYQETYGYEVRNADWRAQFVGKTAQDAVQLGKDIRNISGATLSCKHITQGVKRVL
FT                   AVYDLLLAKM"
FT   sig_peptide     270368..270430
FT                   /locus_tag="Rpic12D_5380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            270886..271734
FT                   /locus_tag="Rpic12D_5381"
FT   CDS_pept        270886..271734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5381"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: reu:Reut_A1180
FT                   ApbE-like lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5381"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66604"
FT                   /db_xref="GOA:C6BR96"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR96"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ACS66604.1"
FT                   /translation="MIRRSKPLLGTFVEVRIDDVYPQDCAHLAETAIAAAFSVIEQAEA
FT                   LMSFQRSDSDLSRLHAASVGEAVRVHPWTMRVLREAQRMHERTGGVFDPTVARMLVAHK
FT                   ILPRPAGPTAEVDVRFADVVMLDENRISKRRALWLDLGGIAKGFAVDMAILSLRRHNVR
FT                   SGAVSAGGDLRVFGKHAQPIHVRSANAPGRLELLGRLTNGAVATSGHYFAESFGLPPGT
FT                   ASIRSQQAPMEAPCAERTVTVIAPRCIWADALTKVAMLAGTTAPATVRALSSYHAHVVA
FT                   S"
FT   gene            271731..272222
FT                   /locus_tag="Rpic12D_5382"
FT   CDS_pept        271731..272222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc0612 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5382"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66605"
FT                   /db_xref="GOA:C6BR97"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR97"
FT                   /inference="similar to AA sequence:KEGG:RSc0612"
FT                   /protein_id="ACS66605.1"
FT                   /translation="MTQSSHRHPLKGTGIRLHPYHYWVALAVLLAVAVSGLIWTVLHDL
FT                   LQWEDAPIVRQILQLHGAFAFCSLILLGSMLPQHIRFAWVARRNLVTGTLTGIVFLLLT
FT                   ITAYGLYYGPEDWSGLTKTVHLVLGIAAVAAVPLHMFIGRKRHNGYRAPASKNVRHEKT
FT                   "
FT   gene            complement(272353..272586)
FT                   /locus_tag="Rpic12D_5383"
FT   CDS_pept        complement(272353..272586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_6121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5383"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66606"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR98"
FT                   /inference="similar to AA sequence:KEGG:Rmet_6121"
FT                   /protein_id="ACS66606.1"
FT                   /translation="MNILKKSALVGAALLALGVNVANAATATGARDPYTDGANAMGKRD
FT                   PYTDGGRAARDIYTDGAHSMGTRDPYTDGGHQ"
FT   sig_peptide     complement(272512..272586)
FT                   /locus_tag="Rpic12D_5383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 25"
FT   gene            complement(272718..273044)
FT                   /locus_tag="Rpic12D_5384"
FT   CDS_pept        complement(272718..273044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rpic12D_5384"
FT                   /product="protein of unknown function DUF326"
FT                   /note="PFAM: protein of unknown function DUF326; KEGG:
FT                   azo:azo1773 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rpic12D_5384"
FT                   /db_xref="EnsemblGenomes-Tr:ACS66607"
FT                   /db_xref="InterPro:IPR005560"
FT                   /db_xref="UniProtKB/TrEMBL:C6BR99"
FT                   /inference="protein motif:PFAM:PF03860"
FT                   /protein_id="ACS66607.1"
FT                   /translation="MPHQYFQTCIDECAACHVACLHCAASCLTEKDALTLSTCIRLDLD
FT                   CADICGTAVGLMARGSTQANAICELCAKICQACAAECAKHSHEHCQQCARACETCADAC
FT                   RAVH"
XX
SQ   Sequence 273136 BP; 51281 A; 82265 C; 86006 G; 53584 T; 0 other;
     gtcgccatgt tgtgatgcgt gcacatactt tcaaaaacgt cataggtaag caagatttcg        60
     gacaggttgg actgcgcctg tgccgtcatc ctggtcgagc cggcgcatca cgtcagcgag       120
     cggacgccca aagttcagga gcggatcggc agccggacgg taaatcgagt acggtcgtgc       180
     gcgcgtgtaa cagaaatgat tcccccatgg gcgagaacga ttgctttggt gatggccaag       240
     ccaaggcctg ctccgtcaga ttcgggacgc gcgcgtgact tgtctgcacg aaagaagcgc       300
     tcgaagatga acggcagcac gtcaggagca atcgcttcgc cgtcgttgtc gatcgtcacg       360
     gcgagatcct cctcgcctgg cttgatggaa acgatcacac ggccgcacct gggcgtgtgc       420
     cgtattgcat tcgacaacag attgctgaag gcgcgtctga gcatgagccg atcgccgcgc       480
     acctgcgctt gtccttccac ttgcaactgc acggctttgt cctctgcaaa cgcatcgtag       540
     aactcaaaga gggcacgcac ctcgtcggca agctcgatca tctcggcact aggcagcgtc       600
     aggttgtgct ccatcttggc tagataaagc atgtccgaca ccatccgagc cagccgctgc       660
     agctcttcca cgtttgaagc aaggacgtct ctgtatttcg caggctcgcg agtctgtgag       720
     agtgccacct cggtttgcgt caacaggttg gtgatcggtg tgcgtagctc gtgtgcgata       780
     tcggtcgaga agtcggtgag tcgctggaaa tcgccctgca ggcgcgcgag catgccgttc       840
     aacgtcacgc caagatcggc aacctcgaca ggtaccatat caaccggcat ccgttcgttc       900
     aggcggtcgg cagttacaga cttcgctcgc gaagccattg cgcgcaatgg caacagcccg       960
     cgccgggccg cccaccatcc gaataggccg ctcgccaagg cggccaacgc gatgtagagc      1020
     atcaacgtct tccgaaacgc tcgtaggaaa tgcgcatgga tctccgtatt gatgcccacc      1080
     aacacgtcga gcgcatcgcc gtcgcgcagt ggcacttgca tatgcacacc ccggtattgc      1140
     tcttcgccct gctgccaaac aagggccccg gaatggcggc ctgccttgcg cagcacgcgc      1200
     aacacctccg caaagtcaaa gttgggggta gcaaaaaggg gctgaccctg tggcgcctgg      1260
     acccgcacaa tcagatccgt gcgatgctgc aacacgtcgt tgagtcgagt ggagacctcg      1320
     gccgcagaac tactctcaac cacccggcga atgacgttca cgttctcgcc caacgccgta      1380
     aagtcttcca cggcaaagtg ttcctccatc gccagggcaa tcagaatgcc gaggcccaac      1440
     aacacggccg ctgacgacaa ggagaaatat gcggttagcc gcgccgtcaa tgaaaggcgc      1500
     cgcattactc cccatcctcc gggccttcga ggacataacc cataccacga acggtatgga      1560
     tcaatttggg ttcgaagtta tcgtcaattt tggcgcgcag gcgtcgaatg gcgacgtcaa      1620
     tcacgttggt gtcgctgtcg aaattcatgt cccagacttg ggacgcgatc agggatcggg      1680
     gcagcacctc cccatgacgg cgggctagca gttcgagcaa cgagaattcc ttactggtca      1740
     acgcgattcg ctgcccgccg cgggaagcac ggcggcgagt cagatccagc accaggtcgg      1800
     ccacctggat gcgttctgca agtgatggcg cactgcctcg tcgaagcagg ctccgaacac      1860
     gggcgagcaa ttccgcgaat gcaaaaggtt tcaccaagta atcgtccgcg cctagttcca      1920
     agcccttgac ccgatcggcg acgctatcgc gcgcggtcag aaacagcacc ggtacggcca      1980
     gttcagctga gcgcagcgcg tgcagaatct gccacccctc gagatcgggc aacatcacgt      2040
     caaggatcaa gaggtcatag tcgcccgtca ttgcaagatg acggccgtcc atcccattac      2100
     gggcgaggtc aacaacaaag ccggcttccg acagcccctg ctgcaaatat tcgccagtct      2160
     tggattcgtc ttcgacaaca aggagcttca tgtctgtctc tttattactt atggcgcacg      2220
     aaaagtgcga tcggtatctt gtagcgtaca tggagccgcc tggttgctga ccaacctgac      2280
     caatatgtaa tgtatcggtc aggttaaagt agccttgcag tgattagtct gctcctgccg      2340
     tacaaatctc atcagggact tacgcaagga atcaagagat gcgcagcaat cgtgcaatgg      2400
     gcgtggtgct tccgaacctt cctcggaggc gatttgtgca gggcttggca gccggagggg      2460
     tgatcgccgg cctgggttta agcgggatgc ccgcgcgggc gtcgcaaccc cagggcgcgg      2520
     cctttggcac tgcgcccgtg ctgcgaggca cggagttcga tctggtgatc gccgagaccc      2580
     cggtgaactt caccggcaag ccaggcatgg ccaccaccat caatggcatg ctgcccggcc      2640
     cgacgttgcg ttggcgtgaa ggtgacacgg tcaccatccg ggtaaccaac cgcctgccgg      2700
     agcccacgtc aattcactgg cacggcatca ttctgccgtt ccagatggac ggcgtgcccg      2760
     ggatcagctt ttctgggatc gctccgggcg aaacattcac gtatcgcttc aaggtacagc      2820
     agagcggcag ttactggtac cactcgcact ccggcttcca ggaaatgact gggctgtatg      2880
     ggggcatcgt tatcgacccc gcgggcgagg accgcgtgcg ggccgatcgc gattacaccg      2940
     tcttgctctc cgactggacg gacgaggatc cgatgcgcgt cctaaccaag ctcaagatcc      3000
     agggcgacta ctacaactat aaccagccga ccgtggtcga tttctttcgc gacgtctcgc      3060
     gtgagggatg gacctctgcc atggacaagc gacggatgtg gaaccagatg cggatgaatc      3120
     cgaccgatct ggcggatctc tccagcgcaa cgctgaccta cctcatgaat ggcgtgacgc      3180
     cagcggggaa ttggaccggc ctattttctc cgggccagac ggtacggctg cgcttcatca      3240
     atggggccgg caacacgttc tatgacgttc gcattccggg cctgaaaatg aaggtggtgc      3300
     aggtcgacgg acaggatatc gagccggtgt cggtcgatga gttccgcttc ggccctggcg      3360
     agacctgcga cgtagtggtc gctccaacgg acgaggccca cacagtgttt gcccagacga      3420
     tggaccggac cgggtacgcc cgcggcactc tcgccgtgcg tccgggtgtg caagcccctg      3480
     tgccagctgt cgacaaggcc gaatggctga cgatggcgga tatgatgggt gacatgggtg      3540
     acatgtctgg gatgtctggg atgtctggga tgtctgggat gtctgggatg tctgggatgt      3600
     ctgggatgtc tgggatgtct gggatgtctg ggatgtctgg gatgtctggg atgtctggga      3660
     tgtctgggat gtctgggatg tctgggatgt ctgggatgga ccatggcgcc atggtcatgg      3720
     accacagcca gcatggaacg atgcagggca acgtcgcaaa ctccttgaag gtgccgagca      3780
     agaaggcccg tcatgcgcga acagagtacg gtccaagcac cgacatgcat gtcgatatgg      3840
     cgcggacaaa cctcgacgat cccggcattg ggctgcgcaa caatgggcga cgcgtgctgg      3900
     tcctgcagga catgcatacg atcggcggcc ccatggacgc ccgcagcccg cagcgcgagg      3960
     tggagttgca tttgaccggc aacatggagc gctacgcatg gtcgctcgac ggcgttgagt      4020
     tcggcaaatc aacccccgtc catttccgct atggggagcg tcttcgcgtc atccttcaca      4080
     acgatacgat gatgacgcac ccgatgcaca tgcatgggat gtggagcgaa ctcgaggcgc      4140
     cggacggtac attcttggcg cgcaggcaca cgattccggt gcagcccgcg cagcgcgtta      4200
     gcttccttgt cacggctgac gctctgggac gatgggcttg gcattgccat ctcatgctgc      4260
     atatggatgc aggtatgttc cgtgaagtga tcgtcgccta agcccggatc gacaagtcaa      4320
     atgaccacgc ataagcacgt taagacagca ttggcagttg ccttggccgt tgtcggcatc      4380
     aacgccgcgt cggcacagga atctacagct acctacgacg ccatggcgcc aagctcgggc      4440
     gccagcactc ggccgactgc ccatggctcg atgcagggca tggaccatgg ctcgaagcag      4500
     ggcatggacc atggctcgat gcagggtatg gaccatggct cgatgcaggg tatggaccat      4560
     ggctcgatgc agggtatgga ccagggctca atgcagggta tggaccaggg ctcaatgcag      4620
     ggtatggacc agggctcaat gcagggtatg gaccatggct cgatgcaggg tatggaccat      4680
     ggctcgatgc agggtatgga ccatggctcg atgcagggta tggaccaggg ctcaatgcag      4740
     ggtatggacc agggctcaat gcagggtatg gaccagggct caatgcaggg tatggatcag      4800
     ggctcaatgc agggtatgga tcatggttcg atgcaaatgc aaggcggctc accgcctcct      4860
     gatgcgcggg atccgaatgc atactcgggt ggatatcagt tgggtgtcgg aaagttcgcg      4920
     ctgggcaata cccgccagct catgatggcc gatgagcaca attttggatc gttcttgatt      4980
     gatcgcctgg agtgggtacg cggccccaac tccaacgccg cttcttacga agcgcaagcg      5040
     tggtacggaa gcacttacga caaggtcgtg ctgaaggcgg aaggcgatgt gaaaaaaggt      5100
     cgactcgagg aggcgcgtac cgagttgcta tgggggcatg cgatcacgac gttctgggac      5160
     acccagcttg ggattcgcaa tgacgttggc tcggggcgtc cagcgcggaa ctgggcggct      5220
     ttcggtgtgc aaggtctggc gccatactgg ttcaacatcc aggccactgc atacgttggt      5280
     aacagtggtc gtaccgccct gcggttgtcc acggagtatg agttgctgct gactcagcgc      5340
     cttatcctac aaccgcgcgt ggaggcgaac ctctacggaa agaatgatcc ggctttggag      5400
     atcggcagcg gcctgtccag cgctagcgtc ggattgcgtt tgcgttacga gttcagtcgg      5460
     caattcgcgc cttacatcgg cgtcgagcgg tatcagactt ttggcaacac cgccaacatg      5520
     attcgggcag atggcggccg aagcggtgag acccgatttg tggcaggcct gcgtgtttgg      5580
     tactagccat tctctattta caccaccagg aggtattgac atgttgaccc ctcgttacat      5640
     cgcaagcatc gctgtcgcgg catcggccat tttcgccagc acggccgcat tcgcgcatcc      5700
     taagctgctg tcttcgacgc ctgctgacaa agcggaagtc gccgcgccgg caaagatcga      5760
     gcttaagttc tcggaaaatc tctcgacgca attctcgggg gctaatctcg ttatgacgga      5820
     gatgcctggc atgtccagtc acgacgccat gaaagtcgcc gcgaaggtcg ccgccgacga      5880
     tgaccccaag acgatggtca tcacgcccgc acagccgctg atgacgggaa cctacaaggt      5940
     cgaatggcgt gctgtctcgt cggatacgca cccgatgacg ggaaacttct cgttcaaggt      6000
     gaagtaaagt tatggcagac gactggctca atatcgccct gcgctttgcg ctgtacgtgg      6060
     atctgacgat cctgtttgga gtctcgctgt tcggtgctta cgccttgcgc cccgatcatc      6120
     ggagctcagc gattgcgcgc cggtatgtct gcgccattgg cgtcgccgca gcttccggta      6180
     ttgtgctgtc tctctggagt atcgtagtga cggccaaagc gatgaccgga gccgccgaat      6240
     acgcggagtt gagcagccac gtcttcggca tgatgctgag tagcactgcg gttggcattg      6300
     ggtggttggt tcgtatcgca gccctggcgg cttgtttaat catcgtcatg tgtgtgcgta      6360
     ggatgccaac tctgcacttt gatatctttg ctgttctggg ggcggtagcg ctggcaacag      6420
     tggcctgggc agggcatggc gcgatgcacg acggttcgcg tggatacgtc cacatcacgg      6480
     ccgacatcgc ccacttgtta gccgcgggtg catgggttgg atcgctgaca gcgtttgtgt      6540
     tgcttgcgcg ggcgcagcag gcggcttcat tggagtcggt ggaaatcctc aaccacacgt      6600
     ccaacggctt cgcccgtctt gggacattga ttgtcgccac gctgctcgca acgggcgtcg      6660
     tcaactatct gttgatcgtg ggcccaacaa tcgacgggtt ggccacttcg gcatacggcg      6720
     tcctgttgtt ggccaagttg gcactgtttg ggcttatgct cgggctggcg gcagccaacc      6780
     gttacctgtt gagtccgcaa cttgaaatcg caatgcgcag cggcgaccac gctggcgcag      6840
     tcatgacact gcgccgcagc ctgctcacgg aggccagcct cgccgtcgtg atacttgctt      6900
     tggttgcgtg gctcggggtg ctttctccgc ctgggaccta attccgtcat tttcgtgtag      6960
     ccattcaacg ctccatgaca acgccattga actcgcagtc tatatccgcg tctaggcgat      7020
     ctctgatggt cggcctggct ctcttgcctg ccatagcttt ggcgcagaag tctgagccaa      7080
     agcctacatt ccaagtttgg aagacgccgg gttgtggatg ctgcaaggat tggttgtccc      7140
     acctgcggga caacggattc gatgtagtca cacacgacgt cgaagacacc gtcgaggctc      7200
     gacgcaagac aggcattccc gatcgctacg cctcgtgcca tacggcagcc gtgcagggct      7260
     atgccgtgga aggccatgtg cctgcgcgcg agatcaagcg cctattgcgg gaacgcccta      7320
     aggcaatcgg gctggcggtc cccagcatgc ccatcggtgc gcctggcatg gacggtccgg      7380
     cgtacggtaa tcgacgtatg ccgtacaacg tattactgat cggtttggat gggacatcca      7440
     ctgtgttcca agcgtacagc tgaacgaata gaagacgttg gccgtgaaaa cgatgggttc      7500
     accatgtatg tggccaacaa atctggcgat acaccgacgc aatcactggt tggctcacca      7560
     ggagcggtca tgaggaacat gtcggtggcc gacctgcctg ccgatgtact cgcggcaatg      7620
     gctctcgtct tcgtcacatg gattgttctc ctagtgggtt tcgcttggta cctgcgccgc      7680
     aaacatggcg taagacggca cgcagacgcg cgtgccgcta ttcatggccg ccgtagtaag      7740
     aaaccacgtc gacgcgcttt gcgacgaagc tctgggaacc catgatctgc cgcaggttcc      7800
     agggtgcctt gtgtcacgca ccgctaggaa ttcgccgtgt ttctcgccgc tgactacagc      7860
     gttcgagcga tagcttcgat cggcttgatc cccacgccaa aacgcgcaat gctatctcgg      7920
     tgttcggtga gactggtata gggaacatag cgaatgccta gttctgcaac cctgcggaaa      7980
     gcgggacgtg cgagttgggc gcgcacgtcc gcctctctgg catctggagc caccaggaat      8040
     aggtgtttcc ttgtcgcttg atctgtgccc aaagccagat ctagcagtcg tacgatgccc      8100
     gagtagatgg atgtggtgtg ttcgacctcg aaggcagctt ccacttccag cgagacagcg      8160
     ttcagccaga cgacatcgat gagaggcacg gtgtcagcgc ctgaaaccaa aagtgaattc      8220
     ggcaatgttg ccaggcagcc ctcgctgagc acgccgccat tgtaggggcg gctgcggtcg      8280
     ttggtcgcca cccagaccgc gaagcccaat gccttgccaa gatcgcgcaa ccagccttgc      8340
     acctctgtat gagaggcatc gtcggttcgg cctgcttgaa gttgcttggc gaaggaggct      8400
     gcttcctcgc gggccttagc cagatccttc tcccactcag caatcgtggt agcgccaccc      8460
     tcttgcggcg gagctggata gcgctccatt ccgatatcga acagcagtcc ggcaatcgca      8520
     cccaggtcat tggacagcag gtcgcggtag cgtccattca gggacagcac gccctcgcgc      8580
     atggccaagt agtggtccca tttgccgagc ttgacacgag agcccgtcag cgcgttgtat      8640
     ccattgacga tcgcagtgtt gaagggaacc gccaaagttg ggtggatgaa atacagcagg      8700
     ttggcaacgg ctgggcccag ccccttgatg ccgtgccggt tcaactgctg aatcgcttga      8760
     actacctctt gctcggtatc gcagcaattg cacgtatgca gcagtctggc gaacgctcgc      8820
     tgatgatctg cgttctcgta gatgtccgga atacgcaact tgggtttcca gaggaatgcg      8880
     tggtccgccc ccttgaagat ttggcgctgc tcggcaatcg cggagaccac ggtttcgaga      8940
     gaggatccgc gataggcgtt gccaaatgtc ccagcctgga tctcgttgac caccgtacta      9000
     atgccacgcc ggatggagcg gaaattcttg aggcgctcgg gccagagaaa ccacgtctgg      9060
     aaagttccgt ctctgtcagg cttccatcgc tcaatgagcg ttcttgttaa atcggtcatg      9120
     caaaatccac tatttttatc gtggcactgt ccgatcggga cagtgtatgt actttccggc      9180
     accgtttcaa tgctgattcg acagagttaa agcgacctat tcaccgccaa tctccgcgtg      9240
     ccatccacga aaaaaaggtg ccaggattgc gacaaacgca gtgcttgtta acaaaactgt      9300
     aatcgcagcg acagggtgct gtcgtcgtct acaacgtaga atttagcagc atggatgcat      9360
     tctcagcatt tgtgcggagc acgtcatgaa cctcatgcgg gccctccaaa gcgccctcat      9420
     gctcttgctg ctaggtttcg cgtctgggtg tacatccgtc gctacgacgc cagcgcagtt      9480
     tgggcatcca gtcgcaattg cacatgcgag ccgaacaatt attttgactc cacgcatcag      9540
     atacgtgcat gtgtacactg gtgaaacagt tgctttccgg attggggaaa aggaaattgg      9600
     ctggatgttc acggccccaa caatcggagg tggccaacca atcgatatgg gctcgatctt      9660
     tcctgatatt cctgaggcaa agggcatcgc gatttttatt gagcggagca atctttacag      9720
     ggcaggataa tcggtcgcga tgggaaaggc gaagcgccgc aagatggcgc gcggctacaa      9780
     cctccgcttc atgtggttca cattcttggg atgacatgcc gattttagct tgacgagagc      9840
     gagacctcga ttgacgagta tcgaatgttg tcgctttccc ctacttgacc acaatctttc      9900
     cgatcattcc ggcttcgtaa tgccctggta caaggcaagc aaaatcaacc atgccgggtt      9960
     catcgaatcg ccaaatgagt gctccttgtt ggccaggctc gagcgcgaga tgctttccaa     10020
     tagtgtggtg gctcatctcc ggcatcttgc gcatcatctc ggcatgctcc tttaagtcgg     10080
     cagcggtgcc gatcaccagt tcatggtgta ctttgccaat gttctcgaca acgaagcgca     10140
     cagtctcccc cactttgacg gtgagcgtgg tcggttggaa acgcatgtca tcgctcatag     10200
     tcacattgat ggtacgcgtc accttttgag gatctccagg ctggcctgcc ttcggcgcgg     10260
     gttcgctgga attggaaccg agaccttcga gttgattcgc cgcaccaaag gcggctaggg     10320
     gcgcaaaact cagtgctagg atggagcgag aaaacctgtt catgagcctc tcccttttgg     10380
     aaagcggttg aaatacttgg tgcggctcga cgttgccgcg gggtgggcgg aagccgttcg     10440
     ccaaaacggg gcccgcctct accgaatcgc gttggcttgg cgacaaaaac tcggcccgtg     10500
     gcatcaatga tagatcttgg aacactcgcc cgtcgatcgg cagttaccca tcagcagggg     10560
     caacatcaat tgcaatgaga cgcgtgctgg ttgaagctcg ccagttgcgc tgggagaaaa     10620
     tccgctcgag aaagaggggg cacagcgaag accaagcttt ctttcggacg gggcggctag     10680
     gcgtgcagat cccggtcttc aagcttgatc gtcggtgatg agctgaagcg gagcgcgtaa     10740
     tgtcaatcag atatcccgtg attactgaag gcgggtacgt tttgcgggcg tgcagcgcgc     10800
     tggcactggc ggcgatggtc agtggctgca caactgctta cgaaggcaaa tatgagtacg     10860
     ccgaaggctg gcggctaggc gtgatcgtaa gaaccggcac gctcgccgac atggcccctg     10920
     tggaggcaat gtgctcgctt gcagaccaga gcagcacggc acgctttgcc tatgtgcagt     10980
     tcatctttgg gccgacccac ggcaagtttc tttacagcgg accacaccaa cgccatgtca     11040
     tcgtgccgct gccgcaaggg ggtgggctgc acgaaggcgc gcgcgtctac ataaatctcc     11100
     aggattgcaa ccaagcggct gttcccgcat ccgcaactac tccataggct gcgcgctcac     11160
     ggggtagcgt cgtcagtccg agttgggccg ggtgaatcct caagagcctg cctcctttgc     11220
     cgccgccgcg agaatacgtc tagcgtgcgc cataaacgcc tgtgccggta gcgaaagagg     11280
     cacactggcc gcctgcaacg ccagcgtccg gaaacggatc ttcttgtcca aggggcgaaa     11340
     cgccgcgcct cgcgcgtcca gctcgctcaa tgcgagcggg ttcacaaggc caatgccgac     11400
     gccattcttc gccagcgacg cgacggtgat cgagtagggg gtctcgcagg ccaagcgcaa     11460
     cgtccgtccg tccactgcca gcaactcgtc gagttgacgg cgcgtcgtat cccggcgtga     11520
     cagggcgatg aacgggtgat cgcatagatc ggagagcttc acgcgtcgtt ggcgtgccaa     11580
     tggatggttg accggcatcg cgaccaccgc gttggttgtc acgatgggtg tggcggtcaa     11640
     tccttcgagt tcgacctcat cagcggcgaa gccgatatcg cactggcctc gcgcgacctg     11700
     atcacgcacc tgcacggagc tgccaatctc gaatcggacc agcacatcag gaaagtcctt     11760
     gcgcaaggcg gcaatgattc ttggcatcag acccaggccg agagcaggca aacaagccac     11820
     ggcaatgctt ccgcctgatc cagagcgcag ttgagtcgcg tactgctgca gatgatccag     11880
     gccggcatag gcacgctcaa tttccgcaaa ccacagcttc gcttccggcg tcgctcgcaa     11940
     ccgcgaacgc tctcgctcaa acaagcgcat ctgcaggctt gcttcgagct gggcgagcaa     12000
     ccggctgacc gcgggttgcg aggtatgcat gtactgagcc gcgcgggcag tcgtgcccgt     12060
     caacatgatc gcgcggaacg cctctatctg tctgtggttc atatcgattt tgaattgact     12120
     tgagtcaact tggcattgga aagaatagac cgagtgcagg atactcgcca gtcatcagga     12180
     agacaccatg ccaccgaata caacacccaa cttcatgacc tcgtcgccac gcttcagtgc     12240
     gctcactgtg ccggtgcacc gagcttcgac actggttttt gacacgacgg cccagttcct     12300
     tgcgcgtaaa ggccagttgt tcgacggcta ctcatacggg ttgtatggga cgccgacaac     12360
     ccgcgccctg gagacggaag ttgcttccat cgaaggtgga tcccgcaccg tgctggtgcc     12420
     ctccgggctg gccgcgctga cccatcccat gcttgctctc ctgtctgctg gcgaccacgt     12480
     cctggtggcc gactgcgtgt atgggccgac gcgcgagttc tgcaacagcg tcctcaggaa     12540
     aatcggtgtt gccgtcacct actttgccgc cgatgccgcg acgatcgacg cgcacctgca     12600
     aagcaacacg cgactcgtgc tgctcgaatc gcccggctca ttcacgatgg agatccagga     12660
     gatcgccgcc atctcccgcg aggctcacac tgccggcgcg ctggtcatgc tggacaacgc     12720
     atggggcttc ggcaactccg ccatgttcga gcatggcgtg gacatcgtct gcaccgcatt     12780
     gtcgaagtac gcggcgggcc actcggatgt ctgtttgggt tccattaccg tgcgtagcga     12840
     acgcttgttc cgccagatca agacgtttgt atcgggtgtt ggcaccgggg tttcgtcgga     12900
     tgacgcattc ctcgtgctgc gcggcctgcg caccctttcc gttcgcttgg ccgaacacgc     12960
     gcaacgaggg ctggacctga cgcagtggct gcgtggccgc cgcgaggtcg cctcgctggt     13020
     ccatcccgct cacccggaag atccacagca tcaacgcttc aagcggtact tcagctccgg     13080
     caacggcttg ctgaccattc tcttgcacag ccaggatctt gaacgcatca gcgccatgct     13140
     cgatggctta aagcattttc ggatcggtgc cagttggggc ggcacggaca gcctgattgc     13200
     cattgcagac ctcaccgcct ctcgcatcgt gcagccatgg cctccaggac gctatgcgct     13260
     gcgactgcat atcgggcttg aaccgttgga acccctgtat gcagacctag aggccgggtt     13320
     taccaggttg aatgggcaag cgtagacatc attgaatcca agcagaacac actcatggag     13380
     aagacatcgt gattcgacta ctcgcatttg ccgcgctcgc cactgtgctc ggcagcgcaa     13440
     ccgcgcagga gaccgggacg ctggcgaaga tcaagcaaac cggcgtgatg accttgggcg     13500
     cgcgcgaagc ttccattcca ttcaactacc tcgatgacca tcaacggcag gcggggtacg     13560
     catgggagct ttccacccgg attgccgacg cggtgaagag gcaactcaag ttgcccaagc     13620
     tcgagatcaa ggaaatcaat ctcaccccgc agacccgcgt ggcgctggtg gccaatcaaa     13680
     ccgtggatct cgagtgcagc tccaccacca acaatctgga gcgccaaaag caggtcgcgt     13740
     tctcaaacac gttctttatc gttggtgcgc gattgctcgt gcgcaagaac tccggaatcc     13800
     agcattgggc agacctgatt ggcaagaacg tggtggtcag cgccggcacc accggtgagc     13860
     gcttgctccg caagctcaac gtcgagaaca ggtggggcat caacatcatt ctcgccaagg     13920
     acatcaacga gaacttcctg accgtcgaga ctggccgggc ggtggcatca atgcaggacg     13980
     acatcatcct ttacagcaac atcgcccgcg cgaaagaccc gtcgatgtgg gaagtcgttg     14040
     gcatgccgca acagcgcgaa gcgtacggct gcatgctgcg aaaggacgac ccagcgttca     14100
     agaagctggt ggacgacact atcgccgcca tgatgaagag cggcgaaatg gaagcgctgt     14160
     acaagcgcta tttccaatcc accatcgcag tcaagggagg cttgcgcatt gatcgcccgc     14220
     tatcgcccga gatgctggac ctcttcaagc atccgaatga caaggcgttc cagtaaatca     14280
     cccgcaacac gcatgcattg atcaatgaac tactcctggg attggctcat ttacttcaag     14340
     ccatcggtga cgggcgaagg gctgtatgga gcgatgctcc tgacaggcct gggttggacc     14400
     ctgctgatct cgctgttgtc ctggacgttg gcgctggcct tgggcaccct cttcggtgtc     14460
     gcccgcacgc tgccgcagcg ctgggttcga tggccaagcg ctgcgtatgt gcattgcttt     14520
     cgcaacacgc cgctgctggt ccagctcttc ctgtggttct acgtacttcc cgagctgcta     14580
     cccgtcgact ggggcaatgc catcaagcag atgaatccga cgctgaatca gtttctgacc     14640
     gttgtcctgt gtctgacgct ctattccgca gccaaatgcg ccgagcagat tcgggcagga     14700
     attgaatcga tcgctgcggg ccagcgggcc gcagggttgg cgctggggct ttccaccggc     14760
     ggcatctacc gccacgtcat tctgccgcag gccttccgca tcatcattcc gcctctgacc     14820
     tctgacttca tgaatgtgtt caagaactcg gcggttgcgc tcaccatcgg gctcatggag     14880
     ttgaccggcc agagccgcca actgagcgaa ttcagtgcac agccattcga gtcgtttctg     14940
     gccgccaccg tcatctatat gttggtcacg ctgctggtgg tctggctgat gcacgtgatc     15000
     gaagcgcgct cgcgccttcc tggcatggtc ggttcgcact gaggtcacga tgagctatca     15060
     attcgactgg tcctccattc cgcgtgcgtg gccttacctt gtagaagggc tcgcgacgac     15120
     gggcggcttg gttgccgcct ccatcacagc aggcattgct ctgggcaccg tgctggcgat     15180
     cggacggctg ttcggcccgc gtcccgtcac catgactgtt gccgcgtatg tgaacgtgtt     15240
     ccgctccata ccgctgatcc tgacgatctt ctggttcttc tttctggttc cggccatgct     15300
     gcgcgctgtg accggtgatc cgtatctcac ggtcggtccg atatgggctg cgttggcggc     15360
     cttcattctc gccgagtctg cctactactg cgaaatcatc cgcgctggca tcggaagcgt     15420
     gaaaaccggg caactgagcg cggcaaaagc gctggggctt acgcagtggc aagccttgcg     15480
     gcacgtgatc ctgccgcagg cgtttcggaa catgacaccg tcgctgatca accagacgat     15540
     cgccctgctc aaggacacct cactcgtcta cgtgatcagc ctgaccgact tccttggcgc     15600
     cgctggcaag atcggccagc gcgatgggcg gctggtcgag atgtacctgt tctcggctgc     15660
     ggtctacctg gtgctgtgct cgtttggcgt ctggctcgtc gccgccgtgc agaagaagcg     15720
     catgggagcc cgggcgtgac caggctcttg cccggttgct ccgatatcaa gacacaaacg     15780
     acaccaacca tgatcaatat ttccgacgtc tccaaatggt atggcccgtt tcgggtactc     15840
     accgactgca cgacttccat cgccccaaag gatgtggtgg tgatctgcgg cccctccggg     15900
     tcaggaaaat cgacgctcat caagacggtc aacggactcg aaccgtttca gaagggggat     15960
     atccacgtgg gaggaatctc cgtcggcgcc gcagacacga accttgcgag tcttcgcgcc     16020
     cgcgtcggca tggttttcca gagcttcgag ctgttccctc acctgacggt attgcagaac     16080
     ctggcactgg gtcagatcaa ggtgctcaag cgcaacagag ccgctgcaga agccaaggcg     16140
     ctggcgctac tggaccgcgt cggactcgtt gcgcacgcgt cgaagttccc cgggcagttg     16200
     tcgggcggcc agcaacagcg tgttgccatc gcgcgcgcgt tggccatgga cccggaggtc     16260
     atgctgttcg atgagccgac ttccgcgctc gatccggaaa tggtgaatga agtcctcgac     16320
     gtcatgatcg atcttgccag ggatggcatg acgatggccg tcgtcacgca cgagatgggc     16380
     ttcgccaggc aagtggcgaa cagagtcatc ttcatggacc agggacagat tattgaagac     16440
     gtgcccaagg cggatttctt tgactgcccc gatgcgcgca ccgatcgcgc gcggcagttt     16500
     ctttcaaaga tcctctccag ttagccatcc aatcgatacg tttttccatc ttgcgcagtg     16560
     tgccggcact ttacgcatga aatcgccgca agagcggcaa ccacaactac cttgaggaga     16620
     caaccatgaa aaacatgatg gcagcggccg tctttggcct ggcgtccatg gcagcgctgg     16680
     cgcacaacat cgacgccgat atcaccaagt tcgagaagat ccatgcaaca aaggatccga     16740
     acagcaagga ggcacgagaa gcaaaggtgc tgatcgagca ggctcgcgcc gtgtacttcc     16800
     actcggacac cgtccaactc ctgcgcatcc gcgcgttgct aaacgatggc ttcaagttcg     16860
     tcggagcgca gcctgctttc ctcggcagcg agatcaaacg cctggaagat gcgatcgcat     16920
     cgcccaagac cagcgatccc gcaatgaccg atgccgccag gaaactgctg ctgcaggcga     16980
     aggccgagaa agccgcgtac gacgtgctgc acgattccgt cggcgagaag atcgatcaag     17040
     ccatgaagct gatcgaagcg gcgaagtaag acgaccgctc gaccacaagg aggagccatg     17100
     agaataagga caacagtttg gaaggtcgcg cccgcgatca tcgcaatgac gagtgaagtc     17160
     gcgctggccc agtcgaacgt ggaggtattc ggcatcgtcg atacggcagt tgagtgggca     17220
     cgcagtggag acggagtcaa tgtcaaccgg ctggtctcgg ggcagaattc agcgtcgcgt     17280
     ttcggcatgc ggggcagcga agatatcggc ggcggactca aggccaattt ctggcttgag     17340
     aacggcttca acacggacac cggcgcgctg tccgatagcg caaggctgtt caacagacgt     17400
     gcgacggtcg gcctgtcggg gccatggggg cgcgttgatc tcggtcgcca gttccgcccc     17460
     gaagcccgcg ccgtgttcgg catggaccca tttgatgggg gctccacagc atcgccctcc     17520
     aatacctact ccaacacggt gttccgcacc gacaatgcgg tcgtgtatga gacgccaaac     17580
     gtgaacggct tcgtgggccg gctcatgtat gccttcggcg aggcacccgg cgcgttcaac     17640
     ggtgccaaca acgatgtcgg cgcctccctt cagtactata acggtccggt ctacctcgcc     17700
     tatgcttatg acgcgcgcac caacgcgacc aacagcgaca agcgaaggtg gcactcgttg     17760
     ggaggcgcgt acgacttcgg cgtggcgaag ctgtatgccg cctatcgcac ccgcaaggaa     17820
     ggtgccgtgg gcctcgacga gagcagctac tggttgggtg tcagcgtgcc gctaggtgcg     17880
     tggaccctct ccgcaaccgc aacgcgcgtc aatgacaaga caccagccga caaaggtgca     17940
     accggaatcg gattgggtgc cgactatgcc ttgtcgaagc gaacgacgtt atacggccgg     18000
     ttcggcaagg tcaacaacaa gaacggggca acgttcaatt tggacaacgg catcaacggc     18060
     cccagcccca gctcgttggc actcggcttg cggcacaaat tctgagttgc tattcggggc     18120
     actcgatcac gacgttccgg aacatgcggc ttcgcatccg gaacgacgtc ggctcagggc     18180
     gtccggcgcc gagctgggcg gctttcggcg tgcaacccct agtgccgtat tgattcaaca     18240
     tccagaccac cgcatacgtc ggtaatagca atcgcaccgc tcagcgactg tctacggaga     18300
     atgagttgct gcgatagcag caactcattc cgccgccgcg gttggggacg aacttctatg     18360
     ggaacgatga tccgtccctg gatattggaa ggggattgtc cagcgcaagc gtgggctgcg     18420
     actgcgttac gaattcagcc gccagtttgc cctacacatt gacgtcaagc gctaccagac     18480
     gcttagcaat acgccaacca tcaaggccga tggtggcagc agcagcgaaa cccgccttgt     18540
     ggcaggcccg cgcgtttggc tcaagcttgt tcgttttttt caccacccgc agaggtattg     18600
     acatgtcgaa ccatcattac attgcaagca tcgctttcac tgcatcggcc atgcttgcta     18660
     gcgccgcggc gtttgcacat cccaagctgc tgtcgtcgat gcccaccgac aaagcggaag     18720
     gggcggcacc ggcaatgatc gaactcaaat tctcggaaag cctctttaca caattctcgg     18780
     gggcaaacct cgttatgacc gagatgcccg gcatgtcgga acacgacgcc atgaaaattg     18840
     ccgcgaaagt caccgctgac gatgacccga aggcgatggt catcacacct gtgcagccac     18900
     tgatgaccgg gacgtacaaa gtcgaatggc gggctgtttc gtcggatatg cacccgatgt     18960
     cagggaactt ctccttcaag gtgaagtaac gtcatgacaa cgatcggctc aaagagaggc     19020
     ggcggcaatt cgggcaatcg aaatggcgga gaaaccgggg cctggggcgg ccagaatgac     19080
     cggcagacag gccttagaag atgacgatac gaagcaggca aacgcattgt gtgaatttgc     19140
     ccctgcttct ctggacaccg catcatgcct gatggactgc tcccgggagc gtgagcattt     19200
     ccggtctctg gtctggcggc cagtttttat ggacatcgcg tctgaattta gctgggattt     19260
     cctcggagcg tgcgaagacc gcggcagccc gatcgccccg caagcgcgtg ccgatcagta     19320
     cattttgggc tgccgcgggg ccggcagcgc tgccatcggt ttggaaaagc aggttgaact     19380
     ccaaaaaggg gaggggcttc tagtcggcgg cggtgaggcg ataggtgtcg acacagtagc     19440
     ggttcgagtg atccggcgac gccccgtcga gttccttcaa gtttggcggg ctacgatcgg     19500
     gcagcttcac aagccccgtg ggggctgctt cagcgtaggc aaccagatca gttcgcggac     19560
     gtgcgtcagc aataccggga aggtcattgc gttatccggc accagcgcag caggattttt     19620
     gagtcatgca tcgaagctcc gcttacccca gatcaggcgt cattgctttg gggcgccaag     19680
     gttgcgtgtg aaaccgtcga ctctgcccac ctgaggccca atacgcctcc aaagctcggc     19740
     cctgtctgtg gcgacccggt gcagaatggc acgccaggta ggctcgagcg gcttacgcgc     19800
     catgcgcgat gtcctccttg gaaagagtgg aagcactaag tgacgtcgcc gcaattgact     19860
     catgcggatc gaacgcccac cggtgctgaa catcggcttg agatggacaa accaagccgt     19920
     caagctgatc acgccgagaa gctccaagaa agcgaataga cggggtcaac gctcgccgcg     19980
     cgctcttaac ctctccgttg tttcattgac gaagaggaca tggaaaccaa tctcgatggc     20040
     gaactgtggg cgctgatcga accattgctg ctgccgaagt cacatcgacc ttcgcacctt     20100
     gggtgcaagc cataggatga tcgcgctgcc ctcacagaca acttgtcgtg ctgcaatccg     20160
     gcattcccgg gggagatgcc gccccagcaa atgggcaacg gctggggcat gagttgctgg     20220
     ggcagacacg cgactaattt gcggcaggcg tttgggaccg attgcacgaa cccctctttc     20280
     aactcctggc gagttcgggg ctcccaggcg agtcggctgc gcgccgccgc agcacgatcc     20340
     cgcaaatggc cggcagcaca aacagggtta ggacagtcgc cgtcaccaag ccgccgatca     20400
     cgaccgtcgc caagggcttc tgcacctcgg cgccggttcc ggtagcgatc gccatgggca     20460
     cgaagccgag cgacgccacc agtgccgtca tcagcacggg tcgtacgcgc tccatggcgc     20520
     cttcgatcac cgccgcgtcg ggtgctagcc catccgccat acgtttacgg atcgccgaga     20580
     tcaacaccag cccgttgaga accgccacgc cggacacggc aatgaagccg accgccgccg     20640
     aaatcgagaa cgggatgcca cgcagcgcca gcgcgaacac gccgccggcc agggccaacg     20700
     gcactgccgt tagcacggta gcggtcagca tggcgttgcc gatggccata tagagcgctg     20760
     cggcaatcag gatgaagcag atcggcacga tgatcgccag gcgctgggtg gcggcctgga     20820
     ggttctggaa ctgaccaccc cattcaatcc acgaaccggt cggcagcttc acttcgcggg     20880
     cgatgcgttg cgccgcgtcg tcgacaaagc tgccaaggtc acgcccggcc acattggctt     20940
     ccacgtagat ccgacgtttg ccgttatcgc ggctgacctc attcaggccc tgtgtaaagc     21000
     ggaattgcac cagttggcgc agcggcacgg agccgcgcgg ctggccatct gccgagggca     21060
     gcatcaccgg cagcgcgcca agcatatcga gattgtcccg ctgcgcgcca ggcaggcgca     21120
     ccacgatatc gaaacggcgg tcgccgtcga acacctggcc ggcggctttg ccgcccaatg     21180
     cggtcgacac ggtatcggcc acctccttga cggtcagacc gtagcgggcg atcgccgcgc     21240
     ggtcgaaggc gatgtcgaag gtcggaaagc cgcttgtctg cggaacccgc acgtcggacg     21300
     cgcccggtgt cttgcgcagc acggcagcaa cgcgctgggc ggtggcagcc agctcgtcca     21360
     gattgtcgcc atagagcttg acggccacat cgctgcgcac accgccgatc agctcgttga     21420
     agcgcatctc gatcggctgc gtgacgtcgt agttgttgcc caccatcggt gcggtcttct     21480
     cgcggatacg ctcgataacc tgttccttgg tcgttacccc ggctggccac tgatctttcg     21540
     gcttgaggat aatgtagttg tccgaggcgt tgggcggcat cgggtcggcg gccaagcttg     21600
     cggtgccggc cttggagtag accgtcttga cctcgggcag gctcatcact gcgcgctcga     21660
     gcggcagatc gatcgccacc gactggtcga tcgacgtgga cgggatccgc accgacgaca     21720
     ggttcaggtt ctgctcatcc agcgtcggca tgaactcgcg gccaaccagg ccgaacgccg     21780
     ccacggccag caccagcacg gccacgcccg cgccgatgaa cggcagcggt cgggccaccg     21840
     cacgttgcag ccacgggcga tagcgctgct tggcggccac gatgacgcgc acctcctgct     21900
     cggccacatg cgagcgcagc aggatcgcga tcatggccgg cacgaacgtc agcgacagca     21960
     cgaaggccga cgcgagtgcc agcatcagcg tgatcaccat cggcgagaac atcttgcctt     22020
     cgacgccctg gaacgtcaga cacggcacga acaccaggaa aatcaccatc tggccgtaga     22080
     cggtcgggcg gaccatctcg cgtgaggagg cgaccgtttc gtccagccgc tcgcgcagcg     22140
     tcagcgtgcg gccttcccga tgctgacgct cggccaggcg gcgcagcgtg ttctcgacga     22200
     tgatgacggc gccgtcgatg atgagcccga aatcgagcgc acccagactc atcaggttgc     22260
     cggagatgcc caaggcgttc atgccgatcg cgctcatcag cagtgacagc ggaatgatca     22320
     gcgcggcaat ggccgcggca cgccagttgc cgagcagcca gaataggatg gccaccacca     22380
     gcagcgcgcc ctcggtcagg ttgcgcgcga ccgtctcgac ggtggccacc accagttggg     22440
     agcggtccag cgtcggcacg atgacgacgc ccggcggcag ggttgtgccg atcttgttga     22500
     gcttctcgcc aaccgcgtgc gccaccgtgc ggctgtttgc accgaccagc atcagcgcgc     22560
     tgccgaccac ggtttcatag ccgttgcggc tggccgcgcc ggaacgcagt tcgccgccca     22620
     cgttgacagt ggccacttgg ccgaccgtca ccggcacgtt ctgccggtgc gcaaccaccg     22680
     ctcgggcgat ttcgtcgatg gtgcggatgc gtgcgtccgc gcgcaccaga taggactcgc     22740
     ccgagcgccg gatgaagttg gcacccaccg agaggttggc gtcttccagc gcgcgagcca     22800
     gatcggagta tgagatgccg taggccgcca gcttcgctgc atcgggctcg accacgtatt     22860
     gctttacata cccgccgagc gaatccacgt cggccacgcc gggcgtggtg cgcagttgcg     22920
     gccggatgat ccagtcctgc acggtgcgca ggtaggcaag cttggcaacc tggtcggcca     22980
     ggcgttcgcc gcgatcggtg aggaagctgc cgtcgctttg ccagccgggc tggccatcct     23040
     tgaccgccgc gcctttgccg tcggggtgcg cgtattcgac gctgtagtgg aacacctcgc     23100
     ccaggccggt ggagaccggg cccatctgcg gctcggcccc ctcggggagg ttgggccgcg     23160
     cctgggccag ccgctccgac acctgctggc gcatgaaata cagattcgcg ctttccttga     23220
     agatcaccgt tacctggctg aagccattgc gcgagaacga gcgcgtgctc tccacgccgt     23280
     tgaggccggc tagcgcggtc tcgatgggat acgtgacgcg cttctcgatc tcgaccgggc     23340
     tcaatgtcgg caccacggta ttgatctgga cctgcttgtt ggtgatatcc ggcgtgacgt     23400
     cgatcggcag cagattcaac tgccatgcgc cgatcgcggc caccacggcg gtcacgaaca     23460
     ggaccatcca gcgcaggcgc accgcgcctt gcagaatgct gtggatcatt cgtcgtcccc     23520
     gccgctcttg ttcatctcgg ccttgaccag gaaggcattg cgcgtcgcca cctgctcacc     23580
     tgcactcaca cccgacagga tctgcgccac gccaccgcgg cgggtgccga ccagcaccgg     23640
     ctgtggccgg aagccttgcg gcgtacgcac gaagaggatg tcgcgcccgt ccaggttttg     23700
     aacggcgtct tccgggacca acaggtcgtc cgccttgccg gcgcgcggat gcaatcgcac     23760
     ctgcacgcca tccccgatta ccagtgcgcc ggcggctggc gtgggcgtca ggaccaccgt     23820
     ggccgcgcgc gtgccgccgc tcacggtcgg tgtcaccgag tgcaccacgg cttgcagcgg     23880
     tgcgccagtc gccgtcagga tcgtcgcggt gtcgcctgca gcgatgtggg tgatgtcggc     23940
     agccgtgacc gaggcctcga cctgcacttg gcccgtgccc gccacacgga acagctcggc     24000
     ctgcggcgtg acggcggcgc cgagtacggc agcctgcgct gtcacccggc cagcgatcgg     24060
     actgaccacg gccaccgagc ggccattgtc agcaacatga gcggcgcggg cgaccgtggc     24120
     ggcgcgctgt gcttccgcgt tggccacgtc cagggctgcc ttggcggctt ccatctcctg     24180
     acgtggcgac acgccctgtt gataggggtc tcctcgtttt cagtgcaata agtgacggta     24240
     cgaaaagcta gcactggcgc ggaggtggtg ttggtagatc gttgatttca ttgactttcc     24300
     tgttcacttt caaatctgcg attcgtggcg tcaaaccgtg gtcggtttca tccattggtg     24360
     ccagttatcg atgcatttgg ccgcgaaggc aggatttggt cagcatagcg gtcaaccggg     24420
     aagcgaaaca caccccgcaa gttgatgctc tccagcctgg tgggcgcaat cttcccgatc     24480
     agttccggtg gaatgacctg gcggcggttc gaccagcgat ccaggaccgc ctgcatctgt     24540
     gaggtattcc acgccatcac gatgttggcc atcaggctca acgcatcggc cacagcctgc     24600
     atttcatcga cacgtttggc ctgcgccggg ctgatccggc cggtataaat ggcgcgcttg     24660
     agggcgttaa cagcctcgcc ccgattgagc acccggcgca actcgttcct gaaagcgtcc     24720
     ttgacaaagt agtcagccaa aaacgccgta cgcagcaacc gccccaattg cacgccagcc     24780
     tcatagattg gatcgccctg ggcggcagaa ccgaaccgcg caagagctgc caccgcactg     24840
     gcatgtccgc tcatgaccga ggctgccagg tgcaccagac tatcccaatg cttttcgatc     24900
     aaagcgacgt cgacattggc ttcgcacacc gcagcgattt ctgcgggcac tttggtgccg     24960
     cgtggcacaa agaggtggcg ctgtttgagt tccttcaacc gcgggcaaag atcaaaacca     25020
     agcaaacggg catgtgacat ggcaaagtcg gtgtagccat gggtatccac agcaagctgg     25080
     ctggtctcca gcttttcttg gcggatgaca ccttcaatgg ccacgcccgc ctggcgctca     25140
     ttgagcacaa agggctgcgc atggaagatg ccccaccggt cttttacatg ggagtagatt     25200
     ccaatggaag gtgtgttgcg ccgaggatca agccgggctt gccacacccg tttggtggtc     25260
     tccatgctca tcatgtcaga agatgccaaa tcggaccgcc cccaggtggc ggcaatcggg     25320
     tgtcgctgca tgaattccag cacagcctgg caggcctggc tcagacgccg ttcgtcccgc     25380
     gcccagcgca tggcctggcg aatgctggtg gcagacaatt gcggaatcat gcgcgcgcat     25440
     tcgaccgcag tcagactggt gccgtgggcc atgatgccgg catagaccat cagcagctcg     25500
     tcggtagagc gcggctcacg tccgagcatg atccagctaa agcgcacctg ggcgtcaacg     25560
     gccagaatca cttccggcaa ttgaacctca ccgatgcggt gatccaaagc cgcgcgcagc     25620
     ttggtcactt ctgggtcttc gtcctctgcg ggcaatggcg acaaatggag ttcatcatcc     25680
     acgcgcagta cgccactgcg ggctgcagcg gccaccgcat cgacaccggc agttactctg     25740
     gccagcaaag gcttcaagaa agtggcagcc ttgctgggta acgatagacg ggcatagtgt     25800
     ttcttggact ctgcctgcca acgctcgtcc gtgaagaaca agcgcgcacg accccgaaag     25860
     ctcaggctgt gctcaatcca gaccgagcca ttgcgcaccg cgcggcgcag ggcaaacagg     25920
     gtggccacct ccaacgcctg aaacgcccgt tcccggtctg ggctggagat cgaaacctgc     25980
     cagatcattc ccagacttgg tgccaccact tcaactggca gctttctgga tcctttgaga     26040
     tataaagctt gcagcttggc aaggtactcg atggcaggat gctcgccggt ggcctgccag     26100
     ggcagctttg caatggcgac gagcaacgac cgcacggggc gaattccatc aatcaatccc     26160
     tcgcggacca gggaggccct gctcggtggt ttgcgtttct gggtttcggt gatcaaggct     26220
     tcaagacggg cacgcaactc agcatctggc accgcacctt gcgcgctcaa ggcaacaagt     26280
     tcgccgagca gcgttttgta cattgcggcc caattgacgg tagcggggac atcggcggca     26340
     gcctgacgcc acagatcggc gatccggcgc tgcaccataa ggatcaactg gtctgtggtg     26400
     gtgaacaggc aataccgaag aaagcatgcg acctccacgg tgcgcgctgg ctctttgatc     26460
     ttggctccgg ctgagggcgg cctggagaca agtcggcgcg cgtagcggcg caagatgaga     26520
     tcggggatgt ctgccaggtg cttatgaacg tccagcgtgt aaagcaggtc gatgcgctcc     26580
     tgtcattttc agaagacgac tgcaccagtt cattgggcta gccgccgtgt gtgcatagga     26640
     ctcctgaacg tgacgtgtca ggagtcctat gcacgaaatg ccgcgagagg ccgggagtgc     26700
     tcagaagtca catgcacggc gcgacgaagc tggaaccgcc gaaaattccg acgatcaacc     26760
     ggcaagctgc ttgatgcgct cggccatgag gccgaacgca tcgttcacgt attccagcac     26820
     cttgggttct gcgccctgcg cacgtaggga gtttttgaag ctgtccagat cggacagcca     26880
     ttgccgatgc agccggccca gctccttgag gtgtggctgg aaggcttgca ggttgccgcc     26940
     tgcacgaagc gcctgatagc cgcgctcaag tgtgtttgcc gttgccagca gttgcgcccc     27000
     catttctttg tgctgttcgg agaactcggc catgccgtca tagggccgcg atgccttgtt     27060
     gcgctcggcg tcggatgcct cttccatgat gcgggcgtag cggtagaagc ctgggaattc     27120
     gcgggacagt gccatgagct gctggtcgga agtgttgacc caaattcgat gcaggtcggg     27180
     cacatacccc atcatgcgat tgatgacggc atgggcatcg ctgacgcctt cggcggcaag     27240
     ctgttgcatc tgctgatcca tcctcgtcgc tagtcggcga aattcgctca tgctcatgct     27300
     ttgctcactc aaagagagtg gcgactttcg ccagcacttc atccatgagc ggcgctggta     27360
     gtgtgtctac cttgcgggcg tgacgtgcgg ccaggtcgat tactcgcggc tggtcacaac     27420
     gcacgacgcc ggtagtcttg ataccagtca caggtacggc gaaaccaagg cggcgggcaa     27480
     actcgccgcc gttggtgatg ggtaggatca ccggcaactt ggtggcctcg ttgaactcgg     27540
     cgggcgacac gaccaggacg ggacggctac cgctttgctc gtgtccggca gtcggatcga     27600
     gcgacacgag ataaatgtcg ccccgcttca tagcagttca ccgcccacgg cgggtgcatc     27660
     aacccattcg cgttcatcgg ctggttgcgg ctgcgaatag tccgacacgg ccagcaactc     27720
     cgcgagcgtg tagcgcgggc gtggattggg gttgaccacc aggcagccat gatcgactgc     27780
     gaggccgacc gttgcgccgg cttgcaggtg cagttgatcg aggaaggccg gcggcacggc     27840
     caacatgatc gagccgccga ccttgcgcag attggttgtg tgcatgatgc acctcctacg     27900
     aataatgtta tataaaagta taactgtctg tgctttcggc tgcaagcagc ttgtccgtca     27960
     aacgatcatt agccggtcaa gccggacatt gtccggcaac atgcttgttt aatgggttgt     28020
     cggacattaa gataggcgga cggaaatgcg gacaaaaggg gcggcaatgg cactgatcgg     28080
     ctatgcgcgg gtatcgacgg agagtcagca cgtcgattta cagaaagacg cgctgcgcaa     28140
     ggcgggctgc gagcgggtat ttgaggacat catcagcggc gcgaaaaaag agcggcaagg     28200
     tctggatgca gcgctggcct atttgcgcga aggtgatgcc ctcgtcgtgt ggaaactcga     28260
     ccgcttaggc cgctcgatgg ttcacttggt caataccgtg caaggcttgg ccgcacgcgg     28320
     tgtcggcctc aaggtgctaa cgggacaagg cgcagctatc gacaccacca cggcccccgg     28380
     caagctggtc ttcgggattt ttgcggccct cgccgagttt gagcgcgacc tgatccgcga     28440
     gcgcaccaaa gctgggttga ccgctgctgc cgcacgcggt cgcaagggcg ggcgcaagcc     28500
     ggtcgtcacc gcagacaagc tacagcgggc gcgggagcac atcgcaaacg ggctgaacgt     28560
     ccgcgaggcc gccacgcggc ttaaggtgag caagacggct ctatacgctg cgctgcaaag     28620
     cgggagcgag caacgatgag ccgcaagcca agcagcgcct tcgtcaagac cagaaaaggc     28680
     ttttgctacc tcacggtcaa ggtcggcaga agcaattaca acatcatgcg cattcgcaat     28740
     tacacgcttg agccgcagga taagcgcgac atgcgccggt tgtatcccga ctatctcttc     28800
     gactggaaga agatcggcca gcagcttgcc gaaaagaggg aggtatgccg agcctaccgc     28860
     tccaagcgtc aagcgccccg gagtgccgaa cgcacaccag agccgttcgt catggtgtcc     28920
     tatgacccaa ggacgcgcac ggtctacgct tctgacgctt gcgattcaat ggcattgctt     28980
     gacgccgttc tgcacatgga acgcgcccgc aagaagtagt cccgacaggc agtgcagccg     29040
     actcctgata ttccgtgcag tcgccttcag aaaatgacaa ccggcttgca atccagtgca     29100
     atggcgtcgc ttccacaaag ccgctaacga cgaagatggg cgtggccagg gacgctcatc     29160
     ttcgttcagt cgcgacggat atcttccaat cagtgggaat gtccgccgct gctcgcaccg     29220
     cctccgtgac ctccgctata gctgccgttg ccggcgcagc cgctaagcgc gatggctatc     29280
     accgctgcgg caacgatcaa tatctttttg ggcatttttt ctccttaatt gacaagtgaa     29340
     ttgatggata aaaggggaat tacaaacagg taggggctgg gttatgccaa tcttcgccgg     29400
     atcagactgt agtggtcaac taattccgga cacctcgatt agccgatcgc cgccggcgcg     29460
     ccgccataca agaagggaga cacagccatg cacgagcacc acccgatcac cgaccccgtc     29520
     tgcggcatga ccgtcaagcc ggaatcgtcg caccgcttcg atcacgccgg ccgcgagccc     29580
     gcgtttgccg gaaggcggtg cgcgcggatt ggctgcctcg ccgtccgcga gaatggcgtc     29640
     gtaatccttg cggcaggacg caaggcgttc gggcgtcagc acgccgccgc ctgatcgacc     29700
     tcatggcaag cggcgaccag cagttcgatc aggcggttgg cccaagcctg ccccatctcc     29760
     tcgaaggcgt aggtcagttc ccgcaggtga tgggcgttac tacctcatat ttcaacaatt     29820
     atttttccat ctgcccgaca gttggtcagg tgaactacgg gaagcgccaa tggaccctaa     29880
     cgtcaacgag catctgatct cttttctgac cagcctggcc atcggccttc tgatcggggt     29940
     tgagcgtgaa cgcgccggtt cggcaatggg gttacgaact tcggccttgg ccgcgctgtt     30000
     cggctccatc gccgccctcg tcggccagag cgtcggggcg ccgtggtttc tccctgccgc     30060
     cttgctggcc atgacgggca tcatggtttt cggtcagacc gcgaccgggg agagcgagag     30120
     ccacgctggc cccaccacac gaatggccat cctgctttcg ttcaccctcg gagcgatggt     30180
     ttggctcggc cacggtcgtt atgctgttat gctagccatt gctgccgcag cgctgctcca     30240
     tttcaaggcc gaactgcgcg gcttgagttc acggattact tcccgcgacc tggtgtcgat     30300
     cctgcagttc gctacgctga gttttatcgt gctgccgctc ctgcccaacg tcggttatgg     30360
     accctatggc gctttcaatc ctcaccacgt ctggatgatg gtcgtcctga tatccggctt     30420
     gagcctcgcc ggctatttgg ccatgcgtgc ggtcggagat cgctttggcc cgcccttgct     30480
     cggtctgctg ggaggactgg tgtcgagcac cgcgactacc ctggtgtacg cccgtcatgc     30540
     ccgccagacg ccgaccatgg cgctgacgtc gtcgatcgtc attctcatgg ccaatctggt     30600
     cttgtccgtg cgcctgggca tgatcgccgt tgccatcgcg ccctccttga tggcgaccct     30660
     ttggccagtg ttggtcggca acctggtggc aggcggcttg gcggtactgt tcgtctggca     30720
     tcgttcgcgg acgggggggc cacttctttt gccggaagtt gccaatccga ccgagttacg     30780
     ggttgcgctg agcttcggtg cgatgtatgc catcatttta cttttagcct cgtggctgtc     30840
     cgattgggcg ggaacccgcg ggctctacct ggcgtccgcc gtgtccgggc tgaccgaact     30900
     tgatgccatc gcattgtcga ccctgcgcct gtttgggaat gggaaactgg gcgccgaggt     30960
     agccgctaac gcgatcggcc tggcgattct ctctaacctg tgcttcaaaa ctggcctcct     31020
     cgcctgggtc gcagggcgcg acttcctgtt gcgctgcctg cctgggatga tggctatcgg     31080
     gataggcatt gcaatcggca tggggtgggt tggctatgct tgaccaatct ctcgtgtagt     31140
     tacggcttgc agctcttcct acggctctgc gccatgtccg ctgatctaaa gggtgctgtg     31200
     ctacgcaagc tgggtgatga gccaagatgg gcgggactga ggttcagacg cgagttgccc     31260
     ctctggctaa cggaaatttc ggcggttccg gcttacaacc ccatgcatgg cggcaccgca     31320
     ggggccacgt ccaccgacag ctacacgacc atcgggttca gcgtcaaagg gggcgtgccc     31380
     gctcagaaca gcgtgatcac ccagaaaccc acgaagccgg cgaacaacac gagcatcgag     31440
     tagggcttct cttcgtgcac atgtgcctct accagcaact cctccgtgac gaggtacagc     31500
     aacgccgccg cggaaaacgc caggacgaca gccaccgtcg atgcgggcag ggcgctcaag     31560
     ctccgatagc cgaccagtgc agtcgtcagg agcgtcgcgg caagcgccac gcacacccag     31620
     agcacacgtc ggccttggat cgcctcggaa accagggaca tgcccaggaa cagcatttca     31680
     gcggacaggc caatggccag cgcgaagcca accttctctc cagccgcaaa gccggcaccg     31740
     atcgtcacgc cgtccagcgc cgcgtcgagg aacacggtga tgaccagtcc gtagttgagt     31800
     tgcgcggaat tgctgcctgg cgcagtgttc gctgcgcgcg cctccagcca ggatcccagg     31860
     cgctgaacac cgaacatgaa cagcacgcca aaggcgaaca tgcccaccag cgcttgtgga     31920
     gatgctgtcg actgacgcat ctctgggaac acctcgatgg tgatcgcagc caagatgatg     31980
     ccggctgcga cgtgctgaac attcgagatc agcgtcttgc tgggctgcca gaacgacgcc     32040
     agccaccctc cgagcaccat gacgatggcc ggaagcgtga ggaagtagta cacgctgccc     32100
     atgacttcat ggtactggcc cccagtacct tgccaaagta ccccggatcg gggacactgt     32160
     ttgcaacaga aaccttggtc actcgtgatc ttggaacacc tccaagaccg ccgcagtgat     32220
     actatcaacg accctcagct cctgctcgag gcggtacatg agcacagcga actaactcaa     32280
     catttcagag gatcgtgaag ccaatcagcg tcatcccacg aacatgctcg cgcgacgggg     32340
     ttgcccccca gcagcgcggc tgggtgtggg cgtttcgctt gttgctggtc atggttctgg     32400
     tgtttgacca ggtcagcgca ccgtttcacc agcatcacca tgacttcggc attgatgccg     32460
     acgctggctt ggccgctttg cacagcccct ccggggattc cctggccttc gaatcgcatg     32520
     ctgaggacag ccatgatggg ctgcaagctg gccaccctgc catcgcgctg cgctcgcagg     32580
     ccgcgtcgga gctgagcggc gttcaatcgg tttccgatgc gctgctttct gtagcggcgt     32640
     tcgtggtggc cttcccggcc atcgaagtgg atacgcccgt ccctgactgg cccgaccgcg     32700
     ggccaccgca gttcacctct ttcaagagcc tgccccccgc aggccgtgcc cctccgctcc     32760
     acgcctgaaa agccgcaagc cgtttttccc gggcgcgcac cagcgcgcgc tcagtccgtg     32820
     gagttttcat gtcatcgcaa tttccccttc gcgcgccggt gcagaggcag cgcggtgctg     32880
     gccttgccag ccgccgcaat gtcgtctcgc aaccgagcct ggcgctgtgc gccctcgcgc     32940
     tcgcgctcac cctttcaaca accacctccc aagcagccga cgcgccggcc ttcggcgtgc     33000
     tgctgcaaca gtcactggcg cgggcgccca tcctgcttga gcagcaggcc aatgccgaag     33060
     ccgcgcgcct ggacgcggcg cagagccgca agtggctcaa tcccaaggtc gacgcacttt     33120
     ctgaagacct gaacgcgccg agcaacggcg gtcagagccc gcgtcaaatc accttctcca     33180
     tcagtcagcc gctggaactg ggcggcaagc gagcctctcg catcgccgtg tccgaccgcg     33240
     attccgatgt ggccgaagcc aggcgccgtg aagccgaagt gctgtgggct gcaaagctcg     33300
     ccgtcgccta cggaacggtc gaggcggccc aagggcggca acgtgtggca gcagatgaac     33360
     tgagccgcgc cggcgacgac ttgcgggccg cgcgcgccca agtcgaagca ggcaaggaag     33420
     ccagtgtccg cgtcgcgcag gcagaagccg gtgccgctgc cgcccgtggc gccgagcgcg     33480
     cagccgccgc cgacctgacc caggccctgg aagagctgtc tgcactcgtt gggtcccagg     33540
     agcgcttcac cggcatcgcc ggatccctgt tcagcacggc agccgacgca ggcgccgcag     33600
     ccgacgaatc tcccacgctg cgcgtcgcgc aaagcgagcg tgaggcctcc gaggcccggc     33660
     tgcaagtgga agagcggcgc tggattccag acctcagcgt gacggccggc gtgcgtcgct     33720
     atgccaggac gtcccagaac ggctatgtgg tcggcttgtc cgcatccatc ccgttgttcg     33780
     accgcaatcg agacggcgtc gccgccgcgc gccagcgcgt gcaggccgcc gacgcacgcg     33840
     tcctggctgc ccggctggag acagctgcag cccgtcgatc ggcgcaggcg caactgctgg     33900
     ctgcggaggg gcaactggaa gctgctcttg agggcgagcg tgcgtccgcc gaaggctatc     33960
     gactggcccg catcggctac gacgccggac gcacgcctct tgtcgagctg ctgttcgctc     34020
     gtcgcgctta ttccgaagct caacgttcaa ccatcgacgc gcgattggcg cgcgtccgtt     34080
     ccctggcagc gctcgcgcag gcgcagggcc gtctcgcatt tggagaatca caatgacaag     34140
     caaattcaag ctgaaccaag tgctgatcgc ggcctgcatc gccgccggtg caggagcact     34200
     gggctacggc attgcgagcc gcagctcgag cggtgcagag ccggcgccag ccgccgccgc     34260
     accgaagccg gcagcgaccg caaatgcggc caagaaggac gcgcccgagc tgaagatccc     34320
     ggcggactac atcaccgccg ccaacatcac tgtcgagaac gcgtctggct ctgacgtccg     34380
     caatgagctt ctgctccctg cggtcgtgac ggccgcaccg ggcgcggaag ccgccgtggt     34440
     gagccgcgca aacggcacat tggtccgggt cttgcgccgc ctcggcgaca ccgtcaaggc     34500
     aggtgaggtg ctcgcaagta tcgagagcct cgaagccgcc accatggtga gcgaccgccg     34560
     cgtggcgcaa gccaaggtcg acctggcgcg caagacgctg gcccgtgaga agagcctctt     34620
     cgaccagggc gtcacgcctc gtcaagcgct ggaagccgct caagcagatg tggacgtcgc     34680
     tgaggctgag gctcagcggg ccgctgctgt cgcaggcgcc gcgcgcgtcg gcagcgacgg     34740
     ccgatcgctc aatatcgtgg cgcccatcgc cggccgcatc acttccatca ctgcgcttgc     34800
     aggcgcccac gtgacgccgg accttgagct gttccgtgtg ggaatgcccg gtgccgtgca     34860
     gatcgaggcg cctctgaccg cggacgatct gcgtcgcgtg gcagtgggcg actcggctac     34920
     tgttctgact cgctccggca agccggtgcc ggtgacggtt cgcggcttga cgccaggcgt     34980
     cagcgccacc acgcgtgcgg ccacggtcgt gctcattccg acggcggggc cggatgcgca     35040
     atcgctcctc gccggcgaag gtgtgcaggt ccgcctgcag acccgcggtc aatccacgcc     35100
     gcagggcgtc gccgtgcccg aagaggcggt gcaaaacatc gacggtacgg atgtcgtgtt     35160
     cctccgcacg cctgaaggct tccgcgtcca gcaggtctac gtgggtctgc gcagcggtgg     35220
     cctggcgcag atcgtcactg gcctgaagtc gggccagcag gtcgccgtcc gcaatgcctt     35280
     cctgctgaag gccgaggcga agaagctcgc gggagacgac gaatgatcca agctcttctc     35340
     cagggcgtgg ttcgagcccg ttggatggtg ctgtttctga cggcgctcgt cgccgccttc     35400
     ggcgcctggc agctcaactt gctgcccatc gacgtcacgc ccgacatcac gaacaagcag     35460
     gtacagatca acacggttgt cccgacactg acaccggtcg aggttgaaaa acgagtgacc     35520
     tatccgatcg agacagcgct tgccggcctg aacggcgtgg agaacatgcg ctcgttctcg     35580
     cgcaatggct tcagccaggt cacggtgatc ttcaaggaga gcgccaacct gtacttcatg     35640
     cgccagcagg tcaccgaacg cttgaatcag gcgcgggcca gcctgcccga aggtgccgac     35700
     cccgtcctcg gaccggtatc cactggcctc ggcgaggtgg tgcactacag cgtcgagtac     35760
     aagtacccgc gcggcgaggg tgcgcctgca ccggctgaag gcaaggccgg ctggcagaag     35820
     gacggcagct tcgtgacgga cgagggcgaa cgcttgcccg attccgtctc gcagttggcc     35880
     tacctccgca cggtgcagga ctggatcgtc cggccacagc tgcgcatgac gcccggcgtc     35940
     gctgacgtgg actcgctggg cggcttcgtc aagcagtacg tcgtcgagcc cgacctgacg     36000
     cgtcttgcgg cctacggcct ggactggagt gaactcggtc gcgcgctgga agactcgaat     36060
     ctatccatcg gtgccaacta cttgcgtcgc tcaggcgaga actacctcgt ccgtgccgat     36120
     ggccgactgc gctccgtgga ccagatcgcc aatacggttg tcgcgcaacg caacggcgtg     36180
     ccggtcacgg tgggccaggt ggccacggtc aagatcggcg gtgagattcg caccggtgca     36240
     gccagccgcg acggcaatga ggcggtcgtc ggcagcgcgc tgatgcttgt cggcgaaaac     36300
     agccggacgg ttgccgccgc cgtggtcgag aagctgggag agatcaagaa gacgctgccg     36360
     gaaggcgtcg tgctggagcc cacgctggac cgctcccagc tggtggtggc caccatcaag     36420
     accgtcgcca agaacctgac cgagggtgcg ctgctggttg tcgccatcct gttcgccctg     36480
     ctgggcaact ggcgcgcggc cgtcatcgcg gcgctggtga ttccgctgtc gctgctgatg     36540
     agcgccatcg gcatgaactc cttcggcatc tcgggcaacc tgatgagcct cggtgcgctg     36600
     gacttcggtc tgatcatcga cggcgccgtc atcgtggtcg agaacgcctt gcggcgcctg     36660
     gcccatcgac aggcactgga aggccgcttg ctgacgctcg gcgagcgcct gcaggaggtc     36720
     atggcttcgt ccaaggaaat gatcaagccg accgtatacg gccagctggt gatcttcctg     36780
     gtgttcctgc cgtgcctgag cttccagggc gtcgagggca agatgttctc gcccatggtg     36840
     atcacgctga tgctggccct cgcgtccgcc ttcgtgctgt ccaccacctt cgtgccggcc     36900
     atgctggccg tcgtgatgac gaagcacatc gaggagcgcg aagtcaaggt gatccaggcg     36960
     accaagaacc ggtacctgcc ggtgctgcag cgtacggtgg ccaacccgtg gccatcgatc     37020
     gtcaccggcc tcgtcatagt ggcggcggca gcggtcacct tccgattcgt cggcaaggag     37080
     ttcatgccca cgctcgacga acagaacctg aacctctcgt cagtccgcat tccttcgatg     37140
     tcgatcgagg actcggccgc gctggacctg cccatcgagc ggaccctgtt gaccctccct     37200
     gaggtcaaga cggtctactc gaaggcgggt acggccagcc tggcggcgga cccgatgcct     37260
     ccgaacgcct ccgacaacta cgtcatcctg aagcccaaga acgagtggcc cgaaggcgtg     37320
     accaccaagg agcaggtcgt cgagcgcatc cgcgagaaga tgtcggcgat cgtgggcaat     37380
     gcctacgacg cgacgcaacc gatcgagatg cggttcaacg agttgatcgg cggcgtccgc     37440
     agcgatgtgg ccgtcaagat ctacggcgac gacctcgacc agttggctgc gaccggccag     37500
     cgcatcgccg cgttgctgaa gaagatcccg ggcgcggtcg atacgcgcgt ggcgcagaca     37560
     tcggggttcc caaccttcga catcgagttc gaccgcgtgg cgattgcgcg ccacggcctc     37620
     acgctcaagg aagttgccga cacggtgtcc gccgcgctgg caggccggcc gtcgggtcag     37680
     atcttcgagg gtgaccgtcg cttcgacctg gtcgtgcgcc tgccaggcga tcaacgcaac     37740
     aatctggacc agctgcgcgg attgccggtg acgctgcccg cggtcgacgg caagccgcgt     37800
     gcttcggtgc cgctgggttc gctggtgcag ttcaagttca cgcaaggtct gaacgaggtc     37860
     agtcgtgaca acggcaagcg ccgcctgtat gtcgaggcga acgtcagcgg gcgggacctg     37920
     ggcagctttg tcgccgaagc gcagaagcgc atcgacgccg agatcaagct gccaaccggc     37980
     gcgtggatcg aatggggcgg ccagttccag aacctgcagg ctgcttccaa gcggctggcc     38040
     atcatcatcc cggcgtgcct ggtgctcatc agtgcggtcc tctacctggc catcggcagc     38100
     gctgcgctga cggcgacggt gttggccacc atcccgatgg cagtggcggg cggcgtgttc     38160
     acgctggcta ttcgcgacat tccgttctcg atctccgctg ctgtgggatt catcgccgtg     38220
     tcaggtgtgg cggtgctcaa cggcctcgtg atgatttcgg caatccgtaa gcggctggaa     38280
     gacggcatgg cgactagcgc ggccgtgatc gaaggcgcga tggagcgcgt gcgacccgtc     38340
     ctgatgaccg ctctggtcgc gtccttgggc ttcatcccga tggcgttcgg taccggcact     38400
     ggggccgagg tacagcggcc gctggcaacg gtcgtgatcg gcggcctgat caccgcgacg     38460
     gtcctgacgc tgctggtcct gcccgcgttg tgcggtctcg tcctgaagcg gtcggatcag     38520
     gccaagcctg agccggaacc cgaacccctg ccgcaagcct gagcttgata ggggaggcgc     38580
     gagcgcttcc ccgtctccct gatttttcac cagcagtaaa ggaaatcatg ttccaacgtc     38640
     ttgcccggcc gctgctcgcg gtgggcctgc tcctctccgc cgcggccgcc tgggcgcacg     38700
     gcatctccga ggccgacaag cagcgcatgc tggatggcgg ctacctgcag tacatcgggc     38760
     tgggcgccag ccacatgctg accggctacg accacctgtt gttcctgttc ggtgtggtgt     38820
     tcttcctcac gaagttcacc gatgtggcca agttcgtcac ggcgttcacg ctgggccact     38880
     gcatcacgct gatcttcgcg acgttcctga agatcacctg gaacttctgg ctcgtggatg     38940
     cactgatcgc gatcagcgtc atctacaagg ggttcgacaa caacggcggc ttccagaagt     39000
     acttcaaccg cccgtcgccc aacctactgc gtgtcgtctt cgccttcggg ctgctgcacg     39060
     gtttcggcct gtccacccgc ctgcagcaac tgccgctggg cgacgacaac ttcagcatgc     39120
     tgatgcggat cctgagcttc aacgtcggcg ttgagatcgg gcagatcgcc gctctcgtgg     39180
     tcatggtcgc cctgctgtcc ctgtggcgca agcgtgagtc gttccagcgg ttcagcacgt     39240
     tctcgaacaa cgcactgatg acgctcggcg cgctgttgct gttgatgcaa ctgcacggct     39300
     accaccacga cttcgatgca gagaacctgc gcttccccga ggaggagcac aagcacctgc     39360
     atgaagacat ggacatcgac aagagcaccc gcacgggacg cgagagcctc tgatggccgc     39420
     gttctttgag ttttccccca ccccccacca aaggagtttt ccatgaagaa actgttcgtc     39480
     tcgatggccg ccatggccgc attcagcctc tccgctcccg cctttgccgg cggtgacggc     39540
     gactgccatt tccacggcaa cacgccagcc aaggccgaga ccgtgtcggg ctgcgccgtg     39600
     aagcgccagc aggcgctcat cgccggcggc aagctcgaca agtcctggca gagcatcaag     39660
     cccggcacgc ccgagcaggt cgatggccag aagggcaagg aatggaaggt caccttcaag     39720
     gatccggccg ctgccgacaa gtccaaggcg aacctctaca tgttcttcac gccgcagggc     39780
     aacttcatcg ctgccaactt caccggcaac tgatcggtct ttgaccgttg cggcgccagc     39840
     aggcattgcg cctgctggcg tctgtccccc tttcgcggag caccgccatg ttggatgtcc     39900
     ttgccaatcg gacgtaccgc caccttttct tcgcccaggt cattgcgctg gtcggaacag     39960
     ggctggccac cgtcgcactg ggcctgctgg ccttcgactt ggcaggtgcg gacgcgggcg     40020
     cagtgctcgg caccgcgctg gccatcaaga tggtggccta catcggcgtc gcacccatcg     40080
     cctcggcgtt tgccgacagg gtgccgcgcc gcaccttgct ggttgcgctg gacctcgtgc     40140
     gcgccgccgt cgcgctggtg ctgcccttcg tcacggagat ctggcaggtc tacgtgctga     40200
     tcttcgtgtt gcagtcggcc tctgcgggtt tcacgcccac attccaggcg acgatccctg     40260
     atgtgctgcc caaggaggcg gactacacca aggccttgtc gctatcgcgc ctggcctatg     40320
     accttgagag cctggccagt ccggcgctgg ctgcagcact gctgaccgtg gtcagcttcc     40380
     acagcctttt ccttgggacg gttgtgggtt tcgtcgcctc ggccgtactg gttgtctcta     40440
     ccgtgctccc caaggcaaag cagccgccgc ggcgcagcat ctacgagcgc accacgcgcg     40500
     gcagccgcat ctacctctcc acaccgcggc tgcgcggctt gctagcgttg aacctcgctg     40560
     tcgcgtccgc cagcgccatg gtcatcgtca acacggtggt gctggtgcag agccagctgc     40620
     agctcaacca gcgtttcacg gccggcgcac tggcggcctt cggcggcggc tccatgctga     40680
     ttgcccttgg gctacccaag ctcctggagc gcttgcccga ccggcgcgtc atggtctttg     40740
     gcgcgtctgt cctgaccatc ggcctgctgc ttggaccctt ggcgacgggc aactatgcgg     40800
     cgctcgtggt gctgtggctg ctgttgggca tgggctactc cctcgctcaa acgccgtccg     40860
     gcaggctgct gcgccgctcg gccagcgagc aggaccgacc agcgcttttc gccgcgcagt     40920
     tcgcgctttc gcacgcctgt tggctcatca cctacccggt cgccggatgg ctgggcgcca     40980
     aggccggcct gaacgccagc ttcatcgctc tgggcattct ggcgggagtg accacgttcg     41040
     cgagtctctg gctttggccc aaggacgatc cggtggaggt tcctcatacc cacggtgatc     41100
     tgaaagaagg cgatgagcac ctgcagagcc cggccgtgga cgacgctcgg cagcactcac     41160
     atgcatacgt gatcgacgac cagcatcagc ggtggccaag gagctgaagt catggacagg     41220
     cgcgcagtac tggcttggat gagctgcgtc accgggagct tgctactgcc cggttgcgca     41280
     agcttcctgc ggggcagctc cgtgggaccg cagtgctacc gcgcgaggaa tggccccggg     41340
     atcaaggcga tatgcacgcc ggaagccgtc cctgacgaag aagccgaatc gcgagccaag     41400
     cggttcgagc cggtcgccgg tcagctgacc atctatctcg tccgccaccg gtggggagat     41460
     gccgccaata gggtcaaggt gggcattgcc ggggagcggt tggtgacgac catcccggct     41520
     tcgctgattc ggatcgccgt gccgcctgga aagcacctcc tggtctttaa ctgggccaaa     41580
     gggcatggag tgctacaggt ccagggcgac gccggacaag tgctgttcgt ggatctggtc     41640
     ggcagcctgt ggatctggaa cgagtggtac cggttggaga tgggcgaccc ctcgtttcga     41700
     gacagggcga tgaagagtcg gctcgtggct gacgtcaagc tgggcgtgcg cgagtgacgc     41760
     aaaaactcct gctggacgtt gggacgcaag tggcggaatc ggacttcccg ccagagtccg     41820
     ccgcggctca ctttgaggcg atcggcaagg gcatcaacga cgtggatgtc atcgtgcagg     41880
     ccttgctgga gaggctccct ccgtccaagc cttggcagcg ccagttgcgc agccatctgc     41940
     gcgatgcgga ccggcacgtg gagattctca ggctggagat ttcactggaa cacgacagtt     42000
     cggagatcca cgcggctgcg ctcaagctca aacatgtcct cgagatcgcg aactttcata     42060
     tcgcgggtgg tcgcgcggaa ggctggataa ggaacgcgct ggcggtggcc taccgcaatg     42120
     cgtcgcttgt cagtaagttg ctggcgcctt gacttttcaa gctagcaata tgtcggccag     42180
     ttaacgccat tgctccgctg acgacagatt cgtagtcgac ccacccggac tctgtccggg     42240
     ggggtgccaa agtgctcttg aggttgaccg agcttgctgc tttgtcggga aaacgttcaa     42300
     ggaccctcat gactgatatg caatgtctga acctgcttgc gccgatagct atggaggagc     42360
     gaactgtcag tgcgcttgtc tcctccggcg tgtgcaggac atatctctgt tcgcccgtct     42420
     acgcccatgg gttcgagcat ttcgacctgg atgatgacgg aggccttgcg ggcggtattg     42480
     cagccttggc caaggcaatc gtgcccgccg aaagaatgga ggagcttctc aagcacctgc     42540
     aattcgaact ggcgctcacc ggtgtgcgct tctggatcag tccggttatc cgccaagggg     42600
     agttcgcgtg aatcaccgga gcctggcatt gcaccgaccc gccgtactgc tgtcggcagc     42660
     cgtcggcgta tgccgccgac gaagacgtac tcgcagctcc agtcgaactg gaaggcgtcg     42720
     cccagctcga agctcatcgg cacgaaggct gcactacgcg gtgcggcgtc ttgctcggcc     42780
     cgctaggctc gcacccagcg ggtcacacgg gcgtcgctgc cggccgctgg cttcgatggt     42840
     cgtcgcgtcc agcgtcagcc cgcaccggtc cagggcttgg cgatcacaag tggctttggg     42900
     gagcccgcga tcagaccggt cgcgcccttt ggttccatcg ccgctgatcc ctaacctggt     42960
     cacgagtcag accccgatcg aagatgcgct gcgcccttta cgccacgtca ttggggacgg     43020
     caacaaactt gccaggggcg actcgaactc gcttcatgct taacccttcg catccgagta     43080
     ctttgccatg ctcgcgattc aaacaagaac gcgccaggct ggggttggtt cggatcgttg     43140
     tagccagcgg cggcgtgcat aaaggcgtac cggctgcgca cgcgctggcc gactccgctc     43200
     cggtggacga gccgtcgatc ttgatgatct gggcgtgtgc ggagaacgag agtgcggcag     43260
     cgcagacagt cagcgcgcca gtgatgaaag aggacgacgg cggccgcatc ggcacctggg     43320
     tcaccatcac cgtcgccgaa cgagggcgag cggttgcgca aagcccagat cacggcaaag     43380
     ggctcgctgc gtgagcgtcg aagagcggcg gcttccgctc aaaccctagg ttcaacggcg     43440
     agctgtgttg cttatcattt ctctcgacca ccacggtgca ctgaaacaga gccgatgagc     43500
     tcacgaggcg acgggtggag acaagcgcgg gggcgaagtt ctacagcatt gaggtttgtt     43560
     ctatgcccgt tttcatcgga agtttgccgc ccgaaccgcc aacccctgcg cgacctgatt     43620
     gcgccagggt gattgcctcc acgtttggca gtcgggatgt gacgtcgcgc ccgccggccc     43680
     atggcgagcg ttgagcgcac cgcctatcct cgatttcctc gtctcctaac accgcaaaag     43740
     ctgcggaagc tgttcactcc gtcgaaagac gaggtggagt gggtcgctgc aagttcgcgc     43800
     ggtgaagacc gtcggctgtc gctgacggtg cagttgaagt gcttccagta cctgcacttc     43860
     ttccagcctg cagagagcat tccgccagag gtggtcgagc atgtggccgt ctgcttgggc     43920
     ttcgcgcccc agcagcagct ccggtatccc gaggccagcg ggaacggggc cttgtatcgt     43980
     gaccacgaca aggttcgcgc cttcctgaag atccggccgt acagcgggcc caagccccgg     44040
     gccgaggctg ttcgcatcgc gcgcagagcc agctcggtcg tcaacaccgt ggtcgacgtc     44100
     atcaacgcgc tgaccacgga actcgtgatc aaggactacg aactgccgag cttcagcacg     44160
     cttcacaaga ttgctgagaa ggagcacgag gctgccgagc aagccatctt cgacggggtc     44220
     gagcgcaaac tcaccaacga ccagcggcgt tggctggacg agttgttgat ctcggagtta     44280
     tccaactggc agacccggta caacgagctg aagcggtcgg ccaagaaggc gtcgcgccag     44340
     caccttgatg aactgctcga gcagcttggc tggctcgaat cgctgccgga cagtgactcg     44400
     ctcctcgaag gcttgacgca gcccaggctt aagtaccttt gcgacctggc cacgactcgc     44460
     gacgccgggg aaatgaagga cttctcgcag gccaagcgcc acacgatgac tctggcgctg     44520
     atccggcaga tgcgcgtgcg cgcccgtgac gacatcgcgg agatgttcat ccgtcggctg     44580
     acagcctgcc acaacgccgc ccaggaggag ctgaaagaac tgcaggcgcg ccagcgcgaa     44640
     ctcagcgagg agcttgtggc cggggtctcc tcgttttcag tgcaataagt gacggtacga     44700
     aaagctagca ctggcgcgga ggtggtgttg gtagatcgtt gatttcattg actttcctgt     44760
     tcactttcaa atctgcgatt cgtggcgtca aaccgtggtc ggtttcatcc attggtgcca     44820
     gttatcgatg catttggccg cgaaggcagg atttggtcag catagcggtc aaccgggaag     44880
     cgaaacacac cccgcaagtt gatgctctcc agcctggtgg gcgcaatctt cccgatcagt     44940
     tccggtggaa tgacctggcg gcggttcgac cagcgatcca ggaccgcctg catctgtgag     45000
     gtattccacg ccatcacgat gttggccatc aggctcaacg catcggccac agcctgcatt     45060
     tcatcgacac gtttggcctg cgccgggctg atccggccgg tataaatggc gcgcttgagg     45120
     gcgttaacag cctcgccccg attgagcacc cggcgcaact cgttcctgaa agcgtccttg     45180
     acaaagtagt cagccaaaaa cgccgtacgc agcaaccgcc ccaattgcac gccagcctca     45240
     tagattggat cgccctgggc ggcagaaccg aaccgcgcaa gagctgccac cgcactggca     45300
     tgtccgctca tgaccgaggc tgccaggtgc accagactat cccaatgctt ttcgatcaaa     45360
     gcgacgtcga cattggcttc gcacaccgca gcgatttctg cgggcacttt ggtgccgcgt     45420
     ggcacaaaga ggtggcgctg tttgagttcc ttcaaccgcg ggcaaagatc aaaaccaagc     45480
     aaacgggcat gtgacatggc aaagtcggtg tagccatggg tatccacagc aagctggctg     45540
     gtctccagct tttcttggcg gatgacacct tcaatggcca cgcccgcctg gcgctcattg     45600
     agcacaaagg gctgcgcatg gaagatgccc caccggtctt ttacatggga gtagattcca     45660
     atggaaggtg tgttgcgccg aggatcaagc cgggcttgcc acacccgttt ggtggtctcc     45720
     atgctcatca tgtcagaaga tgccaaatcg gaccgccccc aggtggcggc aatcgggtgt     45780
     cgctgcatga attccagcac agcctggcag gcctggctca gacgccgttc gtcccgcgcc     45840
     cagcgcatgg cctggcgaat gctggtggca gacaattgcg gaatcatgcg cgcgcattcg     45900
     accgcagtca gactggtgcc gtgggccatg atgccggcat agaccatcag cagctcgtcg     45960
     gtagagcgcg gctcacgtcc gagcatgatc cagctaaagc gcacctgggc gtcaacggcc     46020
     agaatcactt ccggcaattg aacctcaccg atgcggtgat ccaaagccgc gcgcagcttg     46080
     gtcacttctg ggtcttcgtc ctctgcgggc aatggcgaca aatggagttc atcatccacg     46140
     cgcagtacgc cactgcgggc tgcagcggcc accgcatcga caccggcagt tactctggcc     46200
     agcaaaggct tcaagaaagt ggcagccttg ctgggtaacg atagacgggc atagtgtttc     46260
     ttggactctg cctgccaacg ctcgtccgtg aagaacaagc gcgcacgacc ccgaaagctc     46320
     aggctgtgct caatccagac cgagccattg cgcaccgcgc ggcgcagggc aaacagggtg     46380
     gccacctcca acgcctgaaa cgcccgttcc cggtctgggc tggagatcga aacctgccag     46440
     atcattccca gacttggtgc caccacttca actggcagct ttctggatcc tttgagatat     46500
     aaagcttgca gcttggcaag gtactcgatg gcaggatgct cgccggtggc ctgccagggc     46560
     agctttgcaa tggcgacgag caacgaccgc acggggcgaa ttccatcaat caatccctcg     46620
     cggaccaggg aggccctgct cggtggtttg cgtttctggg tttcggtgat caaggcttca     46680
     agacgggcac gcaactcagc atctggcacc gcaccttgcg cgctcaaggc aacaagttcg     46740
     ccgagcagcg ttttgtacat tgcggcccaa ttgacggtag cggggacatc ggcggcagcc     46800
     tgacgccaca gatcggcgat ccggcgctgc accataagga tcaactggtc tgtggtggtg     46860
     aacaggcaat accgaagaaa gcatgcgacc tccacggtgc gcgctggctc tttgatcttg     46920
     gctccggctg agggcggcct ggagacaagt cggcgcgcgt agcggcgcaa gatgagatcg     46980
     gggatgtctg ccaggtgctt atgaacgtcc agcgtgtaaa gcaggtcgat gcgctccagt     47040
     acctcgctga tttggcgggt tgagtgtttc gccggtgcag cccatagcca actctgctgg     47100
     gtttgtccat ctgggcgcag ctctgaaact gaggctcgcc agcgatcaag tgttgctgga     47160
     tcaacgctgg cggcgatggc ggtgcctgtt tcaacttcaa gctgggcaag tgccgccgca     47220
     atcagtgtcc gaattgcccg ctcgtgcacg atcaccagct tgttcttgta cagccattga     47280
     cgcgcccgca cgagtagctg atcgcggtcg gcgcagcgcg ccacttcgtc gcgcagttca     47340
     cgtaccagtg agcggcgctg gtgctcgctc atccactgga atccaagaac cgtgcaggct     47400
     acttgttggt gatcgaatag cgtgcgcccg cgttcataca tggctctcag cgaggcgact     47460
     tctggtgctg caatgccaag ctcgttgcca aggtggcgcc acaaggctac tggaattacc     47520
     cgaaaggcac cgagcaaacg cccactcatg cgcaggaaac caatatggag cgccagacca     47580
     agcttgtggg aatcacctcg gcgtgcattg attgcgtcgc gctcggcacc atcgaaggtg     47640
     aaaaatgcct tcatctcgaa gtcgctgata tcgcggggga gcccacgcat ccccaaaaac     47700
     gttgtgtgcc aaccctgcat cgtgaacctc aaaagtggga ggccaccata cccgtttaca     47760
     aagcgaacag gaaagtcaat gaaatcaacg gtctacccag accacccccg cgccagtgct     47820
     agctttgcgt accgtcactt attgcactga aaacgaggag acccctgata gaggctggct     47880
     tcccgggcgt aggtcttgcg cgccagctcc gccttggcca gcgccacgcg gcgctcggcc     47940
     gccatcgcgg cggcgtctgg gctgtccacc agcgccagca cgtcgcctgc ccgtaccgcg     48000
     tcgcccagcc ggtggttgac gcgctggatg gtgccagacc cacgggcaac gatgatcgcc     48060
     tcgctgcctg gtacggaagc caccgtggcg ggggccagga tttccgtgct cacaccgccc     48120
     gtagcaaccg gcccgacggc aatgttggcg gcggtcagat aggcctcggg aatcttgacc     48180
     tcggccggtg cggcatggac cgttgcggac tctgccttgg gcggcggggc gactttggct     48240
     ggggttagcc cgcgtgcagc gccgaaacca atcagtgcag cgatgccggc aatcccggcg     48300
     atcttgggcc agcccaagga ttggcggttg tcttgcgtca tggtgtttcc tcgaaagcca     48360
     ggcggccctc tgcctgtgcc agtgccgcca gcgcgcgcac gcgcgccagg ctggcatcaa     48420
     tcgtcaatcc cttggcctcg aacagcgcgc gccgggtggc gagcagctcg atcagcgaag     48480
     tcttgcccgc gtcgtagccg atgcggccta gccgataggc ctctgtggcg gctcgctcgc     48540
     cctcggccgc agcagccaag cgcttctccg atgcggccgc ttgtgccaat gccgagcggc     48600
     gcgcagcggc cgcctccagg cgaacgctgt ccagccgcgc ctcggccgcc gcctcgcgct     48660
     ccactgccgc cgtggtcgca gcatcgttcc ggtcgaacaa cggaatcgtg gcggacaggc     48720
     ccacgacgta cccgctggca tttgtccagc catatcgccg cagcccagca ctgacgccaa     48780
     catcggggat ccatttcttc cgctcgacct gcacctgagc gttcaacgca tcccgctcgg     48840
     cttgtgccgt gagaacagcc ggcgtctcgt ccggctttgt cgtattcgcg ggtgcagggc     48900
     cagctgccgc cagcaatgag gtggggagcg tcgtataggg ctcgtcggag ccggccagca     48960
     ccgccaagtg ctccagggcc tgtgttgcct cggctgtcgc cgcttgttcg gcagcctgcg     49020
     cggccgcgac acttgcttgg gcctgtgcgg cacgcaaggc agcctctttg ccgaattgca     49080
     ccagcgcccg ggccgcgcgc aggtcgtcgg ttgcgcgcag gcgatcctcg gctgccaagg     49140
     ccttgcggcc aagcatggct tctgccgtgg cataggccac cgccagttca gcggcatagg     49200
     tcacccgcgt ttgccgttcg cgggcctcgg cagccacgag gccgcgttgg cctgcctcga     49260
     cgcgagcact acgcttgccg ccgatttcca gcggctgggt gatcgtgtag gtgttctggc     49320
     gctggcttac gccaccactt tgcggcgcgc caaggttttc gtacaccgtg tccacgcgcg     49380
     gattcagcca cgcacgtgcc tgagcggcgt cggcgcctgc cgcagccacg ttggcggcct     49440
     gttctcgcaa cataggagca tgcgccaagg actggcgcag caaagcggtg taaggcggcg     49500
     cctcggcagc actgccaggc atggcagcga acgccaacaa gagcccggca gccttgcggt     49560
     ggaagtcata aattgcggtg gaaatagtcg acctcctcgt cggaagtcct ggtatttcac     49620
     gcaatgtgtt ggtggaagcg gccatgctcg ttccgtttca tggaaatggt cagttgcgca     49680
     gaacaggctg tgcgtaggtg cacacgctta tgactcgcat gcgcaacctg agaagcacac     49740
     tcggcgtgga caatccatca acctggaatc aatgtagtat acccccctat agtatatttg     49800
     atgagatcct acatgagcca cacagtccaa gagaagcaga agctgctcaa ccgcgtgcgc     49860
     cgcatccgcg ggcagctcga cgccatcgag cgtgcgctgg aggatgagca cggctgcgtt     49920
     tccgtcctgc agcagatcac cagttgccga ggcgccatga atggcctgct ggcgggggtg     49980
     ctggaagacc acatccgaac ccacctcacc gaagtggatg ccgaacacga gcacgccaac     50040
     ggcagcgcca aagatcagtt gatcgaggtc gtacacagct atttcaagtg agcctgttat     50100
     gagcgatttc tacgacgcgc cgttcgccag cggccatgac cacgtgttct tgggtgccgg     50160
     gcacgagaag aacgagcgca agacctgggc ggtgatcgtc ttgtgtgccc tgatgatggc     50220
     cgttgagatc atcggcggca gcgtgttcgg ctcgctggcg ctggtggccg atggtctgca     50280
     tatgtcgacg cacgccgggg ccatgctgat cgcggcgctg gcttacacct atgcgcgccg     50340
     gtatgcgcac gacccgcgtt tcgtgttcgg cacgggcaag ctgggcgatc tagcgggtta     50400
     caccagcgcc atcatcctgg cgatgattgc gctgctgatc ggctacgagg cggtggcgcg     50460
     gttcttctcg ccagtgccga ttcactttgc cgaggcgatc ccgattgcga tcgtcggtct     50520
     gctggtgaac atcgccagcg cgtggctcct gagcggcggc gaccaccacg gccacagcca     50580
     tggccattcc catggccacc atcacggcgc cgctcatgac gatgcgcacg accacggcga     50640
     agacgtgcag cacatcacca cgcccgctgg cgtgctggct ctgtcgatct tcgaggatgg     50700
     cgtgccccct gttttccgcc tggctgcgga agccgccgtg ctgccgaatg acgcggcgac     50760
     ggtgaccacg atccgccctg atggcgcccg tcaggaattc gtactggccc gcaagtccga     50820
     cgtcctcgaa tccaccacgg acattccgga accgcatgcc ttcactgccg tgctcaagct     50880
     tggcgggcag gagcacaccg tcgtctttga agagcacgac cacggctacg gtcacgaagg     50940
     gcaccatcgc gaccacaaca tgcgtgccgc ctacgtgcac gtgctggcgg atgcctttgt     51000
     ctcggtgctg gcgatcattg gcctgctgct ggccaagacc ttcggctggc tgtggatgga     51060
     cccgctggca ggcgtggtgg gcgcactggt catcgccaac tggtcatacg ggctgctgcg     51120
     cgacactggt ggcatcctgg tcgacatgac gccggacaag cacatcgccg gccgcatcaa     51180
     gatcgccctg gaagccgacg gcgacacgct gctcgacctc cacgtgtggc gtatcgggcc     51240
     cgggcatctc ggcgcggtgg tgtcggtggg tacccgccag gtgcagcgcg ggccgcagtt     51300
     ctatcacggg ctcctgcggc ggttcaatac gctgtcccac gttacggtgg aagtgcatcc     51360
     gctgccgacc aaatagcgca acggccaata cagacgttcc gcgaggatgt cctgcagggg     51420
     gcacggagcc cagccgtagg gctgctgcca ccgacgacga caagaaagcg cctttgcgac     51480
     ccgatcggta tgcgcacggt atcgccggca cccgaggcaa cttacgcggg cgcgctccag     51540
     gggaccgtct gtcggtggct tagagcagca gcggcaacga aaggttaatg ttttggggtg     51600
     gcctgacggt ggtgcattcg cagcacgcgt ccggcgtcgt tgcacagggc tccaagccat     51660
     ttcgtaccgc aagcctggtc ggagagctct ttgtgaggcg ctcacacgtg ataatccgcc     51720
     attatcacgt gtgagagatt ggctccagtg aggcgccttg acgcctcaaa ttaatacgta     51780
     tatacatagt acgtaatacc gtatcaaatt ctaacgccat ggcccgtgcc ggactcagtc     51840
     gtcttgacat taagcgtgct cgcgattcgc tgctcgccca ggggcagcac ccgtcgatcg     51900
     atgcgatacg tatcgcgttg ggcaacacgg gctcgaagac gaccatccac cgctatttga     51960
     aggaactgga agaggaggaa ggcacggcgc tgaagcgggc tggcacgacc tccgacgcca     52020
     tcctggatct ggtcggcaga ttggctgcgc gcctgcatga agaaggacag gcggtggtcg     52080
     accaacaggt tgctgccgcc acggcgcagc gccagcaagt ccgggcggag gccgacaagc     52140
     tgtccgcaga cctcgccgcg cttcgcgccg agctggcgca ggcccacgcc accattgcca     52200
     acgtgcgggc cgcgcaaagt gacacgcaga cggcgctgca gcagcgcacc atcgaggctg     52260
     aacgctcggc acagcagctc caggacctca cggcccggct ggccgagcat gaaggcttcc     52320
     gtcgctcgct ggaggacaag ctgcagcacg cacaccaggc actggagcac ttccgcaatg     52380
     ccagcaagga gcagcgggat caggacgccc gccggcacga gcagcaggtt caacaactgc     52440
     aggcggaaat ccggcaggcc aaccagacgc tgatcgtcaa gcagggagag atcacgcagt     52500
     tgaacaagga tggcgcgcgg ctggtcaccg aagccgggac cgcggcgaag cgcgttcgcg     52560
     agctggagat gcgcggcgaa caggcccaac tcgcactcga ccaagcgcgc gccgatcgag     52620
     cccgaatgga agcagagcgt gatgctctgc gcgccacagt ccaggcgcaa gtgggagagc     52680
     tggcggcggc gcgaacggaa cgcgagaaca tggttggaga gttggccaag ctttccgcgc     52740
     ttctcgaggc gcagcaagtc atgctgaccg attaccgggc gcagctcggc gtggcgggcc     52800
     cggcagcgta aggggtgagt cgctgcatgt caggcgggag ctctgccacc gccaatattc     52860
     ggcagaaacg acatattcac tgcgcagtga atatgctgcc caccctcagc caggccttcc     52920
     ggacacagct aggtttgcct gggccagcag tatgaaaccg ccagattccg cacaaaaagg     52980
     acgactgtcg cgaaatcgct gaatttccaa gccactgatc tacaaggaaa actcagacgg     53040
     aaccgccaga ttttgcacga aaaggacgct taccccgaga ataagagcgg ctgcaaatcg     53100
     cttcatgggc atcctggtta cacgggtggg ggcacggagc gccttcgttc cgttgcctgt     53160
     ctgacctatt ctgacaagag caatcggttg tcaatgcgcc gtgctttagc cccaaagccg     53220
     cctcgtgtca gctcgctttc gcagcttggc catgtccaac ttccgcctgt ttattgcgct     53280
     cgatcccacg cccgagacgg ttgcggtctt gcggcgcgcg caggtctgtc tgcgggacgt     53340
     ccattggagt ggggcgcgtt ggctaccccc ggaacaatgg cacgcaacgc tacgcttctt     53400
     gggggcaacg cctgaggatc aggtgcagca ctggaagcac acgctgcagc agttcgacat     53460
     gctcgcccgg gatgcagcgc cactgccgat cgacggcgtt gcaatctggc cagcgccagc     53520
     gcacccccgt gtgatcgtgg tcaccgcgaa gttcgccata tgggcgcagg atatggcgac     53580
     gcgcttggag gccctcgcgc gcgaagccgg ctatcgcgcg gaaacgcgag catttcaccc     53640
     gcatgtcacg ctcgcgagag ttggcgcaca tgcggcaact gcgcgatgct tggccgcggt     53700
     ggacaatgcc gcccgggcgc tcgatggcgc gcacctgcag ttcggtagtg tctctctgtt     53760
     tgtcagtcgg tcgccggcgg aggggccagc ctatgagagg ctggcgacca tggagtttcg     53820
     cccgaactga agatgcggcc gcctccggtg gtcgtcggtg gggtgcggtt aggcggcgat     53880
     attctggacc aacaatgcca gttcgatgtc tggcgacacg gcggactgtt cagcgctcaa     53940
     tggtcgcggc aatccgatcg acagtgcgaa cgctggagag ccccaggatt cggttcactt     54000
     cgacatagtc gactccatcg aggagcaggc gccggcagac cgtattgcgc aggacgcgcg     54060
     ggctcatatc ggaagcaacg aaatcgattg tggtcagtgc ggatttaacg attcgcccga     54120
     cactggcctc attgatccgc gacccgtccg tgtgcaacgt gagcaaggct tggccctggg     54180
     taccctctgc tgcccgtctg gtgagccacg tccgcagcgc cggtattgcg aatggtgtga     54240
     tggggaccgt tcgagcaccg cgcgccgcct tcgctttgat gtgcaggtag ggcagagtgg     54300
     catcgagctg caggtcatct agctcagtgg caatgccttc cgacagtgtc acgccggtcg     54360
     ccaggtagag cgctacgacc gcgcgccctc ggacttctcg caatccgtca tcgggcgctg     54420
     gctgcgtgta ggcctgcagc agtgcgtcct tgtcttcggg gaggaacagg ggctgatcct     54480
     catcaggcca atggcccgtg cgcaactgct ccgaagccgg atttgacact cggacatcgg     54540
     cgcgcacgag ttgccggccg acgcggtcaa gcagcttcag gtaccgcatc cttgtcgcgg     54600
     ccgatcgggc gccgaccgat tcacaaaatg ccgctacgtg ctcgtctccg tagttggcca     54660
     ggtcgcggcc cgtctcgcga aggtagcgca ggaatttctc gaacatcgcc tgatgctggg     54720
     cacgcgagcg tgccgagaag tgctggccgt cgacgccttc ggcctcccgc tcctgccaat     54780
     cagcgtaagc gcgttccgga ttgttcagcc aaagtgtgtc catcgcaatt tacggcctgc     54840
     tatatactga agtacagcta cgaccacatt tcggcttcgc cgaaaccccg cctccacagg     54900
     ggaggggcat atgccttctt ggaccaagtt agccgcgaag aagcccttgt caacgagatg     54960
     gcagtgccgt cgcccacgtc attcggcagc cagatcgcat taggcggtca gaaactcttc     55020
     gatctggcgg ccagcactca gatgggcaac cagccatcct ggcctcttgc cacgtcccgt     55080
     ccaggaatta cccgcctcat cccggtattt ggccggcggc ttgcttctcg ccgcgccgtc     55140
     gcccttgaag ccgagatcca atgccgtgag cccgtacaga tcgatcttct cgtgaatatc     55200
     cacgattgcc gcttgcattt ccttctgcct gagagcttct gcttccttct ggagggcggc     55260
     aatctgtttg acgatgtctt tgtagctggt catggaagtc ggttcctggg caatcaggtg     55320
     ccgattcaag cacagattac ggccgcgcgt cacgtgggcg cagcgttcgc aatgaaacag     55380
     catttgtgct tttcagatca cataataact attatgttaa gtagcagccc tgtgcgaact     55440
     tcgcaatgcg acaaaggtgc ccggtcaccg aaatgaccgg gccggccggg ctacgttggc     55500
     gcgccggagg ccaacatcgc tatcgccatc accagcaggg ccaagccagc acggccactt     55560
     ttgccttgaa tcatgtagca cacccaaacc accatgccgg ccgaaaagat caccgatttc     55620
     aacaaagcgt tctcccaagt agtcgatgca cagggagatg ctttacagac gacgataaag     55680
     gcgttgctgt aagtcgaggc caaccgctca agcctcggga aagtggatgc gagctgcgcc     55740
     gatggtcgag ctttggtgct ccagcattgt gcccagcgac tgcaacaagg cctggcagac     55800
     tggggattgg ggtccgggga ccgatgccac tgccacaggc acctagactc caaggagttc     55860
     gccatccgga gtccgctatg gcattaccca cgcagaccgc gccccgccac tatgcggtgg     55920
     ccatccggga cacggagttg taccttgccc tccgcatttc gcgttccgcc agtggtgtct     55980
     atgtcatctt tccgcgcccc caaaatccta ttggcgggac gaaacggaac ccacacgcca     56040
     gctatcaccg ggacgggagg cggcatcaaa agagctgggg catgccttgg ttcaaggcgc     56100
     aacgacagcc gctggacaac cacttccgcg gcagcgagac aattgtcgcc actgtactgc     56160
     agcccagcca cccgcaagac ccccactgcg acccgaagga tttctccgcc gtcctggaaa     56220
     tcccgctcac tgacatccgt cccaacggca gcacgtcggt ttcggtcgat ctggccgagc     56280
     ccggggtgtc gccaacttcc ttgctacccg gcgccgtgat cgtacggcaa caggcctacg     56340
     ccgatggctg gttcccctgc ctggtggtga ccatctatga ctcccccact tcttcgtgag     56400
     gggtctaacc aagataaggt gagattgcgc acttcggtcc cgaggcggtt ggccctttca     56460
     ttgctccccg ccccggactt gtcacgcttc gatcaggaat cgatcgcgat tcttgccaat     56520
     ccatgcaggc gccctgccgc ggcccgacca ggtagcgccc gtcttcgggt cccgatactt     56580
     gggcggcacg atcgatttgg cttgttcact cttgccggcg cgagccttga ggccgatatc     56640
     tgctgcggtc agaccgtacg cttccacgat ctcgcgagcc cgcgcaatcg ccgctgcttt     56700
     ttcggcgagg tgtgccgcct cgatctgcaa atccaactta gctttttgcg ccagaagctg     56760
     tttgtacgtt gccacgaaac ccccgctttt atttgagcgg caaggatagc cgatgtcgcc     56820
     cgcgcgcgac tgacaaacgc gctcactccc tgcgcaccgt tacgtgaaca caggcgctgg     56880
     acgcctttca gccgcgccaa actgggctaa acacccggtg cgcaagttcg ttggtagcgg     56940
     tgaggttcac cccgcagacc gtcccgctgt cactcaaccg gcacaggcgc gcaaacgtgg     57000
     catgcgcagc gccagaaata ttccttggat cgctcagcca atccttgatg tatctcatgc     57060
     aaaagccggc aatgacatct gccaactgga gaccaatcga gtcgtgggac ttcgcgaaag     57120
     tcagtggcgc cgaggcgccg aagttgtagt cggcgtgcgg ggtgaagaag ttggccgcct     57180
     gaccgccgag ggcttcggcc gcctgcttgt tgttggacag gatctggtcg aattgcagtt     57240
     gctcgtcgtg caccagctcg atcgttgaaa ggtcccgttg gtaatgcagg ttgatccgag     57300
     cgtagatgtt cgtaagcgac gagagattcg gcaacattga aacgggcttc ccgcgcttgc     57360
     cggtgtccgg cgatggcagg aattgcgcgt aagcagtagg aacctcgtcg gcgagcatct     57420
     cctcgtagtc gctgaacgac agattcgtca tctcgcgaca cgccgctgaa acctcgcccg     57480
     ccgggaaccg atccaggaag tccagcaagg cgccaaagga cgatcgcagc gtggcatcgg     57540
     acggggcctg gcaggcggcg atgaacgcgt cgaacacttc cgccggcgtg aagtgataga     57600
     gaaaatccgc aaatgcattc tggacaaagt gcgcctgcgg attgcccaag atgcccgtgc     57660
     tcggtggtaa cacatggctg ctaaccatgt tcatcaccaa atagaatctc ttgtcgacga     57720
     cttcgatgaa gcacggtggg gctcgatcac aaatggcgtc gaccaggtca cggacaaact     57780
     cgggcttgcc tgtcaatgat ttggacttca actcgccagc cggaacgcgg tgcgccgacc     57840
     ggatctcctc gactaccgcc gcgatcgcgg cctgatcgtg caagccgatt gcggcaagtg     57900
     caaaggtcgg ctgaccgtcg aagtcgtatg ccttgccggt actggtggcg ccaccggtat     57960
     tcccgctctc atcgatgtag aacttcatag ctcggagcga ttgtcgtttg cccgtgttgg     58020
     caggtgcctg aacaggcggg tagtttcacg gctccctgca ctccggccat ggacaacgca     58080
     ccctattgcc caaggtagcc agagatcgcc tgggcgatac cgccggcgat cgcctcgaca     58140
     ccaacccctg tcgccttgtt gaacgccttg ccgaccagtt ggccaatcca cgactttgat     58200
     ttctcggacg tgccagatcc agctgcgcgt tctgcatcga gatcgtgttt gaggcctgca     58260
     aaatcggcct ctaacagtcc gagcgactgc aggtagaggc tcagcgcctc ccagtcgccc     58320
     tgccccacct gcacgttggc tgtctgcgtg acgcccgtgc ctgcgttggc tatgttgccg     58380
     acgttgcccc cgatgtgggt attgaagatc tgagtcaatc gttcctcact gatcggtttc     58440
     gagccgaccg gcagctcacc agcgtccggg ctcaattttt ccaattcgat ggcatagccc     58500
     aaaacggccg tcttgatgca atcgagcaac cggtcgatcg ccccaatcgg aatctccatc     58560
     catgcctcga cgcactgcat gtccggggtc agcttagacg catatttgat cgccagcgcc     58620
     acgttccaat ccgtcttgac gtaagacggc ttgttgcctt gcaccagatt ctcgtaggtg     58680
     ctcacggcct gcgccaaccg cgcaattgaa tgccattccc gcaaatgctc tggcagtagg     58740
     aagactggca cctgcagcct gggcgcgttc atgccaaacg gtcccacaaa gctgccgtag     58800
     gaaacaacgg gtgtcacacg gtagggtggc aggtccgcac cctcgggata gccgcgcaac     58860
     tccaaatcca cccactgctc aagctgggta tgccccacac gcgaggccag cagcttgcac     58920
     ttgcgcagca acgacgaaac gctggtcgac acctcgatcg catcggcttg aatgctgcga     58980
     atcaacgaca tgcggtgctc cggtcacagg acagtgggct gccggcattc tacgcccacg     59040
     cggcagtcgt cccgcgcagg tcaccgacga acatcccaag gcggcactgg cccgtgatta     59100
     caggcacttg cttggcatat cgatcgtaga tcacatgaaa aattcgtcac tcgctggcaa     59160
     ttcgtatcgt atcgtataaa ctgcaatacg atatcaattc cggacgttca tacgatacga     59220
     aatggcacgc caagggattt cctacgagca ggtcgttgat gccgccaagg cactggtcgc     59280
     cgagcaactc aagccgacgc tcagcgcggt gcgcgagcga ctgggcagcg gcagcatgaa     59340
     tacgatccac cgccacctga ctgcttggca gggtcagcaa aagccgggcg cgcgcaagat     59400
     cggcgatccg aacccacgcc tgctggccgc gctgggcacc gagttttcgc gggtggccga     59460
     ggacgccgcg gccgacgcag aagccgccct ggcgcaggtc atgagtgaaa acgcgatgct     59520
     ggccagcacc ggcgaggcgc tggaagccga acgcgacgcc ctgacgcagg agctgcagca     59580
     ggttgcgaca gagcgtgaca agcttgccgg caaggcagcc gagcagacag cagagatcga     59640
     acgcttgaat gcagaatcgg agcgggagcg cggcgaactc gcctccgttc gtcgggcgct     59700
     cgcgcaagtg gagttgcgac tggaagcgct gccacacttg gagcgcgaac tgagcgagct     59760
     gcgcgcccaa ctggcgacgg aacaggccgc ccgggtcgct gccgatcgca cagccgccgt     59820
     cgccgatgcg cagcgtgaag ctgctgacat cgcccgaatc caggccaacg agcgcttggc     59880
     caacgccgaa tcgcgcgagc accaggtgcg tgcccaactg gctgaggcgc aagccgcgca     59940
     tgagcgcacc cgcgagaaac taaccgaggt cgtcggtctt gaggccggtg cccaggccga     60000
     gttgcgaatg ctgcgcgagc aaattgaggc cgcgaagccg acaccagagt cggcaccaga     60060
     tcagcagacc ggtcaaccgc cgagcaaacc aaactcacgg cgcaaggggg cgtagcaacg     60120
     ccgcttacct acccactggg cggcacggcc cccctctgca ttgcgccctg cccgccatac     60180
     agtccttccc ctagccctct tcacatccgg agtcatcgca tgctgcggtc gtttggcctg     60240
     gttgaccaat ttcgcacact ggcggcattc gtttgtgccg ccaccctcgc ctccacaccg     60300
     gctattgcac aggatggcgt acccgcactc gcaatcaccg cgccgaacgg ggccaaaagc     60360
     gtgctggtcg ccactctcca cgtcccctat cagggcatgc gccagccggc gatgtcggtg     60420
     ctccagggcg ccacaagttt tgtcattgaa agttcgaggg cccaaggtcc acagcctgtc     60480
     gaactccagg gcgccgatct actggacccc gaggtgtttg ctggtcgggc ctctcgtgca     60540
     ccatgggccc ggtcattgac cgatacacag gttgaatttc ttcagctgcg cgcgaaatgc     60600
     gcagcacctc aacgtcccga cctggccatc gaaatgctgc agcacaagag tccgcgtatg     60660
     gccgccgcgt acgcttggat tccctgcaca gaattgagca acctgtccag agacgcgata     60720
     ttcgcgatag cggcactgcg ctacaacgta gcgatagtgc ctctcgaaga tcagaccgac     60780
     ttggaaaacc ggcgacgcgc ggtcccggat cggatctatt ggcgcctgct gatgggcggc     60840
     ttgaacatcg cccgccagcg agaggatttc cgtcaagctg ttatcgcatt caatcgcggc     60900
     gactatgaga ggatcgccgc tctcgcgagt ctgggtaacg aatctccaga ggatgcggcg     60960
     atctatcacc gcctgatggt ccacgaccgc aatttgtcct ggatgccgcg cttgcgccaa     61020
     gccctcgacg ccggcggcgc ggtggtcgcg gttggtgctg ctcacctgcc agggtccgac     61080
     ggactcatcg cactcttgcg agcggacggc taccaagtca acgacattct gctgccgaat     61140
     gacacagcaa tggagatgca agcaccatga tggatgatgc aatgcatcgc gctcaagatg     61200
     tcgtctatgg ccaagaccaa gccgcgcaga tgcgaaaggc accgggcctt gcgcgcatcc     61260
     gcgcggcagc atctgactcc agttgcacgg tattggacca gtcggtctgg aagcgcactg     61320
     agctgggccc ggtccttgat ctcctcacga ctgaaggatc aacccagcgg gtctacgtcg     61380
     acgtgcccat cgccgccgtg gttggcttaa cgcatcggaa tttcagcaag gccttgacgt     61440
     ggcgcggcat gctgcaggac ctgcacggtt ttggctggga cgagcgcgtc attgactact     61500
     gcgaatcgga aatcggccac caatcatttc ccgcccctga ggcagcgtac gaactgaagc     61560
     tggccgccta cggcggggct gtgacgtgca ccaacggcgt ccaccgcctg gtcgcggccg     61620
     tgaactggtt gggcgccacg caaggtgaac acgccgtgct gcgcaaggtc tcggtctggt     61680
     accggccgac cgatgcctcg ttggtcagtg cgttgcgcgc gctcgagcag caaggcgccc     61740
     gattgcgtct cggctgcgcc agagacgacg ccggcatccg ccgtatgtgg ttcatcgaat     61800
     caaccaccgc gcaccgcgtc agctatttcc acgtcacgcc cggacgctgc actccaattc     61860
     aggtcggacc gcgctgggtg gcaaaagcac gagcatgggc gggcctagag gccgacgccg     61920
     tacatttcgt gtcggagtgg ttcgatattc ccccgaccgt tctcgatacg gtggtaaagg     61980
     atgcttggat cgacgcgcag atccgcgcgc cccgctacga ggcccctctt gactaaatga     62040
     agacggtgag tcccgttgtc cagcacgact ggccttgcta ttcttccctc gcacgcagta     62100
     gcgcgcacaa ttcgccatct cgcgatggtc aaccaccttg aaatctacgc actccatggc     62160
     gacgaaatcc aagaccgcag caaagaaagc cgcaccggca aagaagaccg ccgccgccgc     62220
     ggccccgacc atcaagccgc tgaaggacac cttcaccaaa gccagcctgg tgagtcactt     62280
     ggccgagcag acagaacttg aggccaaggc cgtgaagtcc gtgctcctgc atctggagaa     62340
     caccatcctg agtgcgctgc acaagaaagg cgccggcgag ttcacgctgc ctggtctctt     62400
     caaggtggta tccgtgaagg taccggccac caagcgtcgc ttcggcaaaa accctttcac     62460
     gggccaagag caatggttcg aggccaagcc ggccagcgtg cgtgtcaagg tgcgcccgct     62520
     gaagaaggtg aaggacgccg ctcagtaagt cctccgctgc cattcgtgcc aacgggaggc     62580
     caagcctccc gttttcattg gcgcgtgtgc ccaacgcaac ccatgaggat gtcttgtctc     62640
     tctttcccca gcgtagcgcg gacgtgcgcc gctacaagtt catcaattgg aacgtcgtac     62700
     tgaagccggc tctgcaagag aaatttgaga aggtcatcac tgcagccgag caagcaggct     62760
     acctcgaacg gctatacgtg cgcgtcgaac gcgagcaccg aactgtcacc ctattcccag     62820
     gccagcatcc ggtgggcgct tcgctgagaa aacagggctc gacagcggcg gagcacggag     62880
     ccgcacttgt gttctctcaa gccaaaaccg gcaatgtcgc cgtgctgctc tatccgtacg     62940
     agtctgaatt catgcggcag cccgaaaagc tcatcgtttg gcgagtgttc gtgggcccga     63000
     acgatgtcac acaaagcgtc atcgacgcag ccgtggccga cgcgttccga tactggcgcg     63060
     tatccagtgt gctcgacggt ggttcgcggt gggatcgttg gcgcatcgga atgctgcggc     63120
     gccgagaccg ttaccaatcg gcggagaagg cgatgacgac tcggccaagc ctggtagcaa     63180
     gggccgtcgg cgcgttcctt gcctggtggc ctgttgctgc cttcgtcgcg tttagtgccc     63240
     tcgtgacggt cgtgaccggc tggcacgact tcagcgacaa gtttggtgcc gctttccact     63300
     caacatccac cgcagcgaaa gagtcgacga ctacatcaaa gacaggccgc gccagcgaag     63360
     cggcggcggc cccctcgaca gcgcaggatc gctaggcccg cacccgtagt tacgggttca     63420
     accgaactgg ggggcgaggc atccctgttt tcgggtagta gctgtagtac acgtcaacag     63480
     cgcgggccca gcagtcgagc aactcgtccg agtggtcgcg tacccacttg gccaaggcct     63540
     cagcgttcgg gtggctcatt ccgaacgccg gcgcaccagt cgccacgtcg aacgcgcttc     63600
     gtgtccaagc agaaagcgaa cgccttcgcc ttctcgaagg gatagtcgca gggcaccagg     63660
     gggtgcagcg actgtagcgt ggcggcgctg ggcaccacaa agcctgcgtc atggaagtgc     63720
     tgccggccat gcgcttcaaa gtcgtagtct acgaacccag ccgggctgtt gtattcgacc     63780
     cgcgtaatct cggaggcggt gatcggcgca aacgagagcc accacgtgcc ttctttggtt     63840
     gtggtcgatt tcaataaatg ccgccgtctc gtgagaggca gacgccaagg attttcgacg     63900
     tatgcggaaa ggcccataag cttggcttca tcgggctttt cgccacgacg cgcgtagtac     63960
     tcgacaaagg gcatcagagt ggctgtgtcg gccgacatct ccaccgtcag gcgcactcgg     64020
     gttttgttca tgacgatgcc attcttgggt gcgaccccat cgacgcgggt cagatactcc     64080
     atgtctctcg cggtcaacgt tttgtcgcct gtcgtcaggc cgtgaccatc agcatcggga     64140
     tccgtcgtca gccagaccac tgagttgcga atgcttccgt caccatgctt cacgtggcca     64200
     cgcgaaatcc ccatcgagag gatcgtttcg gcgtacgaga cggacgtgaa atggtagaac     64260
     ttcatccgcg ttccttcatc gttgtgtgtg ttgatagttc agcaacgcga ttgaccgaat     64320
     gcggtgtcaa acgggtgccg acaagctttc ttcattcaat tagtcgcaac tgtcctaggc     64380
     gctccaatcg ctcgcggtcg gcctgatcac tatgctccgg tgcgaccggg tgggcagcgc     64440
     cgcaaatcgt gcagatccaa agctgcaccc ggtgtgccgc gtcgaacgat gttacgccgg     64500
     cattttcggg aacgtggtca cgcaggacgc cacaactgtt gcaggcgagc catcgtgtgt     64560
     gggatctcat gggagtgctt cgagggtttt ggcccgttcg atgatagcgc gcacgttcgc     64620
     aaggcaaggt gctcgctcat acagtgaacc aacttcaatg ccgattttgg cgccactgag     64680
     caaattgctg gccgtcgatt agttcgaagc caaactcgcg cccgacctcg gcggcccccg     64740
     aagtaaagcg gcttgtggta atgacgatcc ctttgctggt gccgctgctg ccgcgatcag     64800
     caaaggcaat ggccccatgc agttcacgca cgatttccgg gccgacactg cgatgcgccg     64860
     cccagcattt gcattgtacg atccaagatt ggccgctctc gtcaaccgcg tatagatcga     64920
     cgccaccatc gccatcccga ctggcggcct ggtgaatcac gcgcagccct cgttccctga     64980
     gcagttgcat acaatcccgc tcgaactcaa accatgccgg ccgcgcacct tctggcgcgg     65040
     ttgatacctc ttcgtagatc atgcgcgatg ccgagcggct gcggtagaca cgcacccgct     65100
     cagcctccgc cattgccccg cgagtgtgtg ggcgcacgaa tgtgaaccct tctggaaggt     65160
     gcattccata ccgctgtgcg agaaaacgct gagtcgccga tgttgttgcc gcccggcgca     65220
     ggtgttgagt gacagcgtgt ggggcacgac cagattcgtg cgcgtgttgt gtcgcctgcc     65280
     gtagattggg ccggctatag cgtacgcgcg gcaggtacac caccgtcgtc aagtcacggc     65340
     cacggctgcg gcgcgttgtc gttcgcgtac caaacagcga ctctcgctcc tccaccacaa     65400
     gaaagtcccg gatgatcgca gctgcgatca actgcaagct caactcggcg tccgtgttcc     65460
     acgtcacttc gccatcatca tcgcgcgggc ggatcaagcg gccacctgtt gcgcgcggcg     65520
     gatcgctggc aatgccaatc gcgacatggt ggtagcgctg cgctgcgtcg agaaattggc     65580
     acgcgaactc gccttggttc tcaaagatcc gcaccgccac gaatgggccg aacgccactt     65640
     ctactcgtgc gccccacggg atagtccatt gccgagcttc ctgtgcttcg cgcagcatcg     65700
     cctgaatcgt cgcttcagct tcgtcttcgg tgccatcgag cgcgacgccg cgcatggctt     65760
     cacagacatc cgacaacggg accggaaaat cgtttggccc gaggcgctgg cccgcgtcaa     65820
     tgaggtccag catgtccaga ccgctgcgcc acatctcctc gatgtcggac agcgacgctt     65880
     cgaggttgaa cggcgcacta cgcaattcca aaccgtgttg cccagtgttg gcgaaccagg     65940
     gccggtgggt gccgccctgc gtgatcttgt catccaacag agcagcctcg aacgtccaac     66000
     gtgcggcttc ggacaacatt tggtcgcccg catcgttgag cagcggaatc agcttgtcga     66060
     gcaaacagaa cagcgcgtac gtgtcatgca gcacctcaac acacgcccga tacgcagctt     66120
     ccgcatcggg ggctggaccc gccaatgctg ccagccaacg tccgatcaat ggcgcacgcg     66180
     ccactagcac cctgccctgc tcggcaataa tgccctcacc gagccagttg ccctcttccg     66240
     tgacgaccgg tggtacgcgg tcatatgcct gtcgctctgc aattccgcgc acgaagccag     66300
     cggcgaggcg gcgattccga tacacctgcc tgccccatgc gacgcgagcc ttgtctgttg     66360
     catttaggtc gcctgcccag ggcccgtcat agttcagctc cgaccagacg tctgacgcgg     66420
     gttccgccca aagcgggatc gcaggagcgg catcggttgt gtcagccttt cgttcgcgct     66480
     cgaatggatc gaatcgctga ccctcgcgtg acccctgcag tccaggcacc ggatgttgcc     66540
     attgctgctc catgccttgg agtgagggag cggtttcccc aaaacccgaa tgcaactgcg     66600
     cctcaaacca aacagtttgg tacccctccg gcgaaacggc gatcatgcga aagcgaccgc     66660
     gctggcgaat cgccgcaacc actggatcag cgctcggccg catccaccgt gtgtggggat     66720
     ggggattctt tccctctgtc atcaacgtaa aggaaaacac catggagggg gtgttgttcc     66780
     aacgccaacc aattgcgacg cacgtccgct gtcgacgtag ccgttggatg gtgtcacggt     66840
     cctgggcgat gaacactatg caagcaacgc catcttcacc gatccagcca ggtccgaaga     66900
     accgttgacc caccgaggtt cccttgaacg gctccgccag cgctttgact tgggcggccg     66960
     tggcatgttc tatcgtcgtg gcaaccgcgc gcgccaccgg cactcgttcg ttccggggga     67020
     attgcttagc aggtgggttt tggtcggcgg gcataggcga atcggcaagc tcagttcgtt     67080
     gtgccataca gggcagactg gcgatcagcg gtcagatgcc accgctgggc aaggttggcc     67140
     gcttcggtgt tgctggccag gaccgcctca gcctgcggaa acaaggcaac gtagctcgtt     67200
     gcaaagaagc tcatgaaaac gagggccacg cttacgaacc tagcggccat cgcctcctgg     67260
     tcgcaaagcg cttgtgcatc gcgaatctgc agaatgctga gccagctcga gtgcgcgtag     67320
     ccgcagagga agctgtagat ttggcggata tagacggggt ggaaaccggc ggcgatgcca     67380
     gtgtcgatcc aagactggcc ggcgcgccat tcgcccttca gaaccttttt acgcatcggt     67440
     tcggaatact gctgccagac gccgtgggct tcgatctcga tctggagttg atcgatcctt     67500
     gtcttctcgt cggccaactt ctgttggtgc tctggcgcac gtgccggata cgcctgtcgg     67560
     tccagtaggc cggcacgacg ccagatcata tggcggaatt gtcggacctc cacatctttg     67620
     ctgccgtaga tgtaggcgaa cgtgaggtag gtctccagag ccgcgcgcgc aagaatcatc     67680
     acggaactgt ggtcgatgtg aagatctgcg ccatacccgg caatatcgat ttggaccggt     67740
     tgggctatca ggcgcagcga ggctacgtgg taacagaatt ttttgcccag cacttgcgca     67800
     tcgttcatcc aaagctggtc caccgggatc tgctgcccgg cctgggactc aacgagctgc     67860
     atcaccaacg tgagcaggcg ctcaaagtcc cccgaaagat catggttcag cactgatgca     67920
     gtcattgcag atatgaaaaa gccgcccgaa ggcggctcct gtaacgtgcg agtgtggcct     67980
     cagcctgcaa cccttacgcg ccggcctgcc aacaccgatc ctgctacttt gggctccact     68040
     accgaccggc gcgcgaccgc ctgttcgcgc gtcaatttgg cgaacacggc gaggcgcgcg     68100
     gcgacctgtt ccggcttttc ggccaggagc gcttggcgtc gaattttgcg tgctgtcggc     68160
     ttcatggttg atctcccttg cgcattgcgg acaggactgc ccccagatcg cgctcaagtc     68220
     tctcaatctt accctttttc tccacgaccc gtgagtagcc caggcttttg tagaaatcta     68280
     ccaactcggg aatgggccgc tgcaatgagg ccgtcgtgca gtcaaacgcc gccgcacaga     68340
     attccaggta gcgcactgcg atcttggcaa agcggccctg cagcgggtta ggtgccggcg     68400
     cacggctgag caggtggatc gacgcgacca cgtgtcgatt actgatccgc cccaggatca     68460
     agccacacaa gacatgcgtg tgatccggca actccgcata aacggcggcc tccacgcggc     68520
     gcggccgacg gcgagcccgt gtcaactcgc gggaccatag ccagcctggg gcatagcctc     68580
     cgaaggtcca gcgatctgca gcatcgacgt ccgtccgtcc gatcggccgg aagcgcaccg     68640
     ttaccccctc ttctaccgcg acggccgcgc tggccgccgc gcctgccagc tcgcgacgct     68700
     cagcgcagcg gctttcggca gtgtcccagt cttggcgctg ggccgccatt tttgaggtcg     68760
     gcgacgacat ttcggtctgg atggaggcta ttgggctgat tctaacatgc ctaaaagcgc     68820
     actccatcga gtgaagtgcg ctttttactg tggttgataa gtattcttat catgtactgt     68880
     gaaattaatg tacgctttcg agaacgtcac tttttcgcgt tttccaacag gcccggaaac     68940
     ccaagcccga caacgcttcg ccgcccatgg acccgctcga ccccgaccac aaccctgaac     69000
     caccccccag cctcgagacg ctgcaaagtg aaataaagcg cactcgaccc acccgccgcc     69060
     gcgttgtcgt tcgacgccac ctccaccgtg gccatttcgc gttcctgcgc gcggtcgtcc     69120
     aggggctgga tgcccggccg atgtgggcgc gctacctggc catcgatggc gaactggagg     69180
     cgcaggccga gctgacgcag gagaccttcg tcgcgcaccc gaaggtacgg cgcatgaccg     69240
     cctggctgcg cgctgaactg gcggcggccg tgcgccgcgc cggccactac ggcaaggtgc     69300
     gcctgatccg catcgacctc tccggccttg cgcagcgcgg acccgcgttg ccagcgctgg     69360
     aggagttcgc gctggagaac gggctggatg acttcagcat cgaggagcag ctcgaagcct     69420
     atcgggagcg cttcggagac gcggtgcagc gggccgagcg ccggaccaag ctgatggagc     69480
     ggcagctgcg cctgctggcc gacctggaac aggtgctggc ggagccggtg cgggtcgacg     69540
     accactgcca cgcgtggctg gccgcgggcg tcgcggatcg gctggaggcc gccggcgtag     69600
     ccaccatcgg caccctgatc gaccgtatca acagcctggg cggcggctgg ttccgcgcgc     69660
     tgcgcggggt cggcgagaag aaagcccacg ccatcgagcg cttcctgcgc gcgaacgccg     69720
     acacgctggc gcgcaaactg ggcgaacacg cccggatccc gcgccggcaa ctcaccgcgc     69780
     acgagcgtga ccgcgtggtg gcatccggca ctggcctcct gcccctggaa aagatcgttg     69840
     tgccggccgc gctcgacggc agtaacggcc gtttccggcg gcccccggtc gagtgcctgc     69900
     tggacgccca gaacgactac gaggcggtac tcacctggct gcgctcgaaa ccggggctgc     69960
     cgcctgccga gatcgcccgg cggcgcaccg gccggcgcga tgtcatcacc gagcccggcc     70020
     cgctggattg gctgcactac ctgtccaaca cccagcgcag ttatcgcaag gaggcagaac     70080
     gctttctgct gtgggccatc tggattcggc gcaagccgct ctcgtcgatg acgactgagg     70140
     actgcgtcgc ctaccgcgat ttcctggccg acgtgcccga cgactggtgt gcgccacgct     70200
     ctcgggaacg gtggacgccg agctggaaac cgttcgaggg caagctgtcg cccgagtcgc     70260
     aggcctatgc cctgaccgtg ctgcagaacc tgtaccggta cctcaacgac aagaactatc     70320
     tgagcggcaa tccgtggggc ggcgtgcggg cgacgaatgg tggcaaacca cagctggacg     70380
     ttgggcgcag tctgaccgag gaccaatggg cgtttgtggt ggagcgcctg ttcctgctgg     70440
     agcgcacgtc atcgaacctg cggctgcagg tcgccttgcc cttgctctac gccacgggct     70500
     tgcgtctcgc ggagatcgtg ggagcgacaa cggccgacct ggcatggcgc agtctcgccc     70560
     tcccccgctc cggcgaacgc atggacggct ggtggctgac cgtggtcggc aaggggtcgc     70620
     gtgtacgtga ggtgccagtg cccgatgagg tcgtgcacgc gctgggcgcg tacctggact     70680
     cccgcggctt ccccagcgac cccgcccaga ttcgtgagcc ggtggccctg ctcggccacg     70740
     cgaccgatca ggctgagcgt gcgccgtggg caaagcggga cacggcgagc cctgccgctc     70800
     cgctgacgcc gggtgtgctc taccggcaga tcaagcgctt cttccaggcc tgcgcaaccg     70860
     agttggaggc aaccgatccg cagggagcag cacggctgaa cgaagccagc acgcactggc     70920
     tgcgacactc acacgcatca catgccattg ccgccggcac gccggtcgag atcatgcagc     70980
     agaacctggg gcacaagtcg ctcgacacca cgacggtcta cgtgacgtcg gaagaggcca     71040
     ttcggatgaa ggagctgcgg gggttttgga agcgttcgtg attttcgaat gcgggggccg     71100
     caacttcccc gtctttgcag gcttagccgg cactgtcctt aagctggcgc caagatcaaa     71160
     cgaagcccgt ccttcattgg gctaactttc agtatatagc gagcccccgt gaacccctca     71220
     atgagttgtc acgtggaaac tcgccccgca agcatcccca gctgcattgc tgcagtttcc     71280
     acgtgacaac ttatcagacg agtgtcatgc gcacgcagaa tcatgcgaca tgttgtcgcc     71340
     gactgccgcc agagaccgta cttctgaacc ttctattgca tcacatagat gctggatagt     71400
     gacgccagca aaggggccca tcgcgtttcc aggtggcagc taccaatggg gttcggtaga     71460
     tccgtaaaag tttcgcccag acttcgcgtc attgcgatcg ccgattcggc taatagctcc     71520
     aagtgttccc gtcagccacg aagcccgttc gcccgaaccg cacatgcaac gtatgcttgg     71580
     cacgagtttc cacgtgacaa ctgcactcca gcgtcaggaa agatgtgacg ggttgtcacg     71640
     tggaaactgg tcgcaaagtt cagtccacag tgcatgacga ggatagtttc cacgtggcaa     71700
     ctcatttaca acggctgatg agaaaaacac taagagagat aagaaattcc ttgagttcac     71760
     agcaagtctc gctaaaatca caaaaacctt ggagaaccta tgagcgcatt tacgattgca     71820
     atcgcaaacc aaaaaggtgg cgtaggtaag acaacgctga gtctcaatct cgcatctgcc     71880
     ttccaatctg gaggcacgga cgtcgctcta gtcgacgcag atcctcagaa cacctcattg     71940
     cgatgggcaa caagcggtga ggagcctctc aagatttcgg tggcgagtct cgctcccgca     72000
     ggttctaaga tcggaaacga aatccaaaaa ttgcaaggca aatacgatct tgtcgttgtg     72060
     gactgccctg gtaaccttga ggacccgcga acgcccgagg tgctcggcat cgcagatttc     72120
     tgcctgatcc caatggggcc atcgccggct gacttgttca gcactctggc aatgattaac     72180
     gaaatcaaga acatcaaacg gcgcatcaat ccggaattag cttccgcact gatgctgaac     72240
     aacatcaatg gccgtacacg catgcgagaa gaaatccttt cgctgctgaa ccagcaagac     72300
     gttggtacgc atctgctcca gagtcaaatt gcccaacgtg aaatctatcg gcagctgttt     72360
     gctcttggga ctaccgcaca tgagtgcggg cgatacatga aggggttgaa ggaagcacgc     72420
     gctgaaatcg agtcgctggt ccttgagttg acgcagcaca tcactcaatc gcgttcgcaa     72480
     aaggtggaaa atgtctaaga atactaagga cactaaagtg caaggcgcct cgacaacaaa     72540
     ggggcagccc atcccaaagc tcaccctcgc gagcgggctg attaaggggt tcaagaacga     72600
     gcagcaggcc attcagactc gcgagcgaga gcaggaaccg cctccggctt cccctcagga     72660
     gcaagaatct caacccgtta ccgagacaac cgccaacacg gtggaacctg ctgccggccc     72720
     aactgcgtcc gcagttggtg ggcgcaagag catcgcaatt gccgattgcg tctcgaaccc     72780
     gtacaaccct cgcgtcttct atccagaggc gaaaatccaa gagttggccc taacccttca     72840
     aagggaaggc caaattgagg ccatcaagtt cacgcgccta cctcagttcc ctggcaagta     72900
     tgtgatcatc gacggcgagc gtcggctgcg tgcgaagaga tcgctgggcg agacgcacat     72960
     cgatgccgaa gaacgtcatg acgtactgcc catcgacctc tacaccacgg cttaccgagc     73020
     gaacaacgac cacgagcggc agtcaatctt cgatgacgcg attgcgtggc agcaattgat     73080
     cgagcaacag gtggtcgcgg atcaaaattc gctggctgag aaggtcacca aagacaaggc     73140
     atacgtcagc aaggttcttt cgctgaacgc actgccgaga gccattctag agcgcatggc     73200
     agaaagtgct gatcgtgtgg ggttgcaggc ggcctactgc ctcaagttga tcttcgaccg     73260
     tgtcggggag gaaggcgctg atcgtcatct gacggcagtt atcgaaggca agagaacggt     73320
     gcgcgaattg gagctcatct tgcgcaacct gcaaggcccg ggcgctaccg cgaagcgaag     73380
     tcgcactcgc taccaccagc ttttcgattt caaagctgat ggtgtgcagc gcggccaact     73440
     taagacattt cctgacggcc gaattagctt ggagctgaag gaaattccgg ctgataaaca     73500
     agaggcgctg gctgagaagc tgaaggcact ggttgaccaa gagttggtag agccatcagc     73560
     gggctagcaa cagcacgctg tatgcaggtt tttcaacgac gaggcccagg tgtacctggg     73620
     tctttgtctt tttttgacgc tctctgaaag agacgcagcg tttactttgt ttacgtaaac     73680
     actttaaacc tttaaacaac atttaggctc cggaaaccca agcccagtaa ggctttgccg     73740
     gtcatatggt gcatagattt gtggattggg tgaacaccat tggggaacgc cggttgtgga     73800
     tttggggcta cggtgaaagc cattggggcc aaggggttgt ggatttgggg ctttggtgaa     73860
     cggatttggg gcgccgccag cgaaccctaa aggtgaaagg atttggggat ggcgagggtg     73920
     aacagatttg gggagagcca ccctagagta cagcccaggt gcgacacacg agaccgtagg     73980
     ttggacccgc ttggtgaacg gatttgggga gatgaaaggt gaaaggattt ggggcgcatg     74040
     cgagcaggca ctcccgcaca aatccatgcc tgcaaacata ggtgaaagga tttggggatt     74100
     ccataggtga acgaatttgg ggtaaccccg tgagtaccca cttccatcca gccccaggct     74160
     cccgggcata ggtgaaagga tttggggagg ggaagggtga aaggatttgg ggcaattggc     74220
     tccgaaagcg cacccgagac gacttcaaga gtctgtcgcc ccttccaatg cttacgaaat     74280
     gggcaaatga gcgctatgga gcacaataga tggacgggca actgcggaaa gccccccaaa     74340
     tccgttcacc tttcgaggaa tgcggggccg aaagcccgcg taaaaggtga acgtttttgg     74400
     ggagagcgag atcaagagtc gaacactcag gcagcgagcg ctgtcccttc ctggcaacgt     74460
     aagattgcca aacgagcgct ataggtgaaa aatctacccc tagtttttca cctatagcga     74520
     acccacccac taggtcatgg cacgcgtacc cgaagcaaag aagggttccc agatcgccct     74580
     gtttcaacaa caggaggctc ctgagccgtt caagaaggcg gttcaagcga tccacgtttc     74640
     accggtaggt agtgcgctgt cgctccagca gcgccgcatc ttcaatgcac tgatcaagaa     74700
     cgccatcgag caacgcctgg caggccgaga aacaaacaac acgtttcagg tctctatccc     74760
     tcagatgatg gcagcgctcg acctcaccac gaaggacaac gcatacatca aagagaccgc     74820
     aaaatcgttg atgcgcactg tcgtggattg ggatcagctc aatagcgacg gcacgtcgac     74880
     atggacgggt tcaacactca ttgccggcgc caagattgtg ggctccgtct tgtcgtattc     74940
     gttcgctccg cagatcagtg aggagctact ggatccccaa cggtacgcaa tgatcgacat     75000
     gcggatcgcc aagctgttcc ggcggtccta ttcgcttgcg ttgtgggaga acactgtacg     75060
     gttcgaacgg ataggcctga ccgcacgtat cccactggcc acctttcgca atctcatact     75120
     cggacgcgaa gagagcgaga ccaaatacaa ggaatacaag atcttcaagc gagcggtgtt     75180
     gacgccgagt attgccgaaa tcaatgatgt atcagaccat gagatcgagt tgatcgagca     75240
     caaggtcggc cgaaccgtcg gtgagattca attcaagatc agtcgcaaag tgagcgcact     75300
     ggaggaggag cctcaccaag acctagtcaa cacagtggtc aagttcggtg tcccgcattc     75360
     cgaggccaag cgcctcgttc gcacgttcgg agccgaacgc atcctggagg caatcagcta     75420
     cacgcgcgct cgacaagcga agaagggtgt tccgccgttg gataacatcc cggcgtactt     75480
     tcgcaagtcg cttacggagg attggggcaa gggcgcgggc aaggctgagt ctgccggagc     75540
     tggtcaacag cagcagaagc cgttggcacg aagcccaaag aatgaagagg atgcgcgggc     75600
     gcaatacctc gcagctcgca ttccgcatgc gcagggctac tttggggaac tatccgctga     75660
     cgatcagtcg gcgatgctct cgcgttacaa cgatcagtgt tctgtgaagg agttgaaggt     75720
     cgtcgcaggc aagaagccct ccaaggcagc ggaatcgaat tttttcgaat gggtggcaca     75780
     cgaaacttgg ggcgaaccca atgccggcga aattctgaac ttcgtgctgt cgggaaaagt     75840
     ctagctgatt atttcgacac accggcttca agaacgaatc gagaggttgg attcttcttc     75900
     gccgtgctca tctcaagacg gtcgcgcgca cgggtcatgg ccacgtagaa caagcgacgc     75960
     tcctcggact ctgtgctctt ctcgttcggc accacggttt cttcagccct gatgatgcat     76020
     acgtgatccc actccaagcc ctttgagttg tgcatggtcg tgagaatcag cgcgtcggcc     76080
     gccggtacgt tgttctcgcg ccgcaggaag gcgatacgat ccgagaatgg accgttgagg     76140
     cggctcagca cgtcgtaggt cgtggtgacc gcacgcttgg cggtgtctgc tttggcacgt     76200
     tgagccatcc actcgtagac accttccagc acgagcggat agaacttccg atcgcagaga     76260
     ccgcgccatt cggcaagccg cttcatcagc tcccggtacg tgtccgcggt gctctcggcc     76320
     aggcccatct cgaccagctc cttgcgcggc cgctgctcaa gactgggacc gatccggctg     76380
     tgcaacgtct tgaggtcttg cgctccgacg ccagcgaacg ccagcacggc atcgaggccg     76440
     ttggtcttcg ttttctggat gagttcgagc aggttgcaca ttagcgcggc ctcggcccgg     76500
     ctcaggattg atttgccgga cgctcggaaa tacttcacgc catgggagcg gcagacggcc     76560
     tcaactgggt cgaggatacg gttcgttctt gccaggatcg ctgccgattt gctggcgcgc     76620
     atcgacgctg cgagggcctc cactgcgttc acggcctcgg catattcgtc atcgaagcgc     76680
     cgaaacgaga tgtggccgcc ggggccacgc gcggcgacca gatctttgcg gatgcgctcc     76740
     ttgttgttcc gaatgacgtt gtcggcagcg gcgaggattt ctgacttgca gcgatagttc     76800
     tcccccagaa tcacgggacg cgcgtcgaac tccttgatga acgactccat gcctcggaat     76860
     ccgagcgcgg ccctgaagcc gtagatgctt tggtcatcgt caccgactac ggtcacgatc     76920
     gagccactgc gcgcgtgctg cgcgacccac tggtattgca gcggatcggt gtcctggaac     76980
     tcatcgacca gcaggtgcgt gaaagggtag ggcgagatgg ttccgcgctc catgccctcg     77040
     atggccatac agagcatgtc ctggaagtcg agcttcccgt tccgcgccag cgcttgttgg     77100
     tatgccgaat acaggcgctc ctcaacgctg ccaggcggaa ccctgccgaa gtccattttg     77160
     attgcctcga tggcggccaa agcggcttct tccttccaat caaggtcggc ttccttcagg     77220
     gcttgtgcaa ccagcgccaa ctggtccccc tcgttggcga tgtcctgctg cttgcatccc     77280
     tttggtgtga gctgcttgaa cgccagcccg tgaaaggtcc ctgccaacag gcgagccttc     77340
     gatgccggcc cggccagcgc gcgaatgcgc tcctgcagtt ccgtggccgc ctccttgttg     77400
     aaggtcacag caccgaccct gcatgcggga tcggcgagaa gaatggctgc cttggtcgca     77460
     attgtctttg tctttccggc gcccgggcag gcaacggcga cacagtgcag gcgtaggtct     77520
     gccacttcgc gctgtgacgg gttcagttcg tctaggattg acgtgggcat ctgagaaacc     77580
     aatacggtgg ccaaccccga gcctgcgatg gccgatgggg tcggcaagtg gcctgcgagc     77640
     cgggtgaagc ttctggaaac tcgcaggcac ccgggactta ggctcgacgg accttctgaa     77700
     gcgacgagcg gaatgcgcgc aggctgtcgt tgaaggaccc agagaacaag taccaacccc     77760
     agcccagaag cgcgaagatg ctgtacatca gcgccagatt catccccgct tcgcgcgccg     77820
     aagcgtcgat cgactgctgt tcgaagccaa acgtcttgca cagggcctgc ggcgggggca     77880
     agcctttgac ggcagacgtg gtgtccttgc atgtctgcat cgtgatatag ccagccggag     77940
     ccgccggata cttggctcta tcagcgacgg actggagcag ctcgcgcggg atcgcggaga     78000
     atgagaagtc actatggatc gcaagcagta ggcagaacgc gacgctcggc acgacaacca     78060
     gcaagcggaa agcccaacca ccccagaatg cgatgtggcg gaccagcgtc catgcgacgg     78120
     acagctttgt cagtgtggcc tgtgagttca tggtgttccc aatggatgtg taagcggtta     78180
     gcgatcgagt gcgtcgccac tccataaatg gcagtgactc gcaaaaaccg gcaatcggct     78240
     tcaaaaaatg tcggtggagt agaccgctgc gcgccgaacc cggggcgtca cgcaatcgcg     78300
     ggggccgcct tgcccgccga ggcagggctt tccaacagct ccaggcgagg tccagccaac     78360
     agcgcagcga gcacccgatc atcaaagtgg atgcggcaca aaaacagatt ggtctgtgcc     78420
     atgcgcacgc atgcctcttc gtcgagggtc agcaatgcct cgcccatcga ttgagagata     78480
     cccagcgcag ttgtcgccag ggcttgatcg gtggctagca gcctgcgagc aaggcgcaga     78540
     tacgcgatat tgagagatcg aatctcgctc agcagcgatg tcgcttccat ggtgatgtcg     78600
     tttgcaggcg attcaggaaa tgccgagcgc atgtggcccg ccgccggcgg aaccctctgt     78660
     gccgatgcgt acgccgtacc gccaccaaca ggtgaagata cggcggaggt cgtccggcag     78720
     ggcacgagcg cgctcagatc agatgttgcg cacggtggtc atcagacgca ggtgcgtcgt     78780
     gtagcaacga atggccagcg gttggaactt gcgcaggaag cgattcactt cctcgttcac     78840
     gtccgactga tcgcggatgg cgttccacac catgaagtcg aagtgatcca tggcccggtc     78900
     gaacttgttc agcacgccca gagcccgcat cgagaagggc gagtatgctt cgaccaccat     78960
     ctccatcgac ggctttgtga ccgacggctt ccagatcatt gcgccgctgg attccatgtc     79020
     cttctcgcgt gctgcgcgat agccctcggc gacgcgcagc tgctcatcga cgtaggcttc     79080
     cagattggcc atttgtgtct cgaagtgctt tgtgatggtc gacagctccg acgcggtgaa     79140
     cgtgctgtgt ccgaagcggg tcaggttgat ggtcatccgg ttcatgaacg gccaccactg     79200
     ctcgaacagg ggcttgaggc gcgtgtggtt gagtttgacc atagtctcga caacagacgc     79260
     acccgcgagc tgacgggtca ggatctggcg ccccagttcg cgccggcggg acacgatctt     79320
     ggcgcgatca tccggcgaca tttcgcggaa cattttgcgg gtgcgcgcaa cctcgccctt     79380
     ctggctgtcc gcgtcggccg ccgagatcag actgtcgcgc tgcagcgcat cgaccgcgct     79440
     ctccatctcg ttgagttctt gttcaacgtc ggacggtgtt gttgcgcctg ccgtattcgc     79500
     tgcggcgctg gattcaactt catcgttggg aagggtatcc ccgttcgtcg tcacggcaac     79560
     gtcggagttg tcggcgcctg caaccttatc gatcgtgttc tgcatggtgt gctccttaaa     79620
     atttgctccc aaaatgggcg ccagtgggac ggaatgaaac gcggctatcg gcctacgtga     79680
     aacgatgcag ccatccgcca gccgagcacg cccaacacca gcgcgccgac tgaccaccac     79740
     atcgtgttca aggaaaatgg aaacaggagg gcggacgtgc ccaatcccag ggtgatgacc     79800
     gtggcgtgtg ccgccacgtg aaaagcaacg gggcttgcga acccggcagc agctgctttg     79860
     attcggcgcg agacggcacc gtcgttcatc atggccatgc cgaagacgaa ggcaccgaat     79920
     gcccacgaga gagcgacgtt cgcgcggaag atgcctcggt agatggacat ccagaagtgc     79980
     cgcagccaag cgttgctcat gtccgtcgcg ccagcgtcgg agatatcggt gctgttcggc     80040
     agcgtggacg tccacgcctt catggcgcca gactcgacga accagtgccg aaactgcgtg     80100
     ttggtccgat ccgcagcccg cgtcgccgcg gtgtctccca ggttcagttc aaccgacgcc     80160
     agttcggcgt cggaaatctc gaatgtggta tcgccttcga ggaagggaca gccgaccgcg     80220
     agcatgatcg gggcaacaag cgtccacagg cgaaggtgcg aggcgaagcg actgtcagcc     80280
     atcagagcac cacgcgcagg atcagcaacg ccggcgtcac gatgacggaa gccaacccaa     80340
     accagaacag cgccggtcgg cgaagtgcga cgctctgcag cgcgaagcac agtgcttcgc     80400
     ggccgcgggc gtactcgggc ggaatctcgg ccagttcctg caggtagcct cgggcggcga     80460
     gttcgatacg gccgaccgta tcgagatcga gccgggacac cttagcgatg agcgaattct     80520
     tcagcgacat cgtattcctc gaaatagcgg cagaagacgt gcccactgag cacccgcgca     80580
     gccatttgca tggcagcgct gcgcggcgtc acgtcgtcag ggcagggctc atcgaccatg     80640
     cggcactggt agccggcgct ttggcgtgcc tcgaagtccg ggatgggttc ctgcagtggt     80700
     gcccagacgt ggtacttctc gcccttgaac gcggcgtagc gcatggaaaa gatctcgtgc     80760
     gagcgggtga agaggccgcg cacgaaagca atattcgcgt cgccctcctt gcgcgcctgg     80820
     cggtaagccg acaacgcatc catcagcatc tcggccacga ggggttcttc gcgcacgcga     80880
     aaattgacgc cgagaaaatc gacgacgcgc ttgcaggagt catccagctc cgggaaggcg     80940
     atgaagacgg gcgcgagctt cgacgaaagc ttgtactggt tcacgacttg tcgaaacaga     81000
     ctgggcatgc tgcagttatc cttggatgat gggaatgcga ccttggtaga ccgagccacc     81060
     ggagatgcgc atgaagtact ggaggttcgg cagttcggtg atgaggcgtg gcggaatcag     81120
     cggcgccttc tccaactgcg tcgagcgaga tacggagccg ctgaattccc cgacgtgcga     81180
     ctcggaacct gtgcttgcgc tgctcgacac cacgatgttg cgaatggctg tctcgcccac     81240
     cttgtcggag aaccattgcg cggtgtcggt atcctcaagg cgcaggatga tctggttgtt     81300
     caggttgccg agcacctgca gcatctttgc agcactgcca agcttggctt ccaggtcgga     81360
     gcggctttgg aacgccacga acgaccggaa gccggcgcca cggcctttgt tgagaatctg     81420
     gatcacctgc tcgttgatgg cttcggccac ctcatcgacc agcaagacga tgtcgggtgg     81480
     cgtctcgtag aagttgtaga tggcgcccgc gacagaagcc acgtcggcca gcagcatgga     81540
     agcgatcgcc ttggcgacga tgctgttgga catcgaatcc aggccaacgt acaggacggc     81600
     cttctgcttg atcacgcgct cgatatccca gatctcacgg tcatccgtga aatcgtcggc     81660
     cttcggcgcg agcatgagac cggtttcgcc ggtagccagc atctgcagca gcggcagcgc     81720
     cgaggcgatg atccgcatgt agtgctcgcg atcgtgcacg aaggtggcca ccaggccgtc     81780
     gatcgtctcg tggccgaggc ccttctttgc gaagttgtcg acgtagagct gaaccatccc     81840
     ctgcagagga tccaccccgc ccttctgggc gatgcgctgc agaaagcctc tggcctcgtc     81900
     ttcccagtcg agcatgcccg cttccggaaa gaatcggcgc aggcatcgat cgagcagacc     81960
     attgatgccg gactgtgcgt aattcaggat cgagcggagg ttcggcttgt cgccgacgta     82020
     cagctcaccc ttgactgcgc ggtcgatgaa gaggaaggca aagtcgcgga aagggccttc     82080
     ttccatcagt tgggagacgc ggctggcgat ttccgacggc tgcgaccaat tctcaaccgg     82140
     attcatccga atcgattcgg acggcgcagc ctgcttccag tacaggaact tgcgaccggc     82200
     acgcttgcat tcacgctcga cgcgcttctt gaagtccttg tcgttcttcg ggtcgacaat     82260
     aatgaggacg tctttgttgg ggctgtgaat gacctgtgtc gcaatcagct cgtaggtctt     82320
     ggttttcccg gcacccgtgg tgccgctcac ggccgtgtga ccgccgagcg ccttatagtg     82380
     caggggcact tcgatcttgt tgggttccat cccgtggatc caggacttgc cctgcggggc     82440
     cgtgtcgggg acgctgttgg gcggcgcaaa cgcggtctcg attcgcttgg cgactttcgg     82500
     cgggagccac ttcggaagac ccggaatttc ggtggacggc atgcgcaaga tgtcgtgcgc     82560
     gatctggcaa tggcgctgcg tccattcgaa gccgttaccg aagtacatcg cgtcaaggtc     82620
     ggctcgcatg cgggcactcg tgcgcagcag cacgtcgatc tgaatgaggg tgagccaacg     82680
     cgtcgaaatc gacatgcgaa aggccagcgc cttgcgcacc tggtaggcgc gcgccacgag     82740
     gaacagagca caaatgaccg cgaacgccca tgcgtggggc atgccggaca gggggagcaa     82800
     gatcaaaccg atcagccaac cgacggccgc gcgggcctcg aagatcgggc gaaagtggct     82860
     cacgtagttc attgctgcgg acgggcgagg atcagcgagc caatgcgctc gaccagcacg     82920
     atgtcagcgc cctgcgagct ggcgaggagg ttgagcttgc gcaggttgtc caccagcgtt     82980
     tcgctggcga tgccgtagct gccgagaatc cgcttttgca gcaccagccc cttttcggcc     83040
     cagtgcacgg ccaccttgcc cgactcgacg tcctgcacga gtgcgcggaa gaactcgcgc     83100
     atgagcgtgc tcgcagaact caggatttcg gcaaacgggt cttcctgttt gaccgttggc     83160
     tctttgggca cctgcatcga gtccaagtcg aacagtgagc tttgggtgtt gggcttctcc     83220
     gatgtcggcg ctggcgtctc aggcgaagct gaagcggttg acgtcggcgt ggccttggcc     83280
     tgctcgaaca gcgccgagac gctatccgct gccgacggct cgctctttgc cgccttggct     83340
     ttgggctgcg atggacgttt ctcggccgcc ggggccggtt gagcgtgagc ggcaaatccg     83400
     tcctccaacg tcttcgcggg aggaatcggc gtggtatcgg gggcaaagcg cgcgcgccgt     83460
     gctttgtcct cggtgtcgca ggtcaccgcc acggcttgac gcaggacctt gtgcagcagc     83520
     gactcggtac cggccgggcg gctctccgga ttgatcgcac cgaagaggtc ggtttgcacc     83580
     atgctctcga gcagctccag ccgagtgttg ccgaggatgg aacgtgcgag cagggcggta     83640
     cgcatccgct cgatgggcaa tggcgcctct cggcgttgca cacggtattc gccaccttcc     83700
     agccaagccg agaaggcgcc atgcgcggca gggctccact cggcctggtc tctcagtcgg     83760
     tagaactgga aatggcggaa cggttcgtcc agccaggtgc agcacgccgc gaggaacacg     83820
     gcatacaggt attgtggttc gagcttgcgc cgacgctccg agggctggtc ggcgccgaac     83880
     ttctgtcccc cggatagccg cagggcgtag tagacggtct cgaccgtggc gcgaaacgcg     83940
     ccaccgggtt ccggatgctg ttcggggcgc agcggcatcg acgaatacca gtcggcgcag     84000
     gtttcgagca cggacaacca cttgcgctcg aaatccgcgc tcgacgactc gttcgcgtac     84060
     tgccgaacga ggtccagccg cgaaccgagc gtggcggtca atgcagcgat gggcattggc     84120
     gtgtggttca tatcgtcagc ccgccatgcg cttgccaagg ccccacgccg ccttgatgcc     84180
     gccctttacg gccccgccgc tgatgccggc accattgcca aacagcttgc ctgcaatgct     84240
     cggaatctcg aacgaaatga acagcaggaa gatgctcagc acgagcgcat aacaggcgcc     84300
     cgccatcgtg tcggtaccga tcgagttcac gtcaccgagt gaagatgcga acgacgcggt     84360
     caccagcttc gacatgattg ccgcgaccac tgcatacaga gagccggaca ccatgtagtc     84420
     aaaccaggcg aggaagtatt tgcgcgtgaa ttcggaaaaa cccagggcga ccgcgagctg     84480
     gccgacgacg atgccgatgg ccacctgaat ttgaccgagc gagatgtaga agttgtagat     84540
     caccgatgtc gccaccgtca cggcgaaggc aagcagcagg gggatcaggg ccagggccac     84600
     cccaatcttc tggtaccagg tcgcggcatt cagggcattg ccgtaggagt cccacaaatt     84660
     gccggccgtc gtggccaacg tcgcaccggg cgaaaggtcg ccgccggcga tggacgtggc     84720
     catggtgttg aagtactggt agatgcctgg cgcgaaccgc tcgtatccca catagatcgc     84780
     ggcgaatatc ccgagcgtcg ccatctcttc caggaagttc gtccacgcgg tgacggggtg     84840
     gtgagcgcca gcgaagcgca ttgccgccag gacaatggtg atgatgccca gcgccgccgc     84900
     gaacttggcg gcttctgggg taatcgtgtg actgataccg accgcggcat tgatgacctg     84960
     cgccgtcgaa tcggtgaact tcttgagcgc gctagagatg gcttccccga ccgcgccttt     85020
     cggcccggcg aggttgggac cggattggtt atccgcgcct gaccccgcag agccggtggg     85080
     agacggcgtc gagggtgtcg tgacagggaa ggtcgcgtct gcctgcgccg ttgcacctgt     85140
     cgacaacgcc gcgaggcaga ccagcaacgc tatgcgcatc aggcccatca gtcgaggaaa     85200
     gctcatctgt gccactctca ctgggcggtg ctgctgcgcg tgtacacgga ctggcgcagc     85260
     ttctggagct gagcgtcctg gctggagatc acgctctgca tggccgccgt tttttcttcc     85320
     gtgtcggcgt tctccttccg gtctttcacg gcgtcagcct gcaccttggt gccaatcagc     85380
     ttgatgaggt cggcgttctg gctggagagc aggtccaggt attgattggt ggtctgggcg     85440
     gtggcctgcg ccgtcgggct cagcgtcatc tgtgactgca ggtcctgacg acgttgggcc     85500
     agatgcgcga tgttcttggc gacgtcggtg ccggcatcga acaaggcttg cgccgtctta     85560
     ttcccagagg tcaggagcgt gcgttggtcc tcgaaccatt gcgcgggcga cttgccggac     85620
     accaccacca ggccgttcac cttgtccaag aagctcgcat cgctggagac tgccccgtaa     85680
     agctgctgga gcacttggcc gtagtccgag tagcgcttca cgtccgccag gatcgagtcg     85740
     atctgcgctt ggttcttgat gtcatcaagg cccacagcct gctggagctg gttcagcatc     85800
     atcttgtact ggtagatgat gttggtgttc tcgtacacct cggtcttcaa cgcttgcgcc     85860
     gcgctgatgg tgttcttgag gaagttagcg gcatcgaaca ccggccagcc ggaggcatgg     85920
     gcggggctcg acagcacgac ggcggatgcg gccacgacga atgtgccgcg catctttcgc     85980
     aaagttgcag agaatgtggt cttgagcatg ggtggctcct tcgattgaga gatggcgcaa     86040
     cgcagcgccg tggtacgact tcggcttagg cggccagaag ttcacgcacg tagcggtcct     86100
     cccagccatc gccctgcatg tagtgcttgt cgaaaaccgc ttgcgccttg ccgtcggagc     86160
     gcagccgggc aaccatctca ggcttgaagt ccgtctggag catgcgcgac gtggtccggg     86220
     tgacccacag gtagtcgcgg ttcggcacgg cgtcgttgat catttgcacc tggtcgacgg     86280
     tcaggccgaa cgtgtcgcag tacaggttct tgctggtatt ggcgaggctg ttgggcaggt     86340
     agatgaagtt cgcgatggtt tccttcagca cctcgaagtc ggtaatccgc gcgatctggc     86400
     gcagcgactg tgttgccatc cacacggcac cgttgagctt gcggatggtg gtcagccacg     86460
     tttccaagcg cctgtagaag cgttcgtact tgaagaagaa gcccgcctct tcaatctcga     86520
     tcagcgtgaa tcgctgacca tccatgctct tgctgatccg gaagaaggcg tagtctagga     86580
     atagaaccgc cgcgcgctcg tagttgatga gcagctcacc catctcgatg gtcaggttga     86640
     ggttgcccct gaaaagtgga gttcttagcc cttgttgaaa ataccgacaa ggagttcaga     86700
     gatgagtgaa aagcaggtgc gtgcgcagta cacgcgagag ttcaagctgg aggctgttcg     86760
     gcaggtgcgc tcgggtcagc cgattgcggt ggtggccaag gtactgggca tccccaaagc     86820
     gagcctgggc aactgggtgc ggctgtcagc caagggagaa ttggacggtg cgggcggtgg     86880
     tgacaagagc atccaagtct cgcccgagaa aatggagatt gctcggctgc gcgccgagaa     86940
     tgcccggctt cgcatggagc gtgacgttgc aaaaaaagcc gcggcgtact tcgcgcagga     87000
     cacgctgcga ggtacgcctg gattcaccaa atgagaaagc tgtatccggt gagtgtgtcc     87060
     tgcggtgtgc tggaggtgag cgcgagcggg tacttcaact ggctgcgccg aggcgagtct     87120
     ggccacggtg gccctggccg gcgctacagc gacgaagcct tgctggcgca cattcgtgcc     87180
     atccacgccc aggtcaaggg cgaatacggc tggccacgca tgcacaagga actgctggcc     87240
     cgaggcatcc gtgtgggcaa agaccgggtt cgcaagctca tgcagcagca cgccatcaag     87300
     gccaggacga aacgcaagtt tgtggtcacc accgacagca gacacagcct gccggtggcg     87360
     cccgacctgg tgcagcggcg cttcaagccc gaggagccca accagctctg gagtggcgac     87420
     atcacctaca tccagaccga cgagggctgg ctgtacctgg ctgcggtcat cgacctgttc     87480
     agccgtcagg tggtgggctg gagcctgcag ccgcacatgc aggcgggctt ggtcaaggac     87540
     gcgctggcca tggcgtggtg gcgccgtaga ccgcctcctg gggtgatatt ccacagcgac     87600
     cggggcagcc agtattgcag cgcagagttc cagcaggccc tgaagaactg gggcatccaa     87660
     tcatcgatga gccgcaaggg gaactgttgg gacaacgcac cgacggaaag cttctggggg     87720
     cggctgaaaa ccgccagcgt gcatgggtgc aaattcgcca cccgtgagca ggcaagtcag     87780
     gcggtgatgg actggatggc cttctacaat caccgaaggt tgcattcgtc actgggctac     87840
     ctcagcccga tgcaatacga gcagcgctgg tacgaggcac agcgtaaaaa ggccgcgtga     87900
     atcgtgggtt aagaactaca cgaaacaggg gcaaggtcag ttgcgcgttt gagcaggcgc     87960
     tggactgctt ggatcatgat gaaaccccct tagaaaacac gtttgatgac gtagtcgttg     88020
     tttgcgtagc cctggatctc cagaatctcg gagacgtgcc gcatctcgcc cgtgcgccgc     88080
     atgtgcacga cgtagtggaa gcagtcggcg atgagcttgc gcatgtcgct cagatcccat     88140
     cgcgagccga gcgggatgcc gagcatggcg aggctctcca ggcgggagag cgcagtgcgg     88200
     ccgttgttgg cgtgcaggga gcccatcccg ccgtcgtggc cggtattgag ggcttgaatg     88260
     aagtcgaagg cctcgccgcc acgcacctcg ccaaccagca cacggtcggg acgaaaacgc     88320
     aggctcagcg cgaccaattg ctgggtcgtg accttcttgt cgggattcga aagaagacga     88380
     acgcagttcg ggacgcttag cttcagttcc tgggtgtcct cgatggagat gattcgctct     88440
     tcgtgtggaa tctcgccaac gagcgcgttg agaaaggtgg ttttgccgga cgatgtgcca     88500
     ccggcgacga gcacgttctt gcgctgccgc accatggtcg acagcgcgtg cgcgagcccg     88560
     tcgtcggaga cgtcgggcgg gaagatgatc tgatcgtcgt cagggttgcg cgcgacggaa     88620
     gaagagaacg cgcccatcgc cgtgtagtcg gagagcgtca ggttcttttc acggtgacgg     88680
     cgaatgctga gggcgtgccc gtcgattgcg gtcgggcgca tgactgcggc gatccgcagc     88740
     cccttatggc cggcgttgat gatcccttga tcggtgcctt tgaccgccga tttctcaacc     88800
     gacgaagcca gcgcgcggat tgcgccttca agcttcttgg gctccagcat gagatcgaga     88860
     cgctccaatc ggcccttgcg ttcaacccac acgctgttgt ggtgattgat catgacttcg     88920
     gccacggtcg cctcttcaag caccggttga atcggcttga gcgattcaaa gaacatcttc     88980
     acggcgcttt cttcgagcgg cgtgagctga ttggaatagg ggtcatgatt cgcggtcatg     89040
     gcgctattct tttggaaaac ggatcaggcc ctcgcggcga aagcggggtc atttttttca     89100
     gctttcgcgg aatgaatgca ttggcgacga tgcaaggctc gaagagctgg ggtgctcaac     89160
     tgcgctaaga ccgtcttgct tgtcgcgcag gacgtagaac gacaatccgg ggcggatacc     89220
     cgcgatggac caaagtgcgg aaagcctcta tgcggatggg cgctttccgg ggatttatcc     89280
     cgaacgcggt aaaccaacgc gcgctttttg gcacccaaac ttcactccgt gaacgcgcta     89340
     gtcaggtggc tcaccgactg acatgacatc ggtgaaaagc tcgcaaatat cgcggggctt     89400
     ttgaatcaag cgtccgcatt cattcctgat tcaattgtcg gcatctaatt gggtgccgga     89460
     atgggtcttt tcaaaagcaa gaaatccgaa caagcgaagg tgctttcacc gcatcccggc     89520
     atgtatgcgg agaaaagcat tgcccaggcc gtcttcgatc aaacgaccgc ggtcaaggtc     89580
     gaccgcaacc attggaagat cgccttcttg attgcgagct tgacggccct ggttgccgtg     89640
     gcgacgcgcg agccggcacc ttccgtggtg aagtcctatg gcgtcagctc cgacgccaac     89700
     ggccagcccc tggtcagagt gctgcagccc tacgagccga aaggacgtga cctgacggtc     89760
     gggttcaagg acctcatcac gcgctggttc acgatcgaac cgatgctgac gccggtggtc     89820
     gaggatgcgc ggatgtacaa gagcatcaag tccgcgaagg agcagatggt tgggactgca     89880
     cgcaagcagt tcgatcaatg gtttgacgag gacgcaccgt tccgggccgt gacgtccagc     89940
     ccgacgctca cccgcgaacc cgaaatcaag aacatcgcgc cgctgcctga caacaccgtc     90000
     gccgtcgaat tcatcgcgac gacgaacgaa gaaggccaga agcccaagcg catgcggtac     90060
     gcgatcacgt tccgctacga aatcaagcct ccccaaagtg atgcggaggc gctgggtccg     90120
     aatccgttcg ggatctaccc agtcttcttc accctccaga agaccccggc atgaccatgt     90180
     ccctattgcg cacaacttcc tcggcgctcg catgcgcttg tctcgcgctg gctgttgtcg     90240
     gaggcgcgtg ggctgctgcc gagcgccccg cgaagcgcgc cgaacctgtt atccccccgc     90300
     tgaacttggg atcaatggcg gatgccatga accccatgaa tccgttcaac ggtggagcgg     90360
     aaccgctggc tatgccgggc gattcccgcc tcgtcgtctt tacgtacagc aaggatcaga     90420
     tttatcgcgt cctgaccgcg ccactgaagg gaaccaccat tgagttcccg gacgatgagc     90480
     agatcgtgtc ggagccggcg tggggtgaca gcgtgcgctg ggaatcgtca acggacaacg     90540
     gcaatcatct ctatctcaag ccgcacgctg ccggtctggt caacaccctg tcggtgacca     90600
     caaacaagcg ctcctacgag ttcacgctgg tgtcgtcccc cctgggcggg atcttctacc     90660
     agaaggttcg cttccgcatc cctgagaccg tgatggccaa gatcaaggcg cgggcagatg     90720
     gcgaggcacg cgagcaggga gagcgtccgg cgaacaccgt cggcgtttcg ccggacaagc     90780
     tcaacttcga ctattcgacg tcgggaagcg cggacttcaa gcccgacgct gtctttgatg     90840
     acggcaagct catctggatg cgcatgcccg cgactgccag cgagtggccc gtcgcgctgg     90900
     tgaaggacgg aagtgatttc gtcgtagcga acttcattcg ccgaggcgac tacctcgtgc     90960
     tgcagcgcct ggcagagacc gtggcgcttc ggtcgggtag cacggaggtg atcgtgcgcc     91020
     gcggccgcgg tcgcttcttg ggtctcttct aaaggatcgg ccgtggctaa gcaggttgag     91080
     gacgtgaccg acgctcgcga gcgagtctcc aaggggaaga tccccaaagg gattatctac     91140
     gtcgcagcag gcattgctgc ggtgctgatc ggcacgcttg ccttctacta ccagagcaaa     91200
     accgacgccg aagtgaaaga ggcgtcggag gagcagcgcg cggagaagat gaaatcgcgg     91260
     gcgacggcgg gtgaggcgtc gcagaacctc ggccagcaga tccgtgccca gcagcaggcc     91320
     gccaaggatg aggcgtcccg ccaagaggcc tctgcggtaa gagccgactc cggtcagcgc     91380
     gcaccggtca tgtcggcgaa agacttcacg acgggccgtc agggcaccga ggtgatgggg     91440
     aagaagaatg aagaggacag catctttact gcgccgctct acaaggcagg catgaacaag     91500
     gtgcgtgaca acgcacgccc gaaagtcgac cttcaaggta cgctggaccc tgcgtccatg     91560
     cgggcgatgc agcaggctgc cgcagcggct gccaacgcaa ccggcgcacc gcctgctgat     91620
     gctgcgcccg tcaacagcga tcaacagttt ctgaaacaga cagcagcaac gaagtacgag     91680
     cgcacaggta ttgcgggccg tttgccgagt tgcaccgtat cccagggctt tgtgattcca     91740
     gcgacgtttg tcggcggcaa caactcggat aagccgggcg agtttcgcgc gatggtgtcg     91800
     cagaacgtat gggacacggt ggatggcacc tgcctcgcga ttccggcagg ttcgatgctg     91860
     gttgggactt acagcagcga catcagcatc gggcaggagc gccttctcgt ggcgttcacc     91920
     cgtctgcagc tccccaataa gaagtgggtt cctctcggct cgatgcaggg tgccgacacc     91980
     aatggctatt ccggtgtgag cggggacgtc aacaaccatt tcttcaagat cttctatggc     92040
     gcggttgtca tcgccgtgct ggagcaacgc ttcaacaatc agcagacggc gacgacctcc     92100
     aattcgaacg gcctgactac ttacggcaac gcggcgggcc aggtcgccac acagacggcg     92160
     cagaccatcc tgaaccgcaa ccagaacatt cggccgacca tcaccacgga acctgcccag     92220
     aagctgttgg tacaggtcaa gcaagacatc gtcctggagc cgtaccgtga atagggcgat     92280
     tgggcttctc ctgatggcgg cctgtgtgtc cgcgcacgcc gtggtggtcg atgcggtgat     92340
     ttcaccgacg gcctacgtcg tgcgcgacgg tggacaggtt cggctgcaga cgcttccggg     92400
     caagccggtc ttgtactgcg gcctgggcgc cttcgaaacc tgggctcagc gtttggtcgg     92460
     ccaggagttc cagatcgggt ccgcgcgaca gcccgacgga gtgactcatg ccgagacgct     92520
     tgtcagcgtt gttgccggtg ccgggtggct gcgtcccgcc tcgttggatg acgcgggtca     92580
     agccgccatc gtcgagcgca agggcggttg ggcctgcgca ccgaaagccg ccccctttgc     92640
     ggaattcagt gatcgcgtcg atccgaccat cctggccggc attgcgctga acgaatcgtc     92700
     gtatcagggg cgaccatggc cgtggacgtt gaacgtcgcg gggcgtggct actacttcgc     92760
     cacccgagac gatgcctatg gtgccatccg ccgcctgatc gaggcgaagc ggtgcgattt     92820
     cgatgtcgga atcatgcagg tgaactggtg ctaccacggc cagcgcttcg catcgccctg     92880
     ggatgccctg tcgcctgcat cgaacatccg tgtcgcggaa accatcctgc tcgaaaaccg     92940
     gcaacgcagc ggctctccga tgaaggcggt cgcttggtat cacagcgctg accccgcgcg     93000
     tggagggccc tacttcgccc gattcctgaa ccacctgaag cggctggact ccgccaatag     93060
     cccatgacga agttccgaca cctcgctttg ctgctgcccg ttctgtccgt gcaggccttc     93120
     gccgcagaca ccgatccgct ggatttcgat taccaggtgg tggcgccatc cacggctcgc     93180
     cccgcgatga tcttcaacga cgggtcgagc acgtacattc agccgcgtgc cgggcagacc     93240
     atcgtggccg acaacgggca atcatccggt ccgtacatca tggttgatgg tgtccccgac     93300
     gttctgcact tcactgcgaa cgggcaaatg gtgacggcgc gctggaaacg ctccaacgcg     93360
     atcacgcgcg agccggcgaa tccgtcgggg gacttgcccc atgggttcac tggcttctcc     93420
     ggccgcatcg cgatggtcgg cgagcacggc aatctgcaac tcgtgcgtcc cgggagcgtc     93480
     acgcagccgc tggcgcaaat cgtcaaggcg atagctccca gcggttggac ggggaccgcc     93540
     caaaagacca ttgcgctgac ggaggagacg acgttcgtca cgcgggatgc cgagaactgg     93600
     cttcaggcgc tcgggcggtt gctggaccag aagggtctct acgcggaggt cgacttcggc     93660
     cgtcgcaaca tcgcgctgcg tgttgagccg cccaagtcga tcgccgtggg cgtcgcggtg     93720
     gcttcgtccg atgccagcaa cggcgcgaat gtcggcaaca caggtgcgcc agcaacggtc     93780
     ccaaacgatc aaggcagtgg tgacggtggc gtggccagct cgctattggc cgaggcgttt     93840
     gacgcgcagg ccatccgcga cacaaaggcc gggacgattc aaattcgctt tgcgacgaag     93900
     cctgagggtc tccagatcag gaacagcgag ggcagcaagc agggcctgac gtggctggac     93960
     ggtgatcgcg tggtcgcgtt cgataccgtg gatcgtttca ccgtctctgc cgcgggtaag     94020
     gctgtcgaag ttcggcgagc tgctgagatt cgctatgact tcgcggccga caacgcagcg     94080
     ggcctcgaat cggtcttcga gaaggacaac gcgacctacc tcgtattccg aacttcaaag     94140
     gccaatgtga gcgcacgcaa cgacaacggc gagggctcgg gcgaactgaa ggaccgctac     94200
     ttcaagttca acggaatcgc tgagcgcttg actgtggtgg ccgacggccg ctcagtgatc     94260
     gtggaacgtg tccctgaagt gcgcttctac gagcgcaagg cgagggtgga atgagcggat     94320
     cacgactccg agtgcgagac gtgagcggtg cgaaaaggct gttcgctttt ttcgcacttc     94380
     tgctggctct tgccagttta gcgcgggcgg attgtctcga cgacgcggcc aattactacc     94440
     ggctcgatcc gacgctcgtt cgcgccatcg cgtggcacga gtccggcatg cggccgcttg     94500
     ctgtcaatcg caactctaac ggcagtgttg acgttggcct catgcagatc aactcctcct     94560
     ggtttccgac gctggcgcgt gtgggcattg cccctgagca cttgtggaat ccctgtgtta     94620
     acgcctacgt cggggcgtgg attctgagct cgaacatcgc gcgcctgggg ccgaactgga     94680
     aagccgtcgg cgcatacaac gccacttcac cggacaagca gttgcgctac gccaaccaaa     94740
     tctacgcgcg ctggcaggca ttgcagcgcg ctggtgccag tcattgacac attgcgagac     94800
     cgttatgaga agccttcttt cccacaagcg catggccgtc atcgcgatgg ctgcatgcac     94860
     cttcgtttcc tccgtccacg cggggacccg tacccagagc gttgacggcg atggttggca     94920
     gccgcttggc agcagtgttc gcaaagcaag cgtcgctggc caagccaatc gcaacggagc     94980
     ctccgatccc aacacgctcg tcgccgcggc ttccgcgttg gcgagtacct cacctgaacc     95040
     agcagtgtca gtcacgtccg ttccctcaaa taggccgttc gaactcatcg ccgacgagtc     95100
     agtagagcag caattgcttg agtgggcgag gcgcgcgggt tggaaggtct tgtggagggt     95160
     gcaggacgca tgggtagtgc cgggcaataa atcctatggc gatgactttg aatctgctgt     95220
     gaagcgcgtc acggaagact tggcagccaa cggaacagac gtgctcggcg acagctggcg     95280
     cggcaaccac acgatcgtta tcacccagaa cggagcagct gagcaatgag gatcttctat     95340
     caaccgaagc tgatcgccgg tgctgtggca acggtcttga gtctgtcggg atgcggtatc     95400
     gcggaggtgc gcggcatcca gaaagacgcg atgcgcgaca cgcgcgcgca gctcgacgct     95460
     gccccgagca gccgcccggt cttccagatc catgaggggg catggcttct tggcgagaag     95520
     gtcaaggcga ccaagccgca accggaactc ttcaacaagc ccgtgtcgta caacgacgca     95580
     cgggaccgca tcagtacgct tgccgacgtt gccgactgga ttgctcgcac ttacaacgta     95640
     cgggtggtca tcgatccctc ggtgaatgca ccgttcccct cggcgcagtc cattgtgacc     95700
     accggcgcaa ccggcgcagt caaggggccg caactacccg cagggctcgc cacgagtctt     95760
     gcaggcgcgc ccaacgcaac gttggccgcc ccaggtggca tgcagtctgg ggccgcagcg     95820
     atgccgacgc agtcaccgct gcactacgtt ggcgatttca agggttttat gcggacgaac     95880
     gagcagcgct acaacgtcta ctcgcgcttt cgcgacggca ccctcacgtt cttccgagtc     95940
     gagacccgga acttcacgtt gcctgacatg ggagccttcg cttccatgag cgggacgatc     96000
     tccagtgacg gcaacctgtc ttccagctcg ggcggcacgt cggcttctac cactagctcc     96060
     acatctggcg gttcaagcgg ttcgggcacc ggcggacaaa cagccagcca gtcgttggaa     96120
     gtgaaaccgt ggaaacgctt ggaggagatc gccaagcaaa ttgcggggaa tggtgcggag     96180
     gtcatcgccg acccgaatct ggggactgtc actgtcaccg ggacgccgcc acagtgtgat     96240
     cgtgttgagg actgggtccg tactcttgat gccatgttcg gtaagcaggt cgccatcgac     96300
     gtgcgcatct acgaagtccg gctcaatcaa gaggacaact acggcttgaa tctctcgctc     96360
     gggtacaaga gcggaaatgg gcacaccggt gccacgttca ccggggtggc gccgccaacg     96420
     gtgtcgagca acgcgacacc catgtccgtc ggcgcgacga ttgtcggcgg caagctggac     96480
     ggtaccaagg tggcagtgca agcgctgtcg acgctgggca acgttacgca ggttgtgtcg     96540
     cgttcgggag ttacccaaaa cggcaaggtc atggcaatgc agtctgcaac tttgcaggac     96600
     tacatcccga gctcgcagac cacgttggcg tcgaacgtgg gttccacgtc ttccatgcaa     96660
     accgcccctg acatctccgg cttcacaagc acgttcacgc caaaggttgt caacggccgc     96720
     atcttgatca tgttcgacat gaccctgtcg aatctgaacc cgctacaaga acagacccag     96780
     ggcagcgggg cctccttgtc caaggtgcag ctgcgaacca agccactggc acgtttccag     96840
     cagaccgtcg gcctgaagcc gggcgagtcg ctggtactta ccggcttgcg cgatcaaacg     96900
     accagtacca cgaacaacgg cgttggctcg ccctacgtcc cagtgacggg cggtggggtg     96960
     gatgccgcaa agcgcgaaac gatgattgcc gtcgttatca ccgcacggct tctttgatac     97020
     ctggggttca tgatgaatcg acatttcttg tctgcagcgg ttggacttgc gctgagcgcc     97080
     ggtgcaggat ttgcaattgc gcagggtgcc tcggcgcctc gcatggagaa ggcgatgcag     97140
     gccgctcaat ccattcgtga tgcgcagcct tcggcaacaa caactccgcc aacgacaaca     97200
     cctgcggctc gtaccgcgca agttgcagaa acgtctgtac ggccaaccca ggctgctcca     97260
     tcaccccagg cgtcgattcc tgttgcggct gcgccttcgc cgaagaccga agccgctcag     97320
     gcaggtgctg aggccgacga actcagcatc ctgcaacggc aagcggcagt cctgaaggtc     97380
     aaggctgaaa ttgcgaagta ccaggcggac atcaaaagct cggagtcgcg cgcgatgcag     97440
     gctgcaacga gcgtgacgcc tgggcaggca ggggaaccgg gagttgttcc gtcgctggtc     97500
     gttcccggca acgttacgaa gccaccgatt ccgctacctg cggccaaaca tgggaaaccg     97560
     cgtctggttc acatcggggg agctgacggc gtctactcgg ctctcatcga aatcaacggc     97620
     atcacgattt cggatgcagt ggctggcact cagctcggcg atggctggca agtcatcggc     97680
     gtcgatgcga aacaagtcag agtgggtcgc ggcaagcaag ttctgaagct cgcggtgtga     97740
     catggctcaa gtcctcaacc ttccagggat caagggcacc tatgccgtcg gcctgacttg     97800
     gcggcatgag gatgccaggc caagccgcgc ggcactgcgc aagaaggctc gtgatctgca     97860
     agcacggtgg agtgtcgtcc atcagacgcg cacagggcac gtacaggccg gcttttgtgc     97920
     gggcctcgag ggcgctgcct ccaactggcg aaccaagccg cttgcagccc ttgtcgctga     97980
     ctcacatcct cagccttggt gcggcttcta tcggatcagc gctgacctgt attggtacat     98040
     cgcggtgcgc gacggccagg aggttttacc ggacggggac cggactggca cgctcgaaga     98100
     attggagcaa ctccatgcgt tgcacaaagc gtccggtgac tggaacgtag tccgcgggac     98160
     cgaagccgaa ctcgcagaca tcgttcgcac ttcgcgatcg gtgaaggggc tgaccgatct     98220
     ggagccgggg ccgcgacgct acgtgctacc ggtggccggg gtgctgacag tggcggcatt     98280
     ggccggcgtc ggcacgtggt ggtatcagca acggcaggct gaggcacagc gcgctgcgga     98340
     tctcgcgcga caacgtgctg cacaggcgat gcacgcggca aagcaagcca agcaacaaat     98400
     tccgccatgg acacttcaac ctgtgccgtc tgctgttgtc gacgcatgtc gttcggcttg     98460
     gcacggcagg gcactcgcca cgaaaggttg gttgctgacc ggctggagct gccagttcgg     98520
     tagtcccgtc acggtcaacg ttgccgctca atgggagcgc gacgggggtg tggctgagga     98580
     cgcgcccggc acgctcctcg acgatggaaa ccactctcgc tcgacggaag ttaagcccta     98640
     tacgttcacg atccaaccaa caggtattga tgattttgag gttgcgaagc gcatcgtttg     98700
     gagcgtgtcg caccgcaaag ctttccagtt gaagctggcg gcgacgcagc ccgccgcgct     98760
     tcctggcgcg aatggccccg atgcacctga accggccccg tggattggga atgcggccga     98820
     tttcacgctt gcgatggctc catggttcag cggtgcttct gcattcgatc aagtcccagg     98880
     tttgcggctg accgaggtca gcgtcgacct gcgagatggc cagtggcatg cgaaagggac     98940
     gctctacgtt aaccgttttc ctggggcgac tgctgccctc aaggtgggga gctgacatgg     99000
     tggctttggt tgagcggttc agggcattct cgcgcgttga cgcgcatgtc gagccaatgc     99060
     ggctcccgcc tgttcctgcc acgctgatgc aacacgtcgt gtgggcgggg gtcggcgaga     99120
     agattcaggt cgatggccgc tatgcaggtg gttcggcctt tctcacatgg ttggctgacc     99180
     tcaaacgcca tggtctggag ccggttgttg aatctcttgc cccgcaggag ctggcgcaag     99240
     cgcgcgaaag cacgtcggac gggcaatcgg gcgacgcata ccttgagttt ctggaaatgt     99300
     cgcgccggcg gcacgtcgag gctgccgaac tgggggcgtc cgaccttcac gttctgcagc     99360
     gagaagacca tgctgaattt cagttgcgca ttgacggcga gctatggacg gtgcccgagt     99420
     gggaactgaa cgctgcgcag ggggaagctt ttgtgcgagc aacttgcgtc ggcctcgcaa     99480
     ccgtcaaaga gccgacattc aatccgctcg agttccagga agcgcagatc agcggcaaca     99540
     agctgcctga gaccgatatt gaaagtgttc gcattacgcg cggcccagcc tatccgatcg     99600
     aggccggtgg tggcgtcatg gttaatcgcc tgcaaccgcg caggcacacg gccacacttc     99660
     agcgacgcga gacgccggcg agtcgtctgc gactggtgag accggaggcg ccggccggca     99720
     aagtcgactt tgagcggatg ggattcacga cgctgcagct cgcgatgttc gagcaggtcg     99780
     tcctgatgcc ggatggtctg tttattcaga cggggccgac gggaagtggc aagaccacga     99840
     ccggctacga aatgctgcgc tacaaggggc agatttcgcc cgagctgcgg cagatcaccc     99900
     gtgagcatcc ggtcgagtac ccgcgtgaat gggcagtgca actgctttcg acggggcaga     99960
     actcctcata cctcgtcgaa cgcatgctcc ggatggaccc ggacatcatc gacatcggcg    100020
     agatccgcac aggcaatgaa ggtgttgcag cagttcaggc agcgcagacc gggcacttgg    100080
     tcttcggctc gctccacgtt cttgatccgt tcgaactgat tggtcgcctg caaatgctcg    100140
     accacacgct gctttccaag gagttgatgt gcaaccacaa aatcatcgcg ggtttcatgg    100200
     ggcagcggat ggttcccgtg ctgtgcacgg agtgtcggga gccattggcc aaacatctcg    100260
     acgcaatgcc gggaattctg ctcgaccgca tcaaaacctg gggaaacatc gaacaggtcc    100320
     atgtgcgggg aaagggatgt ccgcactgct tcggccggca aatccgcggg cgtgaggcag    100380
     ttgcagaggt tgtccttagc accgaagagc tgatggaaga cttcctcagg gggacgtcgt    100440
     tggcacgtcg aaatcaccgc ctgcgtgagg gctccgacaa atccatgctc ggcaatgtca    100500
     tggaacgtgt gttggccggc aggatcgatc cgcgcgacgc gcagaagaac gtgcccattg    100560
     aggcgtatcg cgagggcgta tgaatctcca gaaagctctg cagtggctga agggcaatcc    100620
     tctgccatgg aagctccgaa aacgcctcta tgaacgtgcg tcaacgcatc tggcgaacga    100680
     cgtaacgcta gagcgcgtgc ttacccggtt cggggccggc ttgctacgac ggcgaaaacg    100740
     tcgcgctgct gctgcaatcg atgccgtgac acaaggcgtc cgcaacggcc agacgctggc    100800
     ggcggcaatg gactcgtcgc tcaccaatct tgagcgaacc gtgctcgacg ctggtgatcg    100860
     agcgggcaag cttcccgagg caatgaagct cgtcatcgag gtgcgcgaac tggtggatcg    100920
     catcttttgg aagctgatcc tcggcttcgc gccggcgctt gtctatgtct acgcgctcta    100980
     caaggtactc ggctttatcg gtgccgacgt agtgcccgag ttcgcaggaa tcttgccggc    101040
     cgagaagtgg accggatggg cacgcgtcct ctacctgatg ggcgtgtttg cacaaagcgc    101100
     ggcaatgcct ttggcgacgt acgggctgct tacctatgcg ctctggtgcg catgggcgtt    101160
     accgaactgg gctggccgtg ggagggcgtt ctttgatcga tgggtttttc cgttcccact    101220
     ctatcgggag atcgcagggt tctcttggtt gctgtcgttt cttgctctgc agcgggcggg    101280
     catccctgaa gtggaatcgc tggccgcaca ggtgcgcacg gcatcgccat ggttggcgtc    101340
     gcggctgctc gccatttcat ccggcacacg caatggcttt gatcttgcaa cttccatgat    101400
     gcggactggg cacgacttcc cttccgtgga tctgatcgat gagatcggcg agtacatggg    101460
     caaagccgac tcgtcggaaa agctggcgaa cgtggcgcga gagaacgcgg cctatgtcga    101520
     gcgaaaggtg cttgcgatcg gcggtggcat ggcgttgacc ctgagtcttc ttgtgtacgc    101580
     agccatgttt gtcatgcagt ttggctcaaa cgcgctttcg tcggctctca cgtcgtcgat    101640
     gaggcagatg taaatcgttg gacgtggttt tactttagga gagggtgata tggaacggat    101700
     cattggggcg ctcgtggcga tcgcgctggc aatcctcgca gtgggcaaca cgctcagcaa    101760
     cagcgggcag gcgaagtcgg atcagaagag tggtggcgcg gcgacggata ttggctacgt    101820
     catgacaaag gcccgagcag ggttcgcgca gagcaatacc ggctttgcca atttttcgaa    101880
     cgcgaacctg ggcgggctta ttaacggagg caccttccct ccgaccatgg tcaagagcgg    101940
     aggcattttc gacaagtggg gcaatcccat tactttgagt tcggcaaata gtggcacgag    102000
     cggggtgatc tcttttgggg gtggcgggtc gcaaacaact gacgaatgca cgtccaccgt    102060
     gacgagtctg tcaggctacg acttgttgac ggttggcggt cagagtttta cacgcagcaa    102120
     catgcctgac acgtcgcagg ccggcgctgt ttgctccgcg accgcaacga ttgtcgtgac    102180
     gttccactga gccccagcga gtcagcgttt cgatggcatt cgcactcctt ccgctcgccg    102240
     cagtcatgct gctgttcggg cttggcattc aagcgttcca gctcgccgac agtgttcctg    102300
     gtgccggccc cgcaggccag atggagacgc gctcggtggt gtcatctcag caagctgcga    102360
     tgtttgggac cgcatgtgtt agcacagcga tcgcgcagcg tggcgcaatc agtccaaaca    102420
     tgaccgtgac gctaccggca ggtgtgttgc tgcctgctgg tgctgtttgt atgacgacgg    102480
     cgaatggtag cggtcgcaac gtctacgggt acctgccagc ggcacctggt gcagcgggaa    102540
     agttactcgc cgatgcgcag ggcggcaaca attggttcgt catccgggcc gcaggtgtgg    102600
     cggtgagttt ggcgggcgga aacaccatgt cagtacccac gaccatcccc gttagctcac    102660
     tcctcaattg ggttcagacg tcttcctgaa ggcgacgcgc aatggatgca attctcggtt    102720
     acatgatcgc catcgccctg tcgttgctga gcgtggggca gttctaccag tggcaggcgt    102780
     cgggcatgac aaacgtgcag actgcggccg cggcaagcca gcaggtgatc tacaacaagg    102840
     ccgcggctca gtacgttcaa gacaacggga catcgatcgc ggcgattgca acgcctaccg    102900
     tgccggtgac catcaccacc gcaatgctga tcagcagcgg ttacttgccg aacggctttt    102960
     cgaccacgaa tgttttcgga cagacatggc aacttcaggt cctgcagccc accgcgggga    103020
     cgttgcagtc ggtcgtgcaa tcggttggcg ggagggcaat cgcggacact gtccagcttg    103080
     ttcagattgc cgcccaagca ggggcgcagg gcggattcgt cccctatgcc ggccagaatg    103140
     gtgacgcaac catgaccccc gcaaatgctt acggcgcata cggggcatgg aagcttccgt    103200
     tgaccaattt caccaatcca ggcagcggtc acctggtgtc actgcttgcg ttcacaggcg    103260
     tgagtgcgaa caacagctat ctgtaccgcg ttcaggttcc tggccatccc gagctgaaca    103320
     acatgcagac cgaccttggt atgaccgatc aagggggggc gctgcacaac atcagtggcg    103380
     cacagcagat cagctcacaa agcttgcagg ctctttccgg tggttcgctt gccgtgccat    103440
     cgatcacgac cgcaaacggc aaagtagtca cttgggagca ggtgggcgag ggcggtgtgc    103500
     taggcctgaa aggatcgaac ggtacatcga tctaccttga gagcttgaat ggcacgttcc    103560
     gtatcgtcaa caacccttgg acacagtcca tattctcggt cgaccagtcc ggcgatgtgg    103620
     tcgcggcggg aacgcagagg ctgggtaacg ttgcttcgcc caacacggcg tgtgcccaaa    103680
     acggaacaca ggcaggcaat gctgatggct ctggccagca attagtttgt ctgtacaacg    103740
     tgtggaaacc aattggcggg agcttgcagc gcttcgggta ttacaccgcg caacatggtt    103800
     ctggaattcc gaggccgact tgtccggcgg gcggaacccc gatgatcgtt gtgaccccgg    103860
     cgaactttgc ggtcgatccg acgacggtcg tcaactatgg agcgtgggga tcaggcccgt    103920
     ggactgtcta catcatggat ggatcaaatg ccggcatcgg tggcgcgact gccactgttg    103980
     ggacctattg cggatactaa tggagtcgtg aaatgaggat gctacttagg gtcttgtcgg    104040
     tgattgtgct tctggcggga tccagacttg caatggcgaa ccctgtgctt tgttcaccgg    104100
     gataccaaga ctcgacttgc ccgagcccta tcgcaagggg cccagtcccg gcaccgcagt    104160
     gttcgtctgg cgctggatgg acgacgactt caagtcccgt ttggaagggt tcctattgga    104220
     gtgcgcctgg ctgcaactat cagccaccgc cttcgtgtcc ttcgggctac tacgctgcca    104280
     gtggcccttc ttggaatgga tcgagctggg taggcctgaa ctgtcagccg acggcacctc    104340
     cgcccccgcc gccgcctgca ggtcacgtgt tggtggcaac gtatacaacc aacagctgtg    104400
     gcaaccttgg gccctttaat ggatacgcag acggaacgta tgacgccagc aactccgatt    104460
     ggggagggca gactttctct ggtacttggg accagatgta ttacaacggg gtagcgtata    104520
     tgaactcgaa ctatgctcgt tacattgctc cagcttacat ctcccagcct tcggacccag    104580
     cgacggctac acaatatttg tcgcgagtgt tctttgtcta caacccgtgg gcatgcggcg    104640
     gcggtgttgg ctaaagcaaa atggcgtttg tcctgaccgc aggcaagtta ttgagagatc    104700
     ggcgacacaa agaaaaagcc ccacggtgac tgtggggctt tctttttgat ggctagactg    104760
     tttagcccac cacgttgccg gtcgtgaatg tgaagctgcg cgtgaacggc gtgccgttga    104820
     tcgtaccgga caggttcacc gtgtacggcg tgttcggttg cagcggtgcg gtcgggtagg    104880
     cgacggcttc gaacgcgggg accaacttgt tcggatcagt tgacgagttg agcagttgca    104940
     acgtcaccgt gtgcgaggcg ttgtcggtca tcgtgccgga agtcagcaca acggtgtcgc    105000
     tcgggttggc cgcaaccgcg acaggaatgc cccacgaacc gctggtgttc ggcggcgccg    105060
     gcgtttcacc gttcgacgag taggccacac cggtggtgcc ttggcacggg aaggtcaagg    105120
     gcatgttgcc cggcatcgtc ttaggcgcat cgaagctcat cgaggcgcgc acgtcgggga    105180
     aaccgttgaa cagcgtcttg gagacgccga tgccaacaat gctcgacggc cacacgcccg    105240
     cagcgatgtg gtagacgccg gacagccagc cgataatgtg ttgctgaccg tattgggcgt    105300
     cggtcaatgt cgcattggtg tagtagcccc cgctcacgcc gccgacgtac tgattgggga    105360
     agccagccgc caccgcgcga tcctgatagg tgacaccggt gaagccagtt ttgcccgccg    105420
     tctcgctatc cgcaactacg ccattcgtgc tcatgtaggc agcgtgtgct tgggcggcag    105480
     tgtccagcac agtgttttcg gacagtgccg gaaagccaca ctgcgtacgg tactggttca    105540
     gcgtgttgaa cgctgccagt tgtgcgctcg tgctgccgta ctgcggtgtc gtctgggtgc    105600
     cggtgacagt ctgtgccggc ggagtcgtag tgccgccggt cgaaccgcca gtcgtggacg    105660
     tgccaccgtc accgccaccg ccgcatgcgg tcagtgcgag agtcgatgca gcagcaattg    105720
     cgaggagaga gagtttgttc gtcattgatt ttctccggtg attttgaggt cggtgatcga    105780
     tatgcgacca cttgatttaa tcgtagcgtg cggctcaaga agtcaaggat gcactccagg    105840
     tacttcagat gccgcgctca acgtgtgcgg gggcggtcgg cagcaacgcg ttgctacttg    105900
     accttgtgca gttccacggg cccgagcatc gaaacgagca gataccccgt cgtcgttggg    105960
     aagtccttgt tgctccagtt cgaagggaca tggacgagcg caaagtcctt cgtggatatc    106020
     ccgctgactg attcactaac ggcgcggccg aagagcgctt gagcttgctc tttggtcaga    106080
     tcattgaccg ggccctggat ggctcgccaa ttgccgttgt ggaactcctg aacggcgagt    106140
     ttgccgtctg ccttctcgat ccgaagcgtt ggctcgagcc cgttctttcc ctggacggag    106200
     tattcgccga cgatgtcgct cgtcgacgag ccacatgccg tgatgatggc ggtggcggcg    106260
     atggccagca ggagctttgc cttcttgcgc acggttgcgg taaacgccgg gatgtcgaac    106320
     ttgcagaatg tggtcatgtg attgtgggct gtgagttgtg tcggctgggg ccgtcgtgct    106380
     gatcgtggtg aatgcattat gggtaagcgc gctttctcgc ttgccggtgc cgaagagttg    106440
     cgcgctccta gcacccctct gccgagaaat agagcgtctt gccgcaggtc ttgcaaaaat    106500
     gggcgcgtgt gccgggcgca cgtcgaagcg cgtgcacgct gagatgcttg gacgagcagc    106560
     gatcacacgt gatcgtgcca gcgtcagata ccaaccccgg atgcttcttt cgataccaga    106620
     aaaacgtatg tgttcgaaac cggtagagcc ggtaccagcg cggtgcgaag aagatcatga    106680
     gcgcgagacc gaggaccagc gcaggagcgg tgccggcgtg cgatttcccg actagggacg    106740
     cgccagtcag tgcggtacca aacagcgatg cggtaccaga aacgaagcgg gaagcaagat    106800
     ggcgcatatc gttgtccttt gtggatgggg aggcacccgc cgccagtcgt gacgccgcgg    106860
     cagaggcttc tacgtcttga gcgtacgccg agagaatcag agtcaagctc gggcggcatc    106920
     gccagcccat ccaccattcg gggcccgatc cagctatgcg agttgtttgc gcggtttgcc    106980
     cttgcgtggc gccgtcaacg cacctgtgca tgacgggcaa tagaaggacg ccgccagttc    107040
     gatttttggc gtggtattgc acgtcagata gtgcgtggaa caggtgcggc aactggacat    107100
     ggacaaatcg ctgccggtgg acactgatcg ggccaaatgg aacgcccggt ccggggtcag    107160
     ccgcgcggca tcgccgaaca gacgcccgac ggtgtcgagt gcggtgatga acgcctctgg    107220
     ctcgttcgca cgtgcggcaa gggcgctcca gtacagccaa atcagcgtcg tcgactgaat    107280
     gcggctcgac accgactcca cgtaccagga tgacgaggag ggcatcaggc cgcagggaga    107340
     cgattcgccg tggatttgtc gatagagagc gcgcgccgta gccgcggtgc cagggaacat    107400
     cgaggccacg ctggatgcgc ggcaacgcag gccaatgagc gcctcggtat agcgttccat    107460
     ctgcgcgcgg ccgacgcgga aatttcccca gcgttcacgt tgcaggggcc gcggggcacg    107520
     tgagtcgccg gcgttcatca cgtggtggca gatcgtctct tccgagatga ggttggccga    107580
     atactcaagc cagaacatcg gattctcaaa acgccaacgg aacatcggga agttggcgcc    107640
     gaagatggca agctccagct cgtgctgaga cacggtcacg agatagtcag ccaggtcttg    107700
     cggcatgccc agcagttgag cggcaacggg cgtggagtgg agtaggtcga ctaccatcca    107760
     gacgtaatcc ttgttctggt ggaacaagct catcttcagg ctgggatcaa ggttgccgaa    107820
     ttccgccttc accttgtcaa tggccagggt tggtgtcgtc ttcttgatga ggctgcgcca    107880
     atcttcgacg ttcttgaaca tcggtgtcac gaccaggaac ggtgttccca tcaactgccg    107940
     ctgccctgca gcgttctgcg cgagcatggc cagctcttcc ggccgcactc caaatactgg    108000
     cgccacttcc cggtgccgaa gcatgcaggt gcccatgaaa tccgcaagct ggtagttgat    108060
     ggaacggatc cggtcggtaa tccggtcggg aaggatgagc gagtctttgg cagaaagagc    108120
     agtcgaacga gtcatggcga gagagtcagt tgttgttttt gggaccggcg cttgaatcag    108180
     gcggtttacg tgcgtgtccg gcgggacacg cggtttgtgg tctcggtggt cgcgagcgca    108240
     gcgttcactt caccgaggaa tttggtcagg acgccagcga ggccttcgag aatgggacgg    108300
     cattcggccg atgcgttggc aaagatggcc gtgagttgcg cagactggta tttgtgtgcg    108360
     acggattcga tgtcggcaac cagcgtgatc atcttcgctc tggcgtcagc agacgagttg    108420
     atgtcgtcct gctgttgtgc gatttccagg ttgagtcgat caagctcgtc ctgcttgcgc    108480
     ttaacgtcct cattggccgc ttcgaggcga cggttggctt cttggagcgc atcgtccagg    108540
     gtctggagtc ctggcggcag aacgtgcact tcgactgtct ctttcacagc cgccggttgg    108600
     ccgctctctg cccttgctgc tagcgcgttg cgttcgcgcg tgagacggtc gatctcttgc    108660
     tgtagcgtgc tgacggtcga agagctgcgg gtgacctgga gttgtgcttc gtccatggca    108720
     cgctgccgat tggccacctc ctcctgggac accgtgagtt gggcagccag agttcgaatc    108780
     tgtgcttcaa gatcgcggtt gttgttcagg ttttcgttca gctcttcctg cgtgacttgg    108840
     agctgcaggc cggtattggt cagatcctct tctgtcttcc gaagcttctc gatgatcggc    108900
     cggatgtcct cgcgtttaaa gctatccgtc ttcaacttgt gctcgatgac cttgtcgact    108960
     tcgtcatcgg tgatgtcctt gcgggccaag atcttcatct cacccaaggt caggttggtg    109020
     atggcccggc tgttgttcgc aaacttcctg tagatgttga tgtagagagc cacgcgtgaa    109080
     tcggtcatcc gaaggacggt gcttgcgtag ctggacagca tggcactccc gcgcttcctg    109140
     gccacggtct catcaccgag ggtgcgcgtg aggctcccca tgatgatgcc gtcaatgtgg    109200
     accagccgtg ccccaattgc gatgaactcg gccacgacac ggttttgcga ctgccagatt    109260
     tcctcggtcg cctgtgcgat tcggccaatc gacgattcgt ccaggtccat gaactgggtc    109320
     ctcgcgaatg tcatggcgga gacagaaccg tcgtccgtga tcgtttgcgc aagctggaag    109380
     tccgtatgag tcatgtcgat gtaagccagt agagtgttct cgtgaccgga gccagatgtg    109440
     ctcaggcgcc aaacgggcgg tgcgatgcgg atggttaccg cgaatgcacc tcctcttcga    109500
     gccatcgtaa ggcggtcagg gagaagtcaa gtgaacgcgt ggcctgcgat gtgcgagagc    109560
     aaaatcgaag gtcatcggtt ggggcgggtc ggaaagcggc tacatacgaa cggcctatta    109620
     cgaattgcta aaggaagacg cgactctatc gttgtatcgt tcgccgaatc gcaatactta    109680
     accccaatga ggtggggtgt gggtgcagta tttggagggg tgcgtgaatt aaatgaagct    109740
     aatatcagtc gtcaaagcga attaagattt tctgaatgca tcttcaaatg ccccacaaaa    109800
     ggggggcatc cgatggcatg agcgtcgcgt catccactgc cttgcagcgg ataggctcgc    109860
     gcgtgcgagc ttgcgcggat ccactgcatc cgctaaagtt cgtgacatct ccgcgtcgtt    109920
     gacgcatcga acttgcgctt gatggagcaa ctccatctgg cttcacagcc gctcagcgcc    109980
     attctccctt tctgatttgt cccggctcag cttgtttgcc tgacgctcgc gcgtgaggca    110040
     agcacgttgt tgcttgcggg attccttgct catccgagca tcgaatgatc gcctggcagc    110100
     cgccaggaaa tcccttgccg cgttttctgg agagagaacc atggaatccc tgctcaagtt    110160
     cgtcaatacc ccctttcgtc tgttctgcac gatgctggtg ctgtacatgg ccgcgcattc    110220
     gcatgccatc gccgttgtcg taggcatcgt gttcctctcg gtcatctggc atagcctgaa    110280
     gagcgagaag gctgcaccga tccctgctgc acccgtcatc atcccgccga agcctgcaca    110340
     agccgaggcg gacaaggccg ctcccgcggt gcgcccggct gccaacacgg cacgctatgc    110400
     gaagtccgcg gttgtcacgc ccatgcttcg ccccaaggcc gccacgcgcc cttgacctca    110460
     ggccttccct tggaaggcgc ctttaacccc ctgttggtgg gagtcttctc ccgccagcag    110520
     gtggggggag gctgccccat ggagaagtca ccatgaatac caatgcagtc gcgtggcaac    110580
     tcgatttctt cggggatgct gctgccgtaa cccccacgca acacaagcaa gaccctctcc    110640
     cggatccggc ctactggtcc gactcggtca aggagaagat ggtcgacgct ctcatcagcc    110700
     tcgcatgcga cagccgccga ggcgacaaca tgcccgagtc ccttatcgac tgcgccgaca    110760
     tgcttcgcgc gcggatgcgc ggaaccctct atgacttgga ggattaccgc atgacgctcg    110820
     gctggatctt tcactactgg gacggtgcgc tgccgtacct gtacgtgtgc gcagtgaccg    110880
     gggtgaaccc cgaagtcctg caggacgtca tcctgaacca gcctaggctg aagaaggatc    110940
     tcgacgaact gaggcattcg ttctgcggca cgctgttgta ggaggccgca tgacgttcct    111000
     cgaatcgctc gtgaaggtgc tccttcccaa agccgacaac cctcagcgtc acgcagacgc    111060
     cgaacccatc aaggttggtg ctggcggcaa caacgaaaca cagatgacca tcagcggtga    111120
     gccgcacctg tttcgcgatg aaggtgatcg agtcgcgcat ttcgttgcgc tcttcgagag    111180
     ccgtctcacc gagaccccgt tcggtcccaa gctgctgcct gccttaatcc cccattggtc    111240
     tctcaaagca gtccacgagg gcttgaaggt gacggaggtg gtggcacagg tcattcaggg    111300
     cggcgtccag ccttcctcag tcaagcagga gccgactcgc agtgcggctg cccctagacg    111360
     ggcagtgccc gaaacgacgg aggaagcacc ggttgaggcc gatgcgcagg cccgccgcgc    111420
     acgtgcccct gaagcgcgct cgcgtgccac ctatcacggt cgcatcaagt cgtggggcga    111480
     agagcggttc cctgatcgca aacgtcccgg taagtcctac aagaattttg cgttgaagct    111540
     cgaaatggcc tcaggcatgg agacgctgca gggcgaaggc ctgaaggacg caatctcgga    111600
     ggcgggctgc aagctcggcg acgcagttga ggtcaaacgc cttcgcaaga tcaaggtccc    111660
     ggccttcgat gaaaagagtg gtgaccccgt tctcgatgag aacggcaacc aaaaggttca    111720
     tgacaagtgg ctgtggtcca tctccgtagc ccattaacca aaaggtaatt ccgtatggct    111780
     tcagtcaaca aggtcatcat cgtgggcaac ctcggtgctg atccggaaac acgttacatg    111840
     cccagtggcg acgcggtcac caacatccgc gtggcaacca ccgatcgctt taaggacaag    111900
     ggtagcggtg agatgcgcga agccaccgaa tggcatcgca tcgcgttctt cggtcgcttg    111960
     gcggaaatcg ctggcgagta tctgaagaag ggatcgtcgg tctacatcga gggtcgtctg    112020
     aaaacccgtc aatgggagaa agacggccag aagcaataca gcaccgagat tgtcgcggag    112080
     cagatgcaga tgcttggcgg ccgacagggc gccggtggtg aaagtgaagg cggtggtggt    112140
     tactcgcgcg gtggcgatga tactagcggt ggccatggcg gtagccgcag ccaggctgga    112200
     ggaatgagcc gcagcgcagg cggcagtggc cagggcagta gtgcacgtcg tcaacccgcg    112260
     ccgtccaacg gcttcgagga ttttgacgac ccggacatcc cgttctagtc ctgatcgaca    112320
     gggctcattt gtagttcttc tcaagcgcct ctgggcttcc acgaaagtgg aacctggagg    112380
     ggcaacttcc tctcctgcgc cggcggtcgc ttggcgcatc ccccttcgaa tctcaccccc    112440
     aagacgtcgt gctgaaaaga cggtctgccc gtgcgggccg tcctttgagc aagcgttccc    112500
     tcgcctgtct caggcatcga ccaacactcc acctggagtc atcccatgaa gaaactgagt    112560
     gaaatagtgc aaaactggac gcccactcaa tgggatgctc tggtgaacca atacctgccg    112620
     gcggctttcc tcacggagag cttctggaag ggtaggcctg gcccgtgccc gatctgtggt    112680
     gggcacgatc gatttaccta cgacaacaaa cgtggtcgcg gcgattgggt ctgccgcaaa    112740
     tgcaacgctg gtagccccaa agccggagac ggcattgagc tcgtgtgtcg cgcgactggt    112800
     atgtcgtatc acgaattgac ctgcagattg aacggcgaac ccgttcatcc aatcggtccc    112860
     ttggtcaatc ggccggtcgc ctgtcggcaa aagaagtcag ccgatcccgt ctggaagaag    112920
     cgccgcatcc ataagcagtg ggatgaagca gtgtctctca cgccaggcga ccacgtgatg    112980
     cactacttgg ccgcacgggt tccggggctc cgggcgccgc gtccgcaatc gttgcgggtt    113040
     gcgatgcagg actacctgtt tgaggacgag gtgatcggcc gttatctaac catcatcgcc    113100
     aaattcacct tgcccgatgg ccagatggcg accgtgcatc gaacctcgtt ggaccccgtc    113160
     aagccgatga aggcgaccat catcagcaag gacggggagg tattgcccgc caagcgcaat    113220
     gacgtgtcgg cgttgccgct cgccggcggc gcggtgcggc tgatgacgcc tcgtaacggt    113280
     gagatcggga tcgcggaagg gctggagact tcctacgctg cctacatgct cttcggtgtg    113340
     ccgatgtggt attgcctcaa tcgcgtgctg gtcagccagt tcgttgtgcc agaaggtctt    113400
     ggcatccaca ccgtgcacat ctttgccgac tttgatgcag tggatccaaa gacgggaaag    113460
     tcgccgggaa tgtccgatgc cttgacgctc gccaagcgct tgcgtgcgga aggcttcacg    113520
     gttgtcatcc atcggccgaa gctgcgcggt acagatttct gtgacgagtg gtgtgctgaa    113580
     tatcagtcgc gcgctgtgca tcacgaggcg gttgccgcct aagttcgttg ccgccttcgg    113640
     gtggcatttt ctctttactt ctgccctgtg ggttcgtccc acagggcgaa ttccctgggc    113700
     gcattctgga gttcgctatg cccatgaagg gattcattca agtggtcgga aaactgcaga    113760
     tccacgcgat gcgcattgtc gattcgctgg aggttccagc gggcaagtct gatgcgcagt    113820
     gctaccacgt ctttcgccgc agcgacggcg gcagcatgga gttcgttggc aaggacagcg    113880
     atctcgattt cgtcgagacg ttctgtctgc aacgtgcatc gctgcactga ttgaagtacc    113940
     caaccctaac gaaaaacgcc cggcactgcc gggcgttttt tttcgccttc gattcgtgat    114000
     tcgccgggcc gttactcgtg gccgacgggc cgctgggcaa accggccgag cacgacgcgc    114060
     gcggcttcca gaattgccat gccggtgccg gcgatcaacc agaatttggc ggtattgacg    114120
     tagttgaggt gagcgaagaa gtcagccatt tcaatgcctc ctgaagggtg tgaggttaca    114180
     cgaacgcggt tgcctttgac cgcttgatgt cttcaggata cccgggctgt cgccatgtca    114240
     acctttggcg ccgctacgct gcagggttag tttggaaaga atcgcgccat ggcttcaccg    114300
     aggtgctcgg ccatcgccgt tggcagtcca tcaggcgaag gcgagtcgga ctcggacaag    114360
     gcggccggat cgaaagcggg ggcgggcgaa ggatttggcc gtgccacaga ctccgcgaga    114420
     gcgaacggcg ctggtgctgc agacacgagt gtggcgacag ccggtgcaat ggcctgtgcc    114480
     ggcaccagat ttgtctgcac cgcttgccta gccaggaacg cggtgtagcc gagttctgcc    114540
     atgtgccgca gcgcgtgcgc gcgttgtttg gaatccagga tgccggccag ataggggaag    114600
     agagtcggcg cggtgacggg cgtcagcgtg accttgatcg agagcttgtc catggtggaa    114660
     tggcgccccc gattacttct gcttcaccgg gcgcgtgcta ccaatgtcgt agaagccgct    114720
     cacattagcg aagcacgggg aggaaagggc atggatgggg gtgcgcggga acgcggcacg    114780
     aatggcaggc acatagagtg cgctgccgcc gccggcgagg atgatcgcgc ggatgtcttc    114840
     ggttcggccg acgcgggtct ggatttcctt gacggcgagc tggcagacgc tgcgcgcttt    114900
     ttccagatac ggcgtgagat cgatctcctt gtcgaagaac agcatcggct ttttgtcgcg    114960
     caggcacttg tcgatgcgct caatgccggt gacaggctca ccctcgtcct gctcaatcag    115020
     cgatgcgatc tgctgataga tcttggacga gccgcccggt acgccgccgc tgcgattgtc    115080
     gtccatcgtg aagccctggg cgaccaccca atcggtggtg aagtagccga catcgatgac    115140
     caggtgcgcg ttgtcggcat cgaacttggt gttctgttgg cgcataaacg tcaccagcgc    115200
     gccgagcggt tgcggcaagc agatgaccga tccgatctca acgggttcgc ccccgaaatc    115260
     aagcgttcct gtgaagcgat cgcgcaagta ggaagcgtat ttctgggtcg tgtgaacggg    115320
     caggcctagg atcagttggc ccacctccga tacctgggcg aggcgcaggg cgccacccag    115380
     cagcgcggcg tactcgtctt tggtcacaaa gtcctccgac agcgtgcggc cggtctgacc    115440
     atatgccgag gagagcgaca caccggggcc gacttcgtat tccacgccgt caatggcaat    115500
     ggtgattacg tcgcgcgctt tgaagaagcc gttcccgtgg ttggcaagcg cgcgtggcgc    115560
     ggcttgcggc gcgagggacg ggaacatgtt cagcttggtc tcggagccca tcgagaacgc    115620
     gaacttggtg tttccgtatc cgacgtcgac ggcaacggtg gcggctttca tggtgcagac    115680
     cttgtgttgg ggcggagcag cttccgccgg ggcagtggaa tgacgcgtga gggcgacatg    115740
     acacgtagct cccccttgcg ggagacgtag atgtcacgac gagctgggcg agattggtca    115800
     gcctctgcta gtgacacgta gctgcaccgt gcggtgcacg tgagtgtcac gtggttcagc    115860
     gcataaccga tcggtgcccg ccggtgacac gtagcttccc cttacggggt atgtacgtgt    115920
     cacgtcgcct tacgttggga ctgtacgagg ctgcgccggc tgtttgatgg aagaaagccc    115980
     gtcaatcttg cgtagctttc gtgcggcgca attcactggg ctgccctatc cttgagtcac    116040
     cacacgcgtc ccccgacgca tcgatagctc cgcgaagacc gcggaaactc agggtgagcc    116100
     ggcgaccaag aggttgttgg gcaccaatgt tcgtgccgga tagtcatccg gcattttttt    116160
     caagcaaatc aagtggatgg ggccggagag tgaggccacc ggacaccgcg ataccaaaac    116220
     gatcagcgcg ctggctgtga agctagaccg cagtgcgtac aaatccgaag ccgaacaccg    116280
     aacagtgttt gtggatggaa cgcgataaga cgcacccgtt cagccagagg gctgggcacg    116340
     aatcacaagg cccgatacac agcggcggag atggttcggc ttgtgggtgg gatacgagag    116400
     cgacccgagc aagggtgacc gcacgtatct gaacgtgacg accggtaggc gcagccggca    116460
     ccagaaatgc gcaaggagaa tctcacacca gggcaaaagc ctgtgggcga gtgaaggccg    116520
     cggagtcgcg tgccttgctc gtgtcggcag gaaggcgtcg caagatgccg gccggtgtgt    116580
     aggccgcgaa gcggtgagtc agcgcgcaag cgcaggctcg ctgcaggacg gacagtcaga    116640
     acgcattgct tccatgcgtc gggctgatcg attggaatcg ctaaaggcgg ggaagttggg    116700
     cctggccggg ggaaccggca gccgaccgtg gtgggtcggg taaaggggaa gccagcacgg    116760
     gggtgcggat tccgtgagtg cggcgcggtt gccggcgggg aaacctgcgt cgaggacgtg    116820
     cgcgctgcgc aaccaatact cggagtcacg gtgcagacgc gcatcaatct caagccgatc    116880
     ctggcgaact actcgctgcc ggaacggttc aagtcggaat tcgcggtctt ggcgggcgag    116940
     aacctgcaca agccgcacag ccagacccgc gtcagcggtc gcgcgctgtc gtcgatctcg    117000
     cagaaacagc gcgcgcagat gttgctcagt ctcgcagtgg agctgcgtga gggcggcttc    117060
     accatcatgt cgccctacaa cctggcggag aagcacctgc gatggttggt gcagcgttgg    117120
     gtgacagaac gaaacctcgc ggtgggcagc gttgaactgc gcctctcaca cctgcgcgcg    117180
     ctgtgctcgt ggatgggcaa gaccaacatg gtgggcggca tcgatgacta cgtggagagg    117240
     ccggcaggct acacgcgcag ctacgccgcc gagaccgacc gttcttggga cggcaacaac    117300
     atcgacgcgc tagccaagat cgaggagatc gcccagacgg atgcccacgt cgcaattcaa    117360
     ctgaagcttg aggcagcgtt cgggttgcgc gcgaaggaaa gctggcgact gcgcccagcg    117420
     cgcgacctac ttccatcggg ctatctgcac gtgcaggacg gcaccaaggg aggccggccg    117480
     cgacaggtgc tgatcgagtt cgattggcag tacgacctgc ttgcggaggc ggctgagttg    117540
     gccgcgtgca cgaatcccga acggggctcc ctgatcccgg cgacctatac gcaggtgcag    117600
     tggcgcaggc gcttctatac cgtgctggaa aagcacgccg tgaccaagcg cggcgacggt    117660
     gtcaccgccc acggtctacg acaccagttc ctgcagcaga tgtaccaacg gctgaccggt    117720
     gagcaagcgg ccatcaaggg gggcgcacgc gttctcgacc gtgaagcgca caaggacgcc    117780
     atgacgcggg tggtggaagc cgccggccac agccgcaagg agaaggccaa cgcctacctg    117840
     tcgacgcatt ccgcgatcgc agcccggagc cggcccgtcg tcacacgtga gatggccgtc    117900
     gcggcggttg ccgcggccaa tggggtcaag ctgaaggcgg cagaggccct gggcatttcg    117960
     cgccccgcac tgtatcgcct gcttgccaag cccgccgagg cgggtactgc ggccggccat    118020
     cggcacttca cgggatgagg tcgtgcgatg actgaagatg acgcaatggc cgatggcgat    118080
     tgggatacct acctgtttcc agagccagag ctgcgggcgt gcacagacga agaactgtac    118140
     acactcatcc gagagaacct gccaaacgcg accgcggaga ctgacggcac cgacctgttg    118200
     acggacgtgg ccatcgatca cgctcaagac ctgatcgagc aggcccgcga tttgctgctg    118260
     gctcgtgggg ctgctatctc gccgcaatgg cgcgcagcgc tccgcttcct gcggtggccg    118320
     ctgagcccag cggaagtcac ggccaaccaa gctcggcggc ttcgcgagat cgaggaggat    118380
     cggcttcggc gggcgcacgc cgcgaaactc ggggtggaca tcctccaggc aattcggacg    118440
     gtgatggacg gcggccggct accgctctcc ctctcgttag agggggtgac tgtcagcatt    118500
     ggctggggcc tgcggacatc ggatggtgag cgcaggagca tcagccccag tggggccgaa    118560
     gttgtgcgta tgcgggacgc acttgccgca gcggggtgct gccactgtca gatccacggc    118620
     gcgtcccaag atgggattcc attcgaggag gcgcctacgc cggagtggtc tctcaacttc    118680
     agtgtgccga cgaatcgtgc cgggtgggat ctgctgaagc aatggtggaa ggaagggcgg    118740
     ttcagccacg cgccacacgt ctggatgtac cggccagaac ttggcgaccc cgagttcttc    118800
     tggcactggc cactcgatgc gtgttggccg ggcagcgcac ctgcgtggcg gcgcctgtat    118860
     gggcatcttg gttacgtcga cctcccttgg gtgcgctttc atcgtcgggt gcacggcaat    118920
     tgctgggagc gcgacgaagt gagagtggaa tgggctgcag gagagctccg gtacatcgag    118980
     tgcgccgaag aggctgaccg agaggctcag cggttgatca cgtcgggcga gatactcgcc    119040
     tacaagatct cggccagagc tgctatggac gcacatgccg gtgccggtgc cggtgccggc    119100
     ccggccccgg ttgtgcgatc gcgactcgca gagctgctcg cccgggtttg cggaatgctt    119160
     gggcgttcgt gctcatcggg cgcggccgac ccaacgaaga actgatcgcg cgctagacgc    119220
     gttcaggaca aataacgcaa aagccgccaa cggtgtggcg gcttttgcgg gattggtcgg    119280
     cgggttagaa cggcgggctg gtcccggcga tgtaggaaag gtacagcgcg acggccacag    119340
     cgatcagcca gaagctgaca cgacggccca gggtttgggg agatccgtac ggttgttggg    119400
     ctttcatggg atgcctccat ttagattcca tcttagcgaa cggcggcgct gattgcgcgg    119460
     gccagccgcc atacgttggg aacgcgggcc acggcagtcg gtccgacatc ttccacctcc    119520
     gctgccggcg cgcggctcaa gagatcgttg agggtggtct gccgaccagc cttctcgtgc    119580
     ggatgcgggg tgggcggcgg caactccatc gcctgatcgc gcgtcgcggc cggcagccgg    119640
     gggaacgggt cgacgccggt gaattgtgcg agtttggcga tgctgaccac cgcatatttc    119700
     ggcgtggcat cgttgggtgc gatgtaggct gctgcgccga cgcccgggac gtagatcgct    119760
     ttccacagat agtcgggtac ccgtacatgt tcgttgaggt aacgggcctt gccgtccgtg    119820
     aatgctgggc cggtcaccac gtaggcttcg ccggtctgcc gtaccaggcg gcgggtcgac    119880
     gtctccaggt ggctccacat gcggcggttg ctgaccgagt tctgcgggac gacgttggcc    119940
     aagctgaaac tttcctgttg cgatgccagg tcgccgaagt ccccgcttgg cgacatgtgg    120000
     ccacggtcaa tctggacgtg cgagctaccg tggtagtcct gcagggtggc gcgggcggtt    120060
     gccggcaaag acgtctcttc gaagaaatcg ctttcgcgcg gcagctcacg cgcctggttc    120120
     accgcctgcg cggtcaggtg ttcggctgac cacagcggtg tccgggtcgc cgaggacacg    120180
     agcaccgcgt aggcgcggta gcagagcagg tggctggcgc cagcgtgctt gctggacagc    120240
     accttcggtt gcgcgccgtc cgcgaccgat gcgccgcagt gatcgggaga ggcgccggcg    120300
     acctggagga atgcagagag ggcaacgaag agcagggttt ttttgagcac ggcagttggg    120360
     atccgggttg acctagatcc atcgtgcctt gtaacgggca atgtcaagta cccgaaagcg    120420
     agagcttctg cgggccgatt tgcgtgaagg gtttgggagt gctgggcacg gaacgagatc    120480
     cggccggcca aagcatggcc gttaccgcac ggtcatctac cgcgcgtcga cgccatcgtc    120540
     agttggaagg tcagcgcctc gccgatcgcg cgatcatggt ggcgaggggc gctagtcgag    120600
     ctgaggctcc agggcatcca ccgcacgcgc gacgaatacg tccatgcgcg cgaaggcatt    120660
     ttcttcgcct tcaaccagtt cggcgtcgaa cgcgtcgagt ggttcgaagc ggatccaggg    120720
     acggccatcg acgtagatga ccttggccaa tcgcacgagc ttgcgatacc ggccggcgtc    120780
     ttcaaggacg gtggccattg gtacttccgc ggcggcgggg gaagcgggcc tgctgagctg    120840
     ggcggccatt gccgcgaata tcggtccgcg ggtttcccaa tccatggcat tgcgggcgat    120900
     cgcgtccagc agcattggga tgtccaccgg cgtcaattgg cgacgcgcga tcgaggccag    120960
     ctcgtgttga tcggttgggc gatactcgac gcgtcggttc cagatcaaag ccagctcgtc    121020
     gtaggccgct tctttggagg ttccgatttg cacgggcggc gtgccaatgc cgcactgtgt    121080
     acacacaatg acggcctcct ttcggccagc gaagaacctg gcccgtccgc cgcagtgacc    121140
     acagccgatc agatcgtcaa acataccgtt gggtctcgat gattggattt taagtccgga    121200
     ttatgcctgt cgccgagttt gttgaaccac cactgcagac gggtttatgt tgcagcggct    121260
     ccaaaatatg cgtgagacgt cgccaaaatc ctgatggcgg cgctttccat gaagccttgg    121320
     atgatggctt cagcctcggc gcgggcgcgg ccgaacgccc agaactcgtg cagccagtgg    121380
     cctcctgggc tgtctggccc ctgctggagg ccgatggaca gggcgccgcg cacggcgatg    121440
     atcgtttcag ggtggggaaa ttcggaggag agatctgctg ggggcatgta ctacgttatt    121500
     tggtaaaggc caacttcctc actgcgcttt tgaggaatgg ctggagataa tgcggagaat    121560
     agctgggcgg caccagaatg tatgttcatt gtgcgtgccg attgttgctg ttgtgcggga    121620
     tcaagtcagc gaggcgacgt ggacggcgcc gcgggtttga gcaactggtc gagcatccgg    121680
     cagcgaagct cgcaggctgc tttgccccag gcgctaccgc tctacctgtg gcgttcggcg    121740
     aagggaaggc cggtcgtcgg gctgcgacca ctgaagatgc tgcggaggtt gacgtgctca    121800
     cgcatggccg ccgccgccca ccggggcgct ggcatgtggc tggccgggaa ggctgggcca    121860
     catgctgcta tccgctccgg aaatgttcgt gtgccagttg gcgagtgccg cagcggtcgt    121920
     gatcgtgtga tgcagcgcct tgtcaacgtt gccggcctgc aggtacatca tggagcgggt    121980
     ttcgaggtgg ccaacgagaa agacccagtc cgctggcgac ttgtcggcgt ccttggcagt    122040
     tccccaacgc tggcgctggt gggcggcttc ttgcacgacc ccgcgggcaa agtcatgcag    122100
     ctcggggctg ttgagcagtt gctctgcatt cagtgcccgg gctcgccagt ggtcgagctc    122160
     tgcgatctga gggcgcgtga tgtcgagaga atggcgcagt gcatgccaaa catgcgaatc    122220
     cagagatccc cgcttgtgcg cgtagaccga ctgggcgagc accttgcgat ccgaagtgca    122280
     gcggcgcagt gtcacccagg tggagccgtc gtcatcggcc acactgattt cccagccggg    122340
     aggtagccat ggcgcggcat tgttggattt ctggcatgcc cggcagggaa ccttgccttt    122400
     gtacaccgtc agctcgctac cgaagccgtg gcaactcgca catggcgcct cgggcattgc    122460
     cgttgccgcc ggcgtggtgg tcgattcccc ttgtggccag ccaagagcct tctgagcccg    122520
     gtcaaaggcg gggcggacgg tatccggaat gccgtcttcc tggcccgccc accattgcac    122580
     tgaaagaacg aggtcggcaa gcagcgtcat ggcttcgtgt tgagttgttg ccggggaagc    122640
     gttctcattc gtctgctgca tcgttgacct ccgtcgtcgt tgctgtgctg tgtggagcgg    122700
     ccttgccatt gcctcgttgg tagcctggac acccaccgcc cgaatagtcg aagccggagc    122760
     aaccatcggt tgcgtgtggg cacagcgcgg cgccgcattc cttgctcatc gggagtacct    122820
     tgtggcccct tgccttgtcg atcgtcagct tggtgcgcgc ctcggctggc gtgagcgagc    122880
     gcccggtggc atcacggaag aggccaatgt agtcgtccgg gtacgtgctg ctccgcacga    122940
     agccctcgat gtccaggtgt atatggaacc cccacatcag cgtgggccct cgtctgcgtc    123000
     aatcgacgca gcaccgggcg tatcgcgcaa aactgtgtgg ccatcggcgt cagcgttggc    123060
     cgtgccgact ccgtcagcgc acaatcgcag ctcctggggt cctgggtaga actcgaccac    123120
     gtcgtagcca tgctccttcc agtcgtcggc gatcgccttg ctgtcggtga tgggcacgca    123180
     cacagcggga tgcgtcgttt tccagatcgc gggccgtgac gtgtccggcc ggcccttgtc    123240
     ggccagctcg tcatccaccg ccgttggccc cagccactga gagccctcgc cggggcactc    123300
     gacgtcccag gcgagcagtc cgtccttgta gggcacaacg gcgacctctg cgtcgtgacc    123360
     accgaagaac tgctgcaggc tctcggcctg gcggagggtg atgagcagca tggggcgccg    123420
     cgccggtgta atgcccgcag tttgatgatc gcggattcgc tgcagcacag cgcgggtgcg    123480
     gggtccgcaa tggccttcgt cgagacacca gtcgatctcg gcagccagcg cggcattgtc    123540
     aacctccagc gtcgccggaa cgacaggggc gccactcaac gccggtggcc acggctccgg    123600
     cattaggtgc gtgacgttgc gtgccggctc ggtaccgggc tcgccgttgc ggtccggatc    123660
     aagctcgtag aagtcggtgg ccttcaaggt atggaaccgc tggccaccgt acaaggggta    123720
     cacctcgact tcacagccac ggcctcggaa atgcttcgcg gtgtcgtctg cttcactgcg    123780
     cgtgcgtacc agcaatactt tgtatccgct cacagccacg tcgaacgccc tcggctcgcc    123840
     ctgctgtagg tcggagtggt gggggcaatc atcgttcgtg cactgaaact cctcgcccat    123900
     ctcggccagt gcgctttcga tcgtcggata tgccgctgtg tcccagcagc ccgggtagtg    123960
     gatcgccgcc gccagactac tgcccaggac tttgcggacg gcggccaatg ctccgttcca    124020
     gccttcgttg tggtgctcgg ttgcaagata ggcttccgtg ccgctcctat gcgggttgtg    124080
     atgtttttcg ctcagcattg cgcttgttcg ctgtggtttt cttgaggtcc ggccgaacgg    124140
     ctggtcccca ttctgaaatg ggctgtcagg aggcaaggca ccgcaaccgt cctcatggac    124200
     aaacagctcg tgaacgccgc gcagcgcgtc catgacgcct ttcgcatgcg catcggacaa    124260
     ggcgatggcg ccagctggcg cctcttcctc ggctgcgcgc ctctcgcggt ccacaaggtc    124320
     cagcatggac aggcgacgta tcacatcgtg gccgtcaatc tggccgacga ccctgatggc    124380
     ggccaacatg ttgcgaaggg tggagggttc accggcaccg gcacagtccg cgggaactgc    124440
     tgccgcgggt ggcatgctgg cttgcggggc gtcggcacgc cgccatttgt cgaactctcg    124500
     aaggaagacc gtgtcggcga gcaggccagc gattgcgttg gcaatcagcc cgcgttcccg    124560
     tggagtcggg acatgggacc ccagcgtgcc gtgtagctgg tatccggaca caaactggtc    124620
     gaccaccgct tgcaccggcg cgtacgctgg ttcctgtcgg tcagcatcat ctacggcggt    124680
     caccgcattc agcgcggagt ggtagccgca acgaaagcct ggcacaacga gtgcgccatc    124740
     tggcacgcat tcgacgcaag catgatcgag ggtgcggtct ctgctgagca gaatccattt    124800
     cgccatggtg agcgtggcgt tcgcgcgggc gcggccatcg ggaccgcatg cgactgcagg    124860
     gctggaggat gcggaggtgt tcatcgtcaa ttgtgtgcga ggcggctggc ctcgggtggc    124920
     aatggattca gatcagcgta gccagcccag tacaaagtca agggatggca ccagccgctc    124980
     ggtggtcatg ccgtcgcgag ttgcgcgtca agcgtgtcga gtgccggaac aggcaaacgt    125040
     ggcgagccag tggtcggccc agcgcgaggg cgttcggtcg acgcgtcgaa ggccgccgat    125100
     ttgtcgcgcg tcagaagctc ccccaaacga gagggaagtt ctgccaacac gaacgcgcat    125160
     aggttcgtgt cttgatcatc caatgcactg gccgcgcggc gccgaccgtc ggtgccggcg    125220
     ttcgagcgcc ggcaatgtcg atccccagcg ccagccatcc gagccagtag cggctgcgct    125280
     tcggagggaa ccggtgcggc gcgatcctgc accacctgga gcacccgcag aaggtctgac    125340
     gcttgctcac gtgcgcgttc caagtcagtg aggtaggccc gcaggtgggc aatttcagcg    125400
     tcgaattcct tcaattcctg gtagcggatc tgactgagat acgccgtaag cgcgtattgg    125460
     aggatcgaca gcgactcacg ggtttgcttg cggggaaaca ccgcaaggaa tttgcgcccg    125520
     cggtggaatt ccgcgatgac gtcggaggtc atgaatgcgg ggagcctgac ctgaagcgaa    125580
     cgaacaaccg accgagagac ggccggcacc aatatgccga cctgcgcggc gagataggcc    125640
     gtgcgaatac gctgcgcagc acagagctgt gagtgcaccc ggtcggcacg acggctcagt    125700
     gccgacagcg ccttggccag cgtgctttgc gctgcgtcga tcaattgctc tgccattcca    125760
     tcctccgatg tcgtgtacgc ccgggagtca gtcgttcagg ccacctgcag gtcgccggcg    125820
     gccagcgctg gcacgcgtgt caccatgaag cggcgcaccg cgcgcaaccc ctgagccgag    125880
     tagaaggcct cattggccac ggatatcgga agcgcaatta cgtagcaggg attgccgttg    125940
     gcaaactgga tctgggtcga cccgttgggc agcgccacgt tgtgctcgcg cccacgcaaa    126000
     aagacgactg ccacggtggg tttgccgggc tcctgaaaca gtgcataggt gggttgagtc    126060
     gccagcacat cggccggcag gcccggctcc tcgggatcgc ctgggaggaa aacgcgccgc    126120
     tcgtcggacc agacgtagat gcgaagcgcg ccggcgtggc gcatgccgtc gggtgccgcg    126180
     ccgttccacc aatcgcatag aacgcgcacg gccgggtcag cctcgtagtc gctgccacga    126240
     ctgggcatct cgccgccggc ggctgtgagt gccttcacca gtgcgtcata gtcacccgtg    126300
     accgtctggt tgtcgcaggc ctgctcgagg tcagcgcgcc ggcgcttctt ggccagtgag    126360
     accggaatgc cgtggaaatc agccaggctc gtcaggttga tgcgctcgac gatgggccga    126420
     tctgcattcc agatgccgga cagccattcg tccgtgcgat acagcaaaac gaatttttgg    126480
     cctgcatccg tttgcggagt ggccgcgagc gcctgttcga ggtcgcttgc cgcaatctct    126540
     gactccttga accagcccag gaacgcatcg tcgggctgca tgagcatcaa gagatccagg    126600
     atcagcccta cctcttccgg gtcgcaatag agcgacgcaa aacgaagagc attgctttcg    126660
     aggttgggcg agcgcatgac gaccccgtac acgctcttgt cgtcccgctc gctcagcacc    126720
     agcaccggcc agttcgagag gctgtccttg gcagtcaggc cccacttgac cggccagctg    126780
     tccttgagca cgtcgtgctc tgcaaggtgc aattcggcgg accggaaagg cgattgggcc    126840
     agcagctcgc gcacgatgtc gtcgggctcg gcagcgaacg tgccggtaat cggaaccggg    126900
     cgcgccaatg catagtggac cgtcgcgctt ttgacatcgc tgtcgttcgg aacaacggcc    126960
     acgtaacgga acaggcgtgc ggtgccggtc accctgtcat gctggtcaaa cagccaatca    127020
     cgaattgcca agcattgcgt gtcttgcatg gggggttcct tgttgacgat gttaccggtc    127080
     atcgccggcg acttgagtga gctgagcggg gcgcctggtt gcatgcgtgc gccatcggca    127140
     gagcggttca gtggagtctt catcaccggt ctcgatgtgt cggcgggagg cgggtgtccg    127200
     ctacggggtg tttgttcggg ttccattcga ccaaccggat accgttggtc gcgtagtact    127260
     cgcgcttttc ctgcatccgc cggtcgtact cgcggttgcc ggtcatgccg agcacttcga    127320
     taacggtgcg ctggtcgaca tcctttacct cgaagtccgg gtggactgcg gcggcgccca    127380
     catggcgcag tggcttctcg aacctgcgct gcaggcgaat caggtggtcg gccatgactg    127440
     cctcgtgcga cgagtcgcat ggcaggaagg acgagttggt caacatggct gccatgtcgg    127500
     cgacgtgcaa gtagccattg gcggtcttct cgacggccag gaccgccacg ctccgcaaat    127560
     ccttgcggcc gagaccggcc agcgcagtcg cgtaggagcg tgagaccttc tgaaacagcg    127620
     cattggacat gaaataccgc tggtggcttt ggcgcagcac cagcatgccg ccgtgagcgc    127680
     tcggtttgaa ctcgccgacc tcgccgatga tcagcccccg gtgcgtcgtg gtgccagcag    127740
     tggtcagccg cgcgacgaat gcatcgaact cggcaaggat ctcggcctta tgttccgggt    127800
     cccacctgcg catgatgtgc agcacatcgg ctgccgggcg gccgttgatt ttcgcgtcgg    127860
     cgaactcggc actgagcatg gaccagcatg cattccaacc gcggtatccc tgatcggccc    127920
     acgcgtgcaa tccagccgcc tcccaggcgt attcgagaaa tgcgaggaga ggtgccgatc    127980
     ggcgatgcgc tcgcggcgca ctggaggcct ggggtgatcg cgggccaggc tggccggtgc    128040
     cgggctgtgt aacctccaag gacagatcaa gctgaatgag gtgcttgccg ttccgggttt    128100
     ggaatgggcc cttggttctt gccgtcgccg tggcgtggcc tttgcgttcc tgaaacgggc    128160
     acccctgacg atgcttgtag ttggcatctg gccagcgcgc caggatgaac gccgaccgga    128220
     ggcgccggat gacgagcttc ggccgagggg catgctctgt gcagccgcac tcggcgaacc    128280
     cttgaattcg cttggcgcgc tcgagctggg ttgtgtagcg gcccgggttc tccagcacct    128340
     cagcaaggtc gaagtcggac gggccgatcc ggatcttgat catggtgtgc ccctttacac    128400
     cccggcatcc cggaacattc tgtgcatgtc aacttggatg gcagtgatgt ccaggttgcg    128460
     cttggcgcgc gtgagtgcga catagaggag gcgcttctct tccgtgtcca tcgtgtactt    128520
     gccgtcgtcg tccgtcttga acctgaagtc gccggcaatg cggaccgagt cgtactcaag    128580
     gcccttgacc tgatggatgg tcgagaccac gtaatcggct tcggactctg ggctgacagt    128640
     gctaagcagc tggcggacgt aggggatgcc ttcatcgtcg atcagcttga cgaacggctt    128700
     caggtctcgc ccggcaaacg agtcggcgta gtcctgcacc tccgaccagt tggcgaacag    128760
     ggatagcgcg gtcggatagt cggtccgctg gccgcacatc agccgttcgg cgccgtccag    128820
     gaaggccatg atgtcgcgga tattggcgcg gatcgcgacc ttttcgccgc gttggagacc    128880
     atcggcgaca taggacagca ccgttgcatt cttgcggcaa agcacggcgt tgaccttcag    128940
     ctcgctcggc gagatgtcct tgtggatacg cgatgcaatg ctggcctggc ccctgacggg    129000
     cacttcctcg tccatcgtgc gcaggatgcg ggtcgccagc gcagcgatcg gctcgccaaa    129060
     gcggaaggac agcgtcagcg cacgcttctg cgccttgatg tggtccatcg cgttgacggc    129120
     accgcgccac tcgtagatct gttggtacgg gtcgccgaca tagatcacct gggccgattg    129180
     gcgtcgaagc accgaaagca tcaggccgtt tgcgtcttgc gactcatcga ataggatgta    129240
     gtcggcaggg atggtcggcc ggctcaactg ccacagcttg acgtacacgt cgtgggagat    129300
     agcgcccggg gattgggggt tttgtgattc ctcccagagc ttgacgaccg aaggcagcag    129360
     cgcatggcgt agcgcttcag ccgcttgctc ggtgatcagc ggatcgaccg ggatgtgcca    129420
     atcgagcggc gtcggcttgg cagagccaca gaacctggcc aagccgtctc gcaccatccg    129480
     gccaagcttg gcggaggtca gttcaaggtt cttcccgatc gttgtcggga ccttgatagg    129540
     ctgtaggccg aatcgctctg cgaggaggta gttgggctcc aacggattac ggagcttccg    129600
     ggtgatgtcg gccgatacgg atctgtatgc ctgggagttg accgttccgc accgcacgga    129660
     caaagggaac ttgcgcttgg cctcctccgc aatgaggcga ttgaaggcca aatagacacc    129720
     acgagcccgc cctttggcgg tcgagacgag gcctagggtg gaggtcttgc cggcgcccgc    129780
     acgagcgtca accttcaacg gttcgccatc caaggacgca tcaacgacag cggtttgctc    129840
     ttcggtaggc tgcatgtcag gcgagggtca gttgtgtgtc aacgagagac gcgcgaaacg    129900
     ccgcatccct ctcccggatc gccgcacggc ggcgctcgcc ctcgccggtt tgctgctcaa    129960
     ctacatagat gaagttgttg ggagtggtgg ggccacgcca tgctcgccac gcttcctgga    130020
     tgtgggcacg aacggccgcc ggttgggcga agtacatgct gcgacctttg cgccagtgtt    130080
     tggcctggag cgcgcgcata cgcagctcca gactgtcgga acgacgctgg cgcagggcga    130140
     tttcgtcagc gacggtgcgt tgtgactcgg ctatgtgctc gggaaacagg ggatagcgcg    130200
     cacgctcgcg ggcctgcttg cgagcgaaag cggcctcgcg gcgcgaggta aaatcgatcg    130260
     ggtagtaacg gagataacgt gtgaagcgca tgtcggaaaa ccatcgggat atggttccaa    130320
     gttaccggca tggctgcgaa gtcaatggcg ccggttgagc gaactggccg gtacgatttt    130380
     ggggcgggca acgacgatcg aatcaagcaa aagctcgata ttcgcgtggg ctttcgccgc    130440
     attcccacac cacagcacac gacatgcgag aagttgaaat aggcggccgc ccaaaggccg    130500
     aaccctgctc ccagtttggg gaggctgaag accaggcact ggccagcatt gaggcgcagg    130560
     ccttcgcgcg catgctggat cgcgtcttct ggttcccgga gccgcatgtg ctgcggttcg    130620
     aggcgcgcgt gcattcggat tcgcaaggca tacaccacac tgtggtgggg gttgttgggc    130680
     acggcggcga agcgtggttc agcgaggacc tcattccagc tcgttgggac tatgtggcgt    130740
     tcaaggagat tggctggagc gtctccaagc tactacgcaa caagctcatc gctgacggcg    130800
     tgcttcgtga ggacgcaccg ggcctgctgg cggggttgat gccagacttc tcagggatgc    130860
     aagaaccaga ggagaaggac cactatcgct gggccgtcgt caatcgcttg cggagcgctg    130920
     caatgacgcg gccgatgcca ggaaggtggt agcgggctgg gcgcgcgtgc gcgcagctgc    130980
     tggaaaatgc agagcaactg cgatattctg aaacggtttg ccgcgtctac gacgcatcga    131040
     ttttgaccgc catctgggcg gcctacatct tgtttccccc acagctgtag ggtccggttt    131100
     catctccgac actgcacgtg tcggcctatc gttcgcattc tgcggccggt ctttcccttg    131160
     aacacctgag cgaacttcgc tacgtcgcgg tgtgcctacg cacgccgatt cgttagcgct    131220
     ggtcggtcag gtcgttccat cttcttcccc gctgggagcc gtcccagcag ggacgtctct    131280
     cgtccatttt ctggagacgt tccatgttca acgccgttat tcagcgtttc aaagaagcac    131340
     agctcaaagc cttcgaaagc tacctggtgg tggctcgttt cgaacaggag gccttgccaa    131400
     tcctcgatcc atcgttgcgt gcaacgcgga tcaggaaaga agctgaggta acacacgagt    131460
     tcgagctgtt ctgtgtgcga attgcacgtg ctgttgtgga gactgtgcgc agcaatgctt    131520
     cgactagtgt ggcatcgact atcgatgtgg aatcggaact ccgggtcgct gaagccgaca    131580
     tcaaagccgc tctggctatt ggcgcggtcc ccgacatgga tgccttttgc gcatcgctga    131640
     accagcgctt caatgtgcga gttggggctc tgcaatgagc agggcagcac aacgccggca    131700
     cctggagacc gccgacgaac accaaaaggc cttggtcgat ttgatcaagg ccttcgggta    131760
     ccgtcaccgc gcaagcgatg tgttctccga cttcgttgag atgtccgcac tgagcctcag    131820
     caatgcggtc gatctcgctc agcgagacgg ccgagaggct cggtacatgg agatcgtcaa    131880
     gaagtacacc aaagaagaag tggaccagtt cccgaagatg cttggccacc tcgtgctcac    131940
     ttacgagcgc cggatgactg atgtccttcc cgggtcgccg gcgccggtca gagtcgccgg    132000
     tggctttggc gatgtgcttg gtcacaccta catgctgctt gagctgggca acgatagggc    132060
     ggggcagttt ttcacgccct attcggtatc cagcatgatg gctgcgatgc aggtcaatga    132120
     ccatgatccg gacgtcgcgg aacatggctt catcaccgtg atggagccaa cctgcggcgc    132180
     tggtggcatg gtgatcgcaa tggcggaggc tatgcatcag gcgggccaca actaccagac    132240
     ggccatgcat gcaacgtgca tcgatatcga tccacggtgc gtacacatga cgtatgtgca    132300
     gctggccttg ctccatatcc ctgcggttgt catccttggc aactcattga tgcttgagga    132360
     gcgcgaggtt tggtacacac cagcgcacgt gcttggcggg tggaaccgga aactggctgc    132420
     gcgtgagcgt agccaggaaa cctccccgcc cgttgattcc gaacgcaatt tcgtgcccgc    132480
     agaaatgggt acggtcctgt cgattctgga ggcgattgaa ccgccgcaag cgccggccat    132540
     cattgaagcg gtgccgcaac agcacgctga aattgcccgg caacgtgagc aattgtcgtt    132600
     gttctaggtt ggccactggc cggcctcgcg caagagcggg tccccatctg cggaggggga    132660
     tccgctgtct ggcaccgcag acgtgtttcc ggtattctca aagctcactc cgcgtctttg    132720
     acgcatcgat ctcctgatcg caggacgcgc agcgtctcgc ggttgtccga gggccagcgg    132780
     ttcggtggcc ctcgctttca ttttccatcc catcgggaac ctgttcccgg tgcggcaacg    132840
     ggttcccctt ttccatccct ggagaaccca caaatgcaag aaaaccaaca gagcgtcacc    132900
     gtcaaactcg gccaaatccg gccgggcaag aacccccgga agtacttcga tcccgcgaaa    132960
     atggcggaga tcacggagtc catccgtgag gatggcgtaa ttcaacctgt actggtgcgc    133020
     cctcttgagg acggcaccta cgaactggtc gctggcgagc gccggtaccg tggggcgaaa    133080
     gctgcctgcg gtgacgatta cgacatgccc gttgtcatcc gtgagatgac ggaaggggaa    133140
     gcgcgccggc tggcgctcat cgagaacgtt cagcgcgccg acatggcgcc gtctgaagaa    133200
     gccgttgcgg ccgcggacat cgttggggac ctgaaaggtg accgcgatga agctgcccgc    133260
     caactcggct ggccgcgatc gaccctcgac cgccggctgg cgctaatgaa ctgcagtcct    133320
     gcggtgctgg acgcgctgaa cacgcgttcc atccagcttg ggcatgccga gctgcttgcg    133380
     accctgacga aggaaaagca ggacctgttc ttgccgatca ttctgcaaga gaaaaagacg    133440
     gtggcggacc tcaagaaggc catcgaacaa gctgcctgca acctgaagga cgcgatcttc    133500
     gacaagagcg agtgtgcgac atgcgcgcac aactcggaat tgcagtcggt gatgttttcc    133560
     gaggcgattt cctccggtag ctgtaccaac ccgacctgct acaagggcaa gaccgagacg    133620
     cagctggaag gtatctcgta cggcctgaag gacgaatacc cggttatccg tatcgtccgc    133680
     gctggcgaca accacacgcg cgtgcaattg caggtggagg gaccgacggg agtcggtgcc    133740
     gaacaggcga aagcatgtca cggctgccag aatttcggcg ccgcggtgag tggtctgccg    133800
     gacagcctgg gcaaggtctt ccgtggtcag tgttttgatc cgtcctgcaa tgccaagaag    133860
     gttgcagcga ggatcaaggc cgagcgcgct gaagcgccgt ctactgttaa gggccccaaa    133920
     gccgcgccgg ccaaggaggg cgcggacaag ggcggaaagg ccgaacacgc ggccacgtcg    133980
     attgccgagt cggacaaggt gaagacctac cgacaagggg tgtggcgcaa ggcgctacgc    134040
     cgggaggtgg cggccaacga agcaacggcc aaccactatc tcctcgcact ttcgctgtcc    134100
     ggtcatgcac gcaccatcac cagcgacaag atggggacgc tctttgaacg gatcgcggac    134160
     gagaccagct ctcccaccga tctctcgaag aaccttatct ctgtggccgg cctggctact    134220
     gacaagcggc tcaatctgac gatctcgctc gcgcttgccg cgatcgaagg aatcgatgtg    134280
     cctgtcttga cgtcgctctg caagtaccac gcgctcgacc tgaccaagca ctggaacctt    134340
     cagaaatcca aggattttct ggaactcctg accaaatcgg agttgaaggc tctcgccgac    134400
     gagctgggca tgcgcaacgc gctcggcgat cgcttttcca agctgttcaa ccaatcgaag    134460
     ctcgaagtca ttgaggccct cctcaaggta gacgggtttg actacacggg caaggtgccc    134520
     aaggtcttga agttctgacc acgcctcgct tccccatccc attcattttc aaggaaatcc    134580
     ctatgtttca agaactggtg ccgctcgtga aggcgagcga caaggttgtt atcacccttt    134640
     caatgcaggg tgacgagatg accgtggtcg tcgcgccgac cgtcagcaag ccggacgacg    134700
     cagccctggt tgcgccgatt gctctgacgg ccacgccggc ggagttggat gctgagtttg    134760
     ccaatgcgat cggtggtgtg acgcaggccc gccagggtct cgccgaacag gtcgagtcca    134820
     cgaaggcggt gattcaagcg gctaccgctg ctcagtcgaa caaggcgacc aaggccctcg    134880
     cgacatccaa tcgcgccaat ccgaagttgc cggcgcccaa gtcgaaaggc atggacgacg    134940
     acgatgacga tggtgtggtc gatgttgagg tcactgaaac gacgtccggt agcacgagtt    135000
     cgtcagctaa agatgcgcaa ggcgacaaaa aatcgtctgg cacctccctc gctgatctgc    135060
     tcggttaagg agaagccatg gctatcacca tcaacacggt caagcgcgag ttttcctaca    135120
     acggcatgac gcttgccgat ccgggaacgc agttcactcc ggaccaagtg cgcgacatgt    135180
     acaccgccca gtatcccgaa ctcaccacgg cagccgtgga gggtccggag tacaaggggg    135240
     aaaacgctgt gtacaagttc gtgcgtgccg cgggcgcaaa gggcaaccat gcgtaagcgc    135300
     gatctgatga atgcgttggc cgatccggtc agcatcaatg gaactgagaa accgcccgat    135360
     agggcggttt ttctacatga tgaggaggtg gaatcgtgtt gttcgattct tgccaaggtt    135420
     tatcaggctt cagtgaaagc ctcaccggcg gggcggcatg tcgattcgat tcccctgccg    135480
     gacatagagc tgccgatggt tttctaacac tcccggccat ttcacaatgc gttccagcga    135540
     ttgcacgcct tcggcatacc gacgagggag accttaccgg tctgatacgg gcgcatttcg    135600
     aggctggtcc gctctcgccg cgcgacgctc gctccagcgg caatgctggt gacatgttcg    135660
     cagaggcgat gttcgcgtgg ctgcggcgac gcacaccgac gtgcaagcgg cttctgtttg    135720
     ggttcgcttt gctcgaccag gcggcagcac gcgatcaggt cgatcagttt ggatgggaga    135780
     cggacctctc ggcgccgttg tacttggcga tcgagttgcc tcatgagcag atcttcgaga    135840
     ttggcgcacg gatgcaccca ctgcagcgcg cccaccccgg gctcttgtgc tctgtgatgg    135900
     cgctgatcaa cgaagcgtcc tgcaactcgc tcttcttgcg cacaccgagt tacttcctgg    135960
     agatgttcgc caggtggtgg tgggattggg atgagggtgt gtccgacgag aacgcgaggg    136020
     agagtcttgc tgatcgcctt ggggctgaca gtgaggacat cgagcgctac ctgccttcca    136080
     atgttcgtcc ggtcctggcg ccggaagaaa tgttccccga gcgcggcaag cgcaagggcc    136140
     ggaaaggccc tcggcggtcc gttctcaaga ggtcggaggt gctggagctg gcgcgttcgt    136200
     caagtcgctg gattcagcgg gtatgccgcg cgatgctgca gctggaagat gcactgcagc    136260
     gcgccaaggg ctcgaagctc ttcgaacatt cgcaatgggc cgaacctgca tattcggccg    136320
     cttccattgc ggtgttttcc gaagagtgga tcggcgaact gctggatgac catttcgaat    136380
     gcattagcaa tagcggagag gcgacgatgt accaggtgct gattccgctg gcgagcgacc    136440
     cgcaacaggt gcccaagcag tatgaggacc tgtcgcgcat gttcgagatc gtaaaggctc    136500
     tcgaccaatt actgaccatc atttcacgat aggaggcccc atggccaaga tcttgaccgc    136560
     cagtcggtct catgacgtgg ccctgcaagg ggccattttg ctgtatgggc cggccgaggg    136620
     gcagttcaca tactcgacgg cacaccgcat cactcacgag gcggggactc gaaagcctgc    136680
     aatcggcccg ggtgttccgc tcaatcggcg agcactcatt cacgctgtga cccaggttgc    136740
     tttgtcagcg ttgccgaagg gcgagttcct gacgccgaac gtactgtccg tgagcacgcg    136800
     cgccgtaacg tggtggtgcc cgccggcgat tcgccgggtg ttctttcaat gcaaagaatt    136860
     gggtacgcgc agtgcggtag tgccgcaccc gggcttggtg ttccaggcgg ccaatgacgg    136920
     gttcagcgtg tttgccttga tggaggacgt caggccgacg ccggaatcca tgctgcacga    136980
     gccgccgtac ttcaatacgt gggacgtggg aaggatttgc atcggctctg cgcaggttcc    137040
     gaagcagatc gatgtcgctt cgattgccgg ttgggaagaa gccttcttct cgtcggcctt    137100
     cacgcatcca aaccgcggcg cccaacgcgt caagttcgaa agaggtgtgt acgccttctg    137160
     gaaggagatg ctcgatggca actttgccga gtacccgaag gaagtgctca ttccgttgaa    137220
     gaaatcgctc ggtgatctca tcgccggcaa agttggaggt tgaaatgcat ccgatggaca    137280
     tgacgctgca agcgtctttc ccgacgatca tggtgccgaa attcggtagc ctgacaccat    137340
     tgtctggtag tggtgaacgc ctgctggtgg gaaccaacgg cgtgttcctc gaagtggttc    137400
     gcccgtggct gcgggtagtt cgcaagatcg caagctacga agtcgaaact gccgtcccct    137460
     acgggactgt caatgaggag accgagttgc catgcggtca acttccagct gaactggttg    137520
     gccagtttgg cgagatggcg cgtgcgtcga tgccgaacga aaccggtgct tggatcgtct    137580
     ggaatggcgt ctcgtgcgag ttccggctcg tccctgtcgc aatcttggat cacggctccg    137640
     gacatctgcg ttacgaccgg ccggtgctgc aggaaaacga gcacttggtc atggactgcc    137700
     attcccatgg cacgtttgaa gccttcttct cgggaaccga caatcaggac gacaggcacg    137760
     acgtgaaatt tgcgttcgtg ctgggcaact gcgcaagcat tcgcccgtcc atggcgttaa    137820
     ggttgtgcgt caagggcatc ttcgaacgtg tccacgacat accggccgcc tggaggcaga    137880
     agttcggcat tcgggaggtt gtgtgaccaa aatgacgcat agcatccctc gcgcgatgac    137940
     agagcgggca tggcgcattg ctgtagtagg cgccggcgga acggggagtg cggttatccc    138000
     aagtctggcg cggctccatc acgccatgct cgaacttggc catcccggtg gtatcgactg    138060
     tgtcgtctat gacgatgaca cggtcagtga gagcaacgtc ggccgccagg gcttctatcc    138120
     agcggatgtc ggtcggcaca aggctgctct tctggtcaat cggttgaatg tgctcatggg    138180
     caccaactgg caggcggaag tgcagcgtat caatgccaat gatcggttct gctgtgattt    138240
     ggtcgttgga tgtgtggata cgagggcggc gcgaaaggcc atcctcaagg ccatgcaacg    138300
     cggcacgggc ggctactatc tcgattgcgg caatgagacc gatcgtggtc aagtcatcct    138360
     tggccaagtt cgcggccggg ctgaacatcg cctacctcac gtcggcgacc tgtttcctga    138420
     gctgattgat ccgaagcgcg atgcaaagga cacggcgccg tcttgttcga tggaggatgc    138480
     gctgcgcaag cagtcgctgg tcatcaacca ggcgattgca gtgcaagcct tcaatttgct    138540
     ttggacattg ttccgcaccg ggacgctgca gtacagcggt gtgtttgtaa atctcgaagc    138600
     ggggcgcacg agtccgctcc cggtagaccc ggaggcatgg gcgcgattcg ggtacgtgcc    138660
     gagtatgcgc aaggcgcaga agccgccgcg aattgctgct tgattgaaca tggccatcct    138720
     ccgaaggatg gccttttttc tttctgagcg gcattgagag tcgaccggga tgttgtgctg    138780
     cagccgctgc gcgaggttgc ctaggagtgc gcagaacgtg cctctggtgc gtgttccttt    138840
     gcatcgaata tcctgccttc ttatctcgcg cttctcgcgc atcgattccg cgccacacgg    138900
     tgctaccaac aggccttgcc acgttcttcg gggcatcttg gctttcatcc caccgggaac    138960
     tcattcccgg tgcgggcatg ggttgcctcg cattgacgcc gagatagagc gcaccaacgc    139020
     ggagctggat gcgcacattg cccagtccac ggcttccgcc gagcagagcg cggatctgct    139080
     cgccctgctt gggcaggtga aagccaagaa ggtgccgttg cccgcccagg cagaggcaca    139140
     gatcaggaag attgccgatg ttgctcgcga gaggacagca ttgaattctc gtcgtcagca    139200
     gaccagttca atgccttcca gacagcagtt cgtcggaagc gacaagctgt ccagcgacag    139260
     cgatgatttt gatctctggc tgtacatggc gacagatgtt ccgaccagcc tgagaacgct    139320
     gctactcagt gcgctcaact cgtatcatca tggcatgccg actgattcac atggacaatt    139380
     ctcgggcgct gggacgtccg ggaactgggg cgatgacgct ccggatcaga gagcctcgga    139440
     tgctgctgca gctgccatgg ggctcgaagc gctggctatc tcgacagatg acagtctcgg    139500
     gcgctactcc tgacacgttc gaaatcttga gcaagcgggg acgcgagatg atcgaagagg    139560
     cgaagagcga gaacgcaccg agcttcttcc tgccgcctgg ggggagcagc tactgccgga    139620
     cgcgtcctcg gtgaagtgct cgcagtgcca gtgttcggat agtgggccgg ccaagcccat    139680
     acccgatgcc agccattgaa tccgaagaaa ggcggcagaa aaaacagggc tcttgtcgat    139740
     cattctgttc tgcgcgacag acataatcgt gttgcggcgg tgccaaggtt tgcgcgcaca    139800
     acgccgttgc ccccaaaggg tttgcaactc ctgaccagga acatgttcct ggcagtgcag    139860
     aacacacaag aacctggatt tctctatgga ttacctcctc ggtcatattt ggcagattgt    139920
     gggtgcaatc gcagtgatca gtatcgcagc agcctaccgc caagtgctct ggctgtttgg    139980
     cgtcatcatc gtccccgatg acagcattgg cgtcgtgacg aagaaattcg ttctcttcgg    140040
     ctcaaaccgc agtctccccg acgggcgcat cttggcgctg accggcgaag ctggttacca    140100
     ggcggacacg ctcgccccgg gcctccattg ggcgctctgg ccgtggcagt acgcagttga    140160
     gctgaagaag ttcgtgacga tcccggtggg gaaggttggg gtcgtcgaag cctgtgacgg    140220
     ccatcctctg ccgagcggcc gcattcttgc gaaacgcatc aactgcgaca tgtttcagga    140280
     cgcgcggcag ttcctcgagg gagatggcca acgtggcccg cagatcgatg taattccgcc    140340
     gggcacgtat cgggtcaatc ccctgctgtt caaggtcacg ctcgcggata ccatcacgat    140400
     cccgcccagc cagatcggcg tcgtggaagc ccgtgacggc tcaccgttgc cggcgggccg    140460
     cgtaatcgcc aagcaggtag tgtgtgactc ctaccaggat ggcgcttcgt tcctggaaaa    140520
     cggtggtgag cgtgggccgc agagtggcat catcgccccg ggttcctatc gcatcaaccc    140580
     ggtactcttc gatgtcaatg tggccgaagt ggtggacatt cccgacaaca aagtcggcat    140640
     cgtgactacg cgcgaaggca agcccttggg gcggggcgaa atcgctggcc cggaagtgcc    140700
     tgaccacaac atgttccaga atccgcaggc gttcatccag aacgggggct gcaagggttt    140760
     gcaggaacag gtgctcctcg ccggccgcta cttcatcaac ccgcgcttcg ccaccgttga    140820
     cgtcgtcgat atgaccgagg taccgattgc ccacgtcggc gtggtgatcg cctatgtcgg    140880
     caacgaggga cgggacgttt ccggcgattc cttcaagcat gccaacctcg tctcgcgtgg    140940
     tgagaaggga gtatgggccg agccgctcga tccgggcaag tatccgatca atccctacac    141000
     ccacaagatc cgcaatgtgc cgaccgcaaa cgtcgtgctg aactgggcgg cagggaaatc    141060
     ggaggcccac aagctcgacg ccaatctgtc gaccatcacg gtacgctcgg cagatggctt    141120
     caagttcaac ctcgatgtca gccagatcat ccacattccg cgcaacgatg ctccgaaggt    141180
     cattgcccga ttcggtgata tgtccgcgct ggtgacgcag gtccttgaac cgaccattgg    141240
     caactacttc cgtaacagcg cccaggcctc cgacatcatc gacttcctgc gtgagcggtc    141300
     gaagcgtcag gacgacgccc gaaaggccat cggtgacgcg ctggctgagt acaacgtcgg    141360
     cgcggttgac acgctgatcg gcgacatcgt gccacccgag cagctgatgc agaccctgac    141420
     cgaccggaag caggccgagc aggagagagt cacgttcgaa acccagaagc aagcccaagc    141480
     cgtccgtcag gagctggagc aagcgacggc cctggccaat acccaggcga aggtggtcga    141540
     cgcagagcgt caggtgtcca tctcggagtt caacgctcgg gcggcggtga agcaggccga    141600
     gggtgaagcg caagctaaga cgatcaacgc ggaagcggac gccaaggtgg tcaggctggt    141660
     gggtgaagcg gaggccgcga aggtcgaggc catcggtacc gcggaggcca gcgtcatcaa    141720
     gcagaagatc gactcgatgg agagcggcaa ctacgccgtc gtccaggtcg cggaggcgct    141780
     tgccggctcc gggatgaagc tggtgccgga tgtcgttgca accggcggca gcggtagtgg    141840
     tggcggtact ctcgtggaag tgctgctggc caatctgatt cgcgatggca tgcacaaggg    141900
     aagtggtctg cccttgaatg gcgagtcagc ggtcaagccc gaagccctcc cggcccccta    141960
     agccagcgcg atgaacgcgg ggagacataa catcgggacg gagcattggc gtggtgccgg    142020
     ggcgcctttt ctgcgtcagc gcgcgaagcg gggattgggc cgactgttac tgacggccct    142080
     gatgtcagct ccaagcgttg cgctcgtgtt ggcggatcaa ctggtttcgg ccacgcacga    142140
     actggagctg gtgctcttca atacgctgct tgccagcacg ccgggcccga tcgcggagga    142200
     ggtctatcga gcgatcgccg gtgccgagag caccattcgc gtgctgcagc ggtcgatgtt    142260
     tgcggctctt gtcgtggcca caggcttggg ggcggtgggt gtcttccagg tctggcgcgg    142320
     tcctcgcaag cgagcagatg agcctcgccg tgcttaagct cccggtgatg gcggcgccgt    142380
     gtcgagttga ggtcgtgggc gtgccaccag tgcgcccacg gcctttgccg tgcgaagtcg    142440
     cgcgtctgcg ttgtgagagc gtacgaacga ccattcggaa tgtctggtgc acacaatgaa    142500
     ccccgaaccc aagcccaaaa agccactcag gtggcggatt ctcgccctca tggtgcaatg    142560
     cgccgccgtg gcgatcgcac tgaatgcggt gctggtgcta tttggcgtca tctcgaatcc    142620
     cgcagagcaa cgccgcgaag ttgatgccgt gacgtaccgc atcctggcgg acggctatac    142680
     ggcgggctca cccgtgtacc gcgcagccgt tcgtgatgcg gtgaaagagc gtggggcgat    142740
     catgctcgct gatcgggagc ggctgatggg catgtgggcc aaggccgcgc cggttggata    142800
     tggcgtgccc gctgctattg ggccgcgcga aaccgagcga gcgcgccttc tgcgccttgt    142860
     gaaaggcgaa tcaaactaac actgccaaca gtttgcgact acgtagaccg gctaggaact    142920
     tctttcggcg tgtgtgcgct tcgcgcgtcg gctacgcagg tagaaggaaa gggtgaataa    142980
     aacaagggcg caggctatgc caacaacact acttggccaa atcggattgg cactcatcgg    143040
     agtgctcttc atgtcggctt tcagcctggg ggtgattgca ccattcaatc gatcggtttc    143100
     attgggcgtg atcgccctgt gcattgcggc ggcagtcgca tcgttcgtca taccgggata    143160
     ggaaaaacgc cggctgcgcc ggtagaagga aacagaccat gtcaattgcg aacaacagta    143220
     ccgatccgca gcacctgctg gggcacctgg ccagccagcc tgtcgcagca ccgttcaaag    143280
     tggatttgtc gaagccgacc gacttggttg aagcgatgtt cgggccaggc gccaagatcg    143340
     tgcatccgtg cgatgcattt gcgcgccggg cagggtgtgc ggactgggcg tctgcggtgc    143400
     aggcgatgaa ggcaggcaag gtgctggtcg cgcagggccc caaggttgga aagtcgatga    143460
     tggacctgat gatgttcatt gaacaggttc gttccgaagg actccattcc tacgcagacg    143520
     accttggccg gatctggctg gggctgaaag agaactttcc gcagtccgtg ctcgaccggc    143580
     aagagcagga acagcatctg cgtgaccttc tcattgggcg gtagaaagaa acatgccgag    143640
     tcgccggccg ccacactggg acgaaccact ctcgccgctg tgtgaacacg gcaacggcta    143700
     tagctgcaag cattgccgcg aagtgcttcc tttcccgaca gagccgttgc ctcaccagac    143760
     cgggcatcgc cccagcggga gcaagcacat tcgcaaggtg gcggcctaca ggaccagtga    143820
     taagtgcgaa ggaaagacgc cggcaccgcg cgggctgacg aaataggaca acgacgatga    143880
     atgcaaaata tgcgctgccg gggttagttg atgcggttgg tagtcttttg tggatgcagg    143940
     ttgatcgcta ttcgtttagt tcgtactggt gggtttcaac gctgatcgct ttgctggttg    144000
     ccatggcctg gatggtggca gacggtaagg cggaaggttg atcggaagaa cggataatgc    144060
     gtgagcacgt tgaaatgcag ctcggcgagt ggttcgtgcg cttgttctgc aagctgatcg    144120
     cactcggcgc cgcgatatgc ggggctggtg gcttcgcgat tatcgggatg cggaccatcc    144180
     tgccgctgct ggatgatggc aggtacgtcg agaccgcgtg cgcagccatc gcgtgtgtcg    144240
     cagtgctgta cggactcact ccactcgctt tggccgtgga cggatcgctt ctccatgcct    144300
     tcggcatgga gccgttgaaa gggcttcgac aggacccgaa tcaagagcga tagagggaaa    144360
     gcctcggacg cctgatctga tcgttgccgc tgtgaaggca acagtcggac ccgaaagggg    144420
     gtagccggcc ggtgcctttt cggggatgct gcgagttttt caaaatgcgt gtcgacggcc    144480
     cctttccggc gccaaagcaa gctgctacga tgcccttgct ttccgcgtct taggcgcatc    144540
     gattcacacc agtctttggc tggtatctct tctccccccc ttacgggccc tcacgcccgt    144600
     aggtgtgatg ggcccgtttt tttcgaggcc catcatgttc aagtcctttt tctccgctgc    144660
     tctcgtcgcc ttctgcgttc tagcatctgg atgcgctctt caatagagct cgcccgacgt    144720
     ctaccgcggc atggaagtca tgcgccgcgg tgatgccgag caggtcactg ttgttcgcgt    144780
     tcgcaatgtc acgatcactg gtgacgatgg ctacatgtcc gcatcaagcg gcatgcccgg    144840
     tctcatcggg gcaggcatca gcgcattcct cggtggccgt tccatcggta acggcaatgg    144900
     ccgctatgtc gccggcgcag tctccggcgc cgtgggcggt gtgatcacgc agcaagtctc    144960
     ccaggtgctg aacaagcgcc cgggcgtaga agtcatcgtt cgcacggatg ctgggcgaac    145020
     gttggtcgtt acccaggatg ccacgcagca gtttgtggct cgggagcgtc tgtacatgat    145080
     ctccagcgcg gcgggctttc gcctgacccg ctgatcctct tggtggccgc cgcaaggcgg    145140
     tcaccgccct gttggcgctg ccaacgctgc tccccctcca ctcaatggcc accccaacca    145200
     cagacgatct ggctgtctat cgtcgggatc accggacgct ggaagtcttc agccacctga    145260
     cgcgtggccg ctgttccacc gtcttcttct tcgaattcag ttcgcatccc tcgatcgttc    145320
     cgttcctgat tcccagctac atgcagggca tcacgacgga gttgatccgg gaggcgggcc    145380
     aacaattctt gcaacgcgag gcggcagtac tgcccgtcta gccgacccat catgagcgaa    145440
     caaaatctca tccgctgcac ttcctcgaag tacccaaatc ccggcgaggc gagcgacgct    145500
     ctctcgggtt ccagctgcgt cccgggcttt cgcttcgggt atgtcgatca ggatcaccga    145560
     gtggtggtgt tcttcgatga cgcacacccg gagaaacctc tgcccgaacg caaggggctg    145620
     ttgcgcgtca ccgcgcgtgt tccgctgccg cagctccagc gctagtccgc ggcgctccat    145680
     cccatagcaa gcccgagagg gcttgcccaa ctgccaacag ttgggcaagc gcttttgatc    145740
     gcgtcaccga cgcatcgagc tttgtctggc atgcccagac catacccatc gcgggacacc    145800
     gtcccgctgg ggttggtgta ccgcactctt tcataggaca ccaacgatga agattcctca    145860
     atcctttacc cgaagccgct gcccgtcgaa cacggccgcc ggcgcaatcc tgcaacgtga    145920
     tgcttcacgc gttctgcgtc gcgtcgccaa tgacctggcg ctgcgtcaac gggaatattc    145980
     gatccgcacg cgtcgccagc gtcgccgcct ggtcgacgtc ttcgcgctgc acaccgacgc    146040
     gctgtacttc gaaatctcgc acgcgccggc ggacccgaag gtgttggtcc gctatcgcac    146100
     ctgcgccggc cgtcacgatc ttggcggcgg ccgcaacaac gccgtctgcc tggagtcgct    146160
     ggcatcgccg gaaggttaca gccagcttct ggccaacctg cgattcgttg ccggccgccg    146220
     tggctaaagc gaggccgcca tgtccaaact catcaaggtc attctgcgct cgaccagcgg    146280
     ggacgagaca tctggaaggg cagccatcca ggctgacacc gatgttgtcg tgttgcccaa    146340
     ccggttggtg cagcagatcg agtcggccaa ggccgcaggc gaggcgtacg tcctcgttgc    146400
     tgccgaggat ggctacgaaa tgccgctcgt gcacgtcgaa gcggcgacgt ttcgcttgaa    146460
     ccgcaagggc cgggcgcgca agtcgttgtg gagcgtggtg cgaagcgcac ttctcgcgcc    146520
     aacgcgcgat cagcgccagc agtacggtcg tttcgctcat acgctgtcgg ccgcggcgct    146580
     gatcggtgct gccagctatt tcagtggcag tcgcgcttgg acgctgggtg ccgtgtccga    146640
     tgtcgctacg ttgatcgccg tcactgttgt actatttgta gtaggcgctg ttttgtccaa    146700
     aggagactga ccatgacgct cggaatgttc gccgctgtcg tcacgacatt gatcgcggca    146760
     tatctgctgt gggccgaccg acgtggtcgt cagctcaaca acgactagcg attgctcgac    146820
     gctggcccag ccagccacac caaatgacgc acccattcgt gggtgcgttt tttttgccgt    146880
     ttcggctttg gccgaagcgg caaaagccct cttaaggagg ctcaaccatg atttcaatcc    146940
     gttcacccga atgccaggcg ttggcataca actgtaagct tgaccccctc ggggcaagcg    147000
     ttctcatgtc gctctcgcgc gtcttgtcgt cggttgaccc gatcggcagc cgggagctgc    147060
     aggagcgtgc cgaatgggcg gcagaacttg caggaatgca ggccatcgat agcgaccgca    147120
     ttccggtctt tgtagccgat ggcggctcgc ttgagatgca ctttcgcgat ggccgccggc    147180
     agggaaagga agatgacgaa tacgccgagc gtcacccacc gaccgtttgg tttggcaggt    147240
     ggcgaatgga ctttgacggt ctgcgcgaaa cacgcgcgag cgttgcgcag tcgccagcag    147300
     gctacctccc ggggctggaa gtctcgtacc aaggcggaga ttgcgacgtg cattacggtg    147360
     aagccgtgcc gacgcttgaa gaggctgttg cagtcgcaaa ggagcgcgag agcaattggc    147420
     accaggctga cgattaaatc tccacctcaa gtcgcaggat ggtcgtcagt cattgacgcc    147480
     gccgcatcac catttcatcc aacaacccac gcggggtgcg tccccgatgg ggcactccgc    147540
     gtacaacaag gagttctcca tgggccatca agtcgtcggt gccggcttgg catcattccc    147600
     agcgggcgtg acgatcgccg tgcagctcta cacggatatg cacgtcgcag ttcatctgca    147660
     cgcggcggac gacggtctgc gctatgcctc gttgtccacc aacatccggc acgctccgct    147720
     cgcagacgac gagtttgcat tttcttcggg gctggtgccg caggatatgt gccaagcact    147780
     gctgcacacg ggcgcgtttg ctgataccgg gcgcgtcatt cgcagcggct atgcgacgtt    147840
     ccccatctgg cgcattgccg acgagcaact gatcggccaa gtcgtcgcga tgcgtgtcga    147900
     cgctgctgcc gcgacaaaga ggcgccgcaa gtcgcactga cgcgcggcct tcaattcctt    147960
     ccatcccacc aggggcaatc gccccggtgg ggcgcgttgc cccagtcctt attggagcaa    148020
     cgttcatgta catcatcacc atcaaccata cgaagaccga gacccgcaca acgatggccg    148080
     gcgtcttggc cctcctgaac gccgacaaat cgattccgcg caaattcacc gcggactcgt    148140
     tcactgtaca taccgtcgaa aatggtccaa tccccgtcgt tggtctgcca cgcggccgaa    148200
     tcgggctgcg tcccgacggc acggtgcacg agatcctctt gcacgtgatc accgaagtcg    148260
     agcggatcat cctgaaaccg gacggcaagc tgctgcggcc ctacgaggtc agctttgaat    148320
     cctgggaagc tgtccttgcc gcaagcgcgc tggcctacga gagcgaatac ctgatcgatc    148380
     ctgaacgcct gaaggagggc tcgcttttct cggagttcca agtcgagagt ccgcagcgct    148440
     tcatcacgga cgagctactt cgccggtttg gcttcggaac aggcgggcca cacgcctatc    148500
     cgggcggagg ggcgtgcaag gggcatgaat ggcacgtcgc ctacgcgcta caacgtggcg    148560
     agcgcgtcaa ggattgcatc ctcaacttct accgtcacac gagcacggcg atccctcacg    148620
     gcttggaatg gctgaacgct ctcattgagt tcccagtgct acgcggcgcg ctgccggcgg    148680
     agacgctgcg ggacctgtgt gatgtgctca gacgcgagaa gatggcgatg accgagcaaa    148740
     acgtgtcgaa gctgctcgcc atcgttcggg ccttgccggt cggtagctcc tatatcgaca    148800
     tcgacgacgc gttctacgac gcgaagatcc tcggcccact cacggcgccg acacttcagc    148860
     tcgcagaggg gcctgacgca gagccgcttt cgccgttggc caagcgcgtg acggagtgcg    148920
     tcaacgagag cgtgtatgag aagacggtgg cgcggcttcg gcaggagcgg gaggacggta    148980
     acctttcgaa gcgccgtttc gagctgcaga tgatgatggc cgagcgccaa cgcaattgca    149040
     gaaactacca ctacggcaac atgattgcct cgctgttgtt ggagcgtaat gtcgctgggc    149100
     tgctcgagat tctggaccag cccaacaaca aatcgagcaa gcgcgccatt cgtgaagtca    149160
     tcggggtcaa cctgctgacg gtaacgggag cagcgcgccg gcgcgccatc ttcagcatgt    149220
     gcgggttcgc ccagcaggag caggacgtgt gggagcagca tgcggccgag gccaaggcgg    149280
     agaagcgccg cattgaggcc atggagcagg caaagaagac tgctgagtcg gtacgctatt    149340
     ccgtcggcgg tgggcaggtc atgaccggca agcagtacgt cgacctgtgc atcgcggaag    149400
     gcttctcgca gattgttcct tcgcggcgcg gcaatgctgt cagctacctc ttcgtcgatc    149460
     cgaagcgcga cctgggcagg ccactgaagg tgaaggacgg caccctggac tatgcacgcg    149520
     cttgcttgag tacaccggca gagcgtgtgc cggcgtacgc ctgacgccaa tctctttcac    149580
     gcgccagtcc ctgcccctcc atcacggggg cagggcggcc gtttctaccc ccttgcgcgt    149640
     gtggcgccgc gccgcgcaac ctgctaacct ctccttgctg aaaagcgctg ttcggactgg    149700
     cctgagccaa cccaaacact gtttttcctc gcgtctccga cgcatcgatc caacgccggc    149760
     agcatcggcc gtttcttcaa ccatcccaca ggggtctact ccctgtgggc gtggattccg    149820
     tgggttttcg tcaagtgata ccccatggac aataccctta ccgatcaagt tacgcccctc    149880
     accaatcagg tttccccgtc gcaactggag accctgttgg ctgcctacat tccggcacac    149940
     ctgcccgtgc tcgtgactgg cgcgccaggt gtcgggaaat ccgacatcgc agccgcggct    150000
     gcagagcgcg ccggctacga cctgctgatc tcgcatccgg tggtcgagga cccgacagac    150060
     tccaagggcc tgccgttccc cggcgcggat ggccaatccg ccaggttcct gccgttcggg    150120
     gatctggaga gggtgttaca cgcgaaagag ccgttggtct ggttcttcga cgacctcggt    150180
     caagcgtctc aggcggttca agccgccaag atgcaactgc tgctcgcgcg ccgcatcggc    150240
     gagcacaagc ttcccgagca tgtgacgttc ttggcggcga cgaatcgccg gaccgacaac    150300
     gccggcgtgt ctggcattct cgatccggtg aagtcgcggt ttgcgaccat cgtcgagctt    150360
     gtgccaaacg ttgatgcctg ggcggcatgg gctgtgaagt cgcagcttcc cgctgaactg    150420
     atcgcgttcc tgcgcttcaa gccggatctg ctggtggcga aggagcgcac gcgtgatatc    150480
     gagaacctgc cgtcgccgcg aggctggggc gcggttggga agcagatgcc cgtggtgcca    150540
     gctggcttgg aagcaatcgt gttcaccggt gctgtcggcg ctggtgccgc gaccgagttc    150600
     caggcgtttc gcgagacctt tcgcagtctc ccctctgtgg caagcgttct gtttgcgccg    150660
     gacactgcct ccatcccgga ggagccctcg gcgcgcatcg ggattgcgac ggcagttgcg    150720
     agtcaaacca cggtcgcgaa catcgatcgc gtcctcgtct acgccgaccg catgcaagcg    150780
     ggcggtgacg gtgactgcgc aacgatgatg atcagcgacg cgatccgccg tgacgagtct    150840
     atcgtttccg tgccggcttt cattgcagcg caatccggct ggatcggtgc cgcgatggac    150900
     ggccggtaaa ccggttccct ttcaagcagt acatcccatg cggcgagctt tggctcgccg    150960
     cttttcattt caagaggcta tttccatgaa catcctcaac gttcacgagc gtgtcatgct    151020
     cgcatccctt ggcatctccg tttggcgcgc acgtcgcttc gatacccgcg ccacggaaga    151080
     ggtggaaaag aaccacgcca ccaaagacat cgggcgcttc aacaagaagc tcctgaccga    151140
     cgatgccatt tcttacaaga gcgtgtgcag catcgccacg caagcacgtg ccttcttcaa    151200
     tgcgcacacc ctcgaatacg accagcttgg cgtgcgtttg ctgcccacgg ctgtttacct    151260
     aaaggtcgct gaccggctgc gcgagtttca agacgagttc cgtgaagcca cgtcagcctt    151320
     tctcgccgaa tacccagcgt tgaaggagca ggccaagggt gctctcaacg ggctctatac    151380
     cgaggcggac tacccgaccc tcgaagcgct gtcgaccaag ttcggtatac gcctgtctcc    151440
     cttgccgttt ccggacgcaa gccagttcgg catcaacttg ccggccaacg tgctggacgg    151500
     catcaaggcg gatatggacg agcgggtgtt cagcgcggtc aagacggcca acgaagacat    151560
     cgtcggccgc ctctacgacg ctgtgcagca cttcgccaac cgtctgtacg cgggacgcaa    151620
     cgtccggctg ggcgttgtcg acaaggtgcg cgaactgtgt gacctgcttc cgacgttgaa    151680
     cttcacacag gatccggcat tgacggacat cctgaacgag acgcgcaatc acctggcttg    151740
     ctacacgggc gccgaattga aggattcggc cgatcttcgc cagaaggtgg cggagaaggc    151800
     gatggagatc gaggcgcaga tggcggtgta catgaccggc gcgctcagca cgccggcagc    151860
     accggcactt ggcgattcgt ctgcgctcag tttcctcctt gcctcgtgag gtgtggccat    151920
     gctcgaacgg atcatcaagc agcgtggtca actggtgctg aaccaccctt tcttcggggc    151980
     gctggcgctt cgtctgaagc ctgtcgaaga ccccacgtgc cacacgttct gggttgacgg    152040
     ccgggcgctt ggctacaacg cgcagttcgt ggccaccttg gacgatcttg aactgcgtgg    152100
     gtgtctcgct catgaggtgc tgcaccccgc cagcgggcat tgctggcggc gtggcaatcg    152160
     cgatcagaag ctgtggaacg cggcctgtga ctatgcggtc aatccggttg tgctcgctgc    152220
     caacttgaag ctcccgaaag gcgcactgct ggaggaacgc ttcactggca agtcagcaga    152280
     ggagatttat gcggtgctcc gccaggaacg gccacctgag gctccccaag agcctcaggc    152340
     ccagggcgct cgcggtacgg gcgctgggct gccatcgcgc gacccgaacg catccgatgc    152400
     ggcacaaggg cagggcgctg ccgaaggtgg caacgccgac ggcagcccga cgtatgagcc    152460
     cggcgacatc cgcaaggatc gcggcaatga ccaggcctcg acggagacgc agtggaaagt    152520
     cgcggcgatg aaggctgcgc aggtggccaa gatgcgcggc aagttcggtg cggatctgca    152580
     gaccgtggtt gaccaactgg ttacgccggc ggtcgattgg cgtgcggccc tcgcgcgctt    152640
     tgcaagcgag tcggcccaag ccgactacag ctggtcgata ccgaaccgcc gcttcacgca    152700
     ccttggtctc tatttgccgg cgcttcatag ccggcgggtg ggggacgccg tgtttgtgcg    152760
     cgattcgagt ggctcggtgt tcgatgaaac gcaacgccag ttcgcatccg agatccaccg    152820
     cgttttcgat gaagtgaagc catcgcggct gatcgtcatc gactgtgacg cgcgtgtcac    152880
     gcaggtgcag gtgttcgagc ccggtgatgc gcttgaactg gcgcctgtga aaggcggcgg    152940
     cggtacctgc ttcgcaccgc cgttcgagtg ggtggaggaa cagggctttc ggccggcgtt    153000
     tctcgcctat ctgacggaca tgtatggcac gttccccgaa gtgccgccgg agtatccggt    153060
     gctgtgggcc tcaaccacac cgttgcgcag aatccatacc ccgccattcg gcgattgcat    153120
     cgaggtcatc gtctgaccat tgccccgggc catcccgggg catttctttg ctccggcatc    153180
     ggttggtggg tgttccgccc aatttgaccg cgtgccgaaa tcgatcaaaa tttttgtggc    153240
     actcgacata tctagtcctg tgcccggagg agcaacatca tgatggacaa agaagagccg    153300
     atcgacatcg agtctcttcc tcgcgcggcc gacctcgggt ggattggccg ctggaaacag    153360
     gctgtagaag agggtggtac ggatctcggg tttgacgact ggttcgaatc cgcactgatc    153420
     ggcgcggccg gtggccgcga tggccagccg gtgcagtatc gacagggatc agtgatcttc    153480
     gaactgcagc acggcgcgga tttcgagatc gagcagggcg gcagcgcgaa gcggcgcttc    153540
     cactgcctca tggatggaca cgtaccgttt gtgtccttct atggtgatgg cgacgcagag    153600
     cgccggccct ggatctcgat cagccggctg ttcacggctg aagagttgca cacgctcatc    153660
     ctggtgcccg gaccagcggc ctgatttgcg ctaggcatgg cgaaagggct gatgcgcgaa    153720
     gcggctttct gtggatttat cctgaacgcg gtaaacgcgt gtgtcagaac ccacccgatg    153780
     gtgggggtgc aaaccaaggg ggccaagtgc cccctttttc tttttctatc ctgaagagca    153840
     agtgcggcag cgcccgcctc aaaggtactc acgccctcga gggccatagg gtttggggtc    153900
     aggggaaccc aatacgtcaa gaacttcact gtagtgcgtg acgaccatgg gtgcaccggc    153960
     aggaccatac ggtagcggca tccagtcgtt gcgttcacgg ctgaattgca gcaagtacat    154020
     gccgccggcg gcattcggta gcaactgcac cacccagacc aggtactcct tatagggtgt    154080
     ttcaggcggg gaaggcttgc gttcacgaca atcaatccag tcgatcaagg tgctcacggg    154140
     ttccacggcg tctccaatga tttgttcaac acgatattcc gactggccct gttttccgag    154200
     caaaaaacga tgcacggagc gatgtacggt gtgtcttgta ggacgagtcc atccggcgcc    154260
     aggttgctac ccggccttga gcaggcgtcg atcgcgctgc ccgcccgctt ggcatgtgag    154320
     cacataggcc gctggcgcgc gcggttccca gacgatcacc gcagcgggtc cttccgtgct    154380
     gatgcgtgcc tcgggcatgg tgcaactcac cggaatcgga ttcacaggcg tcccgtgcgc    154440
     agtcacgcgg atcgtagacc cgcgaccggt catgaaattg ccctgcaggc cggcatacag    154500
     gaacgtgaca gtgggtacga gcgggggttc gagaccagat tggtcatcag cctcgtcgtc    154560
     ggcgagcgcg tcgatcttgg cctgcagcca gtggcggtca ctgtcggaga gatcgtggcg    154620
     gctgagcagc gccaccagga acgcggtgcc aagccatccc gggccgctgc tttcacgctc    154680
     gcggataacc tgcgccaaat gagcggaggg ctgtgcgcca ccttccagca gactgcggcg    154740
     tgtgccgcgc gcccgcgcgc ctggcgtgct agtctgcgca aggctgttgg tcgctggtcg    154800
     gtaggtgccg ggcttgctgg cgccggcaga ccgcgaaatg cctccggcac tacgacttgc    154860
     tgtcgagcta ccgccagcgc caccgcggcc ggcgtctgcg acctgtgccg cgctcaaaag    154920
     cacgagggca acggtcaggg tcgagatctt gcgcatggtg gttcccctag cgcccagcga    154980
     gagacagcac ggtggggtcg agtgccgcct gttcggcctg ccggatcgcc gccgtggata    155040
     ggcggctgcg tagcgattcc gcgttgaccg ggcggtagcc gtcatcagga tggcactcgg    155100
     ctcggcagcg taacgcccaa aggtaggcgt tgttcaggtc atgcaacgaa tcgtagagct    155160
     gcgcgttgtt cgccgctgcg gtcgggtcgc ccgccaacca ggcgcgcgcg aacaactctg    155220
     ccgccttgtc ggagctacga atcacgtatt ttccatcgcg cacgatctgg ccagcaacac    155280
     gcaggagccg actattgact gcggtacccg tggaagcctg ggccgccgcg agaatgcggg    155340
     gcgccatgtc gtcgcgtagg ggcagcatcg agtcgccctc gaagtattcc gccagctttg    155400
     ccggcgtgag ccggtccatc gcttgcttga tccgcgccgt gcgtgcgtcg tccaggttgg    155460
     ccatggcttg cacaatatcg ccacagacga cttcgcaacc agtcagggca tctcgaccac    155520
     taccctgcag cggatcgagc ttggccagag cagaaaccgg gtcggagatg gtcttggttg    155580
     tctcgatctc ccggttgatc tgcttggctg tatcggttgt cttgtcgctg caggcggcca    155640
     agccaaggca gagtgcggcg accggaatga gggcggcgta tctggatgca aggtgcatga    155700
     tcgacctgtc agttgggttt gttggtgcgg ctggtcagac agccaaagag ctggaagcgc    155760
     ggcatctcgt gtcgatccat cacgccgtcg gtgattttca tggtgtttgc gtcgtgtcga    155820
     tttcgcattg ccgccatgct gtggcgagag gccagcgtca ggtactcgat tcgagcgcat    155880
     cttcgacagg aggcgcgggc gccgccgctg aaaggcgcgg aatgcgcgtg atgcgaccct    155940
     ccaggttggc gtgcgggccg agccgaatcg tgccggcgta gcggatctcg cctttgaccg    156000
     caccttccac cttgagagag acctgggcat tgacgtcgcc ttcgactgcg ccctggatca    156060
     atacgaactg cccggtgacc gaccccttga tgacggcggc cgggccgatg tggagaaggc    156120
     cgcctgacga gacgacgttg ccattgacga gacccaggat ggagccgcca tggtccatgt    156180
     cgacattgcc gtgaatcgcc atgccctcgt tgatgatgct gatttccatc tgctctttca    156240
     tggtttgctc ctcagaacat cttcacgtcg ccggacggac gattcgcttc cgtggtgcgt    156300
     gccggtggtg tagcggcgcg cggtgccgtg gcggttggtt ggggtgccgg cgcgggccgc    156360
     gtaacagggg cttgatcggg tgcggtgcgc tcggtacgcc gagcagcggg ctgagccggg    156420
     gctgtttcga ccttctccgg cgcaggaacg cgctcgcggg gcgccacctc ggctgcggaa    156480
     agggcggctc gctgtggttg agccaccggt gcagtgggcg cggccgtgac agatgctgca    156540
     accggcgctg agggcgtcga gcttccgatg gctgccggcg tggcttggtt tgcggcgact    156600
     gcaggttccg gcgccgaggc aggggcggcc ggcgcttgcg tctgtactgc gtgcgtgact    156660
     tgctcgggcc cggccgctgc cgccgaaccc gcccggccct tcttggcgta caggtcccca    156720
     agccccaggc cagcaatcgt ggccagcacg atgaacgcgc agcagatcgc agtaaccttc    156780
     aaggcaggct tgtgctggtc ccaccggcgc ttgccgccgg cggcgtaggt aagggccggt    156840
     gcggccgcat gatcttccgc cgtgcccatg tcgatcgtga caggggagtg cgagtactgc    156900
     tggtgcaatc ggtagatttc gcgaatatcc atggctctct ccagcggttg gggtgagggg    156960
     ggcgcctgag aggtcgttta ttcggtccgc gatgccttcg cgcgggacga caatcccctc    157020
     tggccttcgt accggccact gtttcgggcg ccgtgttggc tgctaggtcg gatatggcgc    157080
     catgccggct gccatcccga tgggtgcgtt gggtggtgtg gttggctatc ccgcaggggt    157140
     gtcgccgtct tgtgcgccgt cagcagcgaa acggtcgttg tcggggatgc agctctggtg    157200
     gattgaagcg atcttgctgc cggccacttt catcgtgccc tcgaattcga gcgccgatat    157260
     ggagttggcg acgcgggcga agatggcgag cgcgaacagc ctgtcgtgct ggttcaggag    157320
     gcgaatgagg cgcccagaca gcggatgtgt gacctggacc tcaacggtat cggtctcgat    157380
     ggggatgggg gtttggcttt tgttcgcgtg ccacgcgatg gctttttcga accaaagctc    157440
     ggcttcgcgg aatttttcgt cgagcgctcg ggtcttgcct gacctggcga ctgagaactt    157500
     ggaagagcag aagttgtacg cggagcgcag gaaatcgcga acgtacacag aggaataggt    157560
     gacttgagca ctggcggccg tctcggggac gatccgctta atcctgtttt ctccgaccag    157620
     ccgcgcgatc ggcttgagtc cggagttgga tgtactcggc tgtggcgcgc ctaatggcgc    157680
     ctcaagttcc tgggggtgtt gggcagcgac catggttcat gtgtggtatc tcatctctca    157740
     ctcgaaattt tccggcacgt gaacacggtg gctgcttaca aaagccacgc tattttggcg    157800
     agctttccgg gattcctaat ggattgtctg gtgcatactg caatcactcc tcgcgtcatc    157860
     gacgcatcga actgactccc tagcgagtcc atctccttaa aaaagtcgtg ccttgcgcat    157920
     gcgccgacca gttggcaact ggtgtggaaa tccccccttg tgatgagtgc ttagccagac    157980
     actccccatc tatcagccgt aatacgcgtt cccgtgtgta tgaccctagg tcatgcctgt    158040
     gaacaccgtc tgagccccgg aaatgtgtgg tctctctctc cagcgcctcc gggtgcagga    158100
     cggttgtcgt cgactgatcc gtgaacctgc ggtggacgaa agtcctaaat gggttgttgt    158160
     gcggcgtgaa catgctgcac gagaacgact ttacgttctc ccccctgagc gaagtgcatt    158220
     ggcacgacgc tccctgtgag ccacgccccc gaaaggggcg tggcagcagg tttctcacaa    158280
     gaagcccgct tccggttacc ggagcgggct ttttttgctt ttaagtgaga gaccccacac    158340
     ggaggagctg accatggcac tcgaaatgac gttgcaatcc cagatcaagg cgcagatcgc    158400
     cgaactgatc cacgcccgtc gaccgaagta caaggaccag ccgtacagct ggaaaaattt    158460
     ttgcgaggcg gcgcacgttg ccagcctttc cgacgccgcg cgagcggcat atctcaacga    158520
     agtaacgacc caacgcgggg ccgacgccgc cctgcatctt ggggaccgtg ctgagaccct    158580
     tcgttccaaa gtcgttcagt acctgaacaa caggagcgtt tcatgcacgc aatcccaacc    158640
     cacccaggct tcgcgacccc gcgcagcata attgaggagc ggcccctgcg gccgcccgtc    158700
     attggaaaga tccgccctgg catcaaggtc ctcaccaaga aggccaggga gaatccccaa    158760
     gccgtccaga ttcacgacgc gcttctcgcc caagggctct cgttcgagga catcggttcc    158820
     gagatcgaac gaaaaaccgg cctgagctac gccctcatcc cccgcaatac gccgtacttc    158880
     acgtgtcgtg gcagtgattt cacgaatcct gccatcgcgg aagagatcct gacccgatac    158940
     ggggaggatc gcggtgacgg cctcaagctc tggcgctttc cggtcgtctt tgcgttcgac    159000
     gactggttgc gcaacatccc caacgagctg gcggtattca acggcacggg aaaggtgttc    159060
     tggtcgcagt acggggcgga tggtcttcgt caatgcaaga cgtacgcacc tgtcgagcgc    159120
     agtgaccgcg ccaggcgtgc aaagcgcatc ttcggcggcc gcaccatcat cctgcgccag    159180
     gacgacgcca ttcccgatgg cgtatgcgac ccgcaggtct gcccgcaata ccaggaccga    159240
     cactgcaacc tcacggccag cttcctattt gcgatccttg acattcgagg ccttggcttg    159300
     attgagttgc ccaccaattc gatctacgtc ctgcagaagg cccatgcggc catgcagact    159360
     gtggcgattg cgcgcggcgg ccgtctggtc ggcaccaggt tctggctctc caagcaggaa    159420
     gtggagattt cccgcatcga cgataacggc ttgccggtac gccagaaaca atggctcacc    159480
     acgctggatg ccgaaatcga cctgggcgcg ctgctggatg gcgctgacca tattggtgct    159540
     gcgatcgagg tgggtacgca gacggttgcc ctgctggagc accccacgac cgagccggcc    159600
     gccactgcca cgccaacgtc aggcgaggag ggtggtcagc caggagcgca gagcgagccg    159660
     cctgtcggcg gctctatcgc cgagcagttt gaacgtctca tcgtggcgct gggcatggag    159720
     gggcaggaaa cgcgcgagca tttgcgcgtg tacgcacact ccaagtttgg caagggctgg    159780
     accaagcgcg agcaggacat gcgagcgctg atcgatgaga tgggtgtggc tctcgtgtct    159840
     cctcccgcct tccgcgagaa ggtgaaagcg gagttcgatg gcagtctgtt ctcagcttga    159900
     cctgcgccgg cttggcgcct ggtcgtagca tcaacgtgcg gcgtcgagag ttcccccgac    159960
     gccgtttttc ttttctgttg ctgtgaccgt tctggttgcg gctattccat aggaggtgag    160020
     catgcccaac gatggcgaaa gccttcacgt gggtcatttt tccgacctgc actattcgac    160080
     tgagcggttg gtggaagcgg accgatgctt cggtttcgcc gtggaagatg cggtcgcgcg    160140
     tggttgccat gtgggtatcg tttccggtga cgcaaccgat catcggctcg acgcgcacac    160200
     gccggcactg cgggtgcttg ccgagcgcat tcatgcgctg tcgggccaca tgccggtcct    160260
     catgctgcag gggaccttct cgcatgagcc gccgggcacg ctggacctgt tccggctgat    160320
     cggtagccgc caccccgtct acgtcgccga tcgcattcac caggttgcgc tcgtcggatc    160380
     gacgttcctg ccatcggccg gcccgctgtt caccgtcgaa gagctggaaa cgctgctgca    160440
     ggagggcaca ccctctgctg tgttcacctg cgttccgacc gtcaacaagg ctgtgctggc    160500
     gggcatcgtg ggcgccatgg atgcggcaac cgcggtgggc gagcatctga cggtattcct    160560
     gggtgccgcc ggcaaggtga atcggctgtt gcggtccaaa ggcatccgaa ccatcggtgt    160620
     gtcgcatgga acggtcaatg gctgctacac cgagcacggc gtaccgatgg ccgggttcga    160680
     ccatgagttc tcgctcggcg cgctgttcga agccgagtgc gatgccttca tgctgggaca    160740
     tatccatgcg atgcagttgt gggaacgcga aggccggctg gtcggttacg ccggttccat    160800
     cgggtgcttc cactacggcg aaaagggcaa gaagggctac ctgagctggc agatcaagcc    160860
     gggccgggcc gaagcggtgc aggtggaaac gccggcgcgc gaaacggtct gtgtcgattt    160920
     cgacggcccg ccggatatgg agcgcctggc caacatcgcc gagcaaacgc aggacaagtt    160980
     cgtgcgcgtt cgctggacca ttgacgagga gcatcgccag ctggtcgacc gcgaggccat    161040
     ccgcacgctg ttcgccggcg ccgcggagct gaagctggat ccgcgtgtgt tgcctgccgt    161100
     cagaagccgt gcggagggca tcagccgcgc ggcgactctc ggtgagaagg ttcagcgttg    161160
     gtgcggtttg accgacgtga agccggacgc gttgctggag cgcctgtcca tcctggaggc    161220
     actggagccg caagacatcg cggatcgagt ggtcgcctcg ttggagagcg ggtctgctgc    161280
     cgacaacggt gaaacggtgg cgtccgccac ggctgagccg gtgacagttc agccggcctg    161340
     gcaggacgct gaccaagttc agaaccaatc gtcgttggat tggctgaccg atgacctttt    161400
     cgcggcagat gccgcccaac ccttgaacgt gtgagccacg ttccgacagc cttcggggct    161460
     gtcgaaactc ggttttcccc gcgtctacga cgcatcgacc agcagtacct attcctttga    161520
     acccggacgg gcgcacaacc cgttggggat gcgcttcgcc caatttttgg agtgcatcat    161580
     gattctctat cccgcaggtt cccagtggac ccgttgcttt gaagccgatc tgccggcctc    161640
     cgagttggcc gcgcggttgg tgggcaagca cgaattcact cgtgcgatgc tgttccagcc    161700
     gttcggtcat ggtcgtggcg cggtgatcgc cacgcgcggc cacatgctcg tcatggctgt    161760
     cgaaacggac ggtgagcgca cggtttttac cgtggcgccc acggtccagg tgcagaacct    161820
     tctgtggtcc ctctccaacg gctacaccag ccagtggagt gaggctgaac tcaaggcctt    161880
     gaccgcatgc accacctttc cggaggtgct tgacctggca cggacgcaat ttttcgcggc    161940
     cgtgcgttcg ttcgagcgcg cactagccgg caagccggaa gtcgacgtcg tcgtcacgta    162000
     tgacgactcg cgtgaggtgc tggagatccc cggcgactac tacatgactg gcttcagcgg    162060
     tgagggggca ccatgcgacc tctcaaactg accctgtctg gctttcgcgg catcctggat    162120
     gggatgcacc gcgacagtgt gacggtcgac ctgcgcgagc tgccgaccgg actgatcgcc    162180
     gtgatgggcc ctaacggtgc cggcaaaacg acgatcatgg acaacctgca tccgtatccg    162240
     ctgatgccta gccatgcatc gaagatgtcg gccgatgcgt tttcgtactg ggaccacctc    162300
     acgggtaccc gggccgaaaa ggatttggaa tgggagcacg atggccagca ataccggtca    162360
     cagttcgcgt ttcgtaattc tggcaagacg cgcaaggccg agtactacct gtttgtgctt    162420
     ggctcggacg gcgtatggca accggttcaa ctggcagacg gatcgctgtc tgacggtaag    162480
     gcggagacgt acaaccgctg tgtggaatcg gtcctcggat catcggaggc gttcttcacc    162540
     agtgtcttct ctgcccagaa ccgacggccg attgctggct accagacctc tgaaatcaag    162600
     aagttgcttg ctgagctgct tggtctggag cggatgcgtg agctgtcggg caaggctatg    162660
     gacgtggcga agtgcctcgg ccgtgctttg gatgtcgttc agcacaacat caccagcctg    162720
     gttggtcggc gcgatcgtgt tgcacgactc tccttggaga tcgagcaggc ggaggcctcg    162780
     ttggttgaga cccgccaggc gcgtgatcgt gagctggagg ccaatgcgca gatggttcag    162840
     gagcgtgcga cgcttgcagc caagcaggcg agcagcaccg tagcagaagc gcgcatgcgt    162900
     gagcttggcc aacagaaggt ggcccaggaa gcaaggcgcc gaacgcttga caacgacgaa    162960
     cgggctgccg tgcaacgtac cgaggcgcaa gccaaggaac tgggggccgt catttcaagc    163020
     cgccgcgcaa tcctggccag cagcaccgcc atcctggcgg ccgcaacctc gcgtgatgct    163080
     ttgcaattga ccgtcacgca gcgacagtcg gaggcaattc ggctgcaaga ggggattgct    163140
     cagctcgaaa aggttgtgcc tgaccaatcg cgcatcatcg gcgaattgca aaacatggcc    163200
     ggtcaaggtg aatcgaaggc tgtccttgaa aagtcgctga agggccaggc cgacgtcatt    163260
     gagtctgttc cgtgccggga caatccgatg cactcgacgt gcccattgct ggctcaggcg    163320
     cgcagggcga gcacggatct cacggaagtg cggatctcgt tggcagagct tcgaaccggc    163380
     taccgggaca agctcaagct caagacggcg ctcgatgagc agctcgcgcc gttggcgggc    163440
     caacgtgctt cacttcgagc actgcagggg caggtggcgg ccgaccaacg ggagttgcaa    163500
     cggctgaccg aacttgctgc gcagaagcca ttgcttgacg acgcccaaga gacgctggcg    163560
     aaggccgagc gtgatctggt cgagctgaac gccgaagctg ccgcccgaaa ggagcgatac    163620
     cagcgcgacg ttgttgcgac ggacgatcag ttggccacga tcaaccggga ggttacgtca    163680
     ctgcaaagtg ccgacgttac cggaaagatc gcggactttg atcgtcaggt tgccagctcg    163740
     cgcgagcgca ttgcccagtt cgaaggccgg attgaagcac tgatccggac tcagactgcg    163800
     ctcagcaccg agcggcaggg cctcctggtt gatctggagg cactacccgt tgtgcagcgt    163860
     aaggcagagc ggatctccga cgagatttcg tcgtggaagc tgctcggcaa ggccttgggc    163920
     aatgacggtg tgattgcgct gtcgatcgac gatgcaggcc ctgaaatcac gaagaaggtc    163980
     aacgacctgc tcctggcgtg ctatggaccc cgattcacaa tcggtatcca cacgcaaacg    164040
     gagctggcca acggcgataa gcgtgagggg tttgagattc gtgtccacga cgctcaggct    164100
     gacagcgaga aggagttcgc ggtcatgtcc ggcgggcaga aggtgtggat caacgaatgc    164160
     ctgacgcgtg gtattgcgct atatcgcgcg cagggcgccg gcaccgcctt ccagacgttg    164220
     ttcacggacg aggcggatgg cccgcttgat ccggagcgca agcgcgagtt catgaaaatg    164280
     aagcgcgagg tgttgcgcca gggagggtat gagcgggagt tcttcatctc gcaaacaccc    164340
     gatctggtcg acgaggccga tgctgtcatc gatgtggtcg cactggccac tcagtaggtt    164400
     ccaccaacca tattggtccg ctctcaccag aggcggacca tttttttttt gagatatcga    164460
     aatgactacg attcaaatct cagccgtcga tgctgaacgg cttctcccac agaaaaaaag    164520
     aagtgcacac gttcattcgc agtctgggct ggatgggggc agacgtgacg cgcgagaagg    164580
     cgctcgcagc cttcaaggcc tcggtccgcg ttgatctgtc ggatgaagcg gacatgtttg    164640
     atcaccaact ggtcgtcgcg atggatggcc tgcgcacgtt cgtcgaaacc gatcagcagg    164700
     cgctggccac gttgtttccg cagtttgcgg ggtaattgtc cttttcgtgc attttcttac    164760
     ggtttccccg cagagccttt attcataagg gccccaggtc tctgccgaca attgtctgct    164820
     gccctccagt gacttcggga gtacgatatt cgcccgcgat ttcggatcgc gccaccttga    164880
     cgggggcaca agatgccggg cttggaattt cgctatgtgg gaagagactc cctacccacg    164940
     cgtctgccgg agttcgacgt cgagcattac ttcgcgttga ccgctagcga tgtcgccgcg    165000
     atcaaccaga agttccgacg cgccagccgc cctggagtcg ccattcagtt ggtctttctg    165060
     cgcgccagcg gccgtacgct ggaccaactc aacacactcc cccgtcagtt gctgcgctat    165120
     atcggcgaaa aactcgccgt cgagacacca acgatcgcct cgctgcgcac catttaccag    165180
     cgatacccga cgctgtatga gcatcaggtc tgggccctcc aatatctggg cctgacacgc    165240
     ctcgatgacg agcaatgggc cggactcgaa gcctggatgc gtcaggacgc cgccgaatcg    165300
     ctgaccgttg aggaactgct tcagcacgcg cactactggt tgtacgaacg gcgcattctg    165360
     atcccgtcga cgcgtgcgct gcaggatctg gcccgctcca tctgggcggg catcgagcgg    165420
     gatctgctgg ccatgatcga cgtggtggtc tcgcgcgagc agatcctgcg ggccgaggct    165480
     gcggtgtttg cccagcacgc cacatcgggc acgacggtgc tggaatggct caagacccca    165540
     cccgcgcgcc acagcccgtc aacgatgacc gagatgctgg ccaagatcag cttcttgaag    165600
     gacctcggcg cgcatacctg gacatttgac gcggtcccca tcgagaaaca gcgggcctac    165660
     ggccaacgta tccaggcccg ccgtcccgcc aaaatccgcg aactcaaagc gtcgacgcgc    165720
     acgctcgaac tggtgttctt cctgcgtgtc accttgctgg agttgactga cgccatggtg    165780
     taccaaagcg ggcgccgtat ctcagacctg gtccggcagg cgtacaacaa gaccacgacg    165840
     aagcaagccc gctcggcgat cgaataccgg cagcaactgg tggagatcaa ggccctggtg    165900
     gacgataccc gccgctcggc cgaggaccga ctggccgaca tcggcaagct gcttaagggt    165960
     ctgtccagtc ggccgccggc aagtcacgcc gcaagcgtgc gcgaaaccct taccgaagac    166020
     caccaccgac tccgcaacct cctgacaccc ttgcgggcgt tggaattcgc cagtcacggt    166080
     aacgatcctg ccatgcgcca actcgatctc gttggcggtt tgcacgatcg gggcatgacg    166140
     gagttgccgc cagactgcaa tgtgccagtg agcgccagtt ggcgcgacct ggtcgacggt    166200
     gaggaccgcc agcgcgcgct gcgtgccttg gaggcctctg ctgtaatgag tttgcgcaag    166260
     gggctgcgcc gcggcacggt gtggatcaac catagcctgt cgtttcgaga acgagaccag    166320
     ttgctgattc cgccggcaca gtgggaggtc gaccgcgacc ggcatctgtc ttcgctcggc    166380
     ctgccaagcc aagcgaggct ctatcttgat cgcctgaccg agcatttgaa ggcgggtctc    166440
     gctgcgctgg acgaggcccg tgaggctggc cactttacga tcgacgcgga cggcatcctg    166500
     catttgtcgc cattggaagc gcagaccacg gataccacgc ctcaacgcac ccgagatctg    166560
     ctgttcaagg acatcggcag cgcacagttt gccgacatga ttctggagat ggatgcgcgc    166620
     accaatttca gtgaagtgct gttggcgcgc aaggcgcggg atgcccacga actcgtctcc    166680
     ctttatgcag ccctgatcgc gcacggcacc gaactggatg ccaagggcgt cgcggcgatg    166740
     atcccgcagt tggacctcgc gcacgtctcc accgcgatgc gctccctgga aatgcccggc    166800
     cggctgcgcc gcgccaacga acgtgtggtg gagttccagc gcacgcaccc gatcaccgat    166860
     ctatggggca ccggccaact cgcctccagc gactccatga gcctggacac gtccccacat    166920
     ctgttctacg cgcgcgctga tccccgccga cgcacgcacg ccgctggcgt ctatacgcac    166980
     gtgctggatc agcatgggat cgtctacaac cagccgatgg tgctcaacga gcgccaaact    167040
     ggcgcggcga tcgaaggcgt catgcgtcac aacgaaaccc gcgctgacgg tgggctgctg    167100
     cggctcgccg tcgacaccca tggctacacg aacgtgggga tggcggtggc caagctactt    167160
     ggctttgacc tctgtccctg gctgcgcaac ctgtcggagc gcaagctgta cctgccgcgt    167220
     gccctgtcgg tgacggaggg attgtcggct gccgtgtcgc acgaggtctc cctcaaggcg    167280
     atccgcgacg gctgggatgg cttgctacgc ctggtggcgt ccattcacgc ggggcgcgtg    167340
     agcgcgatcg ttgcgctgca acgcttcggc agtgctgccc agggtgaccc gatccaccgg    167400
     gcagcggatc acctgggcaa gctgctgcgc acgctgttcc tatgcgactt tttcagcaac    167460
     atcgagtttc gtcgcgagtt gcgcacgctc ctcaatcggg gtgaatccgt gcaccatctc    167520
     cagcgggcga tttatatgag taaggtccaa cacgagcgcg gtcgccgcca ggacgagatg    167580
     atcgcgattt ccggggcgct ctcgctgctg accaatctgg tgattgcctg gaataccgag    167640
     cggatgcaaa cgacggtgga tacgtggcag cgcaaggggc aacggatcga cgatgactgg    167700
     ctgcgccgca tggggccggc acacttcgcc catgtgaatt tccggggcgt tttgagcttc    167760
     aagatccacc aatttcagga tgccctgttg gaggcggcac ctcgccggcg tgcgagccaa    167820
     gcatgaagtc ctgcttggca cgggtcggcc gcaatcgcgt ttattagagg ttcatgcaag    167880
     gttactgcgt caaagcaatg gcagaggtcc gccagaccgg acctgtcaga ctgcaatgcc    167940
     cggccggggt gcgaccgaca gcgctgtttc gatccgatgc tgggcaaatg ggtcggccgc    168000
     gtcgatatag cgcatggccg agcgtacgtc cttccagccg acgtattcca tcagcatctt    168060
     gagatcccac tggttcgagt tcgcccaggt tgcaaagccc cgtcgtagtg agtggctgct    168120
     gtagcggtcc gattgcggca gtcctgcgcg atggagcagc gcgcgcaaca aaggcacgat    168180
     gctgctggcc tgcagtccat cggctgcgat tcggctccag cggtcaatcc tgcggaacgc    168240
     ggggccctcg gtcaggccgg acgccgccaa ccaggcctcg taggcggcga ctgggcacaa    168300
     gcgcgacaac gcgggcgcct tgtgggtcgt accgacatgg ttgcggtccg tcttggtgcg    168360
     cggcaggaaa atcgtcatgc cccggccggg ctccaccgtg atgtgctcga tctgcagccg    168420
     actcagttcg tccgaccgga agccccgcca gaagccgatc agcaccagcg ccttgttgcg    168480
     ggtatgcacc tggagttgat gggcgttgcc ctcagacgag gcggtcgcga tctgcgcatc    168540
     cagcgaggca accagttgct ccaactgggc gagctgcaat ggcttggcgc gccgctcctg    168600
     cgcggggtgc agtgcctgga tgcccttgag caccttgcgg acgtgcggtg ctcgcgtggg    168660
     gtcgggaaag ccctgcgaaa cgtgccactg cgcgatcgca gccaaccgtt ggcgcagcgt    168720
     gttgatggaa agcgtctgtg cgtgctcagc cagatagcgt gcaacgctgt cggcgctggc    168780
     cggcaggaag ccaccccact cttgctcgaa atgacggatg gcggactgat agctgcgccg    168840
     tgtgtgatcg cgggtcgctg cctgcagata cctgtcgata tccgccattg aactctcaaa    168900
     tcaaggtagc gactacgctt tgctcgatgc cttctgcgat cggaggttat acgcgaagct    168960
     gagcacaatg atcagcaaga tcgccacctg tgcgatcacc gtctgcatgg acgggtaaat    169020
     ccccagcacg tcaatacgcg gcatcgaaat cggcgtgatg tgcagaaaac caaccttctg    169080
     caacgccgca acgcccttgc cgatcagcac cactgccagg accgcgacca gagccgagct    169140
     gaaggcaaag aactggcgga tcggcaggcg cgccgaggag cgcagcagca cgacggcgat    169200
     gatcgccagg atcgcaatcc cggagcccaa gccggccagc aggtagatgc cgttcccttc    169260
     gctccacagc gcggcgtaga acagcacggt ctcgaacacc tcgcggtaca ccgtcacgaa    169320
     tgacagcacg aacagcatga tcgccgagcg cttgttcagc gcggaggaca gcttctgctt    169380
     cacataggcc tgccagcgac cggccaggct cttctggtgc atccacatgc ccacgccgag    169440
     caggaccacg gccgcaaaga ttgccgagaa gccttcggtc atctcgcggc tggcaccgct    169500
     caaatccacc aggtaggtag cgacggccca cgtcagtcca ccggcggcca gcgcaacaat    169560
     ccagccggca tggacgtatg gcagcacgtc ggtgcgttcg gccttcttca ggaaggccat    169620
     catggcgacc acgacaagca gtgcctccag gccctcgcgc agcaggatcg tcaaggcgcc    169680
     caggaacgtc gacagcgggt cgttggtgcc acccagtgca tcctgggctt cagtcagcat    169740
     cgtctgcaga tgctgcgcga tgtcccgtac ctgctcggcc tgaccggtag tgatcgcgtt    169800
     gcgatacagg cccatcattt tttcgatgtc ctggaacagc gactggttct tggcggccag    169860
     ggccggttcg accggctcga agccgtcgag gtaggcggag agcgccaggc gcgaggcagt    169920
     cgctttgtcg ccctggtcga aggcggctac gctctctttg agcttgtcct tggcgattgc    169980
     gagactgtct gcgttggagg cgttcagcac atccggcgcg cttctcaaat aggcggtcaa    170040
     ttgccgcgcg gcatccgggc tgatcgtctt ggccagcaac gcttctggcg tctggctgag    170100
     cttggcgagc gtcggcaccg cgctatgcag ctccgggcgg gatgcccaca atttggcgcc    170160
     ggcttgccgg tccgcatcgg aataggacaa ggtcgacgca aaataggcca gtgcccagcg    170220
     atcatcgtca gtgagctgcg cgaagctcgg catcgaggtg ccctcgacac cgcgcgtgat    170280
     gatctgctgg agggcgaaga cgctgcgctc ctgggcgcgc tgatgatcgg ccagggctat    170340
     ggggggcggg ctcagcttgg cggccagcgg accatcggcg tgtccggtgt tgccatggca    170400
     ggacgcgcac tggctttgat acagcgtagc tccatgcttc aggtcgggca ccttgctggg    170460
     cgccatcggc accgggtagg cggccagcaa gctgtccgcg agcttatgcg cctgttcacc    170520
     gacgacggtg ggtgcggcct tgtcggcgat gagcgtgcgc aacgcgccag catccttgag    170580
     caaggcttgc gtctgtggcc ccgccggcaa ctcggcaatc tggcgctgcg ccgcatgcgc    170640
     aaactcctgc atttcggcgt actcatcggc attggccacc tggccgtcct tgacggagcg    170700
     accgtaatcg accgccagat agtcgagtaa ttgccagacc tgcttggtct tgtcttgagt    170760
     ggacagcgtg tcggcgtacg cgcttgaaac cgatgtcagc aggtagaaca ggatgagggt    170820
     gacgacgcgc tgcagttgca tgaagagcct accggcgaag cgggagaaat ggctttaaat    170880
     gagaatgatt gtaattcatg tttcgtgacg cagatgtcgc gctggtcaaa aaacatgcgg    170940
     ccgaaggggt cacatagcga acccgttcgg ccattcccct tcgtgtcagc ggtgcgtgcc    171000
     gtctccagtg cacgtgccgc taccttcgga caacccctgc aggattccgc aagcttctgc    171060
     agctcgcccg tcggaacagg tctcgcgcag cgcgcacaaa tggtgcttta acacccccag    171120
     tgcctcgata cgccgctcga cttcctcgat gtgcttgtcc aggagggtgt tcaccgcgcc    171180
     gcaatcctcg tccggtcgct cgcggtagcg caggagtgtc cgcacgtcgt tcagcggcat    171240
     gtccaatgac cggcagtgga ggatgaactg cagccgctca atgtgccgct cgctgtacag    171300
     ccggaagttg cccgagctgc ggtccggcgg cggcaacagg ccttcgcgct cgtagtaccg    171360
     gatggtttga atcgggcagg ccgtgcgctt ggcgaattca ccgatctgaa tgttcatgat    171420
     gtcgggccga agtcccttga ctctatagta gctatagagt gtgtacttga gtccaatcca    171480
     tttcaagcga caaagggagg tgctgtgagt gattgcggct ccaaggggtg cggttgtgct    171540
     gccaccaacg tggtgacgcc ggcggacggc gatgcggcgg ctgttgacct gaaacgatcc    171600
     cgctaccgga tcgacaacat ggactgcccg acggaagaaa cgctcattcg caataagctg    171660
     gcggcgctgc ccggcgtggt caaccttgag ttcaacctga tgcagcgttc gctggccgtc    171720
     cagcaccggc tgccatcccc ggcgccgatc gagcaagcct tggcagccgt tggcatgcga    171780
     gcggttcgcg ccgatgaaag ccccgccggg cagagcacag tcctgaccat tcgtcagatg    171840
     gactgcccga ccgaagaaac gctgattcgc ggcaagctgg cgggcatggc gggcgtgtca    171900
     gacatgcagt tcaatctcgt ccaacgcaca ctcgccgttc aacacgctgc cgatgcgcta    171960
     ccgcaagtgc tggctgccat tcagtcgctt ggcttcgatg ccgaggtgcg cgaccgctct    172020
     gccgcagcac cgcttcccga acaagatgcc gcgcccacca aatggtggcc gcttgccatt    172080
     gccggcgcga acgccgtcct ggcggaagtg gtgtattggc tcaacggtgg caaccattgg    172140
     gtggtggtga tcctggcgct ggccgcgatc ctgaccggcg ggctgtccac ctacaagaaa    172200
     ggctggatcg cgctcaagaa ccgcaacctg aacatgaacg ccctcatgtc gatcgcagtc    172260
     actggggcga tggtgatcgg ccattggccg gaagcggcga tggtgatggt cctcttcgcc    172320
     ttggcggagg tcatcgaagc ccgttcgctg gaccgcgccc gagatgcgat ccgggggctg    172380
     atggatctcg ccccggagac agccacggta cagcgcagcg acggcagttg gtccgacgtc    172440
     gatgccaaga ccgtggccgt tggcagccgt gtgcgggtca agccgggcga gcgcatcgcg    172500
     ctcgatggca cgattctgca ggggcggtca tccgtcaatc aggcgccgat cacgggcgag    172560
     agcctgccgg tcgagaaggc agcgggcgac tccgtgttcg ccggcaccat caacgaatcc    172620
     gggtcgttcg aatatcgcgt caccgcagcg gcaagcgact ccacactggc acggatcatt    172680
     cacgccgtcg aggccgcgca aggcagtcga gcgcccacgc agcgcttcgt tgaccagttc    172740
     gcccggctgt acacgcccat tgtgttcgcg gttgcgcttg cggtggccat cgtccctccg    172800
     ctggtcttcg gtgcgacttg gctggactgg atctacaagg ccctagttct tctcgtgatt    172860
     gcttgcccct gcgcgctcgt gatctcgacg ccggtgagca ttgtgagcgg cctggcggcc    172920
     gccgcgaagc gcggcatcct catcaagggc ggcgtctatc tggaagaggg acgcaagctg    172980
     aaatggttgg cgctcgacaa gaccggcacg atcacgcacg gcaagccagc gcagacggac    173040
     gtcgtggcct ggaacggtgc ggacgcgtcc gccgcccaga tcctggcagc tagcctggct    173100
     gcccgctccg accatcccgt ctccctggcc gtggcccgcg cggcgcagga ccaaggccta    173160
     gccctgcgcg acgtcaccga ttttgcggcc ttgcccggac gcggcgtccg gggccatgtc    173220
     aacggtgcgc tctatcacct gggcaatcat cgtctggtcg aggaactggg cgtgtgttcg    173280
     ccggcattgg aagcacagct tgccgtgctg gaaacccagg gcaaaacggt cgtgatgctg    173340
     atcggccagg acggcgtacg cgcgttgttc ggtgtggcgg acaccatcaa ggacagcagt    173400
     cgccaagcga tcaaggaatt gcacgcactg ggcatcaaga ctttgatgct gagcggcgac    173460
     aatccgcaca ccgcagaggc gattgcgcag caggtcggta tcgacgaggc tcgcggtaat    173520
     ctgctgccgg aagacaagca gcgcgaaatc gagcgccgat ccgcacaagg aaccatcggc    173580
     atggtcggcg atggcatcaa cgatgcgccg gcgctggcac gggccgatat tggattcgca    173640
     atgggcgcgg ccgggacgga cacggcgatc gaaacggccg acgttgcgct gatggacgac    173700
     gatctgcgca agctcccggc gtttgtacga ctatcccggt ccacggccgg ggtgctgaag    173760
     cagaacattg cgctggcgct cggcatcaag gtcgtgttcc tggcactgac ctttacaggc    173820
     caggccacca tgtggatggc ggtgtttgcc gacatgggcg ccagcctgct ggtggtcggc    173880
     aacgggctga ggttgctgcg caaatgaatt ggaagttcct cgtgtacgac tggggcggct    173940
     ggaacgtcgc gctattccac gccatcaact cggggatgcc aagcgccctg gacccggtgg    174000
     cgtggtgctt tagcctgatt ggcaactact ggactgcgcc gctcttgctg ctggggctct    174060
     ggcggtggtc gatatcagcg tcgaatccag cgcgcgcgtg cgctgtcagg caacgcctcg    174120
     tcacgtttgg gttggccttc gcgcttgccc tgctggccgc ttccgccttg aagtggtggc    174180
     tggatttccc acggccaccg gcggtactcg gccacctcgt gcacgtcatt ggtgagccgg    174240
     aactgcacta cagcctgccg agcgggcact cgacgttcgc agcgcttgtg gtcggggcac    174300
     tctggccctt ggtgggtttt cgggggcgtc tcgcgttggt gttctacgcc gcgttggtcg    174360
     ggtggtcgcg tgttgccgcc gggatgcatt tcccggcgga tgtggtcgcc ggctggatgc    174420
     tcggggctag cagcgtcgct atagcagggt tgttgcgctc agcattgatg tcacgacaag    174480
     gcgccctcgt gaagggactt tctggctgat tccgcagcat gcagcggcgc acgaccgatg    174540
     ggccgtgcgc cgccgagggt ttacttgctc cgcaaatcga cgacggtcgg ctgaccgtcg    174600
     accatatcaa agacggccca caccgcttgg ccctccttga agtgctgcag tgatgccttg    174660
     tccttgacgg caaacgtcat cgtcatggcg cccatgccga gattgtcgat ggcgccgtgc    174720
     ttaagcgtga ccttgccggt gtcgaggtag atcttgcgga cctctgctgc cacgggcttg    174780
     ggcgcctgct tggtttgacc agcaggcttc atgtccatac cttccatcgg cgtggccgca    174840
     aaggcggctg gagtcgacgc cagcgtcagg gcgaatacaa cagcggaaac gtagttcatc    174900
     gtgagacctt gtcatgagag ggtggttggg gaatggattg cccgctgcca cgcctgcgca    174960
     gcagcaggta gacagcagga acgacaaaca gggacagcaa cggcgcggtg atcatgccgc    175020
     cgaccatcgg cgcggcaatg cgctgcatga cttcggagcc tgtgccgtcc gaccacatga    175080
     tcgggagcag gccagccagg atgacggcca ccgtcatggc cttggggcgt acacgcagca    175140
     cggcgccttc ctgaatcgct tccagtagcg cttgggtaga agtttgaccg ttttcctgcc    175200
     gctcggtcca agcgtgtttg agatagagca gcatgatcac gccgaattcg gccgccaccc    175260
     cggcgagcgc aatgaagccg acgactccgg ccaccgacag gttatagccg agcagataca    175320
     gcagccagaa cccgccgatc agtgcgagcg gcagcgtgcc catgatgagc agcgcctcgt    175380
     cgatacggcc gaacacgagg tacagcagca cgaagatgat cagcaaggtg aatggtacga    175440
     ccacctgcag cttggcactc gcacgctcca ggtactcgaa ctgccctgac cagctcagcg    175500
     cgtagcccgc cggcatcggc accgccttgg tcactgctgc ctgcatgtcc ttcaccgccg    175560
     agcgcaggtc gcgcccccgg atatcgacat agatccaacc cgagagccgg gcattctcgc    175620
     tgcgcagcat cggcgggccc tgcacgacgc ggatgtccgc gacgtcggac aacacaatct    175680
     gctggccccg gtcagtgaca atcggcaaac gccgcaactg ctccacggaa tcccgataat    175740
     cgcgcggata gcggaggttg atcgggaagc gggccaggcc gtcaaccacc tcaccgacat    175800
     tatcgccacc gatggcggat gacacgatgc tttgcacgtc gtcgatgttc aggccgtatc    175860
     ggccggcggc ctgtcggttg atgtccacgt cgatgtatcg tccgccggac aaccgctccg    175920
     ctagcgcaga ggtgacaccc ggcacggttt tgacggtctc ctcgatccga gtggtcagtc    175980
     gatcgatctc cttcaagtcc gtgcccgcca ccttgatgcc gaccgggctc ttgatgccgg    176040
     tggcgagcat gtcgatgcgg ttgcggatcg gtggcaccca gatgttggac agccccggca    176100
     ccttgaccac gcggtcgagt tcttccacca gtttgtcggt cgtcataccg gggcgccact    176160
     ggtcgtgcgg cttgaactgg atggtggtct cgaacatctc gatcggcgcc gggtccgttg    176220
     cgctgtccgc gcgcccagcc ttgccgtaca cgctggccac ttcgggaacc gtcttgatga    176280
     ggcggtcggt ctgctgcagg agctgagccg ccttgccggc cgacaaccca ggcaatgctg    176340
     acggcatata cagcagatcg ccctcatcca gcggcggcat gaattcgccg cctgtgcgca    176400
     ggatcggcca ggccgttgcc cccagcagca caatggcgat agcgaccgtc gccttgggat    176460
     acgccagcac cttggacagc attggctggt agaggcggat cagccagcgg ctgagcgggt    176520
     tcgattgctc gctcgggata cgcccgcgga tcaggtagcc catcagcaca ggcaccagcg    176580
     tgaccgacaa cccagccgct gccgccatcg aatacgtctt ggtgaacgcc agcggcgaga    176640
     acaggcggcc ctcctgcgcc tccagcgtga acacggggat gaacgacagc gtgatgatca    176700
     gcagcgagaa gaacagcgcc ggccccactt ctgccgccga ttccccgatc acgttccagc    176760
     gctcgtggcc tgtgagttcg cggccggggt tgtcctcgag ccaatgctcc agatgtttgt    176820
     gcgcgttctc gatcatcacc acggccgcgt cgaccatggc gccgacggcg atggcgatgc    176880
     cacccagcga catgatgttg gcgttgacgc cctggtatcg catcaccagg aaggccgcca    176940
     ggacgcccag cggcagcgag acgattgcca ccagtgccga gcgcagatgg aacaggaaca    177000
     ccaggcacac gacagcgacg acgatgaatt cctcgatcag cttgtgcgtc aggttgtcca    177060
     ccgcgcgctt gatcaaaccg gaccggtcgt agacaggaac gatctccacg ccttcgggca    177120
     gactggtgcg cagcgtggcg agcttggcct tgacggcttc gatcgtctcc agggcattct    177180
     tgcctgaacg caggatgacg acgccacctg ccacctcgcc ctgaccgttc agttccgcga    177240
     tgccacggcg catctcgggc ccgagttgga cggtggcgac atcgcccaaa tgcacggcga    177300
     tgcccgcatc gttcgtcatc aggggaatct gccggaagtc gtcgagcgtc ttcaggtagc    177360
     cgctggcgcg gaccatgtac tcggcttcgc ccagttccag cacggagcca ccggtctcct    177420
     ggttggcacc cttgagcgct gccagcacct tggcctgtgt caggttgaac gcacgcagcc    177480
     ggtccggctg caacaccacc tggaactgct tgaccatgcc gccgacggaa gcgacctccg    177540
     cgacgttcgg cagggccttc aactcgaagc gcaggaacca gtcctgcaac gcccgcagtt    177600
     gggccaagtc gtgccggccg gtcttatcga ccagcgcgta ttcgtagatc cagcccacgc    177660
     cggtggcatc cgggcccagc gccggtttgg ccgccgcagg caggcgggac tgcacctggt    177720
     tcaagtactc cagcacgcgc gagcgtgccc aatacaggtc agtcccgtcc tcgaacagca    177780
     catagacgaa cgaatcgccg aagaacgagt agccgcgcac cgtcttggcg cccggcaccg    177840
     acagcatggt ggtggtcagc ggatacgtga cctggttttc cacgatctgc ggcgcttggc    177900
     cagggaacgg cgtgcggatg atgacctgta cgtccgacag gtcgggcagc gcatcgagcg    177960
     gcgtgctgcg cgcggcccac agaccccagg ccgtcagcat gacggtcgct agcagcacca    178020
     ggaagcggtt gcggatggac gcgagaatca gccgtgcgat catggcttgc ccccctgatc    178080
     cgcgccggcc ggctcgaccg aggacaggac tgccatgcca tcgtcatgca gttggaaccg    178140
     gaagcgcaca cggtccccag gcttgaagcg ctttggcagg ccggagggcg gtgcggcaaa    178200
     atccattgtc atcgcgctcc agtgcgcgga cggaatcgcg ccatgtgaga tcgtcaggcc    178260
     ttcgctggtg acagcctcaa tgcggccgac gccttcatgc tcgatggcgg ccgctgcggg    178320
     cgcggaggcc gcaggtggcg atgccatgcg ttgggcggtg ccgcgcaggc tagcttccga    178380
     atcaatcagg aactgcccgg aaaccaccac cttctgtccc gcgctcaaac cgtcggtcac    178440
     ttcggtctgc ccattggctt cggctccggt cttgacttcg atggggttga agccgccatt    178500
     gccggcgtcc accatgacga tcgtgcgcgt accggtgcga atcaacgcct ccgtggggac    178560
     cagcagcttg tccgggccgg cttgcgcgcc aaaccgcacg ttggcgaaca tgccgggcaa    178620
     gaggcggcgg tcccggttct ggagttcgac gcgcaccttg acggttcgcg tattggcatt    178680
     gacgtcgggc aggatggcat ccaccttgcc ggtcagcgcg tgtccagcga ttgccgtcgc    178740
     cgtggccgtc accgcctggc ccgggcggat ggccgatgct tggctctcgg gaatctccgc    178800
     caagacccac acggtggaca agtcggcaat cttgaagagc gtcatgccgg gtgcgacagc    178860
     catgccgtcc cggaccccga cctcggtgat gacgccatcg atgtcgctgg aaatcgccag    178920
     ccgtggctgt ggcttgccgg tggattcgac cagccggatc tgcgcctccg tcatgccggc    178980
     ctggcgcatg cgcagcaacg ctgcgctgcg caggtccccc tgcagggcgt tggccgtacg    179040
     cgaaacggcc aggtactcct cttgtgcggc gacccattcc ggcgcgtaga cgacgatcag    179100
     cggttgcccg cgcttgaccg ggtctaacgt ggttttcgcg tacgcccgtt cgacaaagcc    179160
     ggcggcgcgc gcttgaatga tctcgatgcc gcgctcgttg atggcgatat tgccgggcac    179220
     ttccagcatg gcgtccagcc ggccggtctt gacctcagcc gtgcgcacag caagattctg    179280
     tgccacacgg ccatcaaccg tgacggcggc gctcccgccg gcgccattct cgtagacggg    179340
     ggcaagcggc atgtccatga aaggtgattt gcctggtttg tcgaaacgct ggccaggtgc    179400
     catggggtct tgccaataga gaatccgctt gcccgtcttg ggatcgatgt cgcccgcttt    179460
     gagcggggca tcggcggctt gggcagatgc tgccgcctgc gtgggcgcgc tccgctgtcc    179520
     ctgcctcacg ccaaggtagt aggtggcgcc catgccaagg ctcgccaaca ccagactggc    179580
     tgcaatgcgc gcaaagatgg ttcggttcat ggttgaactc caacgttgga ggtcggctgg    179640
     tttgccgtgg ggagcggttt gaggaaggcg agctcggccc agagttgggc cgtcgacgct    179700
     tcgagcttga gacgttccag cgcaaggtcg agtgccttgc ggcttgcctc ggcgaccgcg    179760
     gcgagcgaac cgcttccagt ccggtaggac gttagcgctg cctcggtttg cgcgcgcgct    179820
     agcgggacgg tcgtggtttg atagcgatcc aggcggcgtt ggttcagtcg caacgtctcg    179880
     cgcttgccca gaatctggcc caccatgttg cgccgcaaga cttctgcttg agcgcgcgcg    179940
     gcattggctt gcgccagctt ggccgagacc tcgcggtcct ggcggttctt ctgatcccag    180000
     ggaatcggca gggagacgtt caacgacacc atgttggcgt aagccggtcc gcgctggcta    180060
     tacatcagct ccaccgtcac gtcgggtgtc ttggccgcac gagagacacg tccttcagcg    180120
     tccgccatgg cggcttgcgc gctggcagcg gccacatcgg gcagggtatc gatggccgcg    180180
     tcgtccagcg cgtcgagcca ctgcgggacg tcgaacctgg ggggcgcggc gggcgggcgg    180240
     ctggatgcgt cgcctaccca gcgccgcagc atggccttgg cagacgcttc cgtcgcccgg    180300
     gcctcgtcgg tccggtcttg caactgctgc cgttcaaggc gtgcagctac gatgtcggcg    180360
     cgtgagccgc gattgccgcg ataggccgcc tcggctgcct cgacctgcaa ggcgacagag    180420
     gctgtttgtt ccgccagcag ttgaacggta cgtgcggcat accagcggtc aagccaggct    180480
     tgcgctgtgc tgcgctggac ggctgccagc gcggcgacac gctgtgtttc ggccgcggag    180540
     gcctcggcgt tgaaacgttc cgcacgggca cggcgcttct cggtccgcgt gagctcttgc    180600
     atcacgctga ccgagcgcat ggtcatgaaa tcggtgccga tggagaaccg gtcgctgcca    180660
     tcggcgggaa cattgttcac gccgaatttg aggacagggt cgggcagttg ggctgccgcc    180720
     acggccatgt cgagcgccga ctgtacaccg gcgcgggagg tttccgcgtc ggcggagcgg    180780
     gacgatgcca agccgatcgc ttcctgcaag gagagcgcat cggtctggct atacgccaga    180840
     tgactgctta aaagcagcag gacggcgagc gcgagcaagc gcccaccgcg tgggggaaaa    180900
     cgcaaaagca taaagcctcc ggaaagcaac gaccaccttg ccggttaggc ggcaaggcgt    180960
     gagagatacg tcgcttcgga ggctacgtgc ggaaacagca gttcaggatg ggaatcgggg    181020
     gtggtggtgc acggggcgcc acatcggcga gcaagaccga ttggccgtcc gccatgatga    181080
     ctggctcggc cgtgatcatc cggatcagga cgggcaggaa gatgggaatc tgcggcgata    181140
     cgtgattggc cgacttggtg ccgctctggc agtgctcaag acagaggccg tcatgctggt    181200
     gcacatcctg ctgcgcctgc atggccatct cggggcacga ctgcaccatg gcaccggcgt    181260
     cggtcgcatc ggccatggtg ggcatgacct ccgctgagcc gcggcttgcc gcacaggcgt    181320
     atgctgccgc tgccagttga actgtcagga aagcgatgac taggaatccg gcgaaccacg    181380
     gccggcgaag cgatgcgcgc acgttctgca gatgatgtga ttggatcgaa tggtaacagc    181440
     ggctacgcgc gatgtgcacg cggacgcggc ttatgatcga acgggttgat ctgccgcaaa    181500
     cgtgccatcg cgcgatgggc gtcctgccga taatgcagaa cgccccaccg tgttatttcg    181560
     gcgcttgaat catgtcttgg cagggctgcg gcatcgcagg catgccagcg cttttctgcg    181620
     cttgcgctgc gcggatctgc gcaagtttcg cgttgcgagc tttctcgatg acctgccagt    181680
     ctggcccggc aatggccgtc aacgatgtca aaacagccgc caagccgaca gcggaaagaa    181740
     tgaccttctt catggtgatg ctccagtgat ttcacgcggg gccggcatga atgccggctt    181800
     agcaatttgc gtggcgtatt cgcttacgcc gctatacgga tgccgcactg caaaaaggcg    181860
     cgatccgtaa agctaaatgg agcgggctcg gggtggccgt tcgagcggca caggaactgc    181920
     ggaaatatag acaggctcct gggcgggaac caggatgtgc atccccttgg cgccgagcgg    181980
     catcgctggg ctggaaagcg ccccgatcac agcgcagaaa gacacgcaag gagcggtgtc    182040
     cgtgcagtcg gaaccactct gggcatggcc gtcaccggtg atatggcagg ggtgtccttt    182100
     ctcggcttgt acgacatcat gcgctgtcga cagccctggc agacccacag cgccgtgcat    182160
     ctgcattgat gccatgggga gcccgcgcgc aggcaacgcc acggcaagca gcacgatcat    182220
     cagcatgcgc caaaggggat tcatcgcgcg cggatttttg tcagatgttg cgtaggttca    182280
     agctaacggt cagcaggtat gcgtcacgca cgcctgttga ccaattctgg gcagtattca    182340
     ccttcccaca atggcaacgt caaggtttct ttgatggttc ctgctgtttg agcatctggt    182400
     ccatcatcat ctgcatcatg tccatgcggt tttccatcat gttcatgcgc tgctccatgg    182460
     gcatgcccga gccgcccatc atcggcgccg caccgccggc ccccatccct tgaccgccca    182520
     tcatgtccat catcatcggg ccgcccatac cgtgcattgt ctgcatcgtg tcctgcatgg    182580
     cctgcatgtg ctcggccatc agacgttgcc gttccttcgg gtccttggtc tgatggatct    182640
     tgtccatctg ggcctgcatc ttcttcatct gctgacgggc ttgctcgaag cgcttttccg    182700
     tatccgcaga gtttgccgtg gcaggggcag tcttcgctgg ggttgccgca ctaggctggc    182760
     tcgctgcggc ggggtggtgc tcgtcaacgg cccagaccga tgcactggcg atcagcagcg    182820
     cgcctgctac aagaaagcca acatgcttgt tgttcgtcat ggtgctgcct cctgaaatga    182880
     tgggatttca ttttgatatg cgatcggtgg tcgccagttg acgtatcaca acgaattgct    182940
     ctcgcttgac ccgtatcaac ctcccgttcc gggcgtggaa cacactgcaa tcgtagttgt    183000
     gcccagacct aatcaagtta aacaatcagc acatccgagg ttggcatgcc aagcgattcc    183060
     atcggacacc atcgtggcga tcaagtggtc ggtcggcaga gcgcgctgcg catcgctcaa    183120
     ccggtcgtcg atgccggtcg cgtgcgcgat ccggtttgcg gtatggagat ttcccctgcg    183180
     caggcagcag ccagcacgga agtcgggcat cagcgctatt ggttctgttc tcggcactgt    183240
     gagaagactt ttctcgctga tccggcgcga tatctctcgc atgacgcgca tgacgcgcat    183300
     gaccacgacg gcgcggccca tgatcacgcg ccaaccggag ttgctgcggt gtccgcaagc    183360
     acgaagcaac tggccaagga ccccatctgc ggaatgatgg ttgacaaggc cactgccttg    183420
     tccgcagagc gaggagggcg aaagtactac ttctgcagcg agagctgtct gcacacgttt    183480
     gagtcgccgg agtccgaact gaaggcgatg aagacgcgcg tcaccattgc cttgaccggt    183540
     gtgctggcgt tggcggtgtt acgcgccggg gcgtttctgg ccttggctgc aggtgcgacc    183600
     ctgctgactt gggcgcccat tccggcgctg ccttggttca catggggaat atggctgttc    183660
     ctgctggtga cccccgtaca gttcattgga ggttggagct tctacaaagg cgcgtggaac    183720
     gcggtccgca cgcgcaacat caacatggat ttcctgatcg cgctgggtac gtcggtagcg    183780
     tacttctaca gcgtggtcgt gttgttcttc ccatcctggt tgccggtgaa ggtggccgaa    183840
     cgcgatgtct acttcgaggt gtccgcggtc atcatcgctt ttgtgctgct gggcaagtac    183900
     atggaggaga tcatcaaaaa gaagtcctcc gccgcagtcc gtcgcctgct tgacctcaag    183960
     cccgctgtgg cgcacgtgat tcgcgatggc aaggaagtcg agattcccgc cgaaagcatc    184020
     atggtctcgg agctggtagt ggtccgcccc ggcgagaaga ttccaaccga tggcaaggtg    184080
     acggacgggc aaaccagcgt ggacgaatcg atgctgaccg gggagtcgat gccagttgac    184140
     aagaagcctg gggcaacggt gatcggcggt acgctgaacc ggtcaggcgc ctttacgttc    184200
     caggcgaccc gcatcggtgc ggatacggcg ctggcgcaga tcatcaagat ggtagaagac    184260
     gcgcaggcaa gctcggcaca gattcagcgg ctggccgacc aggtgaccgg ctattttgtg    184320
     ccggcggtcg tgggcgttgc actgctggct gtcatcggat ggacgctcgc ggggcatttc    184380
     ccgcaggggc tgctcgcctt tattgccgtg cttatcatct cctgcccgtg cgctctgggt    184440
     gtagcgacgc ctgccgcctt gatggtcggc gtgggaaaag gcgcggacgc cggcatcctg    184500
     atccgcggcg gcgaagtgct cgaacgcgct gagaaattga ccaccgttgt ctttgacaag    184560
     acgggcacga ttacgcgcgg cgaaccgacc gtgaccgata tcctgccgct tgggacacac    184620
     caggaagccg agctgctcag tattgctgca gcggtcgagt ccggctcgga gcatccgctg    184680
     ggcgaagcga tcgtccgtgc cgcacagcat cgtgagctgg cgacgcgtaa ggcgaacaac    184740
     atccaggcgc tgtcggggat gggtattcag ggggccatcg acggccagca ggcctggcta    184800
     ggaaaccggc gcatgctcgc gcagcaggcc atctcagtcg atacgattga agcgacgctg    184860
     gccgggctgg aggctgatgg caagacagcg atgctggcgg ggatcgggca tgaactgctt    184920
     ggcatcatcg ccgtggccga tacggtcaag ccagaggcgt cagaggccat tgccatgctc    184980
     aagtcgcgcg gcatcaaggt ggttctgctc agtggggata accagcgcac cgcgcaagct    185040
     atcgggcggc aggtcggcat cgagcgcgta atcgcagagg tcatgccgga agacaaggtc    185100
     aagaccatcc agggcttgca gaaggacggc gaggtggttg ccatggtcgg cgatggggtc    185160
     aacgacgcgc ccgcgctcgc tgcggcggat atcggcgtcg ctatcggctc gggctcggat    185220
     gtggccaagg agaccggcag catcatcctg atccgcaatg acgtacgcga cgtggcggct    185280
     tccatcgagt tgtcccgcgc cacgatgcgc aagatcaagc agaacctgtt ttgggccttc    185340
     ttctacaaca ccatcggcat tccggtggcg gctttcggcc tgctcaatcc catcctggcg    185400
     gcggcggcga tgtcgctgtc ctcgcttagc gtggtggcga attcggccat gctcaagcgc    185460
     gtgcggctga caagtaaggc gcaggaggtg ccggcatgaa acccgctgtc tggttctgtg    185520
     ccgccgtggc gacggcgctg gccgccgcca tcctctattg gtacggaatc tcactgttct    185580
     cggtgctggt tgcgctgatt ctcctggcct gtccggtctg ggtgatctgg atgagtttgc    185640
     gtctttcacg gcaaaccaga cgagaggttg aggcggcagt ggagcgggaa ctgaaatcgc    185700
     gtaggaagtc gtaagacgga ggtggaaaat gacctggctt tcgcaaaacc tgatctggat    185760
     cgtgctgggc ggattggtgg tggtgttcct ttggcgcagc caagcgatgc gctccagagg    185820
     cggcgagggt gccggcatga tgcacggcgc tccagatgca aacagtgacc cagtgaccgg    185880
     aaaccgggtt gacccgaccc acgccatcac ggccaatttt gaagggaaga cgttctactt    185940
     cgagtctgag caatctcgcg cggtctttca gcagaatcct tcacgtttcg tccaccaaca    186000
     ccatcgccat cacggcgggt gctgctagcc agcctttttt caagccgatt gcctgtggac    186060
     gaggaggctc gcatgaatga tcaaatgaac cctgaagatg ggccgcacgc ggcgcacagg    186120
     acagtcttca ggtccaggtg ggttttgata ggcttcctgc ttgtgatcgc ctatttcctg    186180
     ttcacggaac atcgggcaca cgtgatcccg ttcctgccct tcctgttgct cgctacttgc    186240
     ccgttgatgc acctgttcat gcaccacggc caccaagacg aagggggcga gccgtcaacg    186300
     cacgtacatc caaagggaga gtaacgatgc agcacgacac acaatccggc tacgggctct    186360
     ggtcgttggt catcatcaac tcggccatct tcatcatctt cgctttcagc ttcaccaagc    186420
     caaagacctc gcgtgactgg cggtccttcg gggccttctc ggcgtttctc gtggcgctgt    186480
     ttacggagat gtacgggttc ccactgacga tctacttgtt gctgccctgg ttgagcaagc    186540
     attttcccgg tatcgatttc ctctctcacg acgcggggca tttgctggag gtgatgttcg    186600
     gctggcgcgc taatccgcat ttcgggccgt tccacatcct aagcaacctg ctgatcttcg    186660
     gtggtttcat catgctcgct tccgcctggc gggtgctgta tctggcgcag cagcagcacc    186720
     gtctggccac cggtggactc tatacccgca tgcgccatcc gcaatatgtg gcgtttgtcc    186780
     tgatcatgct cggcttcctg ctgcagtggc cgacgttgct cacgctgatc atgtttccag    186840
     tgctggtctg gatgtatgtt catctcgcgc tgactgagga gcgagatgcg ctggccgagt    186900
     tcggccgggc atacgaagcg tattgtgagc gcacaccacg tttcatcccc cgttggagca    186960
     gtggtgcgtc gaaggcgtcg tctcattgat cacgacatcc tcggcaggag gcaacccttc    187020
     gcagccgctg taacagagtc cgccactctg atcctcttct ccacgtaatg cacgttggct    187080
     tggctggcgg cgcccgaacc tttcgtggat ttcatgggca cgcttttcca tggcgtagat    187140
     ttcaagcatc tgccggccaa ctgctcacgt gatggtccct tctgtatccc gccatcatgt    187200
     ttgtagtacg gttctttgcg gcgggcgcct tcttttagtc gccgcacaac ggccagttag    187260
     gtcaaagaga aagcgctgcc cgctgaggct cgcgttgcta gtgcgcttgg ccggcaaatt    187320
     cgagcgcccg ttgattgggc cattgcccat gtctggatca tcacaaccgc ccattggata    187380
     tgcagctaag agtcgccgga aacctcaccg cacgtcagtg tcgcaagcgc tgcaagcttg    187440
     gcgaaccgtt gcttctccaa cgtcgcagtc acgatggtct gatgccggaa tataagactg    187500
     cgcaaacgag tagggccaag atggcccgta aagccactgg aatgccgtct cggccaccaa    187560
     gtcgcgcact gaccgacctg tctcaagtgt gtgtgtcagc gtggcgctaa gcgcttcttc    187620
     cgaagcgcgc cagatattgt cttccccggc ttttcgcctg gaggccctca cgcccgcagc    187680
     catggcggct acgagcaaca gccatggttg gaaccgctcg gaccatgcat agcgcgtcca    187740
     gcgcatcgga tggctccatt tcagccattc agcgctccac ggcgttgcca gcgcgcgcac    187800
     ggttgggctc cagaactggt catacagccg ttcgttgatt tccgagacgg cgcgcacatg    187860
     ctcgaacagg gcacgcgggt atgggaattg aatgtcttcg acgcgacgcg gctcaaacgt    187920
     gaccccgcgt tgggagttgt tctgtggcgg cgcatcggag tgttccgaca gcttcatctc    187980
     gtacaagccg ggcggcagcg cctcaatcgc atcgaggctt tgcaggatcg cgcgatgctc    188040
     gtgacgcgcc acgcttgcgg agacgaaaat gccgaggtgt ccgacatgcg ggttggtgag    188100
     atacacgatt cgctggccgg cggcgaccag agcttccgta ctttcgtaca cgacgggaat    188160
     ccagccgagc gcctggtgcg gtggcgtgat gttgtcgccg tacgaggcaa agatgacgat    188220
     cggtttgcaa atgcgccgta agtcgaccgt gcacttaccg tcgacatgca cttcgccggt    188280
     ttccaacttg ttgccgacaa aaagatcctg gatggttgcg accagttctt cccggctgag    188340
     aaagtaaaag ccattccacc agcgctcgaa ttccaaaaac cggtcacctt caccatccgg    188400
     atcggcgaag acagtgtaga gcttggtcca gagcgcggac tcaggcttga gtgcctcgaa    188460
     gttctgtacc agccatgcac cgtcaaaacg gccgttgccc agatcggcaa gaaagtttgc    188520
     tgaccacacg ccgccggtga acgccccgag caggcgcatc gggttgacgc ctgcttcgcc    188580
     ggaccagtac gagagcgggg agccgttgag caccgcaggg caggcgacgc gctcgcagca    188640
     gtgggcagac aggagcatca cttcccagcc ggcctggcag ttgccgtaga gcaccggcgc    188700
     ctgcccgtca tgccgtcgcg cgacctcctc gacgaaggta cgaagcgcgt tcaggacgtc    188760
     gccaagggtc tgtccgcggc agggggccgg gaagaagctg acaaagtaga caggatggcc    188820
     ttcggcgagg gccatgccga cttccgaatc gcgcttgaag cccccaatgc ccggtccgtg    188880
     accggcacgc gggtcgatga cgatgacggg ggttgcatcc gcccgaacct gtcgctccag    188940
     gtggtcggtg ccacagcgcg tgatacggag cagggcatag ttggccgggc gctcgaaggt    189000
     tcgcgcatcc agtagcaatt cgtagtcgaa atgcagcggt ggcggcaggc cggcctcctc    189060
     atgggccaac atattgttgg cgcgttgccg caggatatcg atgaacagaa tccaccgctg    189120
     cgtgacatcc acccagtagt cccacccttg ctcaagaggg ggctcggcag gtgccggctg    189180
     tggctcggcc tggtggtccg gttcgctaac caaccgcagc gccggggctg ctacacccgg    189240
     cgccgatcgg gccggacgtc gtttgcgctg taccgtacgg tctgtcatca caccacctca    189300
     tcacttcctg tgaaagtcgt gatgtccgtc accagacagt gcggacacgg gctgcaaatc    189360
     atgcggtgca actgcatggg ccttgtaggc cagcttagcc gcatcgggcc gaacttcgtt    189420
     gtcgcaggtc aggtgaattg aagcgcgggc tcttttctga gcccgcgcgc agacttactt    189480
     ggtatcggga tggaaatgct tggacttgtc cctgcccttg gtgtcctcgg cgggggcggc    189540
     cgccggcgcg ctggcggcgg aagcgccagc tttctcggcg acgtgcgaat gcggtttcat    189600
     tttgtgcgcg ccggaggctt cggatgccat gggcatgtcg ttgtccgtgg caaatacgcc    189660
     ggccgacatg gatgcggcgg ttgcaagcag cagtgcggaa aggatggttt tgcggttcac    189720
     gttgtgtctc ctagcgataa aagttggcgg ttcagttttg cagtccattc tgggtgatga    189780
     ggggccacta ttgcactgac tcctgctgga tagcgaccgt ggcttgatcc atgtcaagcc    189840
     ggatcggcgc tccatgtctc atttcaccca gccaatagca ggatgtttgg tctcgtacgc    189900
     catgccccaa tgctcttggg caggggcggt gggtgcgggg atggtttcca tgagcggggt    189960
     atcggcagtc tgccaactgc ttcccgatgg gaagctgacc ggaaggtgac ttttctgtca    190020
     tgcattccag ttgcttgatc ttcaggtgca tgtttctggc acatgggggc tgaaatggcg    190080
     acgggtaagc tattacctgc tacgcaattg gatcgaatat gccttgatcc aggtaaagcg    190140
     atgccgccca taaaggtgta acgtgaattg tgcttggggt tacaccttgg gtttcacgag    190200
     gaggtgcacg atgatggttc acgggttcga catggccggc tatggtctcg ctcactggat    190260
     cacgtttgcc gtcatggcgg tggtattgct gtatcccatc ggccgaatcc tgatgcggat    190320
     cgggttgtcg cctttttggg ccattctggt gctggtgcca ttcttcaacc tgatcgggct    190380
     ttgggtgctg gcatttgtcg aatggccacg gcaagggtct ggccgtcctg gctagtcgga    190440
     tgccatgaaa tcgttcagct gcccggatgg caccatggtt cgcaaggcca ttccctctct    190500
     ggtgtccgcg tgccttgtgg cgtttgctgc cgcatgcatg gtgggtgggg cttgggctga    190560
     ggaaccagac ggccgcacgc tcgtcgatcg cgtcgatacc ctgctgtggg gcaagacgct    190620
     gcaaggcgag ttccagatga cgatcaccac accgcgctgg cagcgcgcgc ttgacctgcg    190680
     cgcctggatg gagcggccgc ggcgctcgtt catccgcgtt ctggcgccgg ccaaggaggc    190740
     cggtattggg tcgctgcgta tcggctcgga gatgtggaac tacctgccca acatcgagcg    190800
     caccatcaag attccgccgt cgatgatgct gcagccctgg atgggctccg acttcaccaa    190860
     cgacgacttg gtcaagcaaa gcagcgccgt ggatgactac acgcatcggg ttctccgcac    190920
     ggaggtgctg aacggcgccg cgtcttacgt gattgaatcg attcccaagc cggatgccgc    190980
     cgtcgtgtgg ggaaagattc tctactggat tcggcaagcg gatacgattc cgctcaagca    191040
     gtattactac aacgagcgca acgaactggt gcgggtcctg acgttctccg acgttggccc    191100
     gatgggtggc cgcaccattc cgaccaaatg ggaaatgcgc cccgtgaatg atccaggcca    191160
     cgcaaccgtg atcgtcgtca aggccgcgcg ctacgaccag ccgattgacg acgaacgctt    191220
     tacgcagcgc aatctgcaaa agccatgaat gctgcagccg atacagtcgt caagctcgta    191280
     ggtgtctcca ggctgtatcg gcaaggtgcc agcgtcgtgc atgcgctgca gcatatcaat    191340
     ctggaaatcc gcaaaggcga ctttgcggtg ctggtagggc cgtccggctc gggcaagaca    191400
     acgctcctga acgtgatcgg tggcttggac tcacccaccg aaggccatgt ctgggtcgac    191460
     ggcagcgaga tcgggacact gggtaaagcc gcgctttcgg acatccgctt gcgcaagatc    191520
     ggcttcgtct tccaggagtt caatctgatt cccgttcttt ccgcgctaga aaacgtggaa    191580
     ttcgtgatgc tgttgcaggg ggtgccagag atgcagcgcc gggaccgcgc catgacgctg    191640
     ctcaaggaac tgggattgga agggatggag cacaggcgtc cgcagcaact ctccggtggg    191700
     cagcagcagc gcgtggcggt ggcgcgcgcc atcgcggccg agccgatcat cgtgctgccc    191760
     gatgagccga ccgccaatct ggattccaaa gccggcgccg cgctcatgga catgatgaag    191820
     gccatgaatg aacggcgcgg cgtgacgttc gtgttctcca cccacgaccc gatggtggtc    191880
     gaacgcgcgc ggcgggtcat tcgcctgcgt gacggccgga tcgaagccga tgagcgccga    191940
     ccgccatgat gctgctgcca ctcgccgtgc gcaatgtgct gcgcaaccgc aggcgttccg    192000
     ccatcaccat ctcgtcgatc gccatcggcc tagcggcgat gatcttcaac tggggattca    192060
     ccgctggcat gaaccgcgag atggtcgaga acaccacgcg gtatttcgcc ggcgatgcgc    192120
     aggtgcatct caagggctac cacgacgatc cgatccttga tctcgccatg ccagactcgg    192180
     cccccatcct gcatgccgtg cgcaacgagg ctggggtggc agccgccagc atccgcctgg    192240
     aaaccaaagc gctggccagc cggggcgaca agtcgcgcgg cctcatgctc gtcggcgtcg    192300
     agccggcaga cgaggcgcag gtgacgatgc tctcggacgc catcgtggcc gggcagccgc    192360
     tgacgaccgg cgcgcccggc gtgctgatcg gggagatgct tgctgaagcg ctcgcggtgc    192420
     ggcccgggca gaacatcgtg ttcgtggggc agggctacga cggctcgata tcgagcggaa    192480
     agtatccggt gcgcggcatc ttccgcagca agatcgacga tctcgacggc tacgtcgccg    192540
     tgatgccgct gcctgttgtg cgggagtttc tctccgcgcc cggtggcgcc accgccatcg    192600
     ccctgcggct gcgcgagcgc tcgcgcctgg agccggtcag cgcggggctc gccgagcgcc    192660
     tgggagatcg ttacgaagtc gtggggtggc cacggctgct accgatggta gcggtcagtt    192720
     cgcgctttca cgaggtcacg acctacgtgg tgctgttggt gttcttcgtg gtggtcgtct    192780
     tcgcggtggc gaatcctgtg ctgatgtccg tgatggagcg cacgcgcgaa ttcggcatca    192840
     tgcttgccgt cggcatgagc cgcacgcgcg tgcttcggct ggtcctgtat gaatcgatcc    192900
     ttctgggcat cgttggcctg atcgtcggca acgccgtcgg ctggacagtg acggcgtatt    192960
     tcgcgcgcgc gggtatccat ctgcacggtt ttgaagccgg gctgcgcacg atgcccgggc    193020
     tgtccgacgt cgtctatccg gtggtgagcg ccgagcgtgg cgtcgtgctg tcagtggcgg    193080
     tcttcgtcat tgccgggctg gcggcactgt atcccgctgc caaggccgtg cagttgcggc    193140
     ccatcgaggc gattcgcggg ctacccgctg ccatgcgggt gtcgtcacga aacacgggcg    193200
     attcccgctt gccggtgttc gtgctgctcg cactgcgcaa cctgctgcgc aatccacgcc    193260
     gcacggccct catggccgca ggcgctgcct tcggcatcgt gggctttgtc ttcatcctgg    193320
     ggtttttcga cggattcttc gaccagacga tcgagaactc cacgcgttat ctgacggggc    193380
     acatccaggt cgaacgcaag ggctttcgca aggattatgc ccccgagctt gccatcgacg    193440
     atgccgtctc gctgctgcaa gccgtccggg gcacgcctgg cgtgattgcg gctgcgccgc    193500
     gcacccaggt ccaggcgttg gccagcacgg cctcgaaatc cgaaggcatc atgctcatcg    193560
     gcatcgatcc ggtggcggag gctaaggtca cgttcatttc ccgcacggtt gtccagggac    193620
     gggcgctcat acctggcgcc gatcgcgaag tcatgattgg ccgcaggctc gccgacaagc    193680
     tcggtgtccg cctgggcgag aagatcgtcg tcatggccca ggccgccaac ggcgagctcg    193740
     gcacggcagc ctacggggtg gggggcattt tctcgacgga aagtgccagt ttcgatggcg    193800
     catttgcttt tgtcacgctg ccagcggcgc agtcgttgct tgcgctcggt tcacgcgttt    193860
     ccaccatcaa tgtccggctg gaggatcgcg cgcacgtgtc cgctgccgtt gccctgctac    193920
     gcgcgcgtat cggtggcacc gacgtgacgc tgataccgtg gcaggaactc ttgccgcagc    193980
     tcgaagacat ggtccggctc ctgcgcgtgg tgagcagtat catcctggcg gtgctgcttc    194040
     tggtgattac cacgtcggtc atcaataccg tgttcatggc cgtcaccgag cgcacgcgcg    194100
     agtttggcgt gatgctggcg cttggcacgt cgcccgccgc cttgaggcgc atggtcgtat    194160
     atgagtccat cgccttgctg ttgatcgcgt ctgccgtcgg gtatggcgcc ggcattgcgc    194220
     tggtgctgta tcttgggcat gccggtatgg acctgtcgag cttcttcgcc ggatattccg    194280
     ccatccccgg gttgaccggc atcgtttatc cgcgcatttt cggtgcgacg gtggtcccgc    194340
     cgggtattgc gctgttgatt gccggcgtgc tggtttcgct ctatcccgcg gccaaggcgg    194400
     cgcggctcga tccagtgcaa gcgatacgcc atgtttaagc aagccgtgcc gttcggactt    194460
     ctggcggctc tggccttcgg agcctcggcg caggagacgt cgcagtccgg gttgaaattt    194520
     tccggttact acaagagctt gctggaggaa tcggaaacca tcgtgcccgg cgggcaacgc    194580
     tatctgctcg atctcaatcg cctgcggctg cagttgcagg gcaagctctc cgagcacgtc    194640
     gccgtggatc tgcagtacga caacgaattg ctgttcggca gctacctgca caccgcacag    194700
     ttcgcaagcc agagcagtct cgcgccggat cagtacctgg atctcgacgg caattacctg    194760
     cgtggcggct cgtactacgg ccagcaccgg ctgtatcgcg gcaacgtcac cctgtcatcg    194820
     ggcgacaccg atgtgcgcat cgggcggcag cgcatcgcat ggggaacggg ccgtttctgg    194880
     agcccgctcg acctgctgaa ccccctgaac ccgactgcca tcgagcgcga ggagcgcgtg    194940
     ggtgtcgacg cggtgctggc cgagcacaag ctggggccca tctcccgcat cagcgctgtg    195000
     tacgcgccgg ggcacggtgg cgcggactcc agcgcggcat tcaattggca cgccaacacg    195060
     catggcgtgg actattccat tgtcggcggg cgcttcggca atgagcaggt cgccggcttc    195120
     gatctcgcgg ggcagatcgg cacggcgggc attcgtggtg agttcacgca agtgcgtgcc    195180
     aagactggct cgacctatca acgtgccgtt ctcgcgctcg attatgcgtt tgcgaacacg    195240
     ctcacgctta gcgccgagct ctactacaac ggcgccggca cgaccaatgc cgccgcgtac    195300
     gatttcacgt cgctgttgac cggcaagatt cgcagcgttg ccaagcacta tgctggtggc    195360
     tacatgagct acgaaatcac gccgctgctc aagtgggagg gctatgtggt ggtcaatttg    195420
     gacgaccata gccgtttcgt ttcgcccctg ctgacctatt cgatcaagac gaatctcgac    195480
     tggcagatcg gcgcccagtt ctttatgggc agcagtggca gtgagtttgg acatttccat    195540
     cacatctact acacgcagat acagtggttc ttctaaaacg atagtgcttg ccggctgtcg    195600
     acgtccggaa agctgggctc ggatgcgtgc atggcgcggc aatggggaag gtgggcaacg    195660
     aggagaagga acatgggcgt cataacgcat gcgaatcccg aaccagcggt gcgcgagcgg    195720
     gtgcccgctg aactgccacg gctcttgtac atcctgcgcg cattggccgg ggcagggtgg    195780
     gcgcattatg tggagcggct acggattggc cgtgacgcac tcgaagcttc agttgaggcg    195840
     gtgcaagcga ccgatcagga tgcaaagcgg ctgagagcta cgctcgaagg gctggggccc    195900
     gcgttcgtca agtttggcca gcttctgagc ctgcggcgcg atatgttgcc ggaggtctat    195960
     atcgaggagc tgcaacggct ccaggatgat gtcgctgttt tccctggcga gcaggcgcgt    196020
     gagattgtcg agcgtgaact gggcaaatcc gttcacgcgt tgttcaccag tttcgatgag    196080
     acgcccctgg ctgccgcgtc gatcggccag gtccatacgg cgcagttgat tgacggcacc    196140
     agcgtggtgg tcaaggtgca gcgccccggc atcgagccca tcattcatgc cgatgtcagg    196200
     atcatgcgct tcttggcccg tcaactggag cggtatgtgc cggagagtcg ccgatttggc    196260
     ccgggcgatc tggtggaaga gtttgcccgg ctcatcaacg aagaattgga ctatcaagtc    196320
     gaggcgcgca acggcgatct cctgagggag aatttgcagg atgataagca cgtcttcgtg    196380
     ccccgcatct tttgggagca gaccagccga cgtgtcttga ccatggagcg cagtttcggc    196440
     aagaagctta cgcatattcc gtcgtccgaa caggagagcc gacggcgcgt ggcgcaggcg    196500
     ctgatggcat cgttcttgaa gcaggtcttc gaggacggct tctttcacgg cgacccgcat    196560
     ccgggcaacg tatttttgct ggaggacggc cggctttgct ttcatgactt tggcatcatg    196620
     ggacggctgt ccgcctatga tcaggaagcc ttggcccagt tgattctcgc cgtcagttcc    196680
     ggcgaggtgt catggatggt ggatgcctat ttcgagatgg gggtggcgac cgagggggtg    196740
     gatcgtgagg catttacccg cgatgcttcg caggcacttg acgcatacta cgaagccgcc    196800
     gggaaaggct attcgttcgg cgaaattgtc cgccagtttg cgctgctcag ccagcgccat    196860
     cggatcaaac tgccgcgcca gtttctgctg gtctcgaaag cgttcatgct ggtcgaatcg    196920
     caagcgttga cgctcgcccc ggacttcaac gcactcgcgt ccttgcggga atatgcgccg    196980
     catttgctcg gccgcaaact attgcagggg gcgaatgtac agaccgagtt cagcagggga    197040
     ttccgcacct tgcgcgcgct gcatcacgcc gccgccttgc tgcccgacat tctgaaccgc    197100
     acggtggagg cgctcagcag cggtaaggcg acgctgcata tcaaacacga ccagttgcaa    197160
     ggattggaag cgcatatcga ccgtgcaagc aaccggctga gcttgagctt gattattgcg    197220
     agcgtcgtga ttggctcctc aatcgtcatg gcgttccaca gcggtccgca ctatgcgggc    197280
     attccagtgc tggggcttct gggtttcgtc gtcgccagcg tgatgggcct cgcttgggcg    197340
     gttgcgatcc tgcgatcagg aaagttctag aggcgccgct acaagcaatg gggcctcgaa    197400
     agcaacgatg cagcgctccg ctaaaagacg gcgatggcac ccgtggccaa ctcccgtatc    197460
     agcgctggaa gcgccgccaa atgctgcgcg gtcagctcgc gaacttgccg ctgccgcgca    197520
     gcggagaacc cacccgccgc tgcaaggtcg atcgccacca actgaggctg gtcgaccggg    197580
     tggccgattg ccgagagcag cctgaccgtc acttcatcca cgccttcgat gtcggcatga    197640
     atgctcgccg ccaatcgatg tgccagcacg ttgtagagct tgccgacatg cgcggccgga    197700
     ttctttcccg ctgccgcttc caatgacatc gggcggtacg gcgtgatcaa gccgttgacg    197760
     cgattgccgc ggccgacctc gccatcgtcg ccgtgctccg cacttaaccc ggtcacggtc    197820
     aggtaaattc cgctctcgtc aagcgtagct gggtcatcca gggtgttgat cccgatatgg    197880
     cacgccgtcg gcagacaccc agccaggtac gctgccaatc ggcccttgag tgtgaaatag    197940
     tcttcaatac ttcccacgtc tcggtcgacg agtgcgagcg ccacggtaag gccgaagtgc    198000
     gcgcccagcc ggtgccccat gatcttaaaa tccgccccag ccgcatcaaa ggcgctgcga    198060
     aattcgttgg agcgcaggac gcgcgcagcg caaaggaccg tgtcttcgag tcgggagcgg    198120
     ggtgcgtacc cgacgccgaa ggaggtgtcg ttggccagcg gaagcgccgc ctgctggata    198180
     acacgctgaa gattcggcgc cgaaggcctc aaaacaagct cgatgccgat gtcattgcct    198240
     gcctttccca aggttgccac caggtattcg cggatggatt gctcgacgag tgacgtggcc    198300
     gaagccgacg gcaactcggt cacggggccg cagacgatca gccgcgcggg acgcagaact    198360
     ttgccgccgc cgaaccgtgg ctggctgatg cctccgatta acagcgcctt atccaggttg    198420
     aagtgctgaa tcgctccgta tgcttgcaga taggctcggg atagggcgca ggctgccgcc    198480
     tcgacggcgc catcgcacag gctgtccgga tggccgaagc ccttgtgctc ggcaatttcg    198540
     gtttgtgtgg cttccagcgt cgacgtggtc gagatggaga gtgcaatttc gccgacagtc    198600
     cgcatgataa gacgctcctg cccaaatccg attgggtcat tctattcact ggcagtccag    198660
     tttggtatta agaccgtccc ctcgggggtc gcgattgtgg gccttgagcg acatcaacaa    198720
     attcgccgcc cgagtgacta gcatggaaac aggacacccg gagcggcatg ggctcttgtg    198780
     tggcaggaac ggcatggttg gcccatgcgc ggtgttccca tgcctccggg gctaagaatc    198840
     tcgaaaatgg aggtgtctga tgcgagcagc atggtcagtc gttgttgcgg taattttggc    198900
     aatcagcctc tcggggtgcg gctataacac cattcaagcg caggatgaac aggtcaaggc    198960
     aggctggtct gaagtcgtga accaatacca gcggcgcgcc gacctggtac cgaacctggt    199020
     caacacggtc aagggttacg caagtcatga gaaagaggtg ttgacggagg tgactgaggc    199080
     tcgcgcgcgt gtcggcgcca tccaagcctc gcctgcgttg ctcaatgatc cgcaggcgtt    199140
     tgcccgattc cagtcggcgc agcagcagtt gaccggatcg ctgtcccgac tccttgccgt    199200
     gtcggagaac tacccgcagt tgaaggcaga tgctgggttt cgcgatctgc aagcacagct    199260
     tgaggggacc gagaaccgga tcaccattgc acgaaatcgg tacatccaat cggtacagag    199320
     ctacaacgtg accgtgcgct catttccatc gaatctgacc gcgaaggcct tcggctatca    199380
     ggagaagccc aatttcaccg ttgccaacga gacggccatt gccaagccgc cccaggtgga    199440
     attcggttcg ccgtccgcca gtgcgccggg gagctccaag tgaacctcct caaaatcgcg    199500
     cgtggcttgc ttgtggcagc ggctgcgctc gtctcttttg gggcggttgc cgaagttgcc    199560
     gtgccaccct tgacggcgcg ggtgactgac cagaccggca cactcacgcc tgggcaacta    199620
     gcagagctag aacagacgct gcaagccttc gaaaacaaaa agggcgtgca gatcgctgta    199680
     ctgatcgtgc ccagcacact gcccgaagcc atcgaacagt attcgctgcg cgtggtcgag    199740
     caatggaagt tggggcgaaa gcgcgtcgac gacggcgcac tgctgatcat cgctaaagac    199800
     gaccgcacac ttcgcattga agtcgggtac gggttggaag gtgtcctaac cgatgcgaca    199860
     agcaagcgca tcattagcga agtcatctcg ccgcggttca agactggcga tttttatggc    199920
     ggcgtgaaag acggtgttca gagtatgcaa gccgtgattg agggtgaagc actgccgccc    199980
     ccctcacggt cgacgcgcga cggaggcgta tccgttcggt cctatatgcc tgtcattctg    200040
     gtgttgacgt tggtgtttgg cggcgcgctg cgagacttcc ttggccgttt tccgggggcg    200100
     gttgcagcgg gcggcgccgt cgccctagtc gcttggttgc tttcgggcgc catttttgtc    200160
     gcgtttacgg cgggagtgat cgcgctcatc tatacgctat tgggtccggg catggttggg    200220
     cacggaggct cttggtctac aggctcacgc tcgggccgcg ggggattcgg cggtggcagc    200280
     ggcggtttcg gcggtggcag cggcggtttc ggtggaggcg gcggtggttt cggtggtggt    200340
     ggtgcctcgg gaaaatggtg atggaaaaca tcaagcgaat tctttcccat ctactgacga    200400
     cgcactggcg cgtcaggcga gcgttcccgc gcaaggcgat gcgggccatc gggcaagcga    200460
     tcgctcaaag cgagtcgtcc catgtcgggc atctgtgctt tgccgtggaa ggcgcgttga    200520
     gcttctctgc gctatggaag ggggtgacgg cgcgggaacg ggctcttgaa gtcttttcgc    200580
     aactgcgtgt gtgggacaca gagcagaaca acggcgtcct gatttatcta ttgctggcgg    200640
     accgcagtgt cgagatcgtt gccgaccgtg gcattcacgc gcgggttggt gctcaaggat    200700
     ggcaggcgat ctgcagccag atggaagccg cgtgtcggcg cgccgaatat gagcgcggtg    200760
     tgatcgacgg gatacgatcc atcacgctgc gcctgacgca gcatttcccg gcgcgcgacc    200820
     ggcgcgagca gaggttgccc ggcaagccgg tcatcctgtg aagacgcaga aatctctgtt    200880
     tgatatttgc gaagtcgcgg taggaggtga atatgttgtc tctgcgctca tttgttccct    200940
     acgctgcggt gatttgtgtc ttggcgctgc cgtcggtgga aacgctcgcg caagcgcggc    201000
     tcgaacgtga gggcgtcgtc ctctactggg ggttgattcc cgccgccatc gcctcggaaa    201060
     ggctcgactt ggaggagtcg catggcgcac cttcaccggg aggcggccgc cctcaccact    201120
     tgctagtggc gttgtttcgt gccgacggct cccgtatcac agatgccgtg gtgcgtgcgc    201180
     aactcaagga agtcgggatc gttgattcgc cgccgaagta tctgacgccc atggttatca    201240
     acggccaggt ttcctacggc caggtgttca cctcggtgct gagtgggcgc gtgtatttcc    201300
     gcgtactggt gaaacttgtt gaccgaacga atgacatcga atatcggatt tcggtctcgc    201360
     ctccgcacat cggcggaagt gaaccttgat accggatgga gcatggccga tactgtgccg    201420
     accaatgcat ctcggcggat tcgccaagcc tgtaagacga tgattggacg tcgaaaaggt    201480
     cagcagcgac caagacctgt caactcaggt tgagggccat gatcgcgtag acatttcgta    201540
     atgcctcaac tcgacgagcc accggtggcc ggatagcgcg tgtcgcccgt ccatgcgccg    201600
     tccgagtaga tctcaaactt tccagccttg gcgccatcag tgtacggatc gcgcgcgtca    201660
     gcagcccgcg ccccgtcggt gtagacgtcg cgctgagcga gggccccgtt gctggaggtt    201720
     gctgcgctgg aaatgttcgc gccgagagaa atcagcgcgg ctgcgatcaa gacggtcttc    201780
     ttggtgtggt tcattgcatt ctcctgaagt ggttggactc aaaggacttg ctatgggagc    201840
     cactataaga atccgcccct gaccgagcga tgacgaccac attacgagag cgtcattcgg    201900
     gcaaaggatc gcgcaatagt cgcgctgatc catgtcctcc tgaattcgac catacatcgg    201960
     agggcgcttg actcacatca accgcgcaaa attggcaggt gcttaagctt gttcacccgt    202020
     tcgtaggttc aaaatgtggt tgtctgccca tttgagcgtt tcgtaacaac gaaaccgcca    202080
     tacggctgat gacgctctgg agcgttactc ccgtttccat agccaacgcc ggaggtgcgc    202140
     atatggcaaa aggcaagtcg aagaaaaaga ccacttcatc ggacgccgaa cacgtaactg    202200
     gcttatcgtc cagccaggcg cgagtcgatg ctgccaaagg agtccagggt cgcgaggact    202260
     acgaggcgca actgcacctg ctgcaaattg aattggtcaa gcttcaacgg catttcatcg    202320
     ggtgtggtga ccgcatcctt gtcctgctgg aggggcggga tgcggcaggc aaagacggca    202380
     gcatcaaacg cattatcgaa tttctcagcc cccgcgagac gagggtggta gcgctgggta    202440
     agccgtcaga tcgcgagcgc accggctggt atttccagcg ctacgtgccc catcttcctc    202500
     tcgccgaaga gtttgtcctc ttcaaccgca gctggtacaa ccgggcaggc gttgagagcg    202560
     tgatgggctt ctgcactgct gagcagtatg acgagttcat gtactccgtg ccccacttcg    202620
     aggaaatgct cgtcaattcc ggtatcaagc tgcttaagta ctacctcgac atcagcaaag    202680
     ccgagcaagc tcgccgactt gccgagcggc gccgcgatcc gctcaagcag tggaagacga    202740
     gcccggtcga cgccgtggcg ttgaagcatt gggatgccta tacgacggca cgcaacgcca    202800
     tgctgatgca tacgcacacg gctgccgcgc catggcacat cgtgctcgcc gacgacaagc    202860
     gcacggccag gctcaacttg attcgtcaca tcctgtcgcg gctgcactac gcgggcaaga    202920
     agaacaagct ggtcgctccc gatcctgagg tcgtgttcga attttcgaag gagtgcctcg    202980
     atgcgaaacg tctcgcatcc tgatgctatc cagcagacgc aatcgataag gaggagacgc    203040
     ttgaaggtcg tctgcgtgag cgatgaaggc aactgagcaa tgctacgcct gagcctgcag    203100
     tccggtctgc tccgtgccct aacccggcgg gccgactcgc gcgcgttccc actggtggtt    203160
     gccggggcag cactggcggc ggaactgtcg atgtcggttc catttgccag cctgctgatg    203220
     gccgcagtcc tgttggcgcc gcgccgctgg gtgtccatcg cgactttggc cagcctgggg    203280
     gccgctgttg gcgctctcgt gctgtacctc gtctttcatc acctggggtg gaaccggttg    203340
     ttcgctgcct acccggacgt ggtgcgatcc accgcgtggc gtgatgcgac ccactggctc    203400
     gaacactacg gcgtcgtatc gctttcggtc attgccgcat taccggtgcc tctcaccccc    203460
     gctctcatgt ttgcggcgat ctcgcgactt ccggtcgcag aggtcatcgc cgcactgtgg    203520
     ctcggcaagt tggcgaaata ccatgtttac gcctggctcg cctcgcgatt tccggatcgg    203580
     cttgtgcgcc acggccggcg ccatgtcgat acgttgcggg cagtgctcgg caacggcacg    203640
     aaggctgacg gtggcacaac ccccacgcgg ggagggcgtc ggtagctcaa tacaccatcg    203700
     gggcgcctgt ctcacgtggt gaacgcattg attgccggca gccggccgcg ctttggcgtg    203760
     gttgcgttct tggcatgcca tggcatcaat cttcgctcta tgtgccttgc gttttttggt    203820
     ccggtttccc cgttgcagtt gactcctcga tattcgcgac gggcttgggc ggaggcattg    203880
     gcgtcacctt cgctgacaaa aacatgtcca ggtcttggcg gtcaaccact tccttctcga    203940
     gaagtaattg ggccagagca tcgagcttgg tccgctgtcc ttccagcgtc gcttgtacgc    204000
     gatgacttgc ttctgccaat agcttacgga cttcagcatc aatcatctgt gcggtgctct    204060
     cgctgtattc attgcgttcg cgctgcatta gccccgtccc agcaaagagc gggttcggca    204120
     tattctcgta cgtggccagg cccagctggt cgctcatgcc aaactgggta atcatctgcc    204180
     gagccatgtc ggttgcgcgc tgcaggtcgt tctgtgcgcc cgtggatacg tcgccgaaaa    204240
     tgagctgttc cgcaatacgg ccaccgagca agacatcgag ccggtcaagc agttcgctgc    204300
     gcttgagcag gtagcggtcc tcggttgggg tctgttgcgt gtaacccaac gccgcaacgc    204360
     cccgcggaat gatggaaact ttggagacac ggtcagccag cggccgatgc tccgcgacga    204420
     tggcatgtcc tgcctcgtgg aatgcgatag tttccttctc cttcggattc atcacgcggt    204480
     tctttttttc caggccgccg acgatccggt caagcgcctc gtcgaaatct gccatctcga    204540
     ccatttgctt gctcttgcgc gcggcaagga gcgcggcttc gttaaccaag ttggcaagat    204600
     cggcacctgc gaaccccggg gtccgtccgg cgagtttagt caggtcgacc tcaggagcga    204660
     ggacaacgcc cttgacgtga actttgagaa tctgctcccg tcccttgagg tcaggccggt    204720
     ccagtgcgac gtggcggtca aagcgaccgg ggcgaagcag ggcggggtcc agtatctcgg    204780
     gtcggtttgt ggcggccatg atgatgacgc ctttgttgct atcaaaaccg tccatctcga    204840
     ccagaagctg gttcagtgtt tgttcgcgct cctcgttgcc gccgaccgca ttcagtgctc    204900
     gcgtctttcc gagtgcgtca agctcatcaa tgaagatgat gcagggggct ttggtttcgg    204960
     cttgcttaaa gagatcgcgg acccgtgctg cacccacacc aacgaacatc tcgacgaagt    205020
     cggagccgct catgctgaag aatggcacgc cggcttcgcc tgccacggcc tttgccaata    205080
     aggtcttgcc agtgcccggg gccccaacca gcagcacgcc cttgggaatt tttccgccca    205140
     ggcgctggta ccgctgagga tctttcagga agctaacaat ctccgacagc tcctccttgg    205200
     cttcgtcgat tccagccacg tcggcaaaag tcacgccggt ctccttttgc atgtagacct    205260
     ttgccttgct cttgccaatt tccatcatgc tgccggcggc gccgcccacg cgcttgatga    205320
     gaaagctcca gataccgaaa aagatgacgg ccggcacaac ccacgagagg atcgtgctca    205380
     gccatttgtt gtcgggctgc ccgacgaagc gcacctttgc cgcttcgagc tcctgcacca    205440
     gctcaggatc ggccactcga agcgtggaga aggcgtggtc gccctttgcc tctcggcgga    205500
     tttcctcgat ctgctgcttg gcaaggagat tgtcgatacc ttctgtcgag aaggttccgc    205560
     tgatagcctg ctcaccaata gccacgtcct tgagcttgcc agccttcagt aggaccttga    205620
     aatcgctgta tgggatcgtc tcgacatgcc ccgacacgaa gagcgtctgg attgcaagca    205680
     tggccagtat ggtcacgagc acgtaccaga gggagaactg ttgctgtcgc ggttccatgg    205740
     gattcttctc caagtcgacc ttattgaaag tgagtctggt ctccaatgct gggaaggttg    205800
     gtgggcggcc tgggtaggcg ccggacaacc gcgcattggt atgcgttccc agtattgacg    205860
     cttggaaatc gccgaggttg accttcatca acccgcgaca ttggggccgc gcgcgcgggc    205920
     gcaagcgccg tggcttctcc atggttgtgc ccagccgata ggggatgtgt cgcggaaagc    205980
     aaacatgaca aatccattac ggcggcatga gactcaacag caacttgcgc tggcgcaaag    206040
     tatcgatcgc atacccacct aaagtattcc caagtcgcgt tgctcattga gcatccacac    206100
     agaatcagag gattccatgg ctgaggtaac gaagaacgag caccgtagcg catacctggt    206160
     tggcagcggc attgcgtcat tgtcggctgc cgtgctgctg attcgcgacg caggcttcaa    206220
     gggggagaac tgaccttgcc cctgttccac gaatcccata accgagggaa ttaggcagcc    206280
     cggtgttgct gagctgcgga ccagtttttc tcgaacgtca tggggctgac gtagcccagc    206340
     gtcgagtgga gtcggctggc attataaaag ccaagccagt caattacctc gtccattgcg    206400
     gcgcggcggg tagcgaactg gcgaccgtgc aggcgagcga ccttcaacga cccccacaga    206460
     ctctcagtcg gcgcgttgtc ccagcaatcg cccctgcggc tcattgacga gcgcatgcca    206520
     tacgccttca gggcgtcttg aaacagatgg ctgcaatact ggcttccccg gtcggtgtgc    206580
     acaatcacac cggcttccgg gcggcgccgg aaccaggcca tgcgcagcgc gtccgtgacc    206640
     aattcggcct tcatgtgtgg ttgcatcgac cagccaacca cctgccggct gaacaggtcg    206700
     atgatgacca ccaggtagag ccagccttcg gcggtcgcca cataggttat gtcgctcgtc    206760
     cagacttgat tgggtgctgc tgggctaaag tcgcgttgca gcagattggg ggccaccggc    206820
     aaatcgtggt tcgagttggt tgtcgcgatg tacttgcgct tgtggcgggc acggatgccg    206880
     tgcagcgcca tcagcttgcg aacacgctcc ttgcccaccc gcaccccacg cgccagcagt    206940
     tccttccaca tgcgcggcca gccgtactcc cccttgaccc cggcgtgaat cgccttgatg    207000
     tgggccaaca aggcatcgtc actgagtcgg cctctatctg gcctgtcggt gcttactgtg    207060
     cgttgcttgc gctggtgata gccgctgggg ctgaccccta acagctcaca caggaccgag    207120
     accggccagt aacgtcggtt tcgctcgatg aacgcatacc tcacaccgac tccttcgcaa    207180
     agtatgctgc ggcttttttt aaaatatcgc gctccatctt caagcgcgcc acctccgccc    207240
     gaagccgggc cagctccatc tgctccgggc tgaccggctt catacccgca ccagtcagct    207300
     tgccttcccg ctccgccttg acccagttat gcagcgtctg cgctctgatg cccagggtcg    207360
     cgctaaccac tgccatgctc tgcccgctct tcaccagccg taccgcttcc agcttgaatt    207420
     ccagcgtgta ctgcgcccgc tttgtcttgc ttgtcatcac atctctcctt gcttcagttt    207480
     aacctcagca agggattcgt tttgcggggg caagctcaaa catccacatc ttggaggaac    207540
     agcaggtggc cggtggtgcg ctcgatggct ccggtgatcc gcacaaaggc tatgtaactc    207600
     ggggcggtcg catgttcacc gaagagactt atgtctgtct gtggaacgtg ctcgacagca    207660
     ttccgtcgct ggatgatccg aaaatcagtg tcaagcagca ggcctgggcc ttcaacgccg    207720
     aatggcgctc ggattcacac gcccggctga tcgacgggca acgccgtatc ctcgacgctg    207780
     ccgatctggg tttcaacctc catgaccggt tggagatcat gcgattgctg gccacgccag    207840
     aagggctgct gcatacgctt cgcattgagg actgtttctc gccgcacttc ttcgagacca    207900
     acttctgggc catgtggcgt acgaccttcg ccttccagaa ctggcacagc gcgatcgaac    207960
     tcaaacgcta tatgttgcgc ttcttgcagg agttcccgcg tatccacacg ttggccggcg    208020
     tacggcgcac gccgctgaac cagtatgacg cgatcgtgcg gccgatggag caatggctga    208080
     aacagcaggg tgtggtgttc gaatatggca caaaggtgga ggatgtcgac tttgttgaaa    208140
     ccggtgacgg ccggcgaatt ggactgctgc gcgtggtgcg cggcggacag ccgatggcct    208200
     atgacgtgcg gcaagaggat ctggtgctca tcaccatcgg ctcgatgacc gccgacgcgt    208260
     cttatgggga cgaccaccat gcaccggaac tggtgcgcga caaacgcgat ggcgcctgga    208320
     ctctgtggga gaccatggcc cgtaaggaac ctgggctcgg gcggccgaat gcgttctgtg    208380
     gcaacgtcga cgaaagcaag tgggagtcgt tcaccttgac gatgcgcagc ccggcgcttg    208440
     tgcaccggat tgagaccttt accggcaatg cgccaggcac cggcggtctg atgacgttca    208500
     aggattcgag ttggctgatg tcgatcgtcg tgcctcacgc gccgcacttc gccggacagc    208560
     cgaaagacat gtacaccctg tggggctacg ggctcttcgt ggacaacaag ggcgattaca    208620
     tcgacaagac gatggcccag gcaaccggcc aggaaatcct caccgagctg ctgcaccatt    208680
     tgcattgcga ggacattctt gacgaggtct gtcgtaccac cactgtgatc ccggtgatga    208740
     tgccgtacat caccagcgaa tttgagcgcc gcgagccttc ggatcggccg ccagtgatcc    208800
     cgcacggagc gaagaacttc gcgctgcttg ggcagtatgt tgagatccct caggacgtag    208860
     tgttcaccgt cgaatattcg gttcgcggcg cgatgcacgc ggtttatggg ctgctgggct    208920
     tgaagaacga gatcccggcc atttaccacg ggattgctga cccaggcgct gcgtttgcgg    208980
     gcctgaagac gttgttgagt tgaaccgtcg gacggtttac ggttgatttg tatcaaccgg    209040
     aggttggaca tccgcgccta ggctgactct gtgtgaccgt tcctctcttt gggcagaaat    209100
     catgttcttc cactcccgac atctacgccg ctgggcagct caaatgctac tggtgtggct    209160
     gttgggtctg gccgtcggca tcgcaaacgc gtgcgctgtc gcggatgcag gtaaggccgc    209220
     agcgccggca tctggccacg tgtcagccca cagtcatgga caccatgcgg atgccgacga    209280
     tgatggctgt gacgatagcg gcaagattgc ctgccacagc ttctgcgaaa agtcctcaac    209340
     cagcattccc cgtgtgctgt cggatcatga caagcctctc attccggtgg ccgtgccatt    209400
     accgatgagc atggcatcca cgccggaggt ggaccgctgc agtgtgcacc gtcagtccaa    209460
     tccccggcca gcggacaagt tcgcgtctat accaatcgtc ttcctccggt tgacgctata    209520
     gcgctctgtc gctgtttggc agtgcgcggc tttgtcttac gtatcgcctt gacgcgcatc    209580
     cagtgcggac accgccaaag gtgcgttgca acacgccgtt ccatcgtcaa tgcactgaac    209640
     aaaagcggcc ttggtcggca ttcgccccga gcgtctcgat tgcgttcttt ctctactgcc    209700
     ggaaagtgtc tggcgctgtg ttgaacgcag tcgcagtgag attttcaacg tcacctccta    209760
     aaaggatttc ttccatggac actatcgaac tgaagatcaa gggcatgagc tgcggctcct    209820
     gcgtctcgtc ggttactcat gcactgcagc gagtgcctgg tgtggatgcc gtcgacgtgg    209880
     atctggcgcg cggtatcgcg cgcgtcagcg gtaacgccca ggccgcgccc gcaatgctgg    209940
     ccgcgctggc agcagccggt tacgaagccg agtcgcttag cactggcgcc ggagcgaaga    210000
     cggagcatgc ccaccatggt gacgtcccaa ccggcactgc tcacaagagc ggtggatgct    210060
     gccactgata gaccgctagg aggggcggcc gggcagtgca ccgatcggcg tccctaacct    210120
     tgaccttgcg aaggagttct catgtcgtcg cttcgatctc tctccaggca ccgccagtcg    210180
     ggccgcatcg gttcaggggc catcttcatt gcgtttgcgt tgattgccct gttcttcctg    210240
     ttcaccgagc accgggcaca tctgttcggc tggttgccgt ttcttctact gctggcttgt    210300
     ccgctgctgc acctcttcca cgggcacggt ggccatggag ggcacgcagg tcacgaggac    210360
     cagccgcgcg gttccgattc cggaagtagc cgcccatcgg ggtcgacggc cagcgaacaa    210420
     ccgcccgttc agggcgctca gcatcaccac cactaagttc ttctcagagg agcgccatca    210480
     tggaccaatc gacacctccc gcctatggct tatggtcgct ggtaatcatc aattccctcg    210540
     ttttcatcat cttcgcgttc agcttcgcca agccacaaag cccgcgcgac tggcgttcgt    210600
     ttggcgcgtt ctctgcgttc ctggtggcgc tattcaccga gatgtacggc ttcccgctga    210660
     cgatctacct cctgtcgggt tggctgagcg cgaagttccc cggcgtgaat ttcatgtcgc    210720
     atgacgctgg ccacctgctg gaggtgatgt tcggctggcg cgccaatccg catttcgggc    210780
     cgttccatct gctgagcgct atcttcatcg gcggtggctt ttggctattg tcggccgctt    210840
     gggcggtgct ttaccacaac cagcggagcc atacgctggc gaccaccggc gcctactccc    210900
     gtatccggca tccgcagtat gtgggcttcg ttttgatcat gttcggtttt ctactgcagt    210960
     ggccgaccat cctgacactg ctgatgttcc cagtgctggt ggtcatgtac gtgcgtttgg    211020
     ccattacgga agagaagtgg gcggagcgcg aatttgggga ggagtgggcg cactatgcgt    211080
     cgcacacccc gcggttcatc ccgaattttg gcgacaagca agcggatcgc caccaccacg    211140
     catgacaaaa agggggaggc gatgaagctc agttttcacg gtgcggccgg cacagtgacc    211200
     ggctcaaagt atttggtgga gcatcagggg cagcgcctgc tggttgattg cgggttgttc    211260
     cagggctaca agcagttgcg attgctgaac tgggagccgt tgccgttcag cgccgccgac    211320
     atcgatgcgg tggtgctgac acactcccat ctggaccatg ccggtgcgtt accgttgctc    211380
     gtgaaacagg gcttccgggg ccggattctg gcgacgccct cgacaatcga actatgcggt    211440
     ctgctgttgc ccgacagcgg gagaatccag gaggaggacg ccgcctatgc gaaccggcat    211500
     cacacctcca agcacgccac ggctttgccg ctgtacacgg aggacgacgc acgtcgcgca    211560
     atggaacagt tgcaccgatt gcctttcgac cagtgtgtgg acgtcgtccc cgacgttacg    211620
     gtgaccttgc gcccggctgg gcatattctc ggcgcggcct cggccgaact gacagcgggg    211680
     cagacgacag tgctgttctc cggagacgtt ggccgccccg acgacccggt gatgcgtgcg    211740
     cctgcgccgg ctcccaaggc agactacatc gttgtcgaat cgacttatgg ggaccggcta    211800
     cacgaaccgg tacccaatgc gcaggccgtg ctcggtgagg cgattgctcg cacagcacac    211860
     cgtggcggca tggtcgtgat tccggcgttt gcggtggggc gtgcacagtt gctgctgcat    211920
     ttgatccaca agctgaagca acagggcgcg attccagacc tgcctgtttt tctcgacagc    211980
     ccgatggcaa tagatgcaac cgagatctat caccgccatc acgccgaaca taagctgtcg    212040
     ctcgaagatt gcctcgggat gtacaaagct gcgcgcatga tcaggacccc ggaggaatcg    212100
     cgggcgctgg ctgggctggc cctcccggct gtgatcatct cggccagcgg catggccacc    212160
     ggcggccgcg tgctgcacca tctgaagcat ctggcgccgg accggcgcaa caccatcatc    212220
     ctggccggtt atcaggctgg ggggacacgc ggcgcgcggc tgcaggctgg tgagcgaagc    212280
     ctgcgcattc acggtgagga cgtcgccgtg cgtgccgaag tgatttcact gcagggcatg    212340
     tcggcgcatg ccgatgcaag ccaattgatc gagtggctgg gcagtgcgcc agcggcgccg    212400
     cgctcggtgt tcgtcaccca tggcgagccg gggccggctg atgcgatgcg ccagcgcatc    212460
     gagcgggaac ttgggtggtc cgccagcgtt ccgttgttgg gacagcacgt ggagttcgat    212520
     gtatgaggaa ccctcgccac agggcaagtc ttgccgtgcg tcggatgggc atcgagacgc    212580
     agcaggaata tgtcgtctac atgcatcgag actgccatgt ttgccgctcc gagggtttcg    212640
     aggcgcagac gcgagtactg attagcctga acggacgctc gatcatcgcc acgctgaacg    212700
     ttgtcgatcc gaccttgctg gagttggggg aggcggcgct ttcgaacagc gcgtggcgag    212760
     cgctggcgcc cgcgccgggc gaccggatca cgatctcgca tgccccgacg ctggactcaa    212820
     tgagccaggt gcgggcgaag atctacggcc acaggctcga cgcgtcggct ctggactcga    212880
     tcattagtga cgtcgccgct ggcagctacc ctgggacaca tatcgccgct tttctaagcg    212940
     cctgcgccgg cgggcggatg gatttgcagg agacgatcga tctgacgcga gcgatgctgg    213000
     ccgcgggcaa gcggctcgac tgggggcatg caccgatcgc ggacaagcac tgtgtgggtg    213060
     gattgccggg aaaccgcacg acgccgattg tcgtgtcgat catcaccgcg gccgggctca    213120
     cgatgccgaa gacgtcgtca agggccatta cctcgccggc tggcaccgcc gacgtgatcg    213180
     aaacgatgac gccggtggcg ctcgatttgg agcagatgcg ccgcgttgtc caacgcgagg    213240
     gcggctgctt tgtctgggga ggctcgctgg cgctcagccc ggccgacgac atgttgatcc    213300
     gcgtcgagcg cccgctggac ctcgacagcg acgcgcagct cgtggcatct gtgctgtcga    213360
     agaagatcgc tgccggcgct acccactccg tgatcgatgt gccggtcggg ccgaccgcca    213420
     aggtgcgcag tgacgcagac tacgagtgcc tgaagcaaat gctggagcag gtagcgcagg    213480
     cctttgattt gcacttgcag gtagtgcgta cggacgggac gcagccggtg ggccgtggca    213540
     ttggtccctc actggaggcg cacgacgtgc tggcagtcct tcagcgtgcc gagcgcgcgc    213600
     ccgaggatct gagcgtgcgc gctgtcgcat tggctggaca actgttggaa ttttgcggtc    213660
     acagcgagcc gggtactggc gtcttggtcg ctcagcggtt gcttgatagc ggcgccgcgt    213720
     gggccaaatt ccaggcgatc tgcaaagcgc aagggggctt acgcgagccg cagcgggcgc    213780
     ggctacgcga gcctgtgctg gccgaacgtg acgggatggt acgtgagatc gacagccggc    213840
     ggttggctcg cgtggccaag ctcgccgggg caccgaaggc acccgctgcc gggctcgaac    213900
     tgcatgtcaa gctgggggat cgcgtcgagc gaggtatgcc gctgttcacc gtgcatgccg    213960
     aagcgctcgg cgagttggac tacgcgttcg actacctgga ggctcacccg ctgatcgatg    214020
     tgggagattc gagatgacgc cactgatttt tgccatgccg ggcaatgaag cgatggcaga    214080
     gaagctggct tcggcgttgg gcgcagagcg cgggactacg acggtgcggc gctttccgga    214140
     tggagagtcg tatgtgcggg tggagtctgc cgtggagggg cggcgggtcg ccatcgtctg    214200
     cacgctagac cggccggacg acaagctgat tccgttgctg ctgttggcgg cggccgcccg    214260
     ggagaacggt gcgaccgacg ttggtctggt cgcaccttac ctcgcctaca tgcgacagga    214320
     tagttgcttc cagccgggtg agacggtgag tgcacggcat tttgcagcct ggttgtcgcg    214380
     tggatttgat tggctggcaa cagtcgatcc ccacttgcac cgcatcacca agttgtcgca    214440
     ggtctatgta atcccaacgc gtcacgtcca cgcggcgccg gctgtggcgg catggctgcg    214500
     cgcccatgtg acacgcccgg cgcttgtggg ccctgacgag gagagcaacc aatgggtggc    214560
     cgatgtcgca agcagggcgg acgcgcccat ggtggtgctg cacaaggtcc gcaaaggtga    214620
     ccgggatgtc gaggtttcgg tgccggatgt ggagcgctgg cgcgaccaca cgccggtgct    214680
     ggtcgatgac attgtctcca ccggtcgcac gatggccgag accattggtc atctgcggcg    214740
     cgcgggcttg gccgcgcctg tgtgcatcgc gattcacgcg gtgttttcag gcaacgcggt    214800
     tcaggatttg gagtccactg gggccgggct ggtggtgagc tgcgacacgg ttgtccatcc    214860
     caccaatgga atctccgttg ccccggacct agcgtccgcg gttcgtgaac tcatgcaaga    214920
     ccccgggggt gccacatgag tgccaagact ccgcacgttc acttcgagat agatctggcc    214980
     ggattttgca aagccgcgat tccgatgtcg ggttggcgct tcatcgtgtc aattggcgga    215040
     gaggaccgcg acgagccatc aacccaacgg gagggcaaga gatgaacagc accaaggcat    215100
     ttattggcag cgttccttcg accgacaccg agccggcgct acgcatcctg cgtcggttgc    215160
     tcgctgggat ggagaagccg cccgcactgc ggctgtggaa cgacacgctg cacgggcacg    215220
     atacggcggt cgatttcacg ttggtggtgc gggaccccag cctgttgcgt cagttggtgg    215280
     tggcgcgcag tcccctttta ttggctgacg cgtactttcg gggcgtgctc gacatcgagg    215340
     gagacctgta cggcgcgctc cggttgaaga accatttcga gtcgatccag ttgtcgtggc    215400
     gcgacaagct cgcgctgtta aaggacgcgt taatgacctt gcccctgttt cgtgtagttc    215460
     ttaacccacg attcacgcgg cctttttacg ctgtgcctcg taccagcgct gctcgtattg    215520
     catcgggctg aggtagccca gtgacgaatg caaccttcgg tgattgtaga aggccatcca    215580
     gtccatcacc gcctgacttg cctgctcacg ggtggcgaat ttgcacccat gcacgctggc    215640
     ggttttcagc cgcccccaga agctttccgt cggtgcgttg tcccaacagt tccccttgcg    215700
     gctcatcgat gattggatgc cccagttctt cagggcctgc tggaactctg cgctgcaata    215760
     ctggctgccc cggtcgctgt ggaatatcac cccaggaggc ggtctacggc gccaccacgc    215820
     catggccagc gcgtccttga ccaagcccgc ctgcatgtgc ggctgcaggc tccagcccac    215880
     cacctgacgg ctgaacaggt cgatgaccgc agccaggtac agccagccct cgtcggtctg    215940
     gatgtaggtg atgtcgccac tccagagctg gttgggctcc tcgggcttga agcgccgctg    216000
     caccaggtcg ggcgccaccg gcaggctgtg tctgctgtcg gtggtgacca caaacttgcg    216060
     tttcgtcctg gccttgatgg cgtgctgctg catgagcttg cgaacccggt ctttgcccac    216120
     acggatgcct cgggccagca gttccttgtg catgcgtggc cagccgtatt cgcccttgac    216180
     ctgggcgtgg atggcacgaa tgtgcgccag caaggcttcg tcgctgtagc gccggccagg    216240
     gccaccgtgg ccagactcgc ctcggcgcag ccagttgaag tacccgctcg cgctcacctc    216300
     cagcacaccg caggacacac tcaccggata cagctttctc atttggtgaa tccaggcgta    216360
     cctcgcagcg tgtcctgcgc gaagtacgcc gcggcttttt ttgcaacgtc acgctccatg    216420
     cgaagccggg cattctcggc gcgcagccga gcaatctcca ttttctcggg cgagacttgg    216480
     atgctcttgt caccaccgcc cgcaccgtcc aattctccct tggctgacag ccgcacccag    216540
     ttgcccaggc tcgctttggg gatgcccagt accttggcca ccaccgcaat cggctgaccc    216600
     gagcgcacct gccgaacagc ctccagcttg aactctcgcg tgtactgcgc acgcacctgc    216660
     ttttcactca tctctgaact ccttgtcggt attttcaaca agggctaaga actccacttt    216720
     tcaggggcaa cctcattaat gctgcccgct ccggacctgg gtgagatcaa accggatgcg    216780
     ggcttcgcat cccgggtcgc ccggcgcttc gcgcaccggc attcgcgcca cagcgatcgc    216840
     gccgcgatct cgttccacta tgacgtgtcc aacaagttct atgggttgtg gctggacgag    216900
     gagcgggtgt actcctgcgc ctacttcgag cagccctccg attcgctgga cacggcgcag    216960
     cgcaacaagc ttgagcacgt ttgccgcaag ctgcgcctgc ggcccggcga acggctgctg    217020
     gatatcggct gcggctgggg ggcgctcgta tgttgggccg cgcgcgagca cggtgtgcac    217080
     gcccacggca tcaccctaag cgagcgacag ctcgaatacg cccgcgagcg cattcggatc    217140
     gaagggttac aggatcgcgt cacggtggag ttgcgcgatt accgtgatct ggaaggcgag    217200
     ggtgtctacg acaaggtttc cagcatcggg atgttcgagc acgtcggcct gcgcaacctg    217260
     ccggcctact atgcggtggt gcgtcggatg ctcaagccgg gcggcctatt cttgaaccac    217320
     ggcatcacgc acgacgagga agggtggaac aagacagctg ccaccgagtt catcaatcgc    217380
     tatgtatttc ccgacggcga gcttgattgc atcagcaaca tccaactcgg catggagcgc    217440
     gcgggctttg agatccatga cgtcgaggga ctgcgcccgc actacgcgat gaccttacgg    217500
     cactgggtgc atcgcctgga ggctcagcgc gatgcggcga tcgctgaagt tggagaagcc    217560
     gcctatcgcg tctggcgcct gtacatggcg gcctgcgcgt tggagttcga ggccggtggc    217620
     tccggcatct atcaaatcct ggcgtccaat cgccacccgg gtaaatggcc tgtgccgatg    217680
     acacggcgtg atctgtaccg cagtcgaccg cattgggatt gggggaacta gcgctatgtg    217740
     cttttccgcg acggccagct ttggctccgg cacgctactg ctggcaatcg gcaccgtgac    217800
     gctgcgtatg gcgcgctgcc cggcggagcg cccttatgcc gccatcccat tgctgtttgc    217860
     gatccagcag cttgtcgagg gggtggtctg gctcagtttt ggtggccccg cttggcttaa    217920
     ctttgttgct acgcaggtgt actcattttt ctcccacgta ctgtggccgg tgtacgtccc    217980
     cttagcggca tggctgctag agccccgggg tccgcgccgc cgagggttgt tggcctttgt    218040
     ggttatgggt ctggctgtgg gtgcatacct gttgtacagc ctggtggtca acccgattca    218100
     ggcgcgcccg atggcaggcc atgtggacta ccagtccccg catttctaca ttgtcgcgtc    218160
     gatgacgctg tacctgcttt ccacgacggt gagcctgttg ctctccagcc atgtttgggt    218220
     caaggtgttc ggggcgctca cgctggccgc ttcgttcacc gcctacgttt tctatgccca    218280
     ttggttcatt tcggtgtggt gcttcttcgc cgcgctgctg agtggcgctg tcgcactgca    218340
     cttcatcgca ctgcgttcga ttccccaaca acggattccc tcatgagcac aaccaacaca    218400
     ttcgaggtgg cagggctact atcgccgctg gcagcgcgcg gcgtcgaaaa gcacctagcg    218460
     cagatgccgg gcattgagca tgtctcggtc aacgcggtgg ccggatcggc cacggtgacg    218520
     tacgaccagg ggcgcattga tccggaacgc atccgggcgg caatccagga ctgcgggtac    218580
     cactgtgcgg gcgaaatgtt gccccggcac atgtgcgggc cgatggagca tgctgtggcg    218640
     ccggcacacg cgcacggcca tattcagcac gagcatcctg agcggcacgt acatgccgct    218700
     ggtgggccgg ccacagcgga ggcgcccgtc gcgcacgacc acgccgcgat ggctcacggt    218760
     ggcatggatg caatggccca cgagatgggc catggccccg gtatggatgc caaggggatg    218820
     gcgcgcgaca tgcgcaaccg tttctgggtc tgcctggcgt ttacggtgcc gatcttcctg    218880
     tatgccccga tgggcatgga tttcatcaag ctgaagccac cgttcggctt ggatttgggg    218940
     ctgtggctgt tcctgctcgc caccgctgcg gtgatctacc ccgcgtggcc gttcttcgtc    219000
     gccgccgcgc gtgcgttgcg caatggcgtg ctcaacatgg cggtgttggt ggtgctgagc    219060
     gtcggcaccg gctacgtctt cagtgtcggc agcaccttca ttttcggcgg tgcgcagttc    219120
     tatgaggctg tgtcggtgtt gctggtgttc attctgctgg gccactggct ggagatgcgc    219180
     gcgcgcgcag gagcgtcgga agccatccgc gcgctgatgg atttggcccc gccaaaggcc    219240
     actgtcttgc gcgccggcaa ggaagtgact gtggcgaccg ccgaagtgct gctcgacgac    219300
     atcgtcctgg tgcgtcctgg cgacaagatt ccggttgacg gcgaggtgct cgagggcggt    219360
     tctcaggtgg acgaatcgat gctcaccggc gagtcgatgc cggtgaagaa gatggtgggc    219420
     gacaaggtga ttggcgcgac gatcaacaag agcggcagct tccgttatcg tgcgaccaag    219480
     gtgggtgccg acaccgcgtt ggcgcagatc gtcaaactgg tgcaggaggc gcagaattcc    219540
     aaagcgccag cgcagttgct ggccgaccag gcctcacaat ggctggtcgt gatcgccttc    219600
     ctgatcggtg tggccacttt cgctgtctgg tacttcgtgc tcgggcagcc ggtactgctg    219660
     gcactgacac tcacgatcac ggtgtttgtg attgcctgcc cagatgcact ggggttggcg    219720
     acgccgatgg cggtgatggt gggtaccggc ctgggcgcga tgaacggcat cttgttcaag    219780
     aatgctgcgg cgctggagga cgcgacacgg ctaaatgtgg tgatcttcga caagaccggc    219840
     accctgacgc ttggcgagcc ggaagtggtc gatatagcgg tggcccggga cgtaacgcca    219900
     gacgacctgc tgcgcgtttc aggctcggtc gaaaagctct ccgaacaccc gcttgcggtc    219960
     gcgatcctca agcgtgccgg cgcactggcc tccgaagcgg tgacggattt caccaacatc    220020
     gatgggcagg gcacgcaggc ggtggtggcc ggtcggctgg ccctgctcgg taatcggcgg    220080
     ttgatggagg ccaatggcgt tgaccttggc gcgctcaagg cagatgccga ccgtctgcag    220140
     ggccaaggcc gcaccgtggt gcacgtcgca cacggcggtc gcctgatcgg tttgatcgcg    220200
     atcgccgacg cagtgaggcc gtcttcggcc gagacgatca aggcactgca tggccgcggg    220260
     gtgcaggtcg caatgctaac cggtgacaac cgttcgaccg ctgagcgcat tgcgaaggaa    220320
     ttgggcatcg acatcgtgct ggccgacgtg ctgccgggcg acaaggccgc aaaggtcaag    220380
     gaactgcagg ggcagggcaa gaaggtcggc atggtgggcg atggcgtcaa tgatgctccg    220440
     gcgctgacgc aagccgacgt gggcttcgcg atcggtgcgg gcaccgatgt cgcgatggag    220500
     agtgccgatg tggtcctgat gaaaagcgat ccgctggatg tggtcggtgc gattgaactg    220560
     tcccgcgcga ccttgcgaaa gatgcatcag aacctgtggt gggcggtcgc ctataacgta    220620
     gtggcgttcc cgttggcggc cggcgtactc tacccattca cgatcagccc cgaggtggcg    220680
     gcgattacca tgtcgggcag ctctgcgcta gtggcgatta acgcgctaat gctcaagcga    220740
     acccggctga ctggaatccg acgcgcaagc gcggcgacgg tccacaacgg cgtgaccgct    220800
     ccggtggccg ctcacggcgc gggctgaagg catcatgctt aatcaatcgt ccgccactcc    220860
     cgcacccctc gatgcgcggg ccgtcaggcc agcgttggtc gtgctgcttg ctctggtatt    220920
     tgttgtctct ctcggctatg gagtcgggct gccgttgctg cagttgtatc tggcgcagta    220980
     cctgcctggt gcgacgcggc aaacgctggc gtggcacgtt ggcatgctgg gaggaatcta    221040
     cacgctcgcg ctgttcatct ttgcgccgtg gtggggccgc cagtcggatc atcgtgggcg    221100
     ggcggcggcg ctgactaccg gcttcgctat gtttgtgctg ggaaccgcga tggtcgcgct    221160
     aatacccagt ctcatggcga tctatggcgg tcgattgatc gccggggcgg gggcagcggc    221220
     tatcgtgccc ggtgcccagg cctatgtgac cgacatcagc aataccgagg acaggagtcg    221280
     gcgctttgtg ctgatcggta gtgcatcgtt cgttggcttt ctcgcgggcc ccgcgttcgg    221340
     tagttggctt gccgggccgc tgatgggcat gcctgcaggc cagatgccca gtatggtcaa    221400
     ctggcccgcg ttggtggtcg catcggtcgg actgccactt ctgttggcgg ttcgccgctg    221460
     cctgagcacg accaagccga tcttgctcga cagcggctcg gtgcagatga cccggcagcg    221520
     caagcgcttc gttgctgtat cgatgctgtt agccctgctg gcgtcctttg ccgcaggtac    221580
     cttcgaagtc ggcttcagcc tgtttggtgg ccagacactg cgcctaccca actcgatgat    221640
     tgcggtgatg tttgtcacgt gcagcctggc gatgctcgcc gcgcaggctt tgctgctgct    221700
     tccggcagtg cgcaagcata tcgaccatcg ctgggttgcc ggcgcatttg ccggctcagc    221760
     ggtggcactg ggctttgccg cactggtgcc cgatgccgcc gcgcttgggc tgctaatcgc    221820
     cgtggtggct accggcgtcg gcatgattgg accggtgctg tcttatgagt tgctggaagg    221880
     tgaccgtagt ttcgctgggt cgctgttggc aaggcaggca gccgcaggca acctggggca    221940
     ggcactaggt tcggtgagtg ccggtaccct gtttggatgg aatacgttcg ctccattttg    222000
     ggcagcggcg gctgtgttgc tgcttggtag tgtggctgca ctgcgttggt ggggcgcggc    222060
     gcggcaggct gaacgtcagc cagagcagcg cagctttcaa gcagaaggag aaaggcagac    222120
     gagggaaggg cggggcgcat gaacaacaat gaaaattcct cgtgctatgt gcgcgcattg    222180
     tgcttttgag gccgctttcc aatggcagcg caccgaaccg gcaattcgtg gatggtgtaa    222240
     cacgtgacgg cggatgtgac ctatcagcgc catttgctcc ttccaattga actggggttc    222300
     aaagccgtta ttgcatagct cgacaggctt gcgcgcattc ctcacacgca cgtgcgcaag    222360
     tttgacagtg gtcgtgtgca tgcttcgcgc actctgcgcc gcatttctga cagatggttg    222420
     cgcataatac gcaaacggct ttggcttggc tgctgccgcg tgccatataa ccaacggcag    222480
     tctggcacaa ctccgcgcaa tcgagatcca ggcgaataca gtcggcaagt tccgccgggc    222540
     ttggctcgtt gaggcaagcc acagcacagt gcaagcatgt gacctgacac gcgttacagg    222600
     cgtcgagaca ttcttgatag gtttggtgag acatcgtcgt tctcctgggt ggttggcgta    222660
     ccgacatggc atgcgcaccc acgagaaagc aaggacggcg ccttgtgcca aagaggcggg    222720
     gcacgttgag tcgcaaatgg ccagatctgt ccgaaccgta atcggaccgc catgtggcgg    222780
     tcatgtgcgc tttccgccag tggcccatgg tgaaccgaag tgttcgcgct ctcggcggaa    222840
     tgcggtcggc acgtggagac gcgcgtgcgc cacgacgacc acaaggccat gtcgcggggg    222900
     tgtgccggat cgcattgggc agcaaatcac caacgtagca gcgccacagc aaagtggtct    222960
     agaactagcc tctggtggac ggtgtcgagc cggtgccgaa cccgtacacc tctatgcgtc    223020
     gtgacatcac ccagcgggcg ctaccgcgcg caccaacaac ttcggtacgc attgccatat    223080
     cgtgctgttt tgggacaccg attaccatct catcgcacgc tagttgctcg tgggtggtct    223140
     gacctgcatc aacaggctcc gtgtgcaacg acttaagcta aatgcacatt cccaagaaac    223200
     ggaggtgcgc catgtccgca agtcgccgcg cattgcgagg ctcagtcacc gtcctgttcg    223260
     cgattctgag cgagatcgct ctcggccatc caaagctggt ttcatcgaga ccagcgaaca    223320
     attctgaagt ggccgcccca aagcgaatcg aattgagatt ttcagaggaa cttgtattcc    223380
     cgccttcggg aggtaatcta gttatggcgt ggctgccggg ccgggcgctt cacgggccga    223440
     tgaagattcc ggctgaagta tcgcgtggcg gagacgccaa gacggtcgtt attcagccga    223500
     ctcaacctct catggctggt tcctatcgcg ttgactggca agcggtctca tccgatgggc    223560
     atcctgtcaa tggcaggatc gtattccgag tacgatgaag cgccgatcct catcgtttga    223620
     gtccatcgga gtggcgcgcg aaaccggcgg ctgtttcggt ttgcgaccca aaatgcccgc    223680
     caagcccggc ttggcagtag tcgccgcagt gtgcaaagaa ctatacagac aatattgcgg    223740
     catcgatgca acgcggtagg cggatagaga accgtgtgcg cccgtcaatg cgcgcaacgg    223800
     tgatggtgcc gccgtgcgcc gcaacgatcg ctttggtgat ggccaagcca aggccggcac    223860
     tttccgactc gggccgcgcg cgcgatttgt ccgcccggaa aaagcgctcg aagataaatg    223920
     gcagcagctg cggcgcgatc tcgctgccgt cgttgtctac cgaaaccgtc atgccgtcgc    223980
     gatcatcact gaccgagacg accacgcggc catgtcgcgg ggtgtgccgg atggcgttgg    224040
     agagcaggtt gctcaacgca cggcgcagca tgagccggtc tcctgtgacg tgtccatcgc    224100
     cccgcgtttc gagcaggaca gccttgtctt ctgcaagcgc gtcatagaaa tcgaacaacg    224160
     cgcggatttc gtcagcgatg cggatgtctt cggcgcttgg cagcgtcagg ctgtgctcca    224220
     tcttggcgag gtacagcatg tcggacacca tgcgtgccag gcgctgcagt tcctccgcat    224280
     tggaggtcag cacatcgcga tacttcgtgc cctcgcgcgg ctgggatagc acgacctccg    224340
     tctgcgtgag caggttcgtg ataggcgtac gcagttcatg ggcgatgtcg gtcgagaagt    224400
     ccgacaagcg gcggaaatcg ttctgcaggc gctccaacat gccgttcagg gtcgcggcaa    224460
     ggtccgccac ttcgactggc acggtatcaa caggcatgcg ttcatcgagc ttgtcggcag    224520
     tcaccgtgcg cgcccgcgag gccatggtgc gcaaaggcgc caggcctcgg cgtgcagccc    224580
     accagccgaa taggcccgtg gccagcgctg cgacggcgat atagaaagcg agcgtcccgc    224640
     ggaaggtgtg gaggaagtgg gcgtgaatgt ccgtgttgat ccccagcagg acatcaagct    224700
     cgcccgatga tccatctcgc agtgggatgg ccgcgtgcat gccccgatat tgctgaccgc    224760
     cttgcgccca aacgagggtt tcgctggtat gccgcaactg cgccagcgct tgcgttgccg    224820
     cttgaaaatc gaaatcctgg gttacgtaca gcatgtgccc gtccgaaccc tggatacgag    224880
     ctacgagatc ggtgcgatgt tggattgcct cgcggatgcg ttcggggacc tgttcggcgg    224940
     gactcgattc gacaatcttt tcaatgacgc tgacgttctc gcgcagcgcg gtgtagtcct    225000
     ccaccgcaaa gtgctgatcc atggccagcg caatcaccac gcccaggccc agcaagacgg    225060
     ctgccgaaca cagcgagaaa tacgcggtga gccgagtggt cagggagaac tgccccatca    225120
     ggccgcgtcc tcgggcgctt ccagtacata acccatgccg cgtaccgttt ggatcagctt    225180
     cggctcgaag tggtcgtcga tcttggcgcg caaccggcga atggcgacgt cgatcacatt    225240
     ggtatcactg tcgaagttca tgtcccagac ctgcgaggcg atcagggagc gaggcaagac    225300
     ctcgccacgg cggcggacca gcagctccag cagggagaac tccttgctcg tcagcgggat    225360
     cttctggcct ccgcgtgagg cacgacggcg agccaaatcc agcacaaggt cggccacttg    225420
     gattcggtcg gacgagacgg caccggttcc ccggcgcagc agcgtgcgga cccgggctag    225480
     caactcagca aacgcgaatg gcttcaccaa gtagtcgtcg gcgcccattt caaggccttt    225540
     gacgcggtcg gccacgctgt cgcgggcggt caagaacaac accggcaccg cctgttccgc    225600
     agcgcgcaac gattggacga tctgccagcc atccacgtca ggcagcatca cgtccagcaa    225660
     cagcaagtcg tagtcgcccg acatggccag atggcggccg tcagtaccgt tgcgtgccag    225720
     atcgaccaca aagccggctt cggtcaggcc ttgctgcaga tactctccgg ttttgggctc    225780
     gtcctcgacg accaacagtt tcatatcgcg cctgaatcac ttcctatgat ttatgggctg    225840
     tagagtaccg cgctgcaggc ggcatcacac caagatgacg gatttgtaat gtttcagtca    225900
     ggtcggggta gcctggcgct gggtagcctg cacccacctt tcagagtcgg acattttgtt    225960
     aaggaaatct cgatcatgcg cagcaatcgt gcatccggcc tcgtgctacc gaacctgccg    226020
     cggcggcggt ttgtgcaagg tttggctgcc ggcggtgtca tcgccggttt gggcctgggt    226080
     ggtttcactt cggcggcatc cgctgcgtcc accgcgctgg ggaccgcacc agtgctgcgc    226140
     ggcaccgaat tcgacttggt gatcgacgag acgccggtca acttcacggg caagccggct    226200
     atggccacga ccatcaatgg catgctcccg gggcccacgc tgcgctggcg cgagggtgac    226260
     accgtcacct tgcgcgtgac caatcgcctg cgcgagccga cgtcaatcca ctggcacggc    226320
     attgtcctgc cgttcgagat ggatggcgta ccgggcatca gcttccacgg cattccgccc    226380
     ggcgagacct ttacctaccg cttcaaggtg cgacaaagcg gcagctactg gtaccactcg    226440
     cattcgggct tccaggagat gaccggggtc tatggcgccc tcatcatcga tgccgccggc    226500
     ggtgacgcga tccgggccga ccgcgattac agcgtgctgc tgtcggactg gaccgacgaa    226560
     gatccgatgc gcgtcctctc caagctcaag acgcagggcg actactacaa ctaccaccag    226620
     cctacggtgg tggacttctt ccgcgacgtt tccaacgatg gctggaaggc ggccatggaa    226680
     aagcgggcca tgtggaacca gatgcgcatg aacccgaccg atctggccga tctctccagt    226740
     gcaacgctca cctatctgac caacggcgtc acgccggccg gcaattggac gggcctgttt    226800
     acgccgggcg agactgtgcg gttgcgcttc attaacggct ccggcaacac gttctacgac    226860
     gtgcgcatcc cggggctgaa actcaaggtg gttcaggtcg atgggcagaa catcgagccg    226920
     gtcacggtgg acgaattccg cttcggcccc ggcgagactt gcgatgtgct ggtcgcgccc    226980
     aaggacgacg cctacaccat cttctcgcag tcgatggacc gtactggtta tgcacgtggc    227040
     acgctggctg tctgccgggg cttgcaggct gcagtgcctg cgctcgacaa ggtggaatgg    227100
     ctgtccatgg ctgacatgat gggtgacatg ggcggtatgg gtggcatgag ccacggtggc    227160
     atgtcgggca tggaccatgg tgcgatgtcc ggtatgaacc acggcggcat gcccggtatg    227220
     gatcatggcg acatgcagat gatggacgac actggcatga ccatgatgga ctccggcggc    227280
     atgcagatga tggaccacag ccagcatgcg gaatccggcg gagcggctaa cagcttgaag    227340
     gtgccgagca agacagcacg gcacgcgcgc acggaatacg gtccgagcac cgatatgcac    227400
     gtcgacatgg cgcgcaccaa cctggacgat cccggcgtcg gtctgcgcaa caacgggcgc    227460
     cgcgttctgg tgctcgccga catgcatacc atcggcggtc cgatggataa gcgcggtccg    227520
     gagcgcgagg tggaactgca cctcaccggc aacatggagc gctacacgtg gtcgttcgac    227580
     ggcgtggagt tcggcaaatc gacacctgtg cacttccgtt atggcgaacg gctgcgcgtc    227640
     atcctccaca acgacacgat gatgacgcac cccatgcacc tgcatggtat gtggagcgaa    227700
     ctggaagcgc cggacggtac gttcctcgcg cgccggcata ccatccccgt ccagcccgcc    227760
     caacggatca gctttctcgt cacagcggac gcgctgggtc gctgggcctg gcattgccac    227820
     ctgatgttgc acatggatgc gggtatgttc cgcgaagtgg tggtggtctg atgctcgact    227880
     ttcacagcgg attgatcatg cacaagcacg taagaacact gttgactgtg gcgctggctg    227940
     ccgccggcat cggcgttgcc tcggcccagg aaatccaact gatgaacggg gagacaaccc    228000
     cggcgtccca atctggcgct cagaatactg gcagctcaat gcaggggatg gaccacggct    228060
     cgatgcaagg catggaccac ggcagcatga agatgcagga tggttcggcg ccgcccgacg    228120
     cacgcgatcc cgatgcttac tcgggcggat accagctcgg caccggcaaa tacgcactgg    228180
     gcgatccccg ccacatgatg atgatggcgg acgcgcacaa ctttggctca gtgctggttg    228240
     accggctgga gtgggtgcac ggtaacgatg ccaatgcaac cgcctacgaa ttgcaagccc    228300
     ggttcggcag cgtgtacaac aaagcggtcc taaaagccga aggcgatgtc tcaaaggggc    228360
     gcttcgaaga ggcgcgcacc gagttgctgt ggagccatgc cgtcacaacg ttctgggata    228420
     cccagctcgg tgtgcggaat gacacgggtt tcggccgacc cacacgcaac tgggtggcct    228480
     tcggcgtgca aggtctggct ccatactggt tcgatgtcga ggccaccgcc tatgtgggca    228540
     atagtggacg cacggcattg cgtctgtcca gcgaatacga gctgttgctg acccagcggc    228600
     tgatcctgca gccgcgcatc gaagccaact tctatggcaa gcgcgatccc gatctcgccg    228660
     ttggcagcgg gctttccaac gcgacggtgg gcttgcggct gcgctatgag ttcagccgcc    228720
     agtttgcgcc ctatatcggc gtcgaacgca gtcaggcatt tggcggtacc gccaacatga    228780
     tcgaagcggc cggtgggcgc cgcggcgaca cccgttttgt tgcgggtgtg cgcctctggt    228840
     tctagttttc tcaactccca accacaaggg tgtttctatg ttcacgtctc gttttgccac    228900
     caaggccatc attggcacgt ccttggcgct tctggcttcg gccgcgttcg cgcatcccaa    228960
     actggtctct tcgacgcccg ccgatcaggc ggaagtgact gcgccgacga agatcgagct    229020
     gaagttctcg gagaccctca cgacacaatt ctccggggcc aatctcgtca tgacggagat    229080
     gcccggcatg tcggggcata acccgatgaa ggttggcgca aaagtctccg ccggcgacga    229140
     cgccaagacg atggtcatca cgcccgcaca accgctgacg accgggacgt acaaggtgga    229200
     gtggcgcgcg gtctcgtcgg atacccaccc gatgacgggg aatttcacgt tcaaggtgaa    229260
     gtaaggccat ggcggacgat tggctcaata tcgccctgcg ctttgggctg tacctggact    229320
     tgacgatcct tttcggggtc tcgctgttcg gggtccaggc gttgcgaccc gatcaccggg    229380
     ccacggcgat tgcgcgccga tacgtccgtg ccgtcggagt cactgccgca ttgggcatcg    229440
     tgctgtcgct ctggagcttc gttgtcatgg ccaaggcgat gacgggggcc accgagtacg    229500
     ctgaactcac cagccatgtc ttcagcatga tgctgaccac caccgcggtt ggcctggcct    229560
     ggatggcgcg attggtggcc ctggccggat gcttggtcgc cgttgcgcgt ttgcggaagc    229620
     acccagcgcc tcacttcggc gtgtgcgccg ggctgggtgc ggtggctctg ctaacggtca    229680
     cttgggccgg gcatggggcg atggacgacg gtgtgaaggg ataccttcat ctcacatttg    229740
     atatcgcgca cgttttggcc gcgggcgcct gggttggcgc attggcagcg tttgtgctgc    229800
     tggcgtcgac aagacaagcg gcctcatcgg aaacggtgga aatccttagt cacacatcca    229860
     atggcttcgc gcgtcttggg acgctgattg ttgccacgct gtttgcgaca gggacgttca    229920
     actatttttt gatcgttggg ccgacgatta acgggttgtt caccacgcca tacgggcgct    229980
     tattgttgat caagctggct ttgttcgcgc tgatgctcgg actggccgca gccaatcgtt    230040
     atcggctgag cccacggctt gcggcggcgg ttagggccgc agaccacgtc cacgcggtga    230100
     tagcactgcg ccgcagtctg gtcatggaaa ccagccttgc catactgatt ttggcgttgg    230160
     tcgcttggct tggtgtgctt tcgccgcctg gaacctgata ctgcttacct gtttgccgga    230220
     ggaaccatga tgatgaaatc gccgactgcc aagcccgtgt ccgcgacaag acggtccctg    230280
     attgcaggtc tgttactgct gcctgccgta gccctggcgc aaaaggccgg atcgaaaccc    230340
     gtgatccagg tgtggaaaac gccgggttgc ggctgctgca aggattggct tgcccacttg    230400
     cgggacaacg ggttcgacgt ggttgcacat gacgtcgagg aaacggtgga agccaggcga    230460
     aaggctggca tgccagagcg ctatgcctct tgtcacacgg gcatcgtgca ggactatgcg    230520
     ctggaaggcc atgttccggc acgcgaaatc aagcgtctgc tgcaggagcg cccgaaagcg    230580
     atcgggctgg cggtccccag catgccgctc ggcgcccctg gcatggatgg gccggcatac    230640
     ggtaatcggc gcatgccata caacgtcctg ctgatcggat tggacggaca ggccaccgtg    230700
     ttccgcgcat acagctgatg gggtgtgacc gtctccttgg cacccgcaat cgtgccaccg    230760
     gtcagagcgt tttggcgatg gcttcaatcg gcttgatacc tgcgccgaac cgggccatgg    230820
     tttcccggtg ctcggtgagg ctggtgtagg gcacatatcg gatgccaagt tccgatacgc    230880
     ggctgaaggc ggggcgtgca agttgagcgc gcacgtcggc ctctcgtcca tccggcgcaa    230940
     ccaggaacag gtgtttcttc gccggctgtt ctgtgcccag ggctaaatca agcagtcgca    231000
     cgatgcctga gtagatcgaa gtggtgtgtt cgacctcgaa ggcggcttcc acctccagcg    231060
     aagcagcgtt cagccaaacg acgtcgataa ggggcacggt gtcggcaccc gctaccaaca    231120
     gcgagttcgg caacgttgcc aggcagccat cgctgagcac gccgccgttg taagggcggc    231180
     tacggtcgtt ggttgccacc catactgcga agcccagtgc cttgccgaga tcgcgcaacc    231240
     agccttgcac ctctgtatgg gaggcatcgt cggttcgtcc cgcctgaagt tgtttggcga    231300
     aggaggccgc ttcctcgcgc gccttggcca gattgctctc ccactcagcg atcgtggcag    231360
     catcgccttc tcgcggcggc gccggatagc gctccattcc gatatcgaac agcagtccgg    231420
     caactgcgcc caaatcgttg gacaggaggt cgcggtagcg accattcagg gacagcacac    231480
     cctcgcgcat ggccaggtag tggtcccatt tcccgagctt gacgcgagaa cccgtcagcg    231540
     cgttgtatcc gttgacgatc gcggtgttga agggaaccgc cagcgtcggg tgaatgaagt    231600
     acagcaggtt ggcgacggcc gggcccagcc ccttgatgcc gtgttggttc aactgctgaa    231660
     tcgcttgaac cagttcttgt tcggtgtcgc agcaattgca cgtatgcagc agcctggcga    231720
     acgctcgctg atgatcggca ttctcataga tgtccgggat gcgcagtttg ggcttccaga    231780
     ggaaggcatg gtccgccccc ttgaagatct ggcgctgctc tgcaatcgag gagaccacgg    231840
     tttcgagggg ggacccgcga taggcgttgc cgaatgtccc agcttgaatc tcattgacga    231900
     ccgcgccgat gccgcgccga atggagcgga agttcttgag gcgctccggc cagagaaacc    231960
     acgtctgata tgtcccgtcc ctgtcagctt tccatcgctc aatgagcgtt cttgtcaaat    232020
     cggtcatgca cgccagtgtt cttcaaaaga tcggagtcta tcttctcaaa gaatgcgttc    232080
     aatttgtcgc tcgtatgcgc gtcttgtttc gataaccagc gtgctggtgc cgggaatgct    232140
     gtatgggcgc aaactgattt cggcggacac cctggaacgt gcaccgcagg cgtcaggtga    232200
     taccagtgtg gctcactgag agcagggtcg gtggccgtac ggccaattgc gaaggtgtat    232260
     gtttttgaag tgtacgttgc cccttgaatc catagaggcg cgctccaccg cttgatccta    232320
     tgacctattt tcttttcaaa tcagcacctt agatcggatg tggcggattt tttacgaatc    232380
     ccggccatcc ctcccattgg cccaggtggc gaagccgcgc cgcagcgagt ggctgctgta    232440
     gctacccgcc tgcgccaggc ctgcgtcacg aaacagcgaa cgcagcaacg gcacgatgct    232500
     gctggcctgc agcccgtcgt cggccatccg tccccagcga tcgatccgtc ggaacacggg    232560
     gccgccggcc aatccggatg cgcccagcca agcctcgtag gcggcgaccg gacacaagcg    232620
     cgacagggcc ggtgccttgt gggtggtgcc cacgtggttg cggtccgtct tggtgcgcgg    232680
     caggaagatc gtcatgcccc ggccggcctc gaccgtgatg tgctcgatct gcagccggct    232740
     cagttcgtcg gagcggaagc cccgccagaa gccgatcagc accagcgcct tgttgcgggc    232800
     atgaacttgt agtggatgga cgtttcccgc ggccgagtct gccgcaattt gcgcgtccag    232860
     ccacgccacc aactgctcca gttgggcgag ctgcagcggc ttggcacgtc gctcctgggc    232920
     cgggtgcagc gcctggatgc ccttcagaac cttgcggaca tgtggcgctc gggtggggtc    232980
     cggaaagccc tgcgagatgt gccattgcgc gatcgcagcc aaacgctgac gcagcgtgtt    233040
     gatggaaagc gtctgcgcgt gctcggccaa atactgcgca atgttgtcgg cgctggccgg    233100
     caggaagcct ccccattccc gctcgaaatg gcggatggca gactgatagc tgcgtcgcgt    233160
     gtgatcgcgg gttgcggctt ccaggtatcg gtcgatgtcg gccatgaagc agtcgtggtg    233220
     ggctggatgg ccatattgtc gccgctgcag caccgtgatg tggcaccggt caacagtgac    233280
     cgtactcctt gccatcaatc catatttcta ctacattgga aatatggaag aaaacgacgt    233340
     catccgatcc ctcgccgcgc tcgcgcacag cctccgcctg caagttttcc gcatgctggt    233400
     ggtggctggg cccacgggca tgactccagg tgcgatcgcc gaacagctcg acgtgccggg    233460
     tgcgaccttg tcgttccacc tcaaggaact gatgaacgcg cacctggtga cgcaagagcg    233520
     cgacggccgc aacctgatct accgcgcggc ctacgaccat atggatgcac tgttgggctt    233580
     cctgaccgcc aactgctgcc agggcgaagc ctgcctggaa gccgacacca ccgcatgcaa    233640
     atgctgactg gagatgccaa atgaagcgat ttcacgtaca cgttcacgtt gacgatcttg    233700
     gcaagagcat cgccttctat tcgaagctgt tcgccgccga gccggcgcgc gtggaaagcg    233760
     actatgcgaa atggatgctg gacgatccgc gcatcaactt tgccatctcc acgcgcggca    233820
     gcgccgccgg agtggaccac ctcggcttcc aggtcgatga cgctgccgag ttggccgagt    233880
     tgaaggcgcg agccgaagcc gcagacatgg cgttgctgga cgagggcgag accacctgct    233940
     gctacgcccg tagcgacaag cactggatca ccgacccgca gggcatcgcg tgggagcact    234000
     tccattcgct cggcaacatc ccggtattca gcgaaggcaa gaaggaagaa gttgctactg    234060
     aaggctccgc ctgctgcgct ccgcgtgcgc cgggtggaaa gccgattggg attgcggtga    234120
     agtcgggttc gtcctgctgc taggagcccc tccatggccg acaagaccta caacgtgctg    234180
     ttcatctgca ccggcaattc cgcgcgctcg atcctggccg agggtctgtt gaaccacctc    234240
     ggtggcgacc gattcaaggc cttctccgca ggtagccacc ccgccggtgc ggtgaacccg    234300
     tttgcgctgc atgccctgca gcagttcggt atcccgacgg acgggttccg tagcaagagc    234360
     tgggacgagt tctcgcaaga cggcgcgccc gaactggact tcgttttcac cgtctgcgac    234420
     aaggcagccg gcgaggtgtg tccggtatgg ccgggccagc ccatgaccgc ccattggggt    234480
     gtggttgatc ctgcagcggt ggagggttcc gacgagcgca agcagcaggc catccgcgat    234540
     gcagccatca ccctgaagcg ccgcatcgag ctgttcctgt cgttgccaat tccaaagctc    234600
     gataccgttg ccttacagaa ggctgtgcgc gacatcggcc agcaataacc cgatttcttc    234660
     ccatgactac aaacgtcctt atcctctgca cccacaactc cgcacgcagc gtgctgagtg    234720
     aaggcatgct caaccactgg gcacaaaagc tcggcaaaga cgtgcgcgcc tacagcgccg    234780
     gtagcgcgcc gagcggccgc ctcaacccgt ttgcattgga agccctcacc aacgccggca    234840
     tcgacaccgc cggttatcgc agcaagagct gggacgagtt cgtcgctgac ggtgcgccac    234900
     agatgcgcgt cgtcatcacc gtgtgcgaca gcgccgccgc cgagcaatgt ccctactggc    234960
     cgggcagccc ggtcaaggtg cattggggct atgccgaccc atccaacgct ccaggcggcg    235020
     acgagggtaa gcgacaagcg tttgaggtga cgcgccaagc catcggctac cgcatgctac    235080
     aactgctggc gttgccactc gatacgctct ccaacgccga gttgcaagcg cagctcgaac    235140
     gcatctcgca agactgaacg ccatggtgga tctgcgcagc cggcttgccg ccgaagcatt    235200
     gggcacggcg ctactgctcg ccattgtcat cgggtccggc atcatggccg agcgcctggc    235260
     gggcggcaac gtcgcggtgg cactgctggc caacacagct gccacggtcg gcggcctcta    235320
     catcctgatc gaggtgttcg ggccgatcag cggcgcgcac ttcaatccgg ctgtccgtgc    235380
     ggtcatggcg gcacgcgcag aactgcccgg ttcggcgctc gctccctaca tcgcggcaca    235440
     gcttgtgggg gcggtactgg gtgcatggct ggcgcacgcc atgttcgaca tgacgatcct    235500
     gcagttctcg accaaggtgc gcagcggacc ggggcaatgg attgccgagg cggtggcgac    235560
     cgcggggctg ctgctggtga ttctgcgtgc gccgaacggt cgtgcctctt ccatggtggc    235620
     ggcctacatc ggtgcggcct actggtttac ggcctctacg tcgttcgcca acccggcggc    235680
     cgcgttcgga cgcatgttca gcaacagttt cgccggcatt gccccaagca gcgtaccggg    235740
     ttttgtgctg gccgaatgcg ctggcgcggt gctcggattg atgctgcacc ggatgctgga    235800
     gccgcgtctg gcgcgtcgcg ggcatcccaa cgtcatcgag tcctccggcg aacacccggc    235860
     ggattgactt ctccaatgag cacacctgac tttcgccctg cacgccctga ggactatcca    235920
     gccattcgcg cgctgctcat tgaggaaggg ctgccgagcg aggatgttgc ggtcgggcaa    235980
     gtcagccgct tccacctggc tgtgcaggat ggagagcttt tggcttgtgc agggttggag    236040
     ctatacgggt cggatgcgct gctccgatcg gtcgccgtcg ccaaatgcgc ccgccagaac    236100
     ggtcttggcc gcgccctcgt gggaatcgcc gagcgcgatg cctttgccat tggcgtaagc    236160
     cgcctctttc tgctgacgac gacagcagca ggctacttca ccgcgctggg gtacgagcgc    236220
     ttcgaccggc gcttggcgcc tggctcgctt caatccagct cgcaattcag cttgctgtgt    236280
     ccggcgtccg ccacgtgtat gacaaagaac ctgctgtaat cgcgggaaaa tgcccgtttg    236340
     tgtcgcgacg acctcaaggg agcggataga ctcgtggcgc ggccatacgg tatgggcgcg    236400
     accagcgcgg ctcaagcgac cgcggttctc ggcctcgcta tggcaggatc gatccacccg    236460
     acacagagcc aatcgctgtg actgcaccca ctcgcaccac cttgagccag atacccgcag    236520
     ggatttggat gcttggcttt gtcagcctgc tgatggacat ttcgtcggaa atcattcaca    236580
     gcctgctgcc tgtcttcatg gtgaccgcac tcggcgcgag tgccttctat gttggcctca    236640
     tcgagggtgt cgccgaggcg actgcgttga tcgtcaaggt gttttcgggc gcattgagcg    236700
     actacctcgg caagcgtaaa gggatcgcgg tgctgggcta tgcccttggg gcgctgtcta    236760
     agccgttctt cgcgctggcg ccaggggtgg gagtcgtgct ggcggcgcgt ctggccgacc    236820
     ggatcggcaa gggcattcgg ggcgcacccc gtgacgcgct ggtcgcagac attgcgccac    236880
     cgcatctccg aggggcagcc ttcgggttgc ggcagtcttt ggatactgtg ggcgcctttc    236940
     tcggccccct gatcgccatt ggcctgatgt ttttgtgggc gaacgatttc agggctgttt    237000
     tctgggtggc cgtcatcccg ggcattctct cggtgttgct ccttctggtc ggcgtgcggg    237060
     aaccggatac ccacatcggc gccaagcgga ccaacccgat caagtgggcg aaccttgtcc    237120
     ggcttggacg tccatactgg caagtggtcg caattggagc gctgttcacg ctggcgcgct    237180
     ttagcgaagc gtttctggtg ctgcgctccc agcaggtcgg cctgccgcta tacctggcgc    237240
     cgctggtgtt ggtcgcgatg aacgtcgtct attcgctctc ggcctatccg tttggcaagc    237300
     tgtccgatcg cctacgtcac accacgctgc tggcgtgggg ccttggggtc ctgattctcg    237360
     ccgacctggt gctagcagta agcgcgcatt gggccgccac gcttgccggt gtggcagtgt    237420
     ggggccttca catgggcatg acgcaggggc tgctcgccac catggtcgcc gacaccgccc    237480
     cagaggattt gcgcggtact gctttcggct tcttcaacct ggccagcggc ctagcgctgc    237540
     tggtggccag cgccttggct ggcctgctgt gggaccagct cggggccgct ttcaccttct    237600
     atgccggcgc tgccttctgt gtggccacca tcgcgttgat catccttgcg cggtatggcg    237660
     cgcggaggct gtcgtcgggc gagacggcag gtgccgggcg tatgcgccgg tgacggcagc    237720
     tcacttgagg ctgtacgagt ccgacgcgct tcggccggac ccctggttcg cggtaggctg    237780
     acgcttatgc cttgttcgat gcagaccgca cgttgtaggc gatcatgccg gcaatgatca    237840
     acagaatcgc cacctgggcc agcacggtct gcacagaggg gtaaattccc agcacgtcga    237900
     tgcgcggcat cgaaatcggc gtgatgtgca ggaagccgac cttctgcagc gctgcgaccc    237960
     ctttgccgat cagcactacc gccaggacag cgaccagagc cgaactgaag gcaaagaact    238020
     ggcggatcgg caggcgtgcc gaggatcgca gtagaacaac ggcgatggct gccaggatgg    238080
     cgatccccga gcccaagccg gccagcaggt agatgccgtt gccttcgctc cacagtgcgg    238140
     cgtagaacag cactgtctcg aacacctcgc ggtacaccgt cacgaacgac agcacgaaca    238200
     gcatgatcgc cgagcgcttg ttcagcgccg acgacagctt ctgcttcacg taggcctgcc    238260
     agcgaccggc caggctcttc tggtgcatcc acatccccac gccaagcagg accacggccg    238320
     caaagatcgc cgagaaacct tcggtcatct cgcggctggc gccgctcaag tccaccagat    238380
     aggtggcgac ggcccacgtc agcccaccgg cggccagtgc aacaatccag ccggcatgga    238440
     cgtacggaag cacgtccgtg cgctccgctt tcttcaggaa cgccatcatg gcgaccacga    238500
     cgagcagcgc ttcaaggcct tcgcgcagca ggatcgtcaa ggcgcccagg aaggtcgaca    238560
     gcggatcgtt agtgccgccc agcgcgtcct gggcttcggt caacatggtc tgcagacgct    238620
     gagcgatttc ctgcacttgc cctgcctgtc cggttgtgat ggcgttgcgg tacagcccca    238680
     tcgtcttttc gatgtcctgg aacagcgcct ggttcttggc ggccaaggcg ggctcaaccg    238740
     gctcgaagcc gtcgaggtag gcggaaagcg caaggcgcga ggcggtcgct ttgtcacctt    238800
     ggtcgaaggc ggccacgctt tccttcagct tgtccttggc aatcgcgaga ctgtcagcgg    238860
     tggacgcgct cagcacgtcc ggagcgcttc tgaggtaagc ggtcaattgc cgcgcagcat    238920
     ccgggctggt cgacttagcc agcgacgcct cgggcgtctg gctgagtttg gcgagcgtgg    238980
     gcaccgcgcc atgcaactca gggcgggacg cccacaactt ggcgccggct tgccgatccg    239040
     catcggaata cgacagggtc gacgcaaaat aggcgagcgc ccagcgatcg tcgtcggtga    239100
     gctgcgcgaa gctcggcatc gaggtgccct cgacaccgcg cgtgatgatc tgctggagcg    239160
     cgaagacgct gcgctcctga gcccgttgat gatcggccag ggcaatgggc ggcggactca    239220
     gtttggcggc cagaacgcca tcggcgtgtc cggagctacc gtggcaggac gcacactgat    239280
     tttgatacag cgtggcccca cgcttgaggt cgggcacctt gctgggcgcc attggcaccg    239340
     gataggctgc cagcaagcta tccgcgagct tgtgcgcctg ctcaccgact gcggctggcg    239400
     cggctttgtc ggcgatttgc gagcgcaatg ccccggcatc cttgagcagt gcttgcgtgc    239460
     cgggccccgc cggcaactct gcaatctggc gctccgccgc atgcgcaaat tcctgcattt    239520
     cggcgtactc gtcggcattg gcgacctgcc cgtccttgac ggagcggccg taatcgaccg    239580
     ccagataatc aagcaactgc cagacctgct tggtcttgtc ttgcgtcgac agcgtgtcgg    239640
     cgtacgcgct tgagaccgat gccagaaggt agaacaggag gagagaaacg acgcgctgca    239700
     gctgcatgaa aaaccttccg gcgaagcggg agagattgcc ttaaatgaga atgattgtaa    239760
     ttcatgtttc gcagcaaaag ccatccacgt cctccctgca gccgtgcagg cggttcctga    239820
     gagatgatcg gcgcgaagaa tcgggacgat gacctgtggg ctgcgtatca gccttgacgg    239880
     gtgacgtcag cgtcgcaccc gtaactcgcg tcggacaacc cttgcaggat cccgcacgct    239940
     tcagcggccc ggccatcgga gcagctttcg cgcaacgcgt acagatggcg cttcaaggcc    240000
     gcaagcgcct cgatgcgccg ctcgacctca tggatatgct tgtccaggag ggtgttcacc    240060
     gcaccgcaat cctcgcgcgg ttgctcgcgg tagcgcagca gagcccgcac gtcgctcagc    240120
     ggcatgtcca gcgaccggca gtggaggatg aactgcagcc gttcaatgtg ccgctcgcca    240180
     tacagccgga aatttcctga gctgcgctca ggcggcggca gcaggccttc gcgctcgtag    240240
     tagcggatgg tttgaaccgg gcacgccgtg cgcttggcca gttcaccgat ctgaatcgtc    240300
     atgatgttgg gcaggagtct cttgactcta tagtaactat agagtgtgta cttaagccca    240360
     atccaattca agcgacaagg agttgccgtg agcgaatgcg gcccgaaggg atgcgattgc    240420
     gctgctgtca acgtggcgcc tccggccccc gatgcaactg gcgtcgattt gaagcgctcg    240480
     cgctaccgga tcgacaacat ggattgccca accgaggaag cgctcattcg caacaagctg    240540
     gcgacgttgc ctggggtggt gaagcttgag ttcaatctgg tacagcgttc gctgaccgtc    240600
     aatcaccggc tgccgtcccc ggcctcaatc gaacaggcgt tgtcggccat tggcatgcaa    240660
     gccgtgcgcg cggaagagac gcgttccgcg caaagcacgg tcctgaccat ccggcagatg    240720
     gactgtccca ctgaggaagc actgattcgg ggcaagctgg cgggcgtgcc gggtgtggcc    240780
     ggtcttgatt tcaacctcgt tcagcgcacg ctggcggtcc gtcacgctgc gcacacgttg    240840
     ccccaagtat tggccgccat ccaatcgctt ggcttcgatg ccgaggtccg cgacacctcc    240900
     gctgccgcac ccgcttctgt gccggatgcc gcgcccacca aatggtggcc gcttgccatt    240960
     tccggggcga acgccgtact ggcggaggtc gtctattggc tcaacggtgg caatcactgg    241020
     gtggtggtgg tcctggcatt agccgcgatc ctgaccggcg ggctcaccac ctacaagaaa    241080
     ggctggatcg cgctcaagaa ccgcaacctg aacatgagtg ccctcatgtc gattgcggtg    241140
     acgggcgcga tggtgatcgg ccactggccg gaagcagcga tggtgatggt cttgttcgcg    241200
     ctggccgaag tcgtcgaagc ccggtcgctg gatcgtgcgc gtgacgcgat ccgtggtttg    241260
     atggatctcg cgcccgagac cgccatggtt cagcgcagcg atgggagctg gggcgacgtc    241320
     gatgccaaga ccgttgccgt cggcagccgg gtgcgggtca agccgggcga gcgcatcgcg    241380
     ctcgatggcg aggtgctgca ggggcgctcc tccgtgaacc aggcaccgat tacgggcgag    241440
     agcctgccgg tcgagaaggc ggaaggcgac ccggtgttcg ccggcaccat caacgagtcc    241500
     ggatcgttcg agtaccgcgt caccgcggcg gcaagcgact ctacgctggc acgcatcatc    241560
     cacgcagtgg aggctgctca aggcagtcgc gcacccacgc agcgtttcgt tgatcagttc    241620
     gcccggctgt acacccccat cgtcttcgcc gtcgcgctgg cggtggccat cttgccgccg    241680
     ctcctgttcg gtgccgcctg gctggattgg atctacaagg ccctcgtact gctggtgatc    241740
     gcgtgtccct gcgccctcgt gatttcgacg ccggtgagca tcgtgagcgg cctggccgcc    241800
     gccgcgcgac gcggcatcct gatcaagggc ggggtctatc tcgaagaggg gcgcaagctg    241860
     aaatggttgg cgctcgacaa gaccggcacc atcacacacg gcaagccggc gctcaccgat    241920
     gtcatggcct ggaacggcac agacccctcg gccgccgaga ggcttgccgc cagcctggcg    241980
     attcgctccg accaccccgt ctctcaggcg gtggcccgcg cagcgcagga caaaggtctc    242040
     accccaggcg aggtcgccga tttcgcggcc atgcctgggc gcggcgtccg gggccatatc    242100
     gacggtgcgc tctatcactt gggcaatcat cgcctggttg aggaactcgg ggtgtgctcg    242160
     ccggcattgg aaaccaacct tgccaccctc gaaacccagg gcaaaaccgt cgtgatgctg    242220
     atcggcccgg acggcgtacg cgcgctgttc ggcgtggccg acaccatcaa ggacagcagt    242280
     cgccaggcga tcaaggacct gcacgcgctg ggcatcaaaa ccgtgatgct cagtggtgac    242340
     aacccgcaca ccgcggaggc gatcgcgcag caagtgggta tcgacaaagc tcggggcaac    242400
     ctgctaccgg aagacaagca gcgcgaaatc gagcagctat cggcacaggg aaccatcggc    242460
     atggtcggcg atggcatcaa cgacgcgccg gcgctggcac gggccgatat cggtttcgcg    242520
     atgggggccg ccgggacgga cacggcgatc gaaacggccg acgtcgcgct gatggacgac    242580
     gatctgcgca agctcccggc ctttgtacgg ctatcccggt ccacggcggg agttctgaag    242640
     cagaacattg cgctggcgct cggcatcaag gtggtgttcc tggtgctgac ctttaccggc    242700
     caggccacca tgtggatggc ggtgtttgcc gacatggggg ccagcctgct ggtggtcggc    242760
     aacgggctga ggttgctgcg caaatgaatt ggaagttcct gttgtacgac tggggcggct    242820
     ggaatgtcgc gctgttccag gccatcaatt ccgggacgcc gggcgcgctg gacccgtggg    242880
     cgtggctttt tagtctggtt gggagctatt ggaccgcgcc gctcatgctg ctgggcctgt    242940
     ggtggtggtc cacgtctgca tcgaatccga ctcgcgcatg cgctgtgcgg caccgtctgg    243000
     tcacgttcgg cgtggccttt gcgctcgcct tgctggccgc ttccgcgttg aagtgggggc    243060
     tggatttccc gcggccgccc gcagtgcttg gcactctcgt gcacgtcatc ggcgtagcgg    243120
     aactgcgcta cagcctgccc agcggacacg cgacctacgc ggcactggtt gtgggcgcac    243180
     tctggccctt gatgggacgt cgaggccatc tcgccttggt gtgctacgcc gctctcgtcg    243240
     ggtggtcacg cattgcggcg gggatgcatt ttccggcgga tgtacttgcg ggctggaccc    243300
     tcggggctgg ctgcgtcgtt gtcgctggcc acctggtgcc gttgcttgct gcaacatgga    243360
     ggaaccgtgg cacaccgaac gcggtctggt atggcgttgc ggcgtgttgc ttcatggccg    243420
     atcaagctgc caagttcgcc atcacgcgga tgtttgccta tggtgagcgg gttgagatca    243480
     cgtcaacgtt caacctcgtg tacgtgcgca atcctggcgc ggccttcagt ttcctcgcca    243540
     atgaggccgg ctggcagcgc taccttttta ttggcttggg cctggctgtc tcagcgtggt    243600
     tggcccacac gttgcgcaag cggttgtctc gtatggaagc tttggcgtac agcttgatcc    243660
     ttggcggtgc agcgggaaat ctcacagacc gcgtctggcg tggtcaggtc gtggactttc    243720
     tggacctgca ttggatgcaa ctccactggc cggcattcaa ccttgctgat atggctatct    243780
     ccgcgggcgc ggcatcgctg atgctggcag tgttgacgca acggcatggc attacggcga    243840
     aaaccctgtc cggctgattg cagccatacc ttgcggcggc acacgaccga tgggccgtgc    243900
     gccgccgacg gcttacttgc tccgcaggtc caccacggtc ggctggccat cgaccatgtc    243960
     aaagaccgcc aacactgatt ggccttcctt gaagtttttc agcgacgcct tgtccttcac    244020
     ggcaaacgtc atcgtcatcg cgcccatgcc gaggttgtcg atggcgccgt gcttgagcgt    244080
     gaccttgccg gtgtcgaggt ggatcttgcg gatctccgca gccacgggct tgggtgactg    244140
     cttggcatgg ccggccggct tcatgtccat gccatccatg gattcggccg caaatgccgc    244200
     tggcgctgca gtgagtgcaa gcaggatcgc aaaggtcttg atgtgcttca tggtgattcc    244260
     tcttgatgtg aggggtgggt gggaagtggt gatgatttcg tctgccgccg acggatcagc    244320
     agatacacgg ctgggacgac gaacagggac agtaagggcg cagtgaccat gccgccgacc    244380
     atcggggcgg caatgcgctg catgatctcg gacccggtgc cgtgcgccca catgatcggg    244440
     atcaggccgg ccaggatgac ggcgaccgtc atggccttcg ggcggacccg tagcacggcg    244500
     ccttcctgga tggcttccag cagcgctggt atcgtgttct ggcccgcctc ctgccgctcc    244560
     gtccacgcct gcttgaggta gagcagcatg atcacgccga actcggccgc cacgccggcc    244620
     agtgcgatga agccgacgac cccggccacc gacaagttgt agcccagcag atagagcagc    244680
     cagaaaccgc cgatcagcgc gagcggcagc gtgcccatga tgagcagcgc ctcgtcgatc    244740
     cggccgaaca ccaggtacag cagcacgaag atgatcagca aagtgaacgg cacgacgacc    244800
     ttcagtttgg cgctggcgcg ctccaggtac tcgaactggc ccgaccagct cagcgcatag    244860
     cccgccggca tcggcaccgc tttggcgacc gccgcttgca tgtctttcac tgcggaacgc    244920
     aaatcgcgcc cacggatgtc cacgtacacc cagcccgaca gccgggcgtt ctcgctgcgc    244980
     aacatcggcg ggccttgcac cacctggata cgggccacgt cggccagcgt gatctgctgg    245040
     ccgcggtcgg tgacgatcgg caggctccgc aactgctcga ccgagtcgcg gtagtcccgt    245100
     gggtaacgga cgttgatggg gaaccgggcc agaccatcca cgacttcacc cacgttgtct    245160
     ccccccacgg ctgatgacac gatgctttgc acgtcctcga tattgaggcc gtatcgcccc    245220
     gcggccatcc gatcgatatc gacgtcaatg tagcgcccgc cggacaggcg ttcggccagc    245280
     gcggacgtga ctccgggtac ggtcttgacg gcctcctcga tccgagtggt cagccggtcg    245340
     atttccttca agtccgtgcc cgccaccttg atgccgaccg gactcttgat gccggtggcg    245400
     agcatgtcga tgcggttgcg gatcggcggc acccagatgt tggacaggcc cggtaccttg    245460
     accacgcggt caagttcctc caccagcttg tcggtggtca tgccgggccg ccactgctcg    245520
     cgcggcttga actggatggt ggtctcgaac atctcgatgg gggccggatc ggtggcggtg    245580
     tcggcgcggc ctgccttgcc gaacacactg gcgacctcag ggacggtctt gatgaggcgg    245640
     tcggtttgct gcaatagctg ggccgccttg ccggcggaga gccccggcag cgccgatggc    245700
     atgtacagca ggtcgccttc atccagcggc ggcatgaatt cgcctccgat ccgcatcacc    245760
     ggccaggcgg ttgcgatcag caggacggcg gcgatcccga cggtggcttt ggggtaggcg    245820
     agcaccttgg ccagcatcgg ctggtagagg cggatcagcc agcggctgag cgggttggac    245880
     tgctccgtgg gaatccgtcc ccggatcatg taacccatca ggaccggcac gagcgtgacc    245940
     gacagaccag ccgctgctgc catcgagtag gtcttggtaa atgccagcgg cgagaacagc    246000
     cggccttcct gcgcctccag cgtgaacacc ggaatgaatg acagcgtgat gatcagcagt    246060
     gagaagaaca gcgccggccc gacctcggct gccgattcgc cgatcacact ccagcgctcg    246120
     tggccttcga gctcgcggtt cggattttcc tcatgccagc gttccaggtg cttgtgcgcg    246180
     ttctcgatca tgaccacggc ggcgtcgacc atggcaccga cggcgatggc gatgccgcct    246240
     aacgacatga tgttggcatt gacgccctgg tagcgcatca ccaggaaggc cgccagcacg    246300
     cccagcggca gcgagacgat ggccactagc gccgagcgca gatggaacag gaacaccaga    246360
     cacaccaatg cgacgacgat gaattcctcg atcagcttgt gcgtcaggtt ctccaccgcg    246420
     cggttgatca gcgcggaacg gtcgtaggtc ggcacgatct cgacaccggc tggcaggctc    246480
     ttctgcagcg tggcgagctt agccttgacc gcttcgatgg tttccagtgc gttcttgccg    246540
     gagcgcatca cgatgacgcc gccagcgacc tcaccctggc cgttgagatc ggcaatgcca    246600
     cgccgcatct ccggcccgag ctggagggtg gcgacatcgc ccaggcgaac ggcgatgcct    246660
     gcgtcgttcg tcgtcagtgg aatctgccgg aagtcgtcga gcgtcttcag gtagccgctg    246720
     gcgcggacca tgtattccgc ctcgcccaac tccagcaccg agccgccagt ctcctggttg    246780
     gctcccttga gcgccgccag caccttggct tgggacaggt tgtaggcgcg taatcgatcc    246840
     ggcatcagga cgacctggaa ctgcttcacc atcccgccga gcgacgccac ctcggccaca    246900
     ttgggcagcg acttgagttc gaagcgcagg aaccagtcct gcagcgcgcg cagctggctg    246960
     agatcgtgct ggccggtctt gtccaccagc gcgtactcgt aaatccagcc cacgccggtc    247020
     gcgtccgggc ccagcgcggg cttggcggcg gccggcaggc gggattgcac ctggttcagg    247080
     tattccagca cccgtgagcg tgcccaatac aggtcggtcc catcctcgaa cagcacgtag    247140
     acaaacgagt caccaaagaa cgagtagccg cgcaccgtct tggcacccgg caccgacagc    247200
     atggtggtgg tcagtggata ggtgacctgg ttctccacga tctgcggcgc ctggccgggg    247260
     aacggtgtgc ggatgatgac ttgcacgtcc gacaggtcgg gcaaggcatc gagcggcgtg    247320
     ctacgcacgg cccacaatcc ccacgcagtc agcatcagcg tcgccagcag gatcaggaag    247380
     cggttgcgga tcgacgccag aatcagccgg gcgatcatgg cttgcctccc tgatccgcgc    247440
     cggcgggcgc gaccgaggag aggactgcca tgccgtcctt atccaggtgg aagcggaatc    247500
     gcacccggtc acccgccttc agtcccttcg gtagcccggc ggacggcgcc gcgaaatcca    247560
     tcgtcatggc accccactga atcgagggga tcggaccatg cgagattgtc aggccttcac    247620
     ccgtgacggc ctcgatgcga ccgacgcctt cgtgttcggt ggtggccgcc gcgggctcag    247680
     atgccgcggc cggcgccgcc atgcgctcgg tggtgccgcg cagactggcc tccgaatcga    247740
     tcaggaactg gccggaggtg actaccttct ggccagcctt gaggcccgcc aggacttcga    247800
     ccatgccgcc ggcctcgcgc ccggtcttga tctcggtggc cacaaagccc gactgacctc    247860
     cgtccaccat gacaatgctg cgctgaccgg tacggatgac ggcctccaac gggatggtca    247920
     gcacgtcctg gtgctcgccg ctgtcgaagc ggaccgtggc aaacatgccc ggcaacaggt    247980
     gccggccctt gttgggcagg acgatgcgca ccttgatggt ccgcgtcgcc gggttgacgt    248040
     cgggcaacac ggtgtcgacc ttgccgacca gcggctcgac tgccccggtc ggtgtcacct    248100
     tgaccgcgag gccaggcgag atgatgcgag cttggccttc cggtacctcg gcaatgaccc    248160
     agacctggct caggtcggcc aagcggaata gcgtcatgcc gggggagacg gtcatcccgt    248220
     ctcgcaccgc aacctcagtc acgatgccat cgatggggct tgcgatgccc acgctgggct    248280
     gcagccggcc ggatgcctcg accgcgctga cctgacccgg cgtcatgccg gcctgcagca    248340
     tgcgcgcctt ggccgcaccg gcgagatcgg cctgaccgtg tgccgactgg cgcaacacgg    248400
     ccagatactc ttcctgggcc gccacccagt ccggcgaata cagcgtcacc agtgcctgcc    248460
     cccgccgcac ggggtcaagc gtcgccctga ccgcgacgtg ctggacgaag gcattcgtgc    248520
     gcgcctggat cacctgcacg ctgcgctcgt cgatggcgat attgccgggc gcctccagca    248580
     ccgcgctcaa ccggccggct ttgacttcgg tcgtgcggat gccgaggttt tgcgcaacac    248640
     ggctatcgac cgcgatgccg ctacctccgt ccccctcggc atagacgggc accaactgca    248700
     tgtccatgaa gggggatttg cccggcttgt cgaaacgctg cccgggcacc atggggtcgt    248760
     gccagtacag taccttcttg ccggtctggg gatcgacgtc gccggccttg aggccggatg    248820
     ccgagctggc cggcatcgac gatggtgcca accgggcacc ctgcgtgacg ccgacccggt    248880
     aggcgccata gatggcggtc ccgataagaa cgagccccac agccgttgca atgaccagtt    248940
     ttttcatttg cgttccttga tggcggactc ggtctgcgcg gtgggcagcg gaaccaggaa    249000
     ggtcagatcg gcccacagct tggccgtctt ggcttccagc gcgagccgtt ccaattccgt    249060
     atcgatggcg cggtgattgg cctcggccac ggccagcagc gatccggtat tggcgcggta    249120
     ggctgtcagg gccgcctccg cctgcgtgct ggcgagcggc aaggtcttct cgtcatagcg    249180
     cttgagccgt tcgagattgc gctgcagctc ggccagcttg gcgccgacca tggcctgggt    249240
     gtcgcgccgg aggatttcgg acttggcacg tgccgcctgg gcctgggcca gcctggccgc    249300
     gacttcgcgg tcctgccggt tgccctggtc ccaaggcagc ggaaagctga cgttcacgga    249360
     gcccatgttc gagaacgcgg agccgcgctg gctgaccatc agctcgaccg tgatatctgg    249420
     cttctttgct tgcgcagcgg cccggatctc gctctctgcc agacccacct cgcgttgcgc    249480
     ggcggcgacc tcaggcacgg tatccaactc accgcgcgcc aaccgctcga ccggcagggg    249540
     aacgtccagg cgcggcggct cggagagcgg gcgggtggcg gccggaccga tccagcgctc    249600
     tagcgcgacg gcgctggccg ccacggcggc gcggttttcg tccaggcggt cctgcagctt    249660
     ctggatttcc agttccatcg ccagcacgtc ggcgcgcgtg ccccgtccgc tgcgatacgc    249720
     ggcggtcgcc gcctgcaacg caagttcaag tgggtgtcca tggtggccca gcaaggtccc    249780
     cgtctgctcg gcataccagc ggtccagcca tgcgctgacg gcgttgcgct gcacgttggc    249840
     catgctgacc gcgcgctgcg cttcggcagc gtcggcttcc gcttcgaagc gtgccacctt    249900
     ggcgcggcgt ttgtccgggc gtgtgaattc ctgcatcacg ctgatggagc gcatggtcat    249960
     gaaatcccgg ctgaccgaaa actggtcggg gccattgacc ggcacgttgt tgatgccgag    250020
     cttgagcacg gggtccggca attggccggc ggcgaccgcc atttgggtcg cggcgtcgat    250080
     ggtcccgcgc gaggattcgg cgtcgccggc atgcgcggtg gcgagcgcga cggtttcctc    250140
     aacggaaagc gtagggacag attgcgaggt cgcggcatgc gacatcgcga tgccgaaggc    250200
     aggcgcgcaa agcaacgcca gcgtcaggcg acgtggaaaa agcataaagc ctccaagaac    250260
     gacgacagct accccaatct agagagggca gcaccgggtg acgtcggtct ggaggctacg    250320
     tttggaaact gcagtaaaga acggccagcg gtggtggcgg cgcgcgcgct gccacttgtg    250380
     tgcgcagcac cgtgcggata ttggcaaacg ccacgggggc cggttcgatg acgccggtga    250440
     gcaccggcaa gaacaccggc agttgcggtg cgacatgatc agcgctcttg gagtcagcct    250500
     ggcagtgggc caagcacagc gcgccgttgt ccttgtcctg gctgctgccc tgatcggtcc    250560
     cattggccat gtcggcgcac gattcggtca gggcggcctt catgttgttg ctgcccactt    250620
     ggtatcggct gccggcacag gcgtacgccg ccgctgccag ttggactgac aggaagacca    250680
     gcaggagaaa gccagcgaag aaagaatgcc ggcgcagcgt gtgacgcaag ggttaattgc    250740
     cgtggaaact ttgtcggaag catacctttt ttcatgcgca atgtaacttc gccggatacc    250800
     cgcgccgcga tcggacaaaa gaacgagcgc gccgtccttg accttcccac gtgggcaggg    250860
     tctaccgtga agccgtgaag atttgggtac gcgtcgctcc cgtggcacat gccacggaca    250920
     cgtgatgccg aagcttcgat gcacgcagga atcgaggagc acaccatgaa tatcggacag    250980
     gccgcgagcg tatccggggt ctcggccaaa atgatccgct actacgaaag cattggcctg    251040
     gtggcgtcgg ctgcccggag cgcgggcaac taccggacgt atggagacaa cgacatccac    251100
     gccctgcgct tcattgggcg ggcgcgggca ttgggcttct ccatggagca gattcgagaa    251160
     ttgctcgggc tgtgggaaaa caagcggcgc gcgagtgcaa cggtgaaggc gattgcgttg    251220
     cagcgcattc aagagctgga cgctcggatt gccgcgctta ccggcgtgcg cgacaccctg    251280
     atgtatctcg cccagcactg tgacggcgac gatcgccccg cctgcccgat tttggacgcg    251340
     atcagcagcg ccgtcccaga gaggcagcct gtggcacatg ccacgcggca ttgaggcacc    251400
     gcgagaatga acgacaaacg accacatccg catacgtcat cccctgcgcc cgggcacgtc    251460
     ggcggagatt tgtgcgcaca aggcggggac caccagcacg ccatggcgaa gcaactgacg    251520
     cttgtgaccg ccaccgagga ccgagatcca gtgtgcggca tggcagtgaa gctcggtacg    251580
     ccataccagt caaactacgc gggggcgcgg tacgtcttct gtagcgcggc atgccagagg    251640
     aagtttgagg cggagccagc caagtatgtc tccgccggtg acgaagccag tgcagcacct    251700
     ggcgccgtct acacctgccc tatgcatccc gaggtccgtc aggaccatcc cgggagctgc    251760
     ccgaaatgcg gcatggcgct tgagcctgag atgccgagcc tcgacgccga cgagaatcct    251820
     gaactcgcag cgttccgccg gcgcttctgg tggaccttgc cgttgacgat tgccaccgca    251880
     ttgcttgcga tgctgggtga acatgcctgg gcaatggggc cgacggtgca aagctgggtg    251940
     gagttcgcat tatctgcgcc cgtggtcctg tgggcaggct tccccgtcta tgcccggtgc    252000
     ctgcaatcgt tccgaaaccg cagcccaaat atgtggacgc tgatcggtct gggcaccggc    252060
     gccgcgttcg tgtacagcgt tgcggccacc gtggcgcccg acctgttccc ccgcagcttt    252120
     gttgtgcatg gccgcattgc ggtctacttc gaggccgccg ccgtgatcat ttcgctgacg    252180
     ctgctcggcc agatcttcga gctgagggcg cgctcacaga cctcggcggc catcaagtcg    252240
     ctgcttggtc tggcacccaa gacagcacgc cgcatcaacc cggacggcag cgaggaggac    252300
     atcccgctca cgcacgtgca tgtcggtgac ttgctgagaa ttcggccggg cgagaaagtg    252360
     ccgaccgatg gcgttgtgat tgaaggtgtg agtgccatcg acgaatcgat gatcaccggt    252420
     gagccactgc ctgtcttcaa gcgggcgggc gaccacgtga tcggcgccac cctcaatacg    252480
     tcgggcagcc tggtcatgcg ctcggaaaag gttggcgctc agacggtact gtcccagatc    252540
     gtgcagatgg tagcccaggc ccagcgctcg aaggcgccaa tgcagcggat ggcggaccag    252600
     gtggccgggg tgttcgtgct ggtggtggta gccatcgccg tgcttgcctt cttcggctgg    252660
     ggattgttcg gtcccgagcc gagctgggtc tttgggctgg tcaacgcggt ggccgtgctg    252720
     atcatcgcct gtccatgcgc gctggggctg gctacaccga tgtcgatcat ggtggcgagc    252780
     ggcaaggcgg cgacccaggg cattctgttc cgcgacgcgg cggccatcga acatttccgc    252840
     aaggtcgaca ccctgatcgt cgacaagacc ggcacgctga ccgaaggccg tccggtcttc    252900
     gagcgggcgt tggccgtcga ttcgctcgat gagaccacgg tgctgcgtct ggcggcgagt    252960
     ctcgatcaag gcagcgagca cccgctggcg gccaccatcg ttgcggcggc gcgtgaacgg    253020
     ggcctgacct tggcgaaggt cgaacatttc gcatcggacg cgggcatggg cgtgcgaggc    253080
     cgggttgacg gtcaccaact gatactcggc aatgcctccc tgatgcgtcg ggagcaagtc    253140
     gatattgaat cgcaagcgtt gcgggcaaac gtgctggggc agtacggcgc cagtgtcatg    253200
     tacctggccg ttgaccggaa attggcgggg ctgctgacgg tctcggaccc ggtcaaggcc    253260
     agcacccccg aagcgcttgc ggcgctcaaa gcagccggga ttcgcgtggt gatggcaagc    253320
     ggcgacagca tcgcgacaac gcgagccgtg gccggccccc ttggcattaa cgagtttcat    253380
     ggtgaggtca aaccggccga caagctggcg ctggtcgcaa aactccagag cgagggccac    253440
     gtggtggcaa tggctggcga cggcatcaat gacgcaccgg cactggccaa agccgatgtc    253500
     ggcattgcca tggggacagg aaccgatgtg gcaatgcata gcgcccaggt cacgctggtc    253560
     aagggtgacc tgcgcggcct tgcgcgcgca cgggaactgt cgcaggccac cattgccaat    253620
     atgaaacaga acctgggatt tgcgttcgtc tacaacgcgc tgggcatacc gctggcagcc    253680
     ggagtgctgt acccgttcac cgggtggctg ctgtcaccga tgatcgcggc cttggccatg    253740
     agcctgagtt cggtgtcagt gatttccaat gcgcttcggt tgagaacgca ggtgttttag    253800
     gcgctgcctc ttggatgacc atcatgcccg tgcgcaatcg cccctcaccg tttttgcccg    253860
     ccttgcggtc aaggtttggc agaactagag tgaacacaat tgttggcagt gattcatgat    253920
     gcatcgccaa agtcctctcg ctcggctgct tacgctctca ttgatcgcga tggtgctttt    253980
     ctcgcgcctt gcgattgcgg gatacgtttg cccgcccgag gcggggacca tggcgaactc    254040
     ctcgacgatg gttgtttccg tcgtgaactg ccagcacatg gatgaggcgc agcccgcgct    254100
     ctgcgcggac catcggcacg atgggcgcca ttgggcggat gccaacggcc acgctcctga    254160
     tcttggcatg ctgcccgccg caattgggct cgtgcacgtt cttcctccga cgccttacgc    254220
     cggaccggct tacccgaagg cctctcggcc cgttgcagta cctgggccca tctacctcgc    254280
     aacagcgcgc ttgcgaatct gatcgctccc cacacgcggc aatccgtcgc cgcgagcctt    254340
     gatttcaatc gctcccccgg cgggatgtcc ctggactctg ccttgactga gccggaaaga    254400
     aaccttatgt ggggaagacc atcatgcatt ccattctcag aatcatcgtt ctcgtttcgc    254460
     ttggtgttgc cgctggcgcg gccttcgcag gtcccaattg ggatgccatc aacagtgcgc    254520
     gcgcggcggc gaaacgctct gccgcagctc cgggcgccgc atcagccaag gatgcgatgc    254580
     agaagcagtg cgctgaaatg atgaagtcgt cggcggacag cgccagcccg aagggcccat    254640
     ccgaggcgaa atgatcgcat gcgcttcggc ctggtcgtcg aggcgcgtat atcgacgcaa    254700
     tcgcttaccg ggagtaagcc gcttgatctt gcggcatccg gaaccggtgg cgaacagcac    254760
     ggaacttaat cgaagatgga gatcgtcatg agaacgagat cagtcatggc cacagcgctt    254820
     gcgcttgccc tgcttggggc cggtggatgg agcgctgcag ccggccccag tcgcgctacc    254880
     gaaggcgcca aagcaagtcc gcaagacccc atgcattcca tgatgatggg ccacatgatg    254940
     gacggcggga tgatgggcgg ttgtccgatg atggggcagt tgccgcccgg aaacgaaaag    255000
     ctctcgatgc agatgcacgg agaaatgatg caggcgatgg gggaaatcct gcgcaagtac    255060
     gcggacaaga tccagacgcc ctcatcgaaa tgacggtggc cggccgtatc gcgaacgacc    255120
     gagtaccaca ggagtaccgc tatgaaatgc aacacgagaa ccatggtcgc cgtgggcgct    255180
     gccctggtgg cgatcttggc agtcgcctat gccgttttcc cgtcagttcg tgccttcgtg    255240
     ctgggcattg gtccctacct gttgatcctc gtctgcccgc tatcgatgtg gctgatgatg    255300
     aaaggcatgc aaggtcaaga cgatcagcgg cgttccatga gagaggacac gcctgagcgg    255360
     aagcagccgt ttcggatcga aaagtgaatc gtgagtgcgg ccgcgcgtat cgcgaaggcg    255420
     ggttccagcg cgagcaggac aaggactgta ggccagcgtg gtacgcgaaa tcatcagcgc    255480
     aagtgtgagg ctgtgtccgg agatacaggg gcaaatccaa tcctgtcgtc tgcgggagga    255540
     gtgcgatgag catcatgagt agtttcagtg cgcactacgg ccattggaac ctggtcgcgg    255600
     tcttggttgg ggtggtgtca tggatcttgt atcggtacgt ggcgccgcaa ggctggcgcg    255660
     aatggactgg ggcgggtctc gtgcaggcct ttgtgatcgc gctgtacgcg gaaatgtacg    255720
     gcttccccct cacgatctac ctcctgacgg gcttcctcgg aatcgacata ccgctgacgg    255780
     cctacagtgg gcatctgtgg gcaacgctgc tcggttatgg catggcaggc gcaatggtcg    255840
     agatggtgat agcgactgtc tttatcctcc cgggcctcat tctgctgatt tgggggtgga    255900
     gcactgtcta tcgagcatgc cgtgccggcc gcatcgccca ggaggggcct tacggattcg    255960
     tccgtcaccc gcagtacctc ggcatcatgc tggctgtctt tgggcagctg gtgcactggc    256020
     ccacgctgat caccgtggtg ctgttgccag tcattgtgtt tgtttatgtc aggctggcgc    256080
     gcaaggaaga acaagacatg gtcagccgtt ttggggccgc ttacgaggcg tatcgacgca    256140
     gggtgcccat gttcgtaccg ggccgcagtc aatggaaaca gctattcagc acccacgtgg    256200
     gctcatgatt tctcgcccta tagccccggc tgccgtggtc gcaccttgat gatcaaggag    256260
     agggttatgc gtaccaaatg gatcatcgcc atcattccca ctgaactgct tgagtcgctg    256320
     gagaggcagc tcgcgaccgc ccatgcccct ggcctgacga tcacaaaggt caaggggtac    256380
     ggcgagtaca agaacttctt ttccagtgac ctgaccaccg tgcacaccaa ggttgaaatc    256440
     ttcgcggacg aggccgaggt cgaggctatc accaacgcga tcgttgaggt cggaaaatcg    256500
     acggtgccgg gcgccgggat cgtcgcggtt gttcctgtcg aggggttctt gcatcttcac    256560
     gttccccctg gggagtcggc tggtccggcg gaataatccc atcgtgtgtc aatggcgggg    256620
     cgccaggcgg cacgggatca catgcccgtg tgacccgcga ggcgtgaggg catccgccga    256680
     gaggctatag cgcgatcagc acggtgtggt cggtcattga ggtcagggag tgatgtatgg    256740
     ggtggagcgt ggcagcgacg cgcactggag gtggcgggcg agtacgaggc gtcgccccgg    256800
     cacagctcgt tttgctgctg ctcgctgtcc tgtggttctg cgtcgcaggc tccggtggtg    256860
     ttgcccatgc cgcggaagag gaaaatctct tgccaccgga gcaggccttc cgctttgcgg    256920
     cgcggcaact cgacgaccgc tccatcgagg tgcacttcga catcgccgac ggctatcacc    256980
     tcttccgtga gcgatttgtg ttcgccgcac agccggctgg ggtcaagctc ggtacgcccg    257040
     agtttccgcc agggcaggtc aaatttgacg aagcgctcgg caagcagatg gagatctatc    257100
     atggcggcgt caccattcgc gtgccggtgg cggtcgtgcc ggctgacggc gaatggctgc    257160
     tgacggtgac atcacaaggc tgtgccgaca agggaatctg ctatccgccg atgcacagtg    257220
     tgtacaaggt cggcggtggc ttgctcggtg gcctattcga taagcatcgg agcagcaggc    257280
     caatgacgtc gcccgtgccg ccggcgatgc cgattttgcc cagcttggga gaggggcaaa    257340
     ttgggccggc tgttccatca gccgcgccaa ggaatgacga cggcgaccgc gttgcgcacg    257400
     tgttggccgg ccaccagctt gggaggattg ctacggtctt tttcggcctc ggtctgctga    257460
     tgacgctcac gccaggcgtg ctggcgatgg tgccgatcct gtcgtcaatc gtcgtcggcg    257520
     agcacgtgac gcgcggtcgt gccttggtgg tctcattagc ctacgtgctc ggaacggcgg    257580
     tggctgatgc cggtgtcggc gtggcagcgg gattgctcgg cgagagattc tcgacggggc    257640
     tgctgacgcc gtgggcgctg ggggctttta ccatgctggc ggtggccctg gcgctgtcaa    257700
     tgttcggact ctatgagcta gggcggctgc ccccaatgac ggcatcctca aatcgctggt    257760
     cgggcggtcg gattgctgtt gccgcagcag caggcgtgat ttcagcattg gtcgtcgtgc    257820
     gcagcgtgcc tgtgccgctg tcgggcacgc tgaccgatgc cgagcaaacc ggtgatgcga    257880
     ttggcagtgg cggtgcacta ttcggtatgg cgatcggcat gggggcgccg ttggtgctgg    257940
     tcggcgtcgc tactggctat cttgtgccgc gcgctgggca ctggttgatg gtgacgaagc    258000
     gcttcttggg cttcctgctg ctcggcgagg cgctctgggc tgtcagcccg cttttgccac    258060
     cctgggcatt gatggcggcg tgggccatgc tgctgctgat tgcctccgcc ttcctgggcg    258120
     ccttcggttc gcttggtcca gagcctcgca gcttgacccg gttgggcaag ggcatgggca    258180
     tggtggccgc gctggcaggg gcgatcctgc tggtcggtct ggcgtccggc ggacgggatc    258240
     tgctccagcc gctgtcgcat ctgcgtgctg gcctgatggc gcccgcctcc actgctggcc    258300
     cggcgctggt gcgcttcgag cgcatccgtt ctgtggccga actcgacgcg cgcctggtgc    258360
     aggccgccgc ggccggcaag ccggtgctac tagatttcta tgccgattgg tgtgtcagct    258420
     gcaaggagat ggaacgcttg acctttagcg atccgagagt ccaggcacgg ctggcggatg    258480
     ttgtgctgct gcaggccgac gtgacacgca attctgccga cgatcgcacc ctgctcaaac    258540
     gcttcggcct attcggtcca cccggcatca tcttgtacgg tgccgatgga cgtgagagcc    258600
     cggtgcgagt gatcggcttc cagtctgcaa gcctttttct cgacagtctc gcgaaagcct    258660
     tcggcgacga cgggaagcat tgagatctgc ctgaccccgc ccgcagctta tgcagcagta    258720
     tcgccaccgg gttctagatg ctgttggcag ggtggccagt ctttatggac accgcctctg    258780
     aatgaaggca gagatttcct cggggcgcgc aaaaaccacg gcggcgcggt cgccctgcat    258840
     gcctgtgccg atcagcacag gttgaccggc agccgggccg gcagcactgc catcggtttt    258900
     gaagcgcagg ttgaactccc aaaagacgtg ggccttccgg tcggcggtgg tgaggcgata    258960
     ggtatcgcca cagaagcgga ttgaggtgac ccgcgacgcc gcatcggact ccttcaaatt    259020
     cggcaggcca cgatcgggca ccttcacacg ccccgtggaa actgcctcaa tgtaggcgac    259080
     cagatcggcc cgcgtgcgtg catcggcaat gccgggaaag gtcatcgcgt tacccggcac    259140
     cagggccgcc ggattctcaa gccacgcatc gaggttccgt ttgtcccaga ccagacctga    259200
     ttgcttgagg gcgtcagagt agcgtgcaaa gccgtcggct gtgcctgctt tacgtcccaa    259260
     aacgcccgcc aagctcgggc ccgtcaagtg gcgactcggt gcaaatgaat ggcacgccat    259320
     gcaagtgcgg gcggcttgtg caccccgcgc ggggtcaccc tctgcacgag ccggcgcgcc    259380
     aaaggcaagt gaggccaaag cgatcccgat cgcatgaaga gcaggtcgtt gaatcattgg    259440
     gccgcagcgc ccgctccatc cacgtgctct tctaacgcgc cagtcaaggc ctggccacgt    259500
     gccacgcgcc aatgacgccg tcgccagtgg tgtcgcccgg cttctgatcc ttgctccagc    259560
     ggtaaagcgg atggcccttg taggcccact ggcgcttgcc gtcatcacgg gtgatgaaac    259620
     tccaatcacc gctcgccttg tcgtatgaat cggccagcgc gggtggccag ttggtcgcgc    259680
     acgtcccgtt gcacgcgctt ttgccggccg cagtgtcttt gtcgaaaaca tacagcgtca    259740
     tcttgtgctc atcgaccagc ttgccttgca taacctcggg cggctcggca agcgccggaa    259800
     acgatgcgac cgcgcccagc gccaacatca tcagggtacg cgacatagtg tgctccttgc    259860
     gttgttgatc aatatctacg ctagcgccgg gacggcaagc tgctaccaac gacctgggaa    259920
     tcccggttgt gtgagatgag tataggggtg ccgaaaaccg cacggcaatt gatgctgtag    259980
     cacgcccgcc gtcgacgaag aggagaagca tgggtgccat ggtggagcgc tttgtgacgc    260040
     cgatcaacca gatgccgacg aggcctgtta aggccaatct tgatgctccc cccgatgatc    260100
     agacgacgac cacgggcttg gctaccggcg acacgctggc gtttgacatt ggtccaaatg    260160
     ctgaacttcg tctgcgcagg gtaggctggc gcgtgccggc ggcggccttc ggggacgcca    260220
     tgattttgct aaggacaagg tgcgcggatc tcatcaaggc tgcgggattg cttcagcagc    260280
     ggcctaccag gcaagccgga tacatgcatg cagaccgttt caacatcacc aacagaggct    260340
     tgcaatagac gtcgaggcca tacatgcctg aaaaggacga ctaccccgat tgccaatatg    260400
     aaagagcgca attgccaaga tcgattgcgc aactgatagg acacactgcg catattcttt    260460
     ctattgttgg ggtggaccac tggagcgttg cgtaggcttt gcacccttgg caaatcatgt    260520
     cctggcgcga gcgatcatgt accgattgca tgcttgtgcc gtcagcatgc ccaccttgtc    260580
     tagtgggagg gaaacgcgca gcgccaaaca ccttcaaccg gctgcattct tgtaatgcgc    260640
     ccgtaactct gtggtcaggt tccgtttcct agactgcggc ttcgtgatcg ttggttcatg    260700
     gtgcccggtg aagttgctgc gtgtgttttt gctctggtta gtactgcttg cgctgccctc    260760
     acagggcatg ggcgcaggca ttctcgccga ctgcgaacgc gcgcatacaa caaccaagaa    260820
     gttacgaaag atgcagcccc agcggccccc caccgctgca cgcgccggcc atgagcattg    260880
     tcatgaccac catggaaaag ccacgcccgt tcgtttcgac gaccgctgca agtcatgtcc    260940
     gtcttgcggg gaagttccgc agcatgcgat gttggcggga ctgaccatgt ccgcttacca    261000
     gccgagattg aaaacacatc gttcgtctcg cgctcacttt ctcagcttcg tcccggacct    261060
     tctcctacgg cctcctcggc tggttgtcta acacgcatcg ccgatggcga gccagctttc    261120
     gcttttgtaa gaggaggcag acggcgcatc ggcaagacct ttggcagcgc ctctacacgc    261180
     gccaagggaa atcgagtgtt tcgtcagcaa gcaaccagga cgccgtcaat ggcgcagttg    261240
     cttgctgcgt aggagtttgc cgtgcatatc tgtgtaagtt gccatacacc cttgaggccc    261300
     ttcgcttggt cgtgcagcgc ttgtggctgg cgagccacca tccgtgatgg cgtcgcttgc    261360
     ttggcgcccg agatgctgca ggacaacgac ggcttccatg agccgctgtt cgaggaatac    261420
     caaaagctgc aggctgacca cttttggttc gtgcatcgcc gcaggctaat cgtgtgggcg    261480
     ctgcagcgcc atttcccgca gctccagtcg tttctggaag ttggctgcgg cacagcggag    261540
     aacctagccg cgattgcaga tcggtttcgg cacgcagaag tgtgcggtgg ggaaccctcg    261600
     ctgaatgcac tccagatggc gcgccgtcat tgcggggcga agttcttgca aatggatgct    261660
     cgcgcgatac cgtttgttga ggcatttgag gtggtcggcg cctttgatgt catcgagcat    261720
     atcgatgatg atcgacgtgc cctaagtgag atgtacaagg cctgccggcg cggtggcggg    261780
     ctgatcttga cagtgcccca gcacccccgg ctctggagcc gcgtggacga tgcggccaag    261840
     cacaaacgtc gctatacgcg ccgggatctc attgaaaagt tgcgcgccac cgggttccga    261900
     ccgctctatg tcaactcctt tatgtcgctg ctgctaccgg tcatggttct ttcgcgtctg    261960
     catcaaaaga tcgcacggac cgagcaggaa gttgacgaag gctttcgtat cgggaaaacg    262020
     cttaatcgcc tgttctcgac ggtctgcaac gttgagtctc gcttgcttac ccgcggcatt    262080
     cactttccgg ccggcggctc actgctcgcc attgcggtca aggagtaagg tagcgactca    262140
     acgaacagga acccgccatt tacacgtgtc cgatacacct acgagaatga gccgccatga    262200
     cgaatcgaca tcgcttctac aggtacctcg cgagcggcgg tgtttccacc gccgctcact    262260
     atctgaccct atacgcgctg gtccaaatgg ggaccgagcc tgtgctcgga tcaaccattg    262320
     cggcgctggt ggggctggtg ctcaactact cggtcagtcg gcggtgggtc ttcgatgcgt    262380
     cagccaagat cccggagacg ctcgcccgat tcgccctcgt atggatgctg gcattgttga    262440
     tcaacgcctg ggcactggca tccctcctcg ctttagggtt ccactatctg gttgcgcagg    262500
     tgaccgcaac cggggtcttg gtcctgatca atttcaatct ccaccgccgt tggacgtttt    262560
     ccggtgcgcg cgtgcccccc ctcgataagt gacccatgtc tcaccaacgc aaacactgga    262620
     cagcacagcc tcaacacgcc ttagggcagt tacatcagga gacgatgcca tgagaaaaag    262680
     tactgtcata tcgatattgg caacccttgc cagctttccc acgattgcaa gcgccttcgt    262740
     cctgcatctc gaacatgggt tcggcaccca caaccccgtc gtgacgttgg gcggcatgca    262800
     gccctcatcc gcactccctg aagagatcga cgtttcgctc aaacggggcg atattctgtc    262860
     caaaacgctt tcgtctcaac agcgctattc catgcggctg gtcaaccgtg gaagcgtttc    262920
     cgtgaaactc cgcttggata tacaagacgc aggcgggatc ggcgcactac cgggcacgca    262980
     accgatcgat ttggtgttgg agccggggga agcgagagaa ctggctatgg aggcttggac    263040
     tccaatgatg gtggtcgtca gtacagcggc gccttaattt ctccgcgtgc aacacctgag    263100
     gcagacgtta gcccgcacgg caaaagccaa gaatgagcgg gcaatgtgcc tctgttgcag    263160
     agactgcgcg ttgcactgtt ctgacacagt agcgaaaccg ccgcaacagt cgaaaaatca    263220
     ccgtgagccc actgcaactc ttcgttatct tggccggctt aaccggccag ctattcattg    263280
     cccgcaaaga cccgcgcggc tatctagcct ggattgccgg caacatgggc ctggtgttcg    263340
     tgtactggga gaccaagcaa tttgcattga ttgcattgca gttcgtcaac acagggatcc    263400
     aggtcacggc tctgatcgct tggcgacgag caaagcggtg caatgaaacc agccctgcac    263460
     aaccgtgtga ggcgtgacag ggctggtggt attttaactg ccggtgaacc aggtgctgcg    263520
     cgcgatgatg acacgcactc ccttggcttc gggtgcatcc ggcagcagaa cgcccaggtc    263580
     gaccgaggtg ctctgcatcg cttcaatgaa tgtccacgct tgcgtcccgg tccccgtgga    263640
     gaatgcgatg gtctcaccgg agtcaacatt gatgtacttc atcccgggct tcactaccac    263700
     cgtgcgcgca gccattgacg caggggcagg tgagccgaac aacaatgcgg tcttgttcat    263760
     attcgacggg ggtgccgacg ggctttgccg cacgtgttcg atccaattgt ccccgccgtc    263820
     accgcggaat ttgtcagagg cccatgccgc cgagcttgcg gcaaagagga ctgcgagcat    263880
     gagcgaagca agtccattgc gattcatcgt tttctcctgg agcgtcaagt ggtgtgaacg    263940
     attctagaga ggcattcctc tcccttcgat gactcgcgaa ttacgtctcg gtaaggcgct    264000
     cataccgaag atgagcctca ggggaggtac acaaaaaaag ggccatgccc ccattcagaa    264060
     ccaccaccgt atgccggcaa tgatttgcct atctgtcgcg ctttgccccg ccgctcgcgc    264120
     aaagtcggcg gtcttgccca tcttcttgcc ccaaaccacg ccgatatacg gagcaaagtc    264180
     gcggcggact tcgtatcgga gtcgcagacc tagccggagg tcagccagcc cgctgccgat    264240
     ttcccgtgcc tcgtcagtct ttgcgtaggc gttcgcttcg atttcgggag tcaggacgat    264300
     gcgctgtgag aagcggacgt cgtaggtaga gcgtacacgc gcagccacgc gccccgcgtt    264360
     gctgacgtac agtgtcgcct ctgcatcgaa ccagtaaggc gcaaggcctt ggattccgaa    264420
     cgctgcccat gtgcgcgccg gcccgccacc aaagtcgcgc cgaatgcccg tctgccaatc    264480
     ccagaacgga gcaaatgcat gtccccacag cgcctcaact tttgcatctt cggtcttacc    264540
     gaatagccgc ataccctgca gtttgagcca cagcctattg atgtcctttc cgatccatcc    264600
     gtgcatgtcc cacgccaacc cggtggcagc gggagcgcgt atggcttcga accggtcgaa    264660
     caagaattgg tgataaacgt cgttgtcggc catggtgttt cccggcatgg tgatgcctcg    264720
     cttgggatct cgcatgggca cgcgaggctc atcgctctta aggatgacgt tgatgccgct    264780
     ttcctcggta ttagcggccc gttcgggtga tgcggacatg tttgctccct ggctgagaac    264840
     ttggtcaggc atgccctgtc gcttctgtgg catggcttgc atggaggagc ctgctgtctg    264900
     tgcgcctgcg gcgtccacag taagcgccag cggcgcggcg accaaacaca gccatctttg    264960
     cactcttggc aacatgactc gctccttagc cgatgggtta ggccacaacc accttgcgga    265020
     acatgccggc ttccatgtga tacagcaggt gacaatggaa tgcccactgc cccggggcat    265080
     ctgccgtcac gaggaaactg atctgcttgg acggttgaac gttgatggtg tgcttgcgaa    265140
     cgagggcttg gcgctcaccg ttctccaatt cgctaaacat gccgtgcaaa tgcatggggt    265200
     ggttcatcat ggtgtcgttg acgagggtga tccgcacccg ttcgccgtaa tacaaacgga    265260
     ttggctcagc ctcggagaac ttcttgccat cgaaccccca aatgaaccgg cgcatgtttc    265320
     cggtcaggtg caggacgatt tcgcggcccg ggggccgagc gtcaatgggg gggcgagcgt    265380
     tcgcaaatcc gcataggcca atacccgacg gccgttgtcg cgcaatcttg gaccggggtc    265440
     ggcgagcgac ttcgaaggat tcatggaacg catgtcgact tcggggccgg tctgcatgac    265500
     cgacatcgtc attggcggag aaatcatggg cttttggcgt ggcggcatcg gcatggggga    265560
     tgccattcct tcatggcctg actgcggttg cttgtcttgc atatcggcca cgggtccgct    265620
     catctccggc attgaatggc ggggggcgga gtgggatccg ttgtttggca ttcgcatcgt    265680
     ggtaccgggc tgttctctgc ccatagccat cccgctagtc tccattccca tgtccgccat    265740
     ggagagccaa gttttagggt ccatcggtgg aacctcggcg cgcatgcccg gctccggcgc    265800
     gagtgtggca cgtgcgtagc cgctgcgatc catcgcctga gcaaagatcg tgtatgcagc    265860
     atcctggggc atttgcacca acacatcgta ggtctcggcc accccgatcc ggaactcgtc    265920
     gacgtccacc gcttcgacgt cttgcccgtc cgctgcgcaa acgcgcatcg ttagacccgg    265980
     aatccggacg tcgaaggtag tggtagccga tccattgata aagcgcagtc gtacgcgctc    266040
     gccggccttc gcgatggccg tccagttggc aaagggagtg gcgccgttga ctaaatagct    266100
     ataagtggcg gctgatacgt cggcgaggtc ggtagggttc atgcgcatct cgttccacat    266160
     gcgccgacgt ttgagcgctc ccgagatgcc cactgtcctt gtgtcgtcaa cgaagtcggc    266220
     gaccgtaggt agctggaagt tataaaaatc gctcgattgc ttcagatgta ggaacacgct    266280
     gtctggattt tcgtccgtcc aatcgctcag catgacaatg tagtcgcggt cactgcggac    266340
     gagatctggc tcttgtggtt cgattaccaa tgggccgtag agtccgagct gctcctgaaa    266400
     acgcgtgtga ctgtgatacc agtaggtgcc ggcctgcctc accttgaacg tgtagatgaa    266460
     tgtctggtga gcgggaatgc cagggaatga cacgccgggc acaccatcca tcgcaaatgg    266520
     aacgaggatg ccgtgccagt ggatcgaggt ttgcgtgtcc agtgtgttgg tgacccgcag    266580
     tgtcaccttt gacccctgct tccatcgcag tatcggcgct gggatcgacc cattcacggt    266640
     gatggcatag cgtgcgcgcc cagtgaaatt gacgagcgtg cgtccaatag tcaagtcaaa    266700
     gtcggtcccc gtaagcgcac ccggatagtt ctgaacttgt tgtgcccata tgggcgcggc    266760
     cattgtcccg ccgaacgcgg ttgcgaccgt gccagccatc cggtgcaaaa acttgcggcg    266820
     gcccacgctg cccagtgaaa tgctgtcgct cacgatcctc tccctatgtt ggaaggttgt    266880
     ggtcctgcgt tacgaacgat agtccccaac gggactcaat gtcggtagca tggggcatgc    266940
     ccagggcgga gggtgcaacg gcggcgttgt tgtcttcgct caccattgct cctcctgtgc    267000
     cagaccgcta tgctcactac gaccttcgta gcgcgccact ctttcctcac aggatgccga    267060
     gcatgacccg ccagcacagc cacaaagaag cagcttcgcg ccaggaaaac gccaacgcac    267120
     cgcaaacaca caacgagtac acgcaccaac gcctatgcga cagcgacgac caacacgctc    267180
     attcgccccc cgtgcccgag gctgtcgaga gcgacaaagc aggcgtctca tcaacgacgg    267240
     agttcgcgcc cacggtttac acctgcccga tgcatccgga gattcgccag gatcatcccg    267300
     gcacgtgccc caaatgcggt atgacgctgg agccggtcat gcccgcggta gaggaggaag    267360
     agaatgcgga gcttgcggac ttccggcggc gattctgggc aagctttcca ttgacggcga    267420
     ttgtttttgt gctggccatg gctggacacc gattgactcg cctcgatcca gcatggcaag    267480
     acaggtttga gttggcactg gccacaccgg tcgtgctttg ggcgggattg ccattcttca    267540
     gacggtgtgc ccaatccttt gtataccgca gcccgaacat gtggacgctc atcggcctgg    267600
     gcacgggggc tgcctatctt tacagcgcgg tagcggtcgt tgcgccgggt gtgtttccct    267660
     ctacctttgc ggcgtccggc cgggtgcaag tgtatttcga agcggcggcc gtcatcattt    267720
     cattgacact gctggggcag atgctcgaac tgaaagcccg ctcgcagacc tcagccgcaa    267780
     tcaagtctct actcggcttg gccccgaaaa cggccaggcg tatcaacgca gacgacagcg    267840
     aagaggatgt tcccattgcc catgttcatg tgggcgattt gctgcgtgtg cgacccggtg    267900
     aaaaggtgcc cgtggatggc gttgtggtcg cgggcgcgag cgcgctcgac gagtcgatga    267960
     tcaccggtga gccgattccc gtctccaaac gcgcgggcga ccatgtgatc ggtgccacca    268020
     tgaacacctc gggcgcactc gtggtccggt ccgagaaagt gggcgcgcag acggtcctct    268080
     cgcaaatcgt acaaatggtt gcgcaagcac agcgttccaa ggcgccgatg cagcggatgg    268140
     cagacaaggt ggcgggcgtc tttgtgatcg gtgtggtcgg catcgccgtc atgacgctct    268200
     tcgcctgggg gatctggggt ccacagccga gttgggccca cggcttgatc aatgcggtcg    268260
     ccgtgctgat cattgcttgc ccgtgcgcgc tcgggcttgc cacgcccatg tccatcatgg    268320
     tggccagcgg caaaggggcc gaacacggca ttctttttcg ggatgccgca gcaatcgaga    268380
     acctgcgcaa ggtcgacacg cttattgtgg acaagacagg cacgttgacc gaagggcgcc    268440
     cctcattcga tcgggccatt ggcctcaatg gattttccga catggacgtc ttgcgcttgg    268500
     cggccagtct ggaccaaggt agtgagcacc ccttggccgc tgcgatcgtg gcgcaagcgc    268560
     gcgaacaggg gctcgcgctc gagcggccgg aagattttga atccgcgtca gggatcggcg    268620
     tgagaggaca cgtcgctggg cgaagcctgg cgctcggcaa cacctcgctg atgcaggcgc    268680
     acgcggttgc tgtcgatgcc gcctccaccg aggcagacgc catgcgagcc cgaggcgcca    268740
     gtgtgatgta cctggcggtc gatggggtcc ttgctggcct gctgtcggtt tccgatcgcg    268800
     tgaagacgac aacaccgcag gccctgaccc aactcagagc cgatgggctt cggatcgtga    268860
     tggctaccgg cgacggaaac gtgaccgccc aatccgtcgc aaaacaactt ggcattgttg    268920
     agtttcgcgg cgaggtcaag cctgcggata agctggcgtt ggtcgccaca cttcaagaac    268980
     gaggcttggt tgtagcgatg gcaggcgacg gcatcaatga tgcaccggcg ctcgccaaag    269040
     ccgacgtggg tattgcgatg ggtaccggta ccgatgtcgc gatgaacagc gcccaggtta    269100
     ccctcgtgaa aggcgacctg cggggcattg cccgtgcccg cgccttatcc gaggcaacga    269160
     ttgccaacat gaagcaaaac ctcggcttcg ccttccttta caacgcactg ggtgtgccat    269220
     tggctgccgg cgtgctctat ccttttaccg gacttctgtt atcacccatg attgccgcat    269280
     tggcgatgag cttgagttcg gcatcggtgg tcgccaatgc gctgcgactc cgtgcgaccc    269340
     gactctgatc ccagcattcg ccgcttcacg aggctattgc gaacaattct cattctccct    269400
     tacaatctcc ttatttcgga aggggagtca aatgcaaggt gctacaaaaa gcacgcattg    269460
     ggggaaggtt tggcttgctg gggcgcttgc ctggctgtgt tccacaactg cgcttgccgg    269520
     cgaatcgccg ttcgggtgga tttacacggc cgacgttatg cccaaaggcc gcttcgaatt    269580
     cgagcaccag tctttcctgc agcggggcca gtcccaagga tcctatagcg gattgctcaa    269640
     ccgcgaagaa gtcgagtacg gcgtgacgga caaattccaa ttggccggct atttcaactg    269700
     gagctacgtg aacgccaatc ggaatggtct tgatggcacc acgcgtgggc cgctgacaga    269760
     tctcggtccc aatgacgatc cgactgggcg ttaccgcaag actcgcttcg agactgtttc    269820
     actcgaagcg atctaccaac tcatgaaccc agtgactgat ccgatcggct tggcactgta    269880
     catcgagcca gaactggggc cccgtgagcg cgatctcgaa tggcgcatca tcttgcagaa    269940
     gaactggttg gatgatcggc tcatttttgc cgccaatatt ctcggtgccc atgagcgcga    270000
     caaaaccgcc atgggtgata ttgagcgtgc ttccatgctt gatctgaccg ccggcgtgtc    270060
     ctatcgcttg accgacaacc tgagcctggg catggaggcg cgcaaccatc gtgaattcca    270120
     ggggtatcgc tataaccgtc gtgatcactc cgcgtggttt cttggcccca atttgcacta    270180
     cgccaccaaa cactggtggg taacggccgc gtggcgccac caattgcccg tagtcaaaac    270240
     ctacaacgag gaccaggcgg acgtagtggc aggcaaccgt atcttcggtg acgagcatgc    270300
     gcgcaacgag ttcatggtca aggtggggtt cccattttga agcgcgtcca ttgatacgga    270360
     gacagacatg aagtggactc ccatggcggc agtgccgctt gcggtgctgg tcgtgcccgt    270420
     ccaagcgacg gaatacctga cagttcaaca ggctcaggcg cagatgtttc ctggcgcgag    270480
     ttttcaggcc gtgcctctcc agattacgga ccagattcgc gaaacattga acgagcgctc    270540
     cggggtacac gagccattca atgacaaggg ggtctggaaa gtgtcgactg gcggctggtt    270600
     catcgtggat cgcgtggtgg gcaagcatga aaaaatcacg tatgccgtgg cgctcgacgc    270660
     caagggagcc gtgcgcgccg tcgatatcct gacgtaccag gaaacgtatg gctatgaggt    270720
     gcgcaatgcc gactggcgtg cccagtttgt tggtaagacc gcgcaggatg ctgtgcagct    270780
     tggtaaagac atccgtaaca tcagtggcgc gacgctctca tgcaaacaca tcacccaggg    270840
     agtcaagcgg gtgctggctg tgtatgacct cttactagcc aagatgtgat tcgtcgctcc    270900
     aaaccgctat tggggacttt cgttgaagtt cgcattgacg atgtgtatcc ccaggactgc    270960
     gctcacttgg cagaaaccgc catcgcagcg gcgttctccg taatcgagca agccgaggcg    271020
     ttgatgagct tccagcgctc ggatagcgac ttgtcacgtc tgcatgcggc gtcggtaggc    271080
     gaagcggtcc gcgttcaccc ttggaccatg cgtgtgctgc gcgaggccca gcgcatgcac    271140
     gagcgtaccg gcggcgtgtt cgaccccacc gtggcccgca tgttggtggc acacaaaatt    271200
     ttgccccgcc cagcggggcc gacggcggaa gtcgacgtgc ggtttgcgga tgtagtgatg    271260
     ctcgatgaaa atcgcattag taagcggcgc gcactatggt tggatctcgg tggcatcgcc    271320
     aaaggctttg ccgtggacat ggctatccta agtctgcggc gccacaacgt tcgcagtggc    271380
     gccgtttcgg ccggagggga cctgcgcgtc tttggcaagc atgcacagcc catccacgta    271440
     cgcagtgcca acgcgcccgg tcggctagaa ctactcggtc ggctcaccaa cggggccgtg    271500
     gccaccagcg gtcactattt cgcagaaagc ttcggactgc cccctggtac agcatccatc    271560
     cggtcgcaac aagcgccgat ggaagcgcct tgcgcagagc gaacggtcac cgtcattgcc    271620
     ccccgctgta tctgggcgga cgcactgacc aaggtcgcca tgcttgccgg tacgacggcg    271680
     cccgccacgg tccgcgcgct atcaagctat cacgcacacg ttgttgcatc atgacgcaat    271740
     cctcgcatcg acatcccctg aaagggacag gcattcgtct gcatccgtat cactattggg    271800
     ttgctctcgc cgtattgcta gcggtagcgg tgtctgggct gatatggacg gttttgcacg    271860
     atttgcttca atgggaggac gcaccgatcg tccgccagat tctgcagttg catggcgcct    271920
     ttgcgttctg cagcctgatt ctcttgggtt ccatgctgcc gcaacacatt cgcttcgcgt    271980
     gggttgcgcg ccgaaacctc gtgaccggta cgttgacggg aatcgtgttc ttgttgctga    272040
     ccatcaccgc ttatgggctg tattacgggc ccgaagattg gagtggtctt acgaagactg    272100
     tgcaccttgt tctgggcatt gctgctgttg cggccgtgcc cctccacatg ttcattggac    272160
     ggaagcgaca caacggctac cgtgcccccg cgagcaagaa tgtacggcac gaaaaaacct    272220
     gaagcgaatc gacgaggcaa tcgtacaagc ctgcgcagca aaccgctcgg cgcgcgggaa    272280
     agagccccgg gggagtaacc ccccggggag ggggaagccc ggaaaggggg ggggccggga    272340
     ttgagctttg gtttattggt ggccaccatc cgtgtaaggg tcacgggtgc ccatcgaatg    272400
     cgcgccatcg gtgtagatgt cacgcgctgc gcgcccacca tcggtgtagg gatcgcgctt    272460
     gcccatcgcg ttagcgccat cggtatatgg gtcgcgcgcg ccagtagcgg tcgccgcgtt    272520
     ggcgacgttg acaccgaggg ccagcaacgc tgcccccacc aatgcggatt ttttcaggat    272580
     gttcatcgcg ttttccttct tcaagttgaa acaagacact gctatgccaa tgcagtgtag    272640
     aaggctgggg ctgacagaaa cgtgaccctc gtattacaag tgcgacagat cagcgagatt    272700
     gatccggtat gccaccttca atgcacggca cgacaggcgt cggcgcatgt ctcgcaggca    272760
     cgcgcgcact gctgacagtg ctcgtgggag tgcttggcac actcggcggc gcaggcttga    272820
     cagattttcg cgcacagttc gcatatggca ttggcttggg tgctgcctcg cgccatcaac    272880
     cccacggcgg tcccgcagat atcagcgcaa tcgagatcca gccgaatgca ggtgctcaat    272940
     gtcagagcgt ccttttcggt caggcaggag gcggcgcagt gcaggcacgc cacgtgacac    273000
     gcggcgcatt catcgatgca ggtttggaag tattggtgag gcatttgggt tctccttgat    273060
     tggcgacgtg ccgaaatggc acgatgcacg tggagcaagg agagagcctg ggccttggtg    273120
     cttgtggaga aatgct                                                    273136
//

If you have problems or comments...

PBIL Back to PBIL home page