(data stored in SCRATCH zone)

EMBL: CP001650

ID   CP001650; SV 1; circular; genomic DNA; STD; PRO; 5128187 BP.
XX
AC   CP001650;
XX
PR   Project:PRJNA38641;
XX
DT   27-APR-2010 (Rel. 104, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Zunongwangia profunda SM-A87, complete genome.
XX
KW   .
XX
OS   Zunongwangia profunda SM-A87
OC   Bacteria; Bacteroidetes; Flavobacteriia; Flavobacteriales;
OC   Flavobacteriaceae; Zunongwangia.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-5128187
RX   DOI; 10.1186/1471-2164-11-247.
RX   PUBMED; 20398413.
RA   Qin Q.L., Zhang X.Y., Wang X.M., Liu G.M., Chen X.L., Xie B.B., Dang H.Y.,
RA   Zhou B.C., Yu J., Zhang Y.Z.;
RT   "The complete genome of Zunongwangia profunda SM-A87 reveals its adaptation
RT   to the deep-sea environment and ecological role in sedimentary organic
RT   nitrogen degradation";
RL   BMC Genomics 11:247-247(2010).
XX
RN   [2]
RP   1-5128187
RA   Qin Q.L., Zhang Y.Z.;
RT   ;
RL   Submitted (22-JUN-2009) to the INSDC.
RL   State Key Laboratory for Microbial Technology, Shandong University, 27
RL   Shanda Nanlu, Jinan, Shandong 250100, China
XX
DR   MD5; cf0b8e99a76b42d733c4c76c002b7235.
DR   BioSample; SAMN02603855.
DR   EnsemblGenomes-Gn; EBG00001152361.
DR   EnsemblGenomes-Gn; EBG00001152362.
DR   EnsemblGenomes-Gn; EBG00001152363.
DR   EnsemblGenomes-Gn; EBG00001152364.
DR   EnsemblGenomes-Gn; EBG00001152365.
DR   EnsemblGenomes-Gn; EBG00001152366.
DR   EnsemblGenomes-Gn; EBG00001152367.
DR   EnsemblGenomes-Gn; EBG00001152368.
DR   EnsemblGenomes-Gn; EBG00001152369.
DR   EnsemblGenomes-Gn; EBG00001152370.
DR   EnsemblGenomes-Gn; EBG00001152371.
DR   EnsemblGenomes-Gn; EBG00001152372.
DR   EnsemblGenomes-Gn; EBG00001152373.
DR   EnsemblGenomes-Gn; EBG00001152374.
DR   EnsemblGenomes-Gn; EBG00001152375.
DR   EnsemblGenomes-Gn; EBG00001152376.
DR   EnsemblGenomes-Gn; EBG00001152377.
DR   EnsemblGenomes-Gn; EBG00001152378.
DR   EnsemblGenomes-Gn; EBG00001152379.
DR   EnsemblGenomes-Gn; EBG00001152380.
DR   EnsemblGenomes-Gn; EBG00001152381.
DR   EnsemblGenomes-Gn; EBG00001152382.
DR   EnsemblGenomes-Gn; EBG00001152383.
DR   EnsemblGenomes-Gn; EBG00001152384.
DR   EnsemblGenomes-Gn; EBG00001152385.
DR   EnsemblGenomes-Gn; EBG00001152386.
DR   EnsemblGenomes-Gn; EBG00001152387.
DR   EnsemblGenomes-Gn; EBG00001152388.
DR   EnsemblGenomes-Gn; EBG00001152389.
DR   EnsemblGenomes-Gn; EBG00001152390.
DR   EnsemblGenomes-Gn; EBG00001152391.
DR   EnsemblGenomes-Gn; EBG00001152392.
DR   EnsemblGenomes-Gn; EBG00001152393.
DR   EnsemblGenomes-Gn; EBG00001152394.
DR   EnsemblGenomes-Gn; EBG00001152395.
DR   EnsemblGenomes-Gn; EBG00001152396.
DR   EnsemblGenomes-Gn; EBG00001152397.
DR   EnsemblGenomes-Gn; EBG00001152398.
DR   EnsemblGenomes-Gn; EBG00001152399.
DR   EnsemblGenomes-Gn; EBG00001152400.
DR   EnsemblGenomes-Gn; EBG00001152401.
DR   EnsemblGenomes-Gn; EBG00001152402.
DR   EnsemblGenomes-Gn; EBG00001152403.
DR   EnsemblGenomes-Gn; EBG00001152404.
DR   EnsemblGenomes-Gn; EBG00001152405.
DR   EnsemblGenomes-Gn; EBG00001152406.
DR   EnsemblGenomes-Gn; EBG00001152407.
DR   EnsemblGenomes-Gn; EBG00001152408.
DR   EnsemblGenomes-Gn; EBG00001152409.
DR   EnsemblGenomes-Gn; EBG00001152410.
DR   EnsemblGenomes-Gn; EBG00001152411.
DR   EnsemblGenomes-Gn; EBG00001152412.
DR   EnsemblGenomes-Gn; EBG00001152413.
DR   EnsemblGenomes-Gn; EBG00001152414.
DR   EnsemblGenomes-Gn; EBG00001152415.
DR   EnsemblGenomes-Gn; EBG00001152416.
DR   EnsemblGenomes-Gn; EBG00001152417.
DR   EnsemblGenomes-Gn; EBG00001152418.
DR   EnsemblGenomes-Gn; EBG00001152419.
DR   EnsemblGenomes-Gn; EBG00001152420.
DR   EnsemblGenomes-Gn; EBG00001152421.
DR   EnsemblGenomes-Gn; EBG00001152422.
DR   EnsemblGenomes-Gn; EBG00001152423.
DR   EnsemblGenomes-Gn; EBG00001152424.
DR   EnsemblGenomes-Gn; ZPR_0019.
DR   EnsemblGenomes-Gn; ZPR_0152.
DR   EnsemblGenomes-Gn; ZPR_0153.
DR   EnsemblGenomes-Gn; ZPR_0266.
DR   EnsemblGenomes-Gn; ZPR_0349.
DR   EnsemblGenomes-Gn; ZPR_0428.
DR   EnsemblGenomes-Gn; ZPR_0524.
DR   EnsemblGenomes-Gn; ZPR_0637.
DR   EnsemblGenomes-Gn; ZPR_0693.
DR   EnsemblGenomes-Gn; ZPR_0694.
DR   EnsemblGenomes-Gn; ZPR_0695.
DR   EnsemblGenomes-Gn; ZPR_0696.
DR   EnsemblGenomes-Gn; ZPR_0697.
DR   EnsemblGenomes-Gn; ZPR_0884.
DR   EnsemblGenomes-Gn; ZPR_0885.
DR   EnsemblGenomes-Gn; ZPR_0886.
DR   EnsemblGenomes-Gn; ZPR_0966.
DR   EnsemblGenomes-Gn; ZPR_0985.
DR   EnsemblGenomes-Gn; ZPR_1156.
DR   EnsemblGenomes-Gn; ZPR_1157.
DR   EnsemblGenomes-Gn; ZPR_1158.
DR   EnsemblGenomes-Gn; ZPR_1159.
DR   EnsemblGenomes-Gn; ZPR_1161.
DR   EnsemblGenomes-Gn; ZPR_1177.
DR   EnsemblGenomes-Gn; ZPR_1262.
DR   EnsemblGenomes-Gn; ZPR_1475.
DR   EnsemblGenomes-Gn; ZPR_1660.
DR   EnsemblGenomes-Gn; ZPR_1844.
DR   EnsemblGenomes-Gn; ZPR_1845.
DR   EnsemblGenomes-Gn; ZPR_1846.
DR   EnsemblGenomes-Gn; ZPR_1847.
DR   EnsemblGenomes-Gn; ZPR_1848.
DR   EnsemblGenomes-Gn; ZPR_2217.
DR   EnsemblGenomes-Gn; ZPR_2520.
DR   EnsemblGenomes-Gn; ZPR_2659.
DR   EnsemblGenomes-Gn; ZPR_2778.
DR   EnsemblGenomes-Gn; ZPR_2779.
DR   EnsemblGenomes-Gn; ZPR_2966.
DR   EnsemblGenomes-Gn; ZPR_3222.
DR   EnsemblGenomes-Gn; ZPR_3497.
DR   EnsemblGenomes-Gn; ZPR_3608.
DR   EnsemblGenomes-Gn; ZPR_3609.
DR   EnsemblGenomes-Gn; ZPR_3610.
DR   EnsemblGenomes-Gn; ZPR_3611.
DR   EnsemblGenomes-Gn; ZPR_3612.
DR   EnsemblGenomes-Gn; ZPR_3717.
DR   EnsemblGenomes-Gn; ZPR_3718.
DR   EnsemblGenomes-Gn; ZPR_3779.
DR   EnsemblGenomes-Gn; ZPR_3780.
DR   EnsemblGenomes-Gn; ZPR_3929.
DR   EnsemblGenomes-Gn; ZPR_3930.
DR   EnsemblGenomes-Gn; ZPR_4139.
DR   EnsemblGenomes-Gn; ZPR_4285.
DR   EnsemblGenomes-Gn; ZPR_4426.
DR   EnsemblGenomes-Gn; ZPR_4546.
DR   EnsemblGenomes-Gn; ZPR_4688.
DR   EnsemblGenomes-Tr; EBT00001741276.
DR   EnsemblGenomes-Tr; EBT00001741277.
DR   EnsemblGenomes-Tr; EBT00001741278.
DR   EnsemblGenomes-Tr; EBT00001741279.
DR   EnsemblGenomes-Tr; EBT00001741280.
DR   EnsemblGenomes-Tr; EBT00001741281.
DR   EnsemblGenomes-Tr; EBT00001741282.
DR   EnsemblGenomes-Tr; EBT00001741283.
DR   EnsemblGenomes-Tr; EBT00001741284.
DR   EnsemblGenomes-Tr; EBT00001741285.
DR   EnsemblGenomes-Tr; EBT00001741286.
DR   EnsemblGenomes-Tr; EBT00001741287.
DR   EnsemblGenomes-Tr; EBT00001741288.
DR   EnsemblGenomes-Tr; EBT00001741289.
DR   EnsemblGenomes-Tr; EBT00001741290.
DR   EnsemblGenomes-Tr; EBT00001741291.
DR   EnsemblGenomes-Tr; EBT00001741292.
DR   EnsemblGenomes-Tr; EBT00001741293.
DR   EnsemblGenomes-Tr; EBT00001741294.
DR   EnsemblGenomes-Tr; EBT00001741295.
DR   EnsemblGenomes-Tr; EBT00001741296.
DR   EnsemblGenomes-Tr; EBT00001741297.
DR   EnsemblGenomes-Tr; EBT00001741298.
DR   EnsemblGenomes-Tr; EBT00001741299.
DR   EnsemblGenomes-Tr; EBT00001741300.
DR   EnsemblGenomes-Tr; EBT00001741301.
DR   EnsemblGenomes-Tr; EBT00001741302.
DR   EnsemblGenomes-Tr; EBT00001741303.
DR   EnsemblGenomes-Tr; EBT00001741304.
DR   EnsemblGenomes-Tr; EBT00001741305.
DR   EnsemblGenomes-Tr; EBT00001741306.
DR   EnsemblGenomes-Tr; EBT00001741307.
DR   EnsemblGenomes-Tr; EBT00001741308.
DR   EnsemblGenomes-Tr; EBT00001741309.
DR   EnsemblGenomes-Tr; EBT00001741310.
DR   EnsemblGenomes-Tr; EBT00001741311.
DR   EnsemblGenomes-Tr; EBT00001741312.
DR   EnsemblGenomes-Tr; EBT00001741313.
DR   EnsemblGenomes-Tr; EBT00001741314.
DR   EnsemblGenomes-Tr; EBT00001741315.
DR   EnsemblGenomes-Tr; EBT00001741316.
DR   EnsemblGenomes-Tr; EBT00001741317.
DR   EnsemblGenomes-Tr; EBT00001741318.
DR   EnsemblGenomes-Tr; EBT00001741319.
DR   EnsemblGenomes-Tr; EBT00001741320.
DR   EnsemblGenomes-Tr; EBT00001741321.
DR   EnsemblGenomes-Tr; EBT00001741322.
DR   EnsemblGenomes-Tr; EBT00001741323.
DR   EnsemblGenomes-Tr; EBT00001741324.
DR   EnsemblGenomes-Tr; EBT00001741325.
DR   EnsemblGenomes-Tr; EBT00001741326.
DR   EnsemblGenomes-Tr; EBT00001741327.
DR   EnsemblGenomes-Tr; EBT00001741328.
DR   EnsemblGenomes-Tr; EBT00001741329.
DR   EnsemblGenomes-Tr; EBT00001741330.
DR   EnsemblGenomes-Tr; EBT00001741331.
DR   EnsemblGenomes-Tr; EBT00001741332.
DR   EnsemblGenomes-Tr; EBT00001741333.
DR   EnsemblGenomes-Tr; EBT00001741334.
DR   EnsemblGenomes-Tr; EBT00001741335.
DR   EnsemblGenomes-Tr; EBT00001741336.
DR   EnsemblGenomes-Tr; EBT00001741337.
DR   EnsemblGenomes-Tr; EBT00001741338.
DR   EnsemblGenomes-Tr; EBT00001741339.
DR   EnsemblGenomes-Tr; ZPR_0019-1.
DR   EnsemblGenomes-Tr; ZPR_0152-1.
DR   EnsemblGenomes-Tr; ZPR_0153-1.
DR   EnsemblGenomes-Tr; ZPR_0266-1.
DR   EnsemblGenomes-Tr; ZPR_0349-1.
DR   EnsemblGenomes-Tr; ZPR_0428-1.
DR   EnsemblGenomes-Tr; ZPR_0524-1.
DR   EnsemblGenomes-Tr; ZPR_0637-1.
DR   EnsemblGenomes-Tr; ZPR_0693-1.
DR   EnsemblGenomes-Tr; ZPR_0694-1.
DR   EnsemblGenomes-Tr; ZPR_0695-1.
DR   EnsemblGenomes-Tr; ZPR_0696-1.
DR   EnsemblGenomes-Tr; ZPR_0697-1.
DR   EnsemblGenomes-Tr; ZPR_0884-1.
DR   EnsemblGenomes-Tr; ZPR_0885-1.
DR   EnsemblGenomes-Tr; ZPR_0886-1.
DR   EnsemblGenomes-Tr; ZPR_0966-1.
DR   EnsemblGenomes-Tr; ZPR_0985-1.
DR   EnsemblGenomes-Tr; ZPR_1156-1.
DR   EnsemblGenomes-Tr; ZPR_1157-1.
DR   EnsemblGenomes-Tr; ZPR_1158-1.
DR   EnsemblGenomes-Tr; ZPR_1159-1.
DR   EnsemblGenomes-Tr; ZPR_1161-1.
DR   EnsemblGenomes-Tr; ZPR_1177-1.
DR   EnsemblGenomes-Tr; ZPR_1262-1.
DR   EnsemblGenomes-Tr; ZPR_1475-1.
DR   EnsemblGenomes-Tr; ZPR_1660-1.
DR   EnsemblGenomes-Tr; ZPR_1844-1.
DR   EnsemblGenomes-Tr; ZPR_1845-1.
DR   EnsemblGenomes-Tr; ZPR_1846-1.
DR   EnsemblGenomes-Tr; ZPR_1847-1.
DR   EnsemblGenomes-Tr; ZPR_1848-1.
DR   EnsemblGenomes-Tr; ZPR_2217-1.
DR   EnsemblGenomes-Tr; ZPR_2520-1.
DR   EnsemblGenomes-Tr; ZPR_2659-1.
DR   EnsemblGenomes-Tr; ZPR_2778-1.
DR   EnsemblGenomes-Tr; ZPR_2779-1.
DR   EnsemblGenomes-Tr; ZPR_2966-1.
DR   EnsemblGenomes-Tr; ZPR_3222-1.
DR   EnsemblGenomes-Tr; ZPR_3497-1.
DR   EnsemblGenomes-Tr; ZPR_3608-1.
DR   EnsemblGenomes-Tr; ZPR_3609-1.
DR   EnsemblGenomes-Tr; ZPR_3610-1.
DR   EnsemblGenomes-Tr; ZPR_3611-1.
DR   EnsemblGenomes-Tr; ZPR_3612-1.
DR   EnsemblGenomes-Tr; ZPR_3717-1.
DR   EnsemblGenomes-Tr; ZPR_3718-1.
DR   EnsemblGenomes-Tr; ZPR_3779-1.
DR   EnsemblGenomes-Tr; ZPR_3780-1.
DR   EnsemblGenomes-Tr; ZPR_3929-1.
DR   EnsemblGenomes-Tr; ZPR_3930-1.
DR   EnsemblGenomes-Tr; ZPR_4139-1.
DR   EnsemblGenomes-Tr; ZPR_4285-1.
DR   EnsemblGenomes-Tr; ZPR_4426-1.
DR   EnsemblGenomes-Tr; ZPR_4546-1.
DR   EnsemblGenomes-Tr; ZPR_4688-1.
DR   EuropePMC; PMC2864250; 20398413.
DR   EuropePMC; PMC4332637; 25679965.
DR   EuropePMC; PMC4731906; 26822136.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01363; CRISPR-DR50.
DR   RFAM; RF01685; 6S-Flavo.
DR   RFAM; RF01692; Bacteroid-trp.
DR   RFAM; RF01705; Flavo-1.
DR   RFAM; RF01726; SAM-II_long_loops.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01999; group-II-D1D4-2.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP001650.
DR   SILVA-SSU; CP001650.
DR   StrainInfo; 720959; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5128187
FT                   /organism="Zunongwangia profunda SM-A87"
FT                   /strain="SMA-87"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Zunongwangia profunda"
FT                   /db_xref="taxon:655815"
FT                   /culture_collection="DSM:18752"
FT   gene            complement(914..2173)
FT                   /locus_tag="ZPR_0001"
FT   CDS_pept        complement(914..2173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0001"
FT                   /product="Multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50365"
FT                   /db_xref="GOA:D5BBD1"
FT                   /db_xref="InterPro:IPR005964"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBD1"
FT                   /protein_id="ADF50365.1"
FT                   /translation="MSNNSNTSGTSRSIIIIGILFFIFGFVTWLNSVLIPYLKTANELN
FT                   NFQSFFVAFASYISYFVMAIPSAKVLEKTGFKKGMGLGLIVMAVGALIFIPAAASRTYA
FT                   LFLTGLFVQGTGLALLQSAANPYITVLGPIESAAKRISIMGICNKVAGILAPLTIGAIL
FT                   LKNMDQVEAKLSTLTGAEREAELDLLSSRVEMPYIVMAIVLVGLAVLIYFSSLPEIETD
FT                   KEDESLAEANKNKTSVFQFPNLLLGTLAMFLYVGVEVIAGDTVITYAKDGQGIPSEAAL
FT                   QFTSYTLAAMIVGYLIGTVTIPKYISQAKALRISGILGILLGLAAIFTDGFVSVLCISM
FT                   LGLANAVVFPAIWPLALDGLGRFTKIASSFLIMAIAGGAIVPLAYGSLADSFGLQQAYW
FT                   VVIPCYLYILFFAVKGYKIR"
FT   gene            2629..4425
FT                   /locus_tag="ZPR_0002"
FT   CDS_pept        2629..4425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0002"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50366"
FT                   /db_xref="GOA:D5BBD2"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBD2"
FT                   /protein_id="ADF50366.1"
FT                   /translation="MKHIRNFCIIAHIDHGKSTLADRLLDFTGSVTEREKQAQLLDNMD
FT                   LERERGITIKSHAIQMDYVHEGEHYTLNLIDTPGHVDFSYEVSRSIAACEGALLVVDAA
FT                   QSIQAQTISNLYLALENDLEIIPVLNKVDLPSANPEEVTDDIVDLLGCDPDDVIPASAK
FT                   TGIGIEEILHAIITKIPAPSGKVDAPLRALIFDSVYNPFRGVETFFRVINGSIKKNQHI
FT                   KFVATGKDYSADEVGTLKLIQHPKQEIKTGDVGYLITGIKDAREVKVGDTITDAKNPTT
FT                   EAVAGFEDVKPMVFAGIYPVDTEDYEELRASMEKLQLNDASLVFTPESSAALGFGFRCG
FT                   FLGMLHLEIIQERLEREFDMTVITTVPNVSYNAYTNKHPDEVILVNNPSDLPEPSTLNR
FT                   VEEPYIKATIITKSDYVGNVMSLCIEKRGEITNQTYLTTERVELSFDMPLAEIVFDFYD
FT                   RLKTVSRGYASFDYSPVGLRTSKLVKVDVLLNGNKVDALSALLHQDNAYDIGKKMCEKL
FT                   KELIPRQQFDIPIQAAIGAKIISRETVKALRKDVTAKCYGGDISRKRKLLEKQKKGKKR
FT                   MRQVGNVEIPQEAFMAVLKLND"
FT   gene            4701..5459
FT                   /locus_tag="ZPR_0003"
FT   CDS_pept        4701..5459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50367"
FT                   /db_xref="GOA:D5BBD3"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBD3"
FT                   /protein_id="ADF50367.1"
FT                   /translation="MAGHSKWANIKHRKGAQDKKRAKQFTRAIKEISVAVKEGGGADPE
FT                   ANPSLRNAISNAKGVNMPKDTIDRAIKKASGADADNYETVTFEGYGPNGIAIFVECTTD
FT                   NTNRTVASVRSIFTKNGGSLGTNGSLEFLFDKKGVFVLEKEKIEMNLEEFELELIEGGA
FT                   TKIEKEDDLMTIYTDFNDFGMMSSKLEELNIETKSSEVQRIPLNTLELPVEDAKKILNL
FT                   VEKFEDDDDVQNVYHNLDITDELIGAMEAE"
FT   gene            complement(5571..7448)
FT                   /locus_tag="ZPR_0004"
FT   CDS_pept        complement(5571..7448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0004"
FT                   /product="sodium/hydrogen exchanger family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50368"
FT                   /db_xref="GOA:D5BBD4"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBD4"
FT                   /protein_id="ADF50368.1"
FT                   /translation="MLELAGIVILGILAQWVAWKFKIPAILPLILIGLCVGPIATMFTD
FT                   DGSKLIEPIWTGESGLFPGESLFYFVSLAIGIILFEGGLTLKKGEILNVGFVIVKLITV
FT                   AVIITFIGAGIAAHYIFDLSWQISFLFASLIIVTGPTVITPILRNIPLKKDVSTILKWE
FT                   GILIDPIGALFAVLVFEFISAGKGKEYTSTVLLEFGKIVLFGFTFGFTFAHALAYSIKK
FT                   NIIPHYLLNVLTLAAVLGVFVLSDQFAHESGLLAVVVMGMVMGNIDLPNLKELLYFKES
FT                   LSVLLISILFILLAANINMEDLYLIFTSKAIWLFAVIVFVVRPLGVFISSINSSLKFNE
FT                   KLFISWVGPRGIVAAGIASLFGIELANQGVEGAEYITPLVFMIVLGTVLLNATTARLFA
FT                   QLVGVFLKDSEGILIIGASSFSRIIGKYMEENGRHVVLVDNNGMNVRKAKSMGLDAIEE
FT                   NVYSEDLINNIELNDIGYLMAMTSNSEINKNAIEKFRKHFGENGSFRVVSPEEMQDPEN
FT                   NPKEGLFSQTDDYVKLTNLARKYSQVHEITLNSKEHYEGLIEISKTDPDIIPLFVKNNE
FT                   GNLSIIPSNSKEVEIEEGFKLVYLGKQMEVEDNSNTGDAEDTKTNTEED"
FT   gene            7619..8482
FT                   /locus_tag="ZPR_0005"
FT   CDS_pept        7619..8482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0005"
FT                   /product="metallo-beta-lactamase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50369"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBD5"
FT                   /protein_id="ADF50369.1"
FT                   /translation="MQLYPIEAGNFKLDGGAMFGVVPKSIWQKTNPADSNNMIDIGARS
FT                   LLIEDGNRLILIDTGLGDKQSEKFFSYYYQWGDDSLDKSLQKNGFHRDDITDVFTTHLH
FT                   FDHCGGCVQWNKDRTGYETVFKNAKYWSNKDHWQWATTPNAREKASFLKENILPIEESG
FT                   QLHFVDRNNKEHFTNIPELGFGVLFVDGHTDKQMIPHLEYKGKKLVFMADLLPTAGHIP
FT                   LPYVMGYDTRPLLTLPEKKSFLDKAADEEIYLFMQHDAHNEVITVKHTEKGVRHDQTYT
FT                   FNELFN"
FT   gene            8466..10163
FT                   /locus_tag="ZPR_0006"
FT   CDS_pept        8466..10163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0006"
FT                   /product="secreted subtilase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50370"
FT                   /db_xref="GOA:D5BBD6"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017308"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034080"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBD6"
FT                   /protein_id="ADF50370.1"
FT                   /translation="MNYLTKMKIPFYKPLLAATSAAILASCGSSAPAIVSTPIASIDTI
FT                   PLKVTALTDAQFKNWPEADLVYDTIPGMSVDRAYSEIIKDQKGTKVIVGVIDSGTDIEH
FT                   EDLKNVIWTNEDEIPGNGIDDDNNGYIDDIHGWNFLGDAVDENLEFVRIYRKLKPKYEG
FT                   KSASAISEANREEFILYKDAEAEYNKKLTEAQQNLAQYQQIKSQLVAAHQAVSSQLGKE
FT                   DYTIDELKAMQATAQPLSQYKAMLLQIQQNVNENIPKAIEELDGAIDYYSDQVKINLNL
FT                   DLNGRELVGDNPDDLSDRNYGNNNVMGPEADKENIKHGTHVAGIIAAQRNNGIGMNGVA
FT                   QNVEIMAIRAVPNGDEYDKDIALAIRYAVDNGAKVINTSFGKYFSTHPDWVRDAIKYAA
FT                   DHDVLIVNAAGNESLNLDEKMVYPNDQTPDNAIEISDNFLTVGALNYDYGSKLVADFSN
FT                   YGKKNVDVFAPGNKIWSTTPNNEYEYLQGTSMASPEVAGIAAMIRSYFPKLTAPQVKKI
FT                   IMDSGLPVQANVIVGGDRLNTQEFSELSTSGKIVNLYNALILASKVSK"
FT   gene            10176..12047
FT                   /locus_tag="ZPR_0007"
FT   CDS_pept        10176..12047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0007"
FT                   /product="M1 family aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50371"
FT                   /db_xref="GOA:D5BBD7"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBD7"
FT                   /protein_id="ADF50371.1"
FT                   /translation="MKKLIFSLALLVSAFSQAQNNTCYWQQHVDYDMNVDMNVENYRYT
FT                   GTQELVYTNNSPDTLNKVYYHMFFNAFQPGSEMDRRLQDIKDPDGRMVNNKGDRQNPDY
FT                   ESRIAKLKEDEIGYLRATSLTQDGKKVETEEEETILIVHLAEPILPGKSTTFKMEFEGQ
FT                   VPVQIRRSGRNNADGVALSMTQWYPKLAEYDFEGWHADPYIAREFHGVWGDFDVTINID
FT                   KDYIIGGTGVLQNPEEIGYGYEEKGTKVKHKGKKLAWNFKAEKVHDFAWAADPDFIHDK
FT                   LETKSGVMLHFLYKDDPKVTEAWKKIQPETAKLLAFFNKHIGPYPWPQYSVIQGGDGGM
FT                   EYAMCTLITGGEDYNSLLGTTAHEFAHSWFQQLLATNESEHPWMDEGFTTYISGLAQKT
FT                   IKGTSGNPFAGSYRGYNYIATSGAEQPQTTHGDRYDINTAYSIAAYSKGAVFLAQLGYI
FT                   IGQENLAKTLNRYYDEWKFKHPTPNDFIRVAEKVSGAELHWYLTDWTETTNQIDYAINS
FT                   VEEAENGTKVTLERKGLMPMPVEVTVTLNDGSKKLYYMPLRMMRWEKPAEGDVERIVKE
FT                   DWPWAYPTYDLEIDTPKANIKSIEIDESQLMADVNRSNNTYGQVDSE"
FT   gene            12168..12347
FT                   /locus_tag="ZPR_0008"
FT   CDS_pept        12168..12347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0008"
FT                   /product="D-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50372"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBD8"
FT                   /protein_id="ADF50372.1"
FT                   /translation="MKLAFFSTKSYDKEFFDPYHKKDIDLKYFEVRLFKDTANLAKDYD
FT                   GVCVFVHDDLNEKP"
FT   gene            12407..13156
FT                   /locus_tag="ZPR_0009"
FT   CDS_pept        12407..13156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0009"
FT                   /product="D-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50373"
FT                   /db_xref="GOA:D5BBD9"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBD9"
FT                   /protein_id="ADF50373.1"
FT                   /translation="MDLVAAKRFGIKVYRVPAYSPEAVAEHAIALILTLNRKTHKAYNR
FT                   IREGNFSLERLRGFNLHGKTVGVIGTGKIGSIFAKNMIGFSCNVIAYDKFENREILAHG
FT                   GTYVSFEKLLEQSDIISLHCPLNPETKHIINKESFKLMKDGMMLINTSRGPLINTVDTI
FT                   EALKSGKLGYLGIDVYEQEEQLFFKDLSESVIKDDVIARLISFPNVLITAHQGFLTKEA
FT                   LQQIAEVTIQNIKDYKAGSETQNQLKL"
FT   gene            13194..13601
FT                   /locus_tag="ZPR_0010"
FT   CDS_pept        13194..13601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0010"
FT                   /product="ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50374"
FT                   /db_xref="GOA:D5BBE0"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020539"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBE0"
FT                   /protein_id="ADF50374.1"
FT                   /translation="MEEGFNKQEKLKSKILIDTLFAEGVSIKNYPLRLVYIPIPSRNSK
FT                   TVSVKNPYFKTGFSVPKKFIKTAVQRNRIKRLMRESFRKNKYIVMTGAKQQYALMFIYL
FT                   SREDISQIKMEQLMVNLLERLKQKEKISVLN"
FT   gene            13638..15275
FT                   /locus_tag="ZPR_0011"
FT   CDS_pept        13638..15275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0011"
FT                   /product="carboxy-terminal processing protease"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50375"
FT                   /db_xref="GOA:D5BBE1"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBE1"
FT                   /protein_id="ADF50375.1"
FT                   /translation="MKKKFYKKTLILIFGGAVLFTSFGFKSDFFEIAKQIEIFTTLFKE
FT                   INMNYVDETSPADLMDTAIKSMLTDLDPYTNFWSEQDVQSSRINMEGEYTGIGAALKQD
FT                   EDVLLITEVYKDYPADKAGLKPGDKITKIGNTKVSDFTEGAQALLNGSVNSAVNITYQR
FT                   QGKTQQTSIKRSSVELKAVPFYALLEDNSGYVVLSRFNQKAYEETSRAVKDLKSQGADK
FT                   IILDLRGNPGGLLSEAINVSNIFLDKGELITSTKSVIEKYNKEYYTQKEPIDTKIPLVV
FT                   LVNGQSASASEIVSGAIQDLDRGVVVGARTFGKGLVQRPKEIAYGTQLKITISRYYTPS
FT                   GRCIQALDYRKRDENGKAVRTKVEDYNAFKTKNGRTVYDGGGILPDVRLESSEYSSITR
FT                   ALLEKNAIFNYATNYYYQHDVQDPVKYTFSDADFNDFKSYLKSTDFTYKTNTEQELEEL
FT                   LITAQSEGFQQDILDSYKQISLEIDKSKAEELDHKKDEIKSVLQDQIIKHYFYQEGLYQ
FT                   NHVASSQEIKKAREVLNNPGQYAKILQN"
FT   gene            complement(15279..15716)
FT                   /locus_tag="ZPR_0012"
FT   CDS_pept        complement(15279..15716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0012"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50376"
FT                   /db_xref="GOA:D5BBE2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBE2"
FT                   /protein_id="ADF50376.1"
FT                   /translation="MEISIKKFNQLSLSELYHILQLRAEVFVVEQDCVYQDIDGKDEKA
FT                   LHIIGKHNGEMVAYTRCFDKGFYFEEASIGRVVVKQEQRKYGYGHQIMTTSIKAIKDRF
FT                   NTDHIKLSAQQYLIKFYESHGFKSEGEGYLEDGIPHIAMKK"
FT   gene            complement(15784..16218)
FT                   /locus_tag="ZPR_0013"
FT   CDS_pept        complement(15784..16218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0013"
FT                   /product="ribose 5-phosphate isomerase B, putative"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50377"
FT                   /db_xref="GOA:D5BBE3"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBE3"
FT                   /protein_id="ADF50377.1"
FT                   /translation="MKISIGNDHAGTQYKNLIQLYLENEAGIEVKNYGTNTDDSVDYAD
FT                   FVHPVAEDVESGKADFGIIICGSGNGASMTANKHQKIRCALCWTGEITKLSRAHNDANI
FT                   LSIPARFVSTQQAVDMVKIFLNTEFEGGRHQKRIDKIPCQ"
FT   gene            16434..16547
FT                   /locus_tag="ZPR_0014"
FT   CDS_pept        16434..16547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50378"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBE4"
FT                   /protein_id="ADF50378.1"
FT                   /translation="MGYFSSSFQQSITGYKQPMKFKVSRFYMLIENFKIVK"
FT   gene            complement(16751..16942)
FT                   /locus_tag="ZPR_0015"
FT   CDS_pept        complement(16751..16942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50379"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBE5"
FT                   /protein_id="ADF50379.1"
FT                   /translation="MVRHLLDNENIIYYIKNETLIDLIPLSSFALGGIKLYIHKSHLTK
FT                   AKKILDQTFRRNNHLRIV"
FT   gene            17418..19628
FT                   /locus_tag="ZPR_0016"
FT   CDS_pept        17418..19628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0016"
FT                   /product="ribonuclease R"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50380"
FT                   /db_xref="GOA:D5BBE6"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBE6"
FT                   /protein_id="ADF50380.1"
FT                   /translation="MRMKRKKKNNKSSAKLGNLDKKITDILRKDAGKAYNYKQIASKLG
FT                   VDDPSSRNQITKKLAQLAAKKEINQVDRGKFMIEKGANYYTGVLDMSSKGYGFVIVDEF
FT                   EDDIMIPQQNLNSAFHGDEVEIYVYKHRRRKKSEGEITRIIKRKRTSFVGVLQLKKDFG
FT                   FVVVDDPKMYTDFFVQKNKLGEAQDGDKVLVEFDDWPKKADSPFGVITRVLGTPGHHNT
FT                   EIHSILAQYGLPADFPEEVEEFANKIDTSISDQEIKKRRDMRDVLTFTIDPKDAKDFDD
FT                   ALSFRKLDNGNIELGVHIADVSHYLQPDTILDQEAYDRATSVYLVDRVVPMLPEILSNG
FT                   ACSLRPNEEKYTFSAVFELDKNAKVKDQWFGRTVTYSDARFAYEEAQHIIETMENKIPE
FT                   DISIREEGSYTVDNAIVEAVLELDRLAKKMRSVRMREGAISFDKVEVKFHLDEENEPIG
FT                   VFFKTSKDANKLIEEFMLLANKKVAEFIGKQKPKKTFVYRCHDEPNEEKLASLQTVVGR
FT                   FGHSLNLSDRKSVTSSLNSLLKNVQGKKEQNLVDTLAIRTMSKAYYGTENIGHYGLAFE
FT                   YYTHFTSPIRRYPDVMVHRLLQQYLDGAASASEDVYDEKCHHSSEMENLAANAERDSIK
FT                   YMQVKFMQDHQDEEFLGVISGVTDWGIFVEIEQNKCEGMIRLRDLSDDHYEFNEEHYAV
FT                   IGRKTKKVYQLGDEVYVKVKNADLVKRHLDFTMLGLKEDFKG"
FT   gene            19647..20321
FT                   /locus_tag="ZPR_0017"
FT   CDS_pept        19647..20321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50381"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBE7"
FT                   /protein_id="ADF50381.1"
FT                   /translation="MKNLLIIAFMAFGFAVNAQETKHDLADFQKIFVYDGLPVKLVRSD
FT                   ENKAVVTGESREDVEFDIENATLKIKLGIDNIFDDDDDTQVLLYYKSIDEVRAKQNASV
FT                   MIADKINAEFFTLEAQEGADITGEFEVDNLIALIRSGGEITPSGNVKHQEVNINTGGKY
FT                   YAKNLQSDYLNVDIKAGGVADVTVSGKVTAKVRAGGTVNVYGDPEEIDKSTLFGGKVVR
FT                   KN"
FT   gene            20352..21056
FT                   /locus_tag="ZPR_0018"
FT   CDS_pept        20352..21056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0018"
FT                   /product="LysE type amino acid translocator"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50382"
FT                   /db_xref="GOA:D5BBE8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBE8"
FT                   /protein_id="ADF50382.1"
FT                   /translation="MLHDILAAMPLGLFLAFMLGPVFFVLLETAAIKGFRAAISFDLGV
FT                   IIADTVFLFIAYLSTTKLLERIKDDPALFIFGGVILTTYGIMTFIQTKKALPQEEESPD
FT                   IRKLGKSDYLGLALKGFLLNFINVGVLGFWLGLIIVFGPRLEMDGNRILVFFSTVLITY
FT                   LIVDIFKILLAKKLNRKLTPGRIYIMKKGISVMLVVFGIVLISQGAFPGEVNEIREQID
FT                   NITPGEGIGFFE"
FT   gene            complement(21223..21296)
FT                   /locus_tag="ZPR_0019"
FT   tRNA            complement(21223..21296)
FT                   /locus_tag="ZPR_0019"
FT                   /product="tRNA-Cys"
FT   gene            complement(21351..21707)
FT                   /locus_tag="ZPR_0020"
FT   CDS_pept        complement(21351..21707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0020"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50383"
FT                   /db_xref="GOA:D5BBE9"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBE9"
FT                   /protein_id="ADF50383.1"
FT                   /translation="MGSIKLKNIKVFAYHGCLEEEGKIGSDYSVDLKVKGDLSNSGKSD
FT                   ELADTIDYVHLNNIVKEEMALRSKLLESVAERINNRVLKEIILVQKVTVSVSKINPPIG
FT                   GNVAMVSVTRSKSR"
FT   gene            complement(21733..22461)
FT                   /locus_tag="ZPR_0021"
FT   CDS_pept        complement(21733..22461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50384"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBF0"
FT                   /protein_id="ADF50384.1"
FT                   /translation="MGMLLLFSCHSSQQKPSKLRIGQFMFTDRPVKIIFTKDGESTLQQ
FT                   QLKYTELTDYQSINSGTYTVEVKAENQSLLKKKVGIGNSGVYTLMLYGILQENPTTNEK
FT                   TSKTKLHEIVEGEEATMPNGNLPQFKILNDEFECGKDEAKIRWVHLAAGVEEISAVATS
FT                   DKKTVSLSSLTYPKVSKTKALLPLQQKVNWKLKGSKVNVAQEQLAIQSQKLYTCFIMGI
FT                   EGKYIDSLKVVTGETPKKKF"
FT   gene            complement(22478..23770)
FT                   /locus_tag="ZPR_0022"
FT   CDS_pept        complement(22478..23770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0022"
FT                   /product="amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50385"
FT                   /db_xref="GOA:D5BBF1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBF1"
FT                   /protein_id="ADF50385.1"
FT                   /translation="MSNNSSKLNPLSVWALAAGGMVGGGIYTVLGVVIAVSAQWTWLAF
FT                   VLTGLIAIPSAYSYVFLTNKFHEEGGAFVFLEKVNDKKMAGNLSWLLIIGYVLTISVYA
FT                   YAFGHYLSFAFHGNPLLMRLLAAGIVIALILLNLAGVGKLTNVEIIIVSVNLLVLLALG
FT                   IYGLANWDTSQLTAGISPRPIWSSLIGGASIFMAYEGFQLLTYEYDKIKNPEKSFMPTL
FT                   MSAVIFVVILYAVVALGATMVGGATSMISFKEIALSISAESAFGKTGLIVMTVAAGFAT
FT                   AAAINSTLFSTANLSKRIASKNELPSWFDHTNKNDVPDRSIIVLGTLAGTLAIVGSLSS
FT                   LVEAASLAFLFTFGIVNWIAYRESEKRKWIPLMGIIIGILVGVALIFRLVISKPVALGG
FT                   ILAVVLLIIMGRPYLLKKKEKTQQKAQVDEN"
FT   gene            24080..25759
FT                   /locus_tag="ZPR_0023"
FT   CDS_pept        24080..25759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0023"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50386"
FT                   /db_xref="GOA:D5BBF2"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBF2"
FT                   /protein_id="ADF50386.1"
FT                   /translation="MAEEKKSLNFIEQIIEEDLKADYKREKLMFRFPPEPNGYLHIGHA
FT                   SSICLNFGLGEKYDAPVNLRFDDTNPIKEEKEFVEAIKRDVEWLGYKWAKECYASDYFQ
FT                   QLYDWAVEMIKNGDAYVDSQTSEDIAQQKGTPTQPGTESPYRNRSVEENLDLFEQMKNG
FT                   ETPEGAHVLRAKIDMSSGNMLMRDPIMYRCVHKPHHRTEGEWKIYPMYDWAHGESDFIE
FT                   QVSHSFCTLEFLPHRELYNWFIAKVSKPGEFIPKQREFARRNLSHTVVSKRKLAQLVEK
FT                   GIVESWDDPRMPTISGLRRRGYTPAAIKNFADSIGVGKRENMIDVAHLEFCAREDLNKI
FT                   TPRVMGVLDPVKLVITNYPEGEEEWLEAENNPEDETAGTRQVPFSRELYIEREDFKESA
FT                   NRKFFRLTLGKEVRLKNAYIIKGEDVVKDEEGNILEIHCTYDPKSKSGSGTEESLRKVK
FT                   GTLHWVSIKHALKAEVRLYDRLFTEEAPDGVKDKDFLEFVNPNSLNTITGFVEPSLSTA
FT                   EELEKFQFQRIGYFCIDRDSTKDHLVFNRTVGLRDSWAKMQK"
FT   gene            25888..26262
FT                   /locus_tag="ZPR_0024"
FT   CDS_pept        25888..26262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50387"
FT                   /db_xref="GOA:D5BBF3"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBF3"
FT                   /protein_id="ADF50387.1"
FT                   /translation="MANTGSTLLALVTGAAIGAGIGLLYAPDKGEKTRKKLKKDALDAQ
FT                   DRFNKKYNETASNLTEKAKKAKFDFEERLEETLSNASHKADDILSAMESKLEELRKQNA
FT                   KLQKEVKKEEAETKANKVVV"
FT   gene            26268..26624
FT                   /locus_tag="ZPR_0025"
FT   CDS_pept        26268..26624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0025"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50388"
FT                   /db_xref="GOA:D5BBF4"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBF4"
FT                   /protein_id="ADF50388.1"
FT                   /translation="MAFEKLSNSIDELNDNVRAFTHSNAEYYKLLIFKQTTKSAILLVM
FT                   FLIVAFALSTAVAFLSLGVAFAISAALDQPSSGFFIVGGFYLVVIVLFVIFGKKPLSKF
FT                   MLKKFSREIFNEEN"
FT   gene            26625..26840
FT                   /locus_tag="ZPR_0026"
FT   CDS_pept        26625..26840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0026"
FT                   /product="glutaminyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50389"
FT                   /db_xref="GOA:D5BBF5"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBF5"
FT                   /protein_id="ADF50389.1"
FT                   /translation="MKQYTSFEEIDRDLKILKLQAQIDKEEIKLTIEEVKDSLSPLRIV
FT                   GNTIGAIMQKAIVLKAVAKMFGIKRV"
FT   gene            complement(26931..28448)
FT                   /locus_tag="ZPR_0027"
FT   CDS_pept        complement(26931..28448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0027"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50390"
FT                   /db_xref="GOA:D5BBF6"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBF6"
FT                   /protein_id="ADF50390.1"
FT                   /translation="MSSNVRVRFAPSPTGPLHIGGVRTALYNYLFAKKHGGDFILRIED
FT                   TDQNRYVEGAEKYIIDSLNWCNIPYDEGPGKEKDCGPYRQSERKSLYKAYADKLIESGN
FT                   AYYAFDSAEDLDKHRKSHEAEGKTFIYNWHNREKLDNSLALPEEQVKKRIENGEHYVVR
FT                   FKSPKDEILKISDEIRGNMEIDTNILDDKVLYKSDGMPTYHLANIVDDHLMKISHVIRG
FT                   EEWLPSLALHFMLYRAFGWAAPKFAHLPLILKPQGKGKLSKRDGDKLGFPVFPLQWKDP
FT                   ESGEISAGYREDGYFPEAVTNMLAFLGWNPGTEQEFFSLEELTKAFDLKRVHKGGAKFD
FT                   PEKTKWFQQHYLQEADNNFIAEQFLDILKKKEIEATKEYTKHVIELVKERAIFIEDIWE
FT                   QGFYFFTSPTSYYPKNTKKAWEEDTHLLMTELIEVIQGIENFKANIIAEKVKSWITAKE
FT                   IGFGKIMQPYRISLVGSLQGADLFEISEAIGKHETIARIKKANETLR"
FT   gene            28693..31866
FT                   /locus_tag="ZPR_0028"
FT   CDS_pept        28693..31866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0028"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50391"
FT                   /db_xref="GOA:D5BBF7"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBF7"
FT                   /protein_id="ADF50391.1"
FT                   /translation="MAEFEAIKNQLQSFIRKYQLNLLIKNTALFILIGLLFWLLLVLFE
FT                   NFIWFDTSVRFLLFLFFIIVESALLIFFIGLPLIKFLDIRRGISDRKAAVLIGDYFPEI
FT                   DDRLLNLIELKSQDNSEFLQAAIHQKSLELKFYNFKNAVSFGEYLKYVLSAGVPLLLIL
FT                   ALMISGRGDWLFSSFDRLKNYDQVYEKPAPFSFVLKEENLRVIEGEDYNLEVNVVGDEI
FT                   PGQLKIIFKDSEYFMRQLEPGRFTYTFKNITKNQEFRLLANNISSRTYNLAIIAIPELV
FT                   NFNIEIVYPNYLGLEDEQTNGEGNLTIPEGTWLKWRFEHRNTETVNLEFSDTLVSVKNS
FT                   FESRFLQSVNYTLSTSNSFLKNYQPLSFRLEIIKDKSPSIQVEEKVDSLNPSLKYYGGK
FT                   ISDDHGISGLMLRYREIGEESFQSEYINFSAGTISQFYVSFPGDLDLKAGRNYEYFFQV
FT                   FDNDAVNGRKSASSSYFTYYKKTAEEIRDQNLQGQKENIGNLSDELDKFKQEDQLNNLL
FT                   NDELENKDFDYEQQQKLESFIKSQERENALMKKFSKNIKDKLDTENLENDKGRRLKERL
FT                   ENTENKLQDNKALLNELKEYSDKIQNENLQQKLQELSKNKNSSKRSLEQLVELTKQYYV
FT                   EQKYNQLVDKLDNLGDDQINLDKSGKSQKEIDEKFDDIQRELDQLDKKNGELKRPKSLE
FT                   RNKEAELDIQEKLENLINTSGSAEREKKNKQDNTGHKMKELAKEMKQSSANMDMQTLEA
FT                   DIESLRKVLDNLVIFSFKQENLMNAFRDINTGSPEFSSQLKEQYVLKENFEHVDDSLFA
FT                   LGLNNQFIAEKVFEFLENVSFNLINSLEELADLRLSKALSSQQYTITGANDLAVLLNEI
FT                   LDNMNDQMNSSGSGGEGTGPQLQDIIEKQQDLGKQLKEQMGKNMKGEGQENTDEGEHSK
FT                   LFEIYKQQEEIRRNLERILKENDEHLNDLNQDYDELEKDILNNDINQNSLNTLNKLNQK
FT                   MLNLKESLNEKGERNERESKTSMRDFDNQSPKNNIEIKDYFNSIEILDRHSLPLRPNLK
FT                   QRVNTYFND"
FT   gene            31859..32299
FT                   /locus_tag="ZPR_0029"
FT   CDS_pept        31859..32299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0029"
FT                   /product="metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50392"
FT                   /db_xref="GOA:D5BBF8"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBF8"
FT                   /protein_id="ADF50392.1"
FT                   /translation="MINQDGIINFYSENDFDIIEKEVYKKWIERVISSEGKRLGEISYI
FT                   FCDDDYLLDINQRFLNHDTYTDIISFDDSIGNLLNGDIYISTERVRENALEFNEDFETE
FT                   LKRVLVHGILHYCGYKDKSDEEAMLMREKESEKIKLFHVEQS"
FT   gene            32315..34186
FT                   /locus_tag="ZPR_0030"
FT   CDS_pept        32315..34186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0030"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50393"
FT                   /db_xref="GOA:D5BBF9"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBF9"
FT                   /protein_id="ADF50393.1"
FT                   /translation="MFNKEYDVIVVGAGHAGSEAAAAAANMGCSTLLVTMNLQNIAQMS
FT                   CNPAMGGIAKGQIVREIDAMGGYSGLVSDTSAIQFKMLNKSKGPAMWSPRVQSDRMRFA
FT                   EDWRLRLEQTPNLDFYQEMVHGLIIENGKIKGVRTSLGIEIRAKSVVCTNGTFLNGLIH
FT                   IGDKQRGGGRAGEAAATGITKDLIDAGFEAGRMKTGTPPRVDGRSLDYSKMIEQPGDEV
FT                   PGKFSYSDETKPLSKQRSCYMTYTSNEVHDILRSGFDRSPMFNGRIKSLGPRYCPSIED
FT                   KINRFADKDRHQLFVEPEGWNTVEVYVNGFSTSLPEDVQFAALSSVAGFENVKFFRPGY
FT                   AIEYDYFPPTQLQHTLETKLVDGLYFAGQINGTTGYEEAACQGMMAGINAALKVQEKDP
FT                   FILQRNEAYIGVLIDDLITKGTEEPYRMFTSRAEYRTLLRQDNADFRLTERSYKLGLAS
FT                   EDRMRKMEEKKEKSLAFVSFLKDTSVVPEDANPVLADYNSSPMKQSDKIFKIFSRPNIA
FT                   MDDVRKFPGVEEYIQQHHLDTEMLEQTEIQIKYSGYIQKEKNNADKLNRLEDVKIPKHF
FT                   DYSKIKSMSFEAREKLNKIQPANVSQASRISGVSPNDISVLLVYMGR"
FT   gene            34220..34768
FT                   /locus_tag="ZPR_0031"
FT   CDS_pept        34220..34768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0031"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50394"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBG0"
FT                   /protein_id="ADF50394.1"
FT                   /translation="MRQKFIISGLLFVIVACQVTTHSVPDIEGSRILENKDHFNYYLFQ
FT                   TKLQRPIAKSWFKKYLGLKRENDLINSEVILFPELEKEFLVSIIVKDDREEYTDVPIVE
FT                   KIFDGILGIDDDDKPIKREEDEEEQTGPVKFFVNITISDRKGVDHISTSSLYSSRVRNY
FT                   LQQLENHFFEYQKNYKALP"
FT   gene            34769..35596
FT                   /locus_tag="ZPR_0032"
FT   CDS_pept        34769..35596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0032"
FT                   /product="protein containing methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50395"
FT                   /db_xref="GOA:D5BBG1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBG1"
FT                   /protein_id="ADF50395.1"
FT                   /translation="MEDSTFYCKDYLVSGEMYRLERWKHYDILKTEPVPENLSAYYKSE
FT                   SYISHTDASKSFTEKLYNIVKTYMLQKKVGWILKEKSAGKLLDIGAGTGDFLKAASRYF
FT                   KVEGVEPSKVAREKAQKKHLRLKKKLSEISDKYNIITMWHVLEHVPNLEQQFKEFHRLL
FT                   NDDGLLVIAVPNYKSKDADIYKEYWAAYDVPRHLWHFSKKGIQTLFFENGFQLFHSKGL
FT                   KFDSFYVSMLSENHRADKQNLFKAFKNGLKSNLSAARSGEYSSMVYFFKKTSK"
FT   gene            35872..36438
FT                   /locus_tag="ZPR_0033"
FT   CDS_pept        35872..36438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0033"
FT                   /product="outer membrane protein (OmpH-like)"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50396"
FT                   /db_xref="GOA:D5BBG2"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBG2"
FT                   /protein_id="ADF50396.1"
FT                   /translation="MKKLIAIGAVAISLISCNQEKTAYVDTTKVIQDYQEMKDVESKFE
FT                   ARRDSLTQLITGPQQQFQQEVQEYQQGMNSMSASQRQAKEQELQQKGQRLQQQQQMIGQ
FT                   QLRNDSDTAIDEVVEKVKDFVAEYGKENGYTYIFGSNESANIMYAKDGLDITDEIVKKL
FT                   NESYSGKSGSNAAVKKTEEDTTSAK"
FT   gene            complement(36509..36910)
FT                   /locus_tag="ZPR_0034"
FT   CDS_pept        complement(36509..36910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50397"
FT                   /db_xref="GOA:D5BBG3"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBG3"
FT                   /protein_id="ADF50397.1"
FT                   /translation="MENIDMNIALLFILFFLLITFFMSFFEKICDYPGTKSFMESHFKN
FT                   TFLAKKIAFLLPILVAVELIAVIMLILAILNYFFTIITINFSPFALIACAISLMMLLIG
FT                   QRVAKDYQSSAGITIYFILVILGFFALAQ"
FT   gene            complement(36914..38068)
FT                   /locus_tag="ZPR_0035"
FT   CDS_pept        complement(36914..38068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0035"
FT                   /product="DNA polymerase III subunit delta'"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50398"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBG4"
FT                   /protein_id="ADF50398.1"
FT                   /translation="MLFSEIVGLPHIKNHLTTTADNSRIAHAQLFIGNSGSGTLPMAIA
FT                   YAQYLLCKNQDGENQHGNPSCNLKFTNLSHPDLHFAFPVATNQTIKSHPVSANFMEDWR
FT                   RFIQHRPYGSLTDWYEHIGIENKQGQIGVDEAQDIVKSLSLKAYEGGLKVMIIWMADRM
FT                   NTAAANKLLKLIEEPPNKTIFILIAEDEEQIIQTIKSRCQTLKFPPLAEADIAEKLMAS
FT                   KNMNTQEASLIAHQSNGSYTRALHLLEKDTADDQYEQWFIEWVRTAFKAKGNKATVLEL
FT                   ISWSEEIATMGREKQKSFLLYCLDFFRQALMLNYKAEPLVFLSPKTKGFQLKKFAPFVH
FT                   GNNILPITKAIEDAIYHIERNANAKIVLTDLSIRLTRFLHIKDA"
FT   gene            38138..39322
FT                   /locus_tag="ZPR_0036"
FT   CDS_pept        38138..39322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0036"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50399"
FT                   /db_xref="GOA:D5BBG5"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBG5"
FT                   /protein_id="ADF50399.1"
FT                   /translation="MKTVDDFNFKDKQALIRVDFNVPLNDDLKVTDANRIEAAKPTIVK
FT                   ILEDGGSVVLMSHLGRPKGKEAKFSLKNIVSKVSEVIGVEPKFVEDCVGAEVKKAADSL
FT                   QSGEILLLENLRFHDEETAGDEDFAKQLSELGDIYVNDAFGTAHRAHASTTVVAQFFED
FT                   KCFGYLLAKEIESLDKVLNSKEKPVTAVLGGAKVSSKITVIENILDAIDHLIIGGGMTY
FT                   TFIKAQGGKIGNSLVEDDKQELALEILKKAKEKGVQVHLPVDSVIADSFSEQASTQVEA
FT                   VDNIPDGWMGLDVGPETLKHFSNVIAESKIILWNGPLGVFEMETFAKGTIELGKAIAEA
FT                   TKNGAFSLVGGGDSVAAVKQFGFDDKVSYVSTGGGAMLEMLEGKSLPGIAAIGK"
FT   gene            39499..41097
FT                   /locus_tag="ZPR_0037"
FT   CDS_pept        39499..41097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0037"
FT                   /product="membrane-bound lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50400"
FT                   /db_xref="GOA:D5BBG6"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBG6"
FT                   /protein_id="ADF50400.1"
FT                   /translation="MKKQVCLLLGLFSVFAVSAQEKEKSKKQVEKANFRVQIFQKVDST
FT                   EIILADPDPEFQEKLPISAVIRDSSKVSLADMPQAAKIDSVWRAELTNSDLYETIQKSI
FT                   AEQDYDEVVYDELPTDTLKARLARLNARTPFNIEYNPSLESVIKMYLKRNKQAMERLMA
FT                   LSDYYFPMFEQELDKYDIPLEIKYLAIVESALNPRAKSRVGATGLWQFMFTTGKMHDLN
FT                   VSSYVDERMDPVKATEAAAKYLSTLYKVFGDWDLVLASYNSGPGNVSKAIRRSGGSTDY
FT                   WSMRRYLPRETAGYVPAFLATLYIFEYADEHNFQPKRPEIPYFQTDTIQVKELLTFDHI
FT                   AKVTGVNKELLQFLNPSYKLDIIPFVEDKNYVVRLPRTKTGAFVNNEAAIYQYAEQEIA
FT                   NREKPLPKYIETEDRIRYRVRSGDFLGRIAEKYGVGVSSIKRWNNLRGNNIRVGQYLTI
FT                   YPRKPVSASQSATASSSAKTNKKGDTKLYTVQQGDSLWSISKKFPGVTVQNLRTWNDMS
FT                   STRLKPGMRIKVSKG"
FT   gene            41127..42110
FT                   /locus_tag="ZPR_0038"
FT   CDS_pept        41127..42110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0038"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50401"
FT                   /db_xref="InterPro:IPR032286"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBG7"
FT                   /protein_id="ADF50401.1"
FT                   /translation="MKKLVFLALSFLIVVSCKKKSEEPESRILADSSGNINQLSVIVDN
FT                   SLWEGQVGDALRDNLAAPVEGLPQEEPLFSLSQIPPETFTGFVRRSRIFIKIEKGKDSL
FT                   AIIKDEYATPQTGIIISGENQQQIIDRINASSDSIIDVLKATEIKEKQRRIGKSPESDE
FT                   ELEKAFGVSMKFPTAYRYAAQEDNFIWIRKEIPKGLMEILVYQVPLNTIDKDSSVIANI
FT                   VKMRDSIGEKYIPGPVEGSYMITEEAYAPYLFETKIDGHFAYETRGTWEVNNAYMAGPF
FT                   VNYAIRDEKNNRYIIAEGFIFRPASSKRDHVFELDAILKSLKFDSN"
FT   gene            complement(42192..42392)
FT                   /locus_tag="ZPR_0039"
FT   CDS_pept        complement(42192..42392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0039"
FT                   /product="Sec-independent protein translocase protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50402"
FT                   /db_xref="GOA:D5BBG8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBG8"
FT                   /protein_id="ADF50402.1"
FT                   /translation="MLPLAIGAPQIVLIVIVVLLIFGGRKIPELMRGLGSGIKEFKDAS
FT                   KDDDDTTTSSASDAKKVEDPK"
FT   gene            42677..43546
FT                   /locus_tag="ZPR_0040"
FT   CDS_pept        42677..43546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0040"
FT                   /product="M23 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50403"
FT                   /db_xref="GOA:D5BBG9"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBG9"
FT                   /protein_id="ADF50403.1"
FT                   /translation="MSKKKKNKKKFTRKLLHKYRMVILNEDTFEERYSLKLTRLNVFVL
FT                   VTTSAILLIAATTFIIAFTPLREYIPGYSSPKLKEQAAQLAYKTDSLQNVLKLNNQFLG
FT                   SIKGVLSGDLQTSDLNRDSIAKFSQENMEVEVIPPSKADSLLREEVAMEDKYNILPGAT
FT                   DDIDFSLFPPVKGTISEGYDAEEKHYAVDVVVPKNSPVKSVADGRVIFAEWTTETGYVI
FT                   IVKHDYGLISVYKHNASLTKEQGDFVKAGEVVATAGSTGEYTTGPHLHFELWNEGNPVN
FT                   PTDYIDFE"
FT   gene            43550..45049
FT                   /locus_tag="ZPR_0041"
FT   CDS_pept        43550..45049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0041"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50404"
FT                   /db_xref="InterPro:IPR004993"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBH0"
FT                   /protein_id="ADF50404.1"
FT                   /translation="MSLKSFAAKIFAKTVRKKIQAWSSKPVEVQEKIFNELISKAKDTS
FT                   FGKDHHFDHIKTHADFVEKVPIRDYEDLRAYVDKMVAGEEDILWPGKPLYYAKTSGTTS
FT                   GAKYIPITKESMPTHIEAARNAILCYIAETGKAKFVNGKMIFLQGSPELTEKNGVKLGR
FT                   LSGIVAHYVPGYLQKNRMPSWETNCIDDWETKVDAIVEETRDLNMTVISGIPSWVQMYF
FT                   EKLEHKTGKKIGDIFKNFELFIYGGVNYEPYRSKFENLIGRKVDSIELYPASEGFFAFQ
FT                   DSQRKKGMLLQLNSGIFYEFIKAESFFDENPKRLTIAEVELGVNYVMIISTTAGLWAYN
FT                   VGDTIQFTSLKPYRVMVSGRIKHYISAFGEHVIAKEVEEAMQVASEKTGARINEFTVAP
FT                   QVNPVAGELPYHEWFIEFEKAPENLTNFRNILDQSLQQQNSYYFDLIEGNILQPVKITK
FT                   VPKEGFQAYMKSIGKLGGQNKLPRLSNDRKIADALEAIIKK"
FT   gene            45061..46740
FT                   /locus_tag="ZPR_0042"
FT   CDS_pept        45061..46740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0042"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50405"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBH1"
FT                   /protein_id="ADF50405.1"
FT                   /translation="MKTDGRTRAQESTNAIERMYITMRHLFNRGFYKPMGVSGETLREG
FT                   LLALRPEIYGSVAEDKAELNGLLYVLERLPIGIEQCRYINLTSDEGYGDSHFQPIVPPK
FT                   RRRNCYRIDEEQMNIEITRGRSEIYDILTHLTFLFIESHKIMRRVVIDEDGSVTRDWKK
FT                   LEAIVLSKEDIDKAEREVALTHAANILGRTFYEVSKIYPKFSTPNNPEQFLHIIYWMGK
FT                   LAIEETVNNDKRIITFSPILRERLGHHIHGEVWADKIKKYLVEEQLLQRPIHIISANMH
FT                   SVMNTLYAPLALKAEIKKKNILQIYETLSDSSNGQVRQKVSKSALSGGMKFIEDTSGTN
FT                   IDVQVFDTAKLEEGFRNKGFKSLKEEEKPVIIVMDYAFGEQAYETMDELLKPYILDGEE
FT                   IKMNVKSVSIMGKAGILEGGKGDIMIPSAHIFEGTADNYPFKNELKKDDLEGHGIKVVD
FT                   GSMITVLGTSLQNRDILKFFHDSTWNVSGLEMEGAHYQKAIQAASKLRKSIAEDVKVRY
FT                   AYYASDNPLETGSTLASGGLGTTGVKPTYLITEKILEQIFNS"
FT   gene            46807..47796
FT                   /locus_tag="ZPR_0043"
FT   CDS_pept        46807..47796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0043"
FT                   /product="dTDP-glucose 4,6-dehydratase, NAD-dependent
FT                   epimerase/dehydratase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50406"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBH2"
FT                   /protein_id="ADF50406.1"
FT                   /translation="MGKTVLITGAAGFLGSHLCDKFISEGFRVIGMDNLITGDIRNIEH
FT                   LFKNKDFEFYNHDVTKFIHVPGKLDYILHFASPASPIDYLKIPIQTLKVGSLGTHNCLG
FT                   LAKEKGARILIASTSEIYGDPLVHPQSEDYYGNVSTIGPRGVYDEAKRFQESLTMAYHR
FT                   FHGLETRIVRIFNTYGPRMRLNDGRVIPAFIGQALRGEHLSVFGDGLQTRSFCYVDDQV
FT                   EGIYRLLFSEYVEPVNIGNPDELTIKDFAEEIIKLTGTNQKIVYRELPKDDPLQRQPDI
FT                   TRAKEILGWEPKVSREEGMKITYNYFKNLSKEDLLKKEHKDFSKHNRK"
FT   gene            47800..48573
FT                   /locus_tag="ZPR_0044"
FT   CDS_pept        47800..48573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0044"
FT                   /product="TuaG-like glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50407"
FT                   /db_xref="GOA:D5BBH3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBH3"
FT                   /protein_id="ADF50407.1"
FT                   /translation="MQNPLVSVIMPAYNSNEFIALAIESVIAQEYKNWELIIVDDASKD
FT                   ATVNTIRNYIKKEPRIKIFRNQTNHGAGYSRNKAIKEASGEFIAFLDADDLWKPEKLSL
FT                   QLKFCEENNAKIVFSSYGRIKENGENLNEIIEALPFVNYPKLIRSNYIGNLTGMYNAGK
FT                   IGKVYHPDIRKRQDWAMWLEVIRKGGTAHGMEESLALYRIRKGSVSENKFEMLSYNFKI
FT                   YNKVLGYGKLKSMYWVLIFLGEHFFVKSRQLKSID"
FT   gene            complement(48562..49872)
FT                   /locus_tag="ZPR_0045"
FT   CDS_pept        complement(48562..49872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0045"
FT                   /product="capsular polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50408"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBH4"
FT                   /protein_id="ADF50408.1"
FT                   /translation="MDWFKLSLQLNKFPVNRARKMLDEIDNIPANQYPQYIETKKKEIV
FT                   DYHLNNNNFYKSFIGSKAIPNWEDIPIMTKTDLQQPLENRLSQSFNLKNSYVGKTSGSS
FT                   GHPFTFAKDKLCHAMTWEGFNNHYNWHGIDLNKSLQARFYGIPLDFYGHLQERIKDQIS
FT                   LRRRFSIFDLSETKLQGFLDRFRRSKFDYLNGYTSAILLFSKFLKKEKIVLKEICPSLK
FT                   LCIVTSERLFEKDKKVIEEAIGIPVVNEYGASEVGLIAFENPNGEWCLNRSDLFIEIVD
FT                   EDNRTLPHGKEGRIIITSLYNKAHPIIRYAIGDIGIMSKKSTPKKPILASLIGRTSDVA
FT                   KLADGKVVPGLTFYYVTKTIIDDTGSTKEFIVTQTKIDSFDIEYVRDTDFDAEETTKIA
FT                   EAVEKYVGKNLNVNFRRKQSLTRSKSGKLKQFTSLIN"
FT   gene            50041..51240
FT                   /locus_tag="ZPR_0046"
FT   CDS_pept        50041..51240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0046"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50409"
FT                   /db_xref="GOA:D5BBH5"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBH5"
FT                   /protein_id="ADF50409.1"
FT                   /translation="MLYGVPILALNMMGNNVIRAEGKPTFAMVSMIIPSVDMLVVGPED
FT                   PLVKGITDFCKGEPDLKDLLIVGPSKRGALLEGSKERAKEFMAMYQIPTAAYESFTIES
FT                   LEAGKTFLETLSAPYVLKADGLAAGKGVLILNDLAEAKTELENMLKNQKFGEASAKVVI
FT                   EEFLDGIELSVFVLTDGKNYKILPTAKDYKRIGEGDTGLNTGGMGAISPVPFADAELMQ
FT                   KIEERIVKPTVNGLTEENIDYKGFIFIGLIKVGKEPYVIEYNVRMGDPETEVVLPRVKS
FT                   DLVEVLAKTAEGKLNEVDLEIDERAATTVMMVSGGYPEAYEKAKEITGIENVNVEDALV
FT                   FHAGTTLKDGKVVTNGGRVIAVTAFGEDYKQALKKSYQNVEKLQFDKMYFRKDLGFDLA
FT                   "
FT   gene            complement(51243..51467)
FT                   /locus_tag="ZPR_0047"
FT   CDS_pept        complement(51243..51467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50410"
FT                   /db_xref="GOA:D5BBH6"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBH6"
FT                   /protein_id="ADF50410.1"
FT                   /translation="MTEFFEGISWLFENVLLVPLDWLRSLELDSWWGANAINFVFIIIG
FT                   MIAFAYWCKQLKIFQDADDENTRSKPYLG"
FT   gene            51514..52440
FT                   /locus_tag="ZPR_0048"
FT   CDS_pept        51514..52440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0048"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50411"
FT                   /db_xref="GOA:D5BBH7"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBH7"
FT                   /protein_id="ADF50411.1"
FT                   /translation="MLTSFFAKSKPINITLVLVLLSGFFITANFHTWFLAFEIFKFFKI
FT                   LGVFLALMLSLFLLNFIAKKNDLTQRSAYKVLLFSVFCASFFSLLKDYNVIVAATLILL
FT                   ALRRIISLKSQISVQKKIFDAAFWICIASLFYFWSILFLFIVLGGIIIYSPRPKNWLIP
FT                   ITSAVCVYMIYCSIHLLVYDQFYLMADWYQPYNFDFSNYQSFKFLTPISIILALTLWSL
FT                   VYYFSIIQKAGVSLRPSLNLILFTLIIGISVGILAPSKNGSELIFFFIPLSIIVSNYFD
FT                   TGRDKIFREILLLILILMPFGVLFIQS"
FT   gene            52622..53227
FT                   /locus_tag="ZPR_0049"
FT   CDS_pept        52622..53227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50412"
FT                   /db_xref="InterPro:IPR025350"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBH8"
FT                   /protein_id="ADF50412.1"
FT                   /translation="MFTDKANKIFQEVIKKYHEIDTVDQLFTNPYDSDSQLIEHLLYRK
FT                   CWIDTVQWHYEDIVRDPNIDPIAGLKLKRLIDASNQDRTDTVEYIDSYFLEKYKAVAPK
FT                   ENATINTESPAWGVDRLSILALKIYHMHEEATREDASADHKEKCQAKLDILLEQRVDLS
FT                   SAIDQLLKDIENGDKYMKVYKQMKMYNDDELNPVLRNK"
FT   gene            53234..54307
FT                   /locus_tag="ZPR_0050"
FT   CDS_pept        53234..54307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0050"
FT                   /product="RfaQ-like lipopolysaccharide core biosynthesis
FT                   glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50413"
FT                   /db_xref="GOA:D5BBH9"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBH9"
FT                   /protein_id="ADF50413.1"
FT                   /translation="MSTAHQHIPNENREKGAHILAIRLSAMGDVAMTVPVIRTFMAMYP
FT                   NCRITFLTRPFFAPMFKGIPNIEIYEADINGEHNGVMGLGRLARELRNHEIEMVADLHN
FT                   VLRSNVLKSVFYFFGIPVKQIDKGRADKKKLTREDHKVFKELKSTHQRYVDVFTALGFP
FT                   LDFNKHIFPEKQQIPSKIHEIVAHSSKKWLGIAPFAQHSSKAYPADLMEEVLKKLNKQD
FT                   NIQVFLFGGGKAEIKKLRSWEQQFENSINVAGLLSFEEELALISNLDAMLSMDSGNGHM
FT                   AAMYGVPVITIWGVTHPFAGFKPFQQPFENSMIPDLEKFPKIPTSVYGNKYPEGYELAI
FT                   RTISPVRVVKKINSVLN"
FT   gene            complement(54368..55414)
FT                   /locus_tag="ZPR_0051"
FT   CDS_pept        complement(54368..55414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0051"
FT                   /product="PaaE-like NADH oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50414"
FT                   /db_xref="GOA:D5BBI0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBI0"
FT                   /protein_id="ADF50414.1"
FT                   /translation="MSTFHKLKIKEIIRETPQAVSISFDIPSELQQEYKFKAGQYITIK
FT                   ADVDGKELRRAYSLCSAPNSEEFKVTVKEVEGGKFSVLANNSLQAGDILEVHPPEGKFV
FT                   LEPSTSAKTYAAFAAGSGITPVLSIIKTVLSEESKSRFILTYGNKSPEDTIFFKELLEL
FT                   QAAYPDRLFVEFVFSRAREDNAHFGRIETSTVNFVMKNKFKDQPFDAVYLCGPEEMINH
FT                   VSEVLTNNGIAEENIYYELFTSNDSGEVEANLEGQTQITVMVDDEETSFVMNQTDVILD
FT                   AALENDLDVPYSCQGGICSSCIARIVEGKAEMRKNQILTDDEIEEGLILTCQAHPLTPT
FT                   IKVDYDDV"
FT   gene            55545..55880
FT                   /locus_tag="ZPR_0052"
FT   CDS_pept        55545..55880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0052"
FT                   /product="transcriptional regulator PadR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50415"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBI1"
FT                   /protein_id="ADF50415.1"
FT                   /translation="MSNSKLYKGSLSTIILKLLAEKDKMYGYEITQKVKEITNGELKIT
FT                   EGALYPALHKLEADGFLQVEVKKVDNRLRKYYKLTEAGMKEKVHKINELEQFIENIQGI
FT                   INPKFSI"
FT   gene            55882..56547
FT                   /locus_tag="ZPR_0053"
FT   CDS_pept        55882..56547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50416"
FT                   /db_xref="GOA:D5BBI2"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBI2"
FT                   /protein_id="ADF50416.1"
FT                   /translation="MKKLNPVQLEEIRSILRHKGIIFFNIQEELLDHIASEIEEKMAME
FT                   SLSFEASSKAVLGLWENSFRLKQNRLLLGKDLYPKIIYEELKRNSVKMLWPLLLLSLVL
FT                   TSLLVILNYETNELFKDFAYLIGFFSLTAGIISLFLYPQLKNGKQTIYSHLLLKDFKIF
FT                   IPMATTVILQVYEQKLENASMYQSILFSFFMAMMLCFLIYLVMLYLKHLDLHRKYALS"
FT   gene            56583..57278
FT                   /locus_tag="ZPR_0054"
FT   CDS_pept        56583..57278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0054"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50417"
FT                   /db_xref="GOA:D5BBI3"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBI3"
FT                   /protein_id="ADF50417.1"
FT                   /translation="MQKVNSNQIDRLYRFTREHFVEYYDVQTELVDHLASVIEKQWRED
FT                   PAIGFENALQEEFKKFGIFGFLEVVEERQKAMTKTYWNLVLKESLEFLRLPKVILMISI
FT                   VSFIFWSLSEFEYGKIMIGSIVLIEMIFLFYHLIKLNREKKKRVKRKGRIYLLEDMILN
FT                   VGQIVATSFYPGYLLLYFDKIIPNEIASIVIAILIAFAFVIHYVAVIVLPEKTKDILLR
FT                   IYPELSLNY"
FT   gene            57416..58816
FT                   /locus_tag="ZPR_0055"
FT   CDS_pept        57416..58816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0055"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50418"
FT                   /db_xref="GOA:D5BBI4"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBI4"
FT                   /protein_id="ADF50418.1"
FT                   /translation="MIFIAVYFAVMFLFMGIGLYPILEKMYPAEDPLFKLNEYILAWLA
FT                   FELIFRFFMQSLPVVQIKPLLLQNIKKHKVINFVLLKSLFSFYNILPVLIYVPFAVVVA
FT                   VKSNHSVISMIAWACSVLFFSFSVNYFNFLIKKKFAEDLKSFLPAIIFILALAGLEYFN
FT                   VFPVSEKFGIFLNYVLEMPYLAVLPLILVVMFFVWVRNTLKKKFYLDTGLKTKQREVKS
FT                   QDFEWLKRFGDVATFLQLDMKLIWRNKRPKTTVYLSFFFLLYGLLFFTNSVYEGMPVMF
FT                   VFAGIFITGIFMINFGQFVPSWDASYYQMIMSQNIPMRKYLASKAALISFSIIILSILS
FT                   TPYVYFGWNILLIIFVCALYNLGVNVPLLMFTGSFNKKRIDLEKSPFMNYQGTGAAQWL
FT                   VAIPLLAVPLGIFYLFYKVFSFNIGLLAIGVLGIIGIVLRNYLMDRITIQYKKNKYAMI
FT                   HGYKQTGD"
FT   gene            58930..59697
FT                   /locus_tag="ZPR_0056"
FT   CDS_pept        58930..59697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0056"
FT                   /product="ABC-type transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50419"
FT                   /db_xref="GOA:D5BBI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBI5"
FT                   /protein_id="ADF50419.1"
FT                   /translation="MITATNLSKVYNGTKVLDIDHLEIPQGQNFGLVGNNGAGKTTFFS
FT                   LLLDLIRPTTGNIFNQDITVNESEDWKTFTASFIDESFLIGYLTAEEYFYFVGELRNQN
FT                   RADIDSFLKQFEEFFNGEIIGRKKYLRDLSKGNQKKVGIVAALIGEPKVVILDEPFANL
FT                   DPTTQIRLKKIIKDLSEISGTTVLVSSHDLIHVTEVCERIVVLDKGNIVRDIKTSEATL
FT                   KELETYFSGEQIPEEIKLSAEEETGEARTNNPD"
FT   gene            59815..62349
FT                   /locus_tag="ZPR_0057"
FT   CDS_pept        59815..62349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0057"
FT                   /product="protein containing tetratricopeptide region"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50420"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBI6"
FT                   /protein_id="ADF50420.1"
FT                   /translation="MRRFTQAFFIFILLGAIISCSRKKDTFISRSWHSVTAEYNTLYNG
FT                   NLALETGREELNQNYRDNYWDVLPIERMQIDEEILLPDSIRNQNFGVAEQKAVKAIQRH
FT                   SMLIAGEEKNPQIDEAYMLLGKARYFDQRFIPALEAFNYILQRYPASNSIRNAQIWREK
FT                   TNIRLENNRVAIKNLKRIIENSQFEDQEYADAKAAIAQAYINLKYPDSALAPLTTAANF
FT                   TKKNEEKGRYFFILGQLYNQLNQPKNANLAFDEVIDLNRKSPRIYMINAYIQKARNFNA
FT                   EENDDQQLKQMLTDLEEDRENRPFLDKIYFQIGEYYYQRDSIDTAIVYYNKSLRSRANS
FT                   DPYLRSINYEILANINFDQSEYQTAAKYFDSTLFEMPSNLREYRTIEKKRKNLDDVIFY
FT                   QAIADKNDSILDLVKLPREEQIAFYTAYTDKLKEGYQKEIEAGEAQAALALNTAGPGVP
FT                   NIGVPVEENASKFYFYSENRINRGEREFLRIWGNRELADNWRWMATGNTGINTQDEDSI
FT                   AEFDFSSDPRFDPLTYVEKLPTDNKVIDSLYEDRNYAYYQLGLIYNEKFGEYQLAVDRL
FT                   EQVLASNPEDRLILPSKYNLYKAYGRLNMLNQQDRMKNDIISNYPNSQYAVFIQNPQSL
FT                   ADGESLPKMSYEKTFELYENQQFVEVISESDKFITRYTGEEIVPKFELLKAMAIGRLRG
FT                   LAEYRKALGYVSLTYPQSQEGQKAKEMISRTLPRLSRLQLKEDSLATNYKLIYEFEASK
FT                   TEEARELQQKIDSALVTLGYSGLSTSIDPYTDDRIFVVVHGLEDRPRALGFGELLREND
FT                   DYKVKNDFLAISTDNYRVVLLKKNLDIYKTDY"
FT   gene            62367..62762
FT                   /locus_tag="ZPR_0058"
FT   CDS_pept        62367..62762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0058"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50421"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBI7"
FT                   /protein_id="ADF50421.1"
FT                   /translation="MFSEKKKGMSGKEMFNEQNKIAAGTQITGDITAKGAFRIEGFLKG
FT                   SLMTTGKVVISKNGSIEGTLECENADIEGNFNGKLTVSGVLSLKSSAIVDGEVVAGKLA
FT                   VEPGANFNATCQMRGTMKSVKNEKQSA"
FT   gene            62743..62961
FT                   /locus_tag="ZPR_0059"
FT   CDS_pept        62743..62961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0059"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50422"
FT                   /db_xref="GOA:D5BBI8"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBI8"
FT                   /protein_id="ADF50422.1"
FT                   /translation="MKNNQRNKYLVFVNVGFQMAIIIAGAVFLGIWLDKKFPNKFSAYT
FT                   ISVSLLGVFIALFQVIRSVKNISKDDE"
FT   gene            62962..63348
FT                   /locus_tag="ZPR_0060"
FT   CDS_pept        62962..63348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0060"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50423"
FT                   /db_xref="GOA:D5BBI9"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBI9"
FT                   /protein_id="ADF50423.1"
FT                   /translation="MGKPLLNFLKVFLPFSLILFIIQFLVISNFIEASLYYSTLANYAF
FT                   HIFATLLIYTLLLYINLNFSDKTGFAFMGLGLLKMVSAVLFLLPALLDDEVSIFAQVIA
FT                   FFVPYFIFLIFETTFAVKLINHNK"
FT   gene            63512..64564
FT                   /locus_tag="ZPR_0061"
FT   CDS_pept        63512..64564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0061"
FT                   /product="ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50424"
FT                   /db_xref="GOA:D5BBJ0"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBJ0"
FT                   /protein_id="ADF50424.1"
FT                   /translation="MTFALALLPVFSFASKEDSLVEAEKEFNATDMILHHIGDAHGWHF
FT                   YGEGENSFTLPLPVILYTDNGLVTFMSSEFHHDTEGHHVVEKNGMSFVNLHEKIYQLEE
FT                   GAHEVEFDKEHHPLNAERPIDLSITKNVAAMFITVIIMLIIFSRLASFHKKNKHAPKGF
FT                   NNLLETFVLFVRDEIAKPQIGEKKYMKFMPFLLTVFFFIWITNLIGLLPGAANVTGNIA
FT                   VTVSLGLFTLVLIVINGNKDFWKHTLWMPGIPTFVKPILTIVEVVGLIVKPVALMIRLF
FT                   ANITAGHIIILSLIGLIFILESAGVAGISVPFALFISVLELLVAFLQAFIFTMLSALFI
FT                   GMAVQEHEHH"
FT   gene            64586..64816
FT                   /locus_tag="ZPR_0062"
FT   CDS_pept        64586..64816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0062"
FT                   /product="ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50425"
FT                   /db_xref="GOA:D5BBJ1"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBJ1"
FT                   /protein_id="ADF50425.1"
FT                   /translation="MEYLHIGLAALGAGLAVIGAAIGVGKIGGSAMDAIARQPEASGKI
FT                   QTAMIIAAALVEGVALFGVVAALLGVLTVPA"
FT   gene            64906..65400
FT                   /locus_tag="ZPR_0063"
FT   CDS_pept        64906..65400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0063"
FT                   /product="ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50426"
FT                   /db_xref="GOA:D5BBJ2"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBJ2"
FT                   /protein_id="ADF50426.1"
FT                   /translation="MDLITPEIGLLFWQTIVFLVLILILAKFAWRPILGAVKEREDSIN
FT                   NALSSAEEARKEMQNLKADNEQLRKEARAERDAILKEARELKEKVLASATEEAQTKADM
FT                   IVAQAKESIEMEKKAAMAEIKSQVANLSIEIAEKVIRKELSSKEKQHQMINEMLGDVTL
FT                   N"
FT   gene            65410..65850
FT                   /locus_tag="ZPR_0064"
FT   CDS_pept        65410..65850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0064"
FT                   /product="ATP synthase subunit delta (OSCP)"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50427"
FT                   /db_xref="GOA:D5BBJ3"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBJ3"
FT                   /protein_id="ADF50427.1"
FT                   /translation="MKGTRAAQRYAKAILELANDKKVAKDVKEDMLSISKTIENSEDLR
FT                   STLASPVIKPSLKNQILKAIFKDVNGLTTGVFNLLVENNRINILDVVAKQYLSLFDTSI
FT                   LVQNAVVTTVVPLTKELEVKIQAKIKELTGREATIENKIDEI"
FT   gene            66012..67592
FT                   /locus_tag="ZPR_0065"
FT   CDS_pept        66012..67592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0065"
FT                   /product="F0F1 ATP synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50428"
FT                   /db_xref="GOA:D5BBJ4"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBJ4"
FT                   /protein_id="ADF50428.1"
FT                   /translation="MAEVNPAEVSAILKQQLSGFEAKASLDEVGTVLTVGDGIANVYGL
FT                   SNAQYGELVQFDSGLEGMVLNLEEDNVGVVLLGPSKEVKEGSTVKRTQRIASINVGEGI
FT                   VGRVVNTLGEPIDGKGTIEGETFEMPLERKAPGVVFREPVTEPMQTGIKSIDAMVPVGR
FT                   GQRELVIGDRQTGKTTVCIDTILNQKEFYDAGKPVYCIYVAVGQKASTVAGIAKVLEDK
FT                   GALAYTTIVAANASDPAPMQVYAPFAGAAIGEYFRDTGRPALIVYDDLSKQAVAYREVS
FT                   LLLRRPPGREAYPGDVFFLHSRLLERAAKVINDDDIAKTMNDLPDSLKDKVKGGGSLTA
FT                   LPIIETQAGDVSAYIPTNVISITDGQIFLTSDLFNSGVRPAINVGISVSRVGGSAQIKS
FT                   MKKVAGTLKLDQAQFRELEAFAKFGSDLDAATMSVIEKGKRNVEILKQGQNDPYPVEDQ
FT                   IAIIFAGSKNLLREVPVEKVREFERDYIEFLNAKHRDVMDTLKAGKLTDEVTDTLASVA
FT                   KELSEKYKG"
FT   gene            67672..68532
FT                   /locus_tag="ZPR_0066"
FT   CDS_pept        67672..68532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0066"
FT                   /product="ATP synthase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50429"
FT                   /db_xref="GOA:D5BBJ5"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBJ5"
FT                   /protein_id="ADF50429.1"
FT                   /translation="MANLKELRSRITSVSSTMQITSAMKMVSAAKLSKAQDAIESMRPY
FT                   SQKLSQLLQDLSATLDDDTSSKYAEQREVQKVLVVAISSNRGLAGAFNANIIKGVKNAV
FT                   AKEYSNKDVHLYSIGKKANDILKRSFKVYKTNTEIFEDLSFENVSVIAEDLMEQFLEGN
FT                   YDKIVLVYNHFKNAATQAVLTEQFLPIPKFETEEEKQLDYIFEPSKLEIVKDLIPKSLK
FT                   MQLYKALRDSFASEHGARMTAMHKATENATELRDSLKLSYNKARQASITNEILEIVGGA
FT                   EALNN"
FT   gene            68697..69119
FT                   /locus_tag="ZPR_0067"
FT   CDS_pept        68697..69119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0067"
FT                   /product="membrane or secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50430"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBJ6"
FT                   /protein_id="ADF50430.1"
FT                   /translation="MLSLFFFTLFTNCGTNKNLQEEAPAEFQQAFYTTVDGQMTFYLPV
FT                   TAIQKNRIELKNIYFKGLKSPIVYNEDGQNRYTASFGIRQSDYVMSSDPREEYGNKMPQ
FT                   KPEKSPVSIAKDQALLEFQENGETKYYVISDIEERK"
FT   gene            69147..70613
FT                   /locus_tag="ZPR_0068"
FT   CDS_pept        69147..70613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0068"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50431"
FT                   /db_xref="GOA:D5BBJ7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBJ7"
FT                   /protein_id="ADF50431.1"
FT                   /translation="MQETQSLLSTLKRFFQDTIIYGIATVVPRLLNFILVPLHTDVLDT
FT                   KDYSVNTTFYIWAALFNVLLTYGMETSFFRFFSRAEDKNKVYSTSFIALTITTLLFFGL
FT                   GMLFQDSFIRVVDLDPFFFNIFFSVIILDTLVVIPFAYLRATNRPVRFALVKLLNVFIV
FT                   FAINIYFLWLVPKFPAFAPQYVLNHFTQKDILGYIFMANLVASGITFLILLPYFFKTKI
FT                   QFSFSLIKQMWKYGWPIMLAGISFIINENLDKLLLKDILSEEIMGAYSGCYKLAVFMMI
FT                   FIQAFRMGAEPFFFNHAKEKNAKITYARILEYFVICGGIILLVLVCFIDIFKQFMIPNQ
FT                   EYWKAMAIVPIILLANLFLGIYHNLSVWYKLTDKTRMGMYISLFGALVTVILNITLIGK
FT                   FGFMVAAWATLAAYGSMMLISYFYGRKYYLVPYNVKKIGLYLLLSVGLSAISFIYFRQN
FT                   YIVATLFVLIFVGITYFKEQEDIKKILKRS"
FT   gene            70610..71044
FT                   /locus_tag="ZPR_0069"
FT   CDS_pept        70610..71044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0069"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50432"
FT                   /db_xref="GOA:D5BBJ8"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBJ8"
FT                   /protein_id="ADF50432.1"
FT                   /translation="MTIKIINKSSHDLPGYATEASAGMDLRAELSEPVTLKPLERAIVK
FT                   TGLFIELPVGYEAQVRPRSGLAAKKGITVLNAPGTIDADYRGEIGVILVNLSNDNFIIE
FT                   NGERIAQLVIAKHEHIKWEEVEVLTDSVRGAGGFGSTGTK"
FT   gene            71087..72097
FT                   /locus_tag="ZPR_0070"
FT   CDS_pept        71087..72097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0070"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50433"
FT                   /db_xref="GOA:D5BBJ9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBJ9"
FT                   /protein_id="ADF50433.1"
FT                   /translation="MKIIVPMAGRGSRLRPHTLTTPKPLIPIAGKPIVHRLVQDIAKVL
FT                   DEDIDEVAFVIGEDFGEKIENDLKDIAESLGAKASIYYQDKPLGTGHAIMCAKESLEGP
FT                   AVIAYADTLFKADFTLDKDADSVIWVKQVDNPSAYGVVKLNDSKQITELVEKPAEFVSD
FT                   LAVIGIYYFKEVAVLKEELQKVLDNNIVHGGEYQINDGIKAMQANGLKFVPGKVEEWMD
FT                   CGNKNVTVETNGRMLKFLHQDGEKLIADSVKIKDAEITEPCFIGENVELINAKIGPNVS
FT                   IGNGTKIENTTIRNSLIQSFAEVKNANLNNAMIGNFAKFNGEFTEISIGDYSVLE"
FT   gene            72172..73509
FT                   /locus_tag="ZPR_0071"
FT   CDS_pept        72172..73509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0071"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50434"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBK0"
FT                   /protein_id="ADF50434.1"
FT                   /translation="MPGKAFAIIQQPEDKNSATVNSDLGEVNDDFQEYFFEALKQRGIE
FT                   NYEKANEALQKCLAINDQSPVIYYEIAKNHYSLEEFEQAKAYFQKALDLKPNDENILRE
FT                   YYENEIASVDYESAIQILQKLIKIDTKYREDLADLYILSDRYDNALSLIDSLDIQYGEN
FT                   EYRTHLRRQIYARTNNTDAQIANLEKAIKDDPKEEENYLNLIYVLSDEGMEEEAFKTAQ
FT                   QLLQVSPGSSLAHLALYKFYLNKDQPEEAMQSMQMVFKSEEIDAASKYKVLNDFLLFVN
FT                   QNPQWENELMEVSQMLSKQENEPSLYRKLGEYYLKSNNKADALRYFEMGLKEDPANFEM
FT                   IKNTLILRIDLEHFENAEKLASEARDIFPAQPIFYLLNGVALNKLKNYSEAVEILTFGL
FT                   DFLIENPRMEADFYQQISVSYAGLEDKERANEYKAKAIKTLKEATK"
FT   gene            73506..74276
FT                   /locus_tag="ZPR_0072"
FT   CDS_pept        73506..74276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0072"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50435"
FT                   /db_xref="InterPro:IPR025634"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBK1"
FT                   /protein_id="ADF50435.1"
FT                   /translation="MIKRIIFALLLTLSIAACGTKKAASGFERSNAKAAGVIKNHYDKA
FT                   IQFNTLSGKLRATYQDADRTQSVNLSFRMEKDKAIWMSASILGFPMAKAYITPQKVSYY
FT                   EKVGKTYFDGDFSLVSQWLGTPLDFEKLQNLLLGQAIYDLREDVYTLSESPRGFQLLPK
FT                   KSSDVKKMFMLDSETFKAKAQQLAQDSKNRSVTVTYGDYQRVAGRLFPETITIIANEGG
FT                   ESTNITLQYRSIEFDGEVSFPFSIPSGYDEISVE"
FT   gene            74273..75490
FT                   /locus_tag="ZPR_0073"
FT   CDS_pept        74273..75490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0073"
FT                   /product="M23 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50436"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBK2"
FT                   /protein_id="ADF50436.1"
FT                   /translation="MILGFFKYIFCIATFLVVTSSFAQNTREALEKKRIELRNEIRRIS
FT                   ELRTSNKKKEKSILNEVQDLNQQIKSTENLIKVTNQQANLLTKEMNENEAKIAKFRKEL
FT                   EELKADYAEMIKKSYRSKSQQSRIMFLLSSESFLQAYKRLQYLKQYADYRKEQGEQIKT
FT                   RTMDLQRLNKRLAYQKEEKNKLIAENRATRARLEENKKSQQELMKTITAKESQFASQIR
FT                   KTQQEIDEIERKIDAMIKASIAETNKKSGSSKRDVFELTPEAKALAKDFASNKGKLPWP
FT                   VATGTVSMKFGKQPHPVVSNITINNSGVNIDTDKGGKARAVFEGTVSEVQILKGANKAV
FT                   MLRHGDYITIYDNLEEVYVRKGDYVSTGQDLGVVATSKSSGKTTLHFLIFQNTKKYNPE
FT                   SWILKR"
FT   gene            75551..76291
FT                   /locus_tag="ZPR_0074"
FT   CDS_pept        75551..76291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50437"
FT                   /db_xref="GOA:D5BBK3"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBK3"
FT                   /protein_id="ADF50437.1"
FT                   /translation="MKKKYSVIAIKCTEACLKVVYFFATIAFIHLFGSCNSDDVLVTEN
FT                   KRMAVFATVLDSKNVALPDIPVNVTTNAFEDYNILGASRSKAGGSVDFVSLVSYNRGVA
FT                   INFNPVSSAVYNPNFTNVSYIDPREIVDREQRIDLDVVKLSRVQDVNVSISLLSQTSNL
FT                   VVKIQYYKSIQSFALNQNIDPLLIPENITSNYLKLDEENPTFENSWKLPVGSPIKFFYK
FT                   KEDEIQKDTTITVNATTNSIDLEF"
FT   gene            76337..76978
FT                   /locus_tag="ZPR_0075"
FT   CDS_pept        76337..76978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0075"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50438"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBK4"
FT                   /protein_id="ADF50438.1"
FT                   /translation="MKNILLLAIILSFSLANAQQDLYLPNPHRNWYEPEDPETVFFGLS
FT                   TYFPIGLSHSSLSNDYELNAGIQLEVNVFITPQFVAGVYGKWHEGEVSNIEKIGNISET
FT                   NFSEYGVSLGYYQAINREFNYLITANIGGVSQRNSVPFSSGSFRENGTSYKLGGELGYR
FT                   FNQTIAVFARVSPYYLNLDINNAAYMDYLNKHFLVDVGFGLRVHLHNPNG"
FT   gene            complement(76996..77508)
FT                   /locus_tag="ZPR_0076"
FT   CDS_pept        complement(76996..77508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0076"
FT                   /product="acyl-CoA thioester hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50439"
FT                   /db_xref="GOA:D5BBK5"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBK5"
FT                   /protein_id="ADF50439.1"
FT                   /translation="MNSKYPKDSRTTLTDLVLPSETNPLNNLFGGELLARMDRAASIAA
FT                   RRHSRRIVVTASVNHVAFNKAIPLGSVVTVEAVVSRAFKSSMEIFIDVWVEDRESGLRS
FT                   KANEAIYTFVAVDETGAPVPVPPLEPETDLEKERYAAALRRKQLSLVLAGKMQPNDATE
FT                   LKALFTK"
FT   gene            complement(77566..78501)
FT                   /locus_tag="ZPR_0077"
FT   CDS_pept        complement(77566..78501)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50440"
FT                   /db_xref="GOA:D5BBK6"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR040495"
FT                   /db_xref="InterPro:IPR041268"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBK6"
FT                   /protein_id="ADF50440.1"
FT                   /translation="MKIANYIQDLLYRYECVIVPGFGAFLSQRESAFIDAATNNLYPPK
FT                   KTVSFNRQLVKNDGLLANYIADAESINYTTALNKIADFVHQLENALKEQQKAEIANIGA
FT                   FTVSEDYTLQFEPFNKVNYLADSFGLDVVHSTKIQREVYKSQVQKIEEKAPIHFTPERR
FT                   NRKAAFLKYAAVGILALGLSGIAGLNIYSNQVAEHNIAEQQEAEDKLQQQIHEATFVID
FT                   NPLPAITFKVEKQPGNFHLVAGAFRVEENAEKKVEELKEEGYKARLIGANKYGLHQVVF
FT                   SSHQTRRDAVNALNKLKRENQAAWLLVEEL"
FT   gene            78599..79699
FT                   /locus_tag="ZPR_0078"
FT   CDS_pept        78599..79699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0078"
FT                   /product="Smf family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50441"
FT                   /db_xref="GOA:D5BBK7"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBK7"
FT                   /protein_id="ADF50441.1"
FT                   /translation="MDINDLRYVLALQRAPNLGDRSAKKLIARLGSAEAIFKEKRQSLL
FT                   KIEGIGELKLQALFDPANFEAAEKEIEFIKNEHLETHYFLDENYPEKLKHCHDSPIILF
FT                   SRGNIQLNNRRIVSVVGTRKITSAGKTFVTQFIEELSPLNPIIVSGFAYGVDIAAHRAA
FT                   IDCNLQTIGCLAHGLDQIYPKLHAKYVDDVLKNGGFFSDFWSSDKFDRNNFLKRNRIIA
FT                   GLSEATVVIESAEKGGSLVTADIANSYNREVFAVPGRPGDKYSKGCNELIKLNKAHLLS
FT                   SAADLVYMLDWKLHEDVKPVQQQLFVELDEEEQQIYDLLKEKGKSQLDAIALYCDFPTF
FT                   KTASILLNMELKGVIRPLPGKLFEAI"
FT   gene            complement(79803..80771)
FT                   /locus_tag="ZPR_0079"
FT   CDS_pept        complement(79803..80771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0079"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50442"
FT                   /db_xref="GOA:D5BBK8"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBK8"
FT                   /protein_id="ADF50442.1"
FT                   /translation="MSRILTGVQSTGTPHLGNLLGAIMPAIKMANSPENDSFIFIADMH
FT                   SLTQIKDAETLRNNTYSVAATWLACGIDIEKTVFYRQSDIPQASELSWYLSCFFPYQRL
FT                   TLAHSFKDKADRLEDVNAGLFTYPMLMAADILLYDAEIVPVGKDQLQHLEITRDVASRF
FT                   HAKMGETFVIPEAKVEENILYVPGTDGSKMSKSKDNTVNIFQTDKKLRKQIMGIQTDST
FT                   PLEEPKNPDTCNVFNIYKLLGSEAQTAELRQKYEAGGFGYGHAKQALFELVKETFAEPR
FT                   EKYEYYINNLEEVDKALAIGKEKATTVAKDVLKRVREKLGY"
FT   gene            80925..81587
FT                   /locus_tag="ZPR_0080"
FT   CDS_pept        80925..81587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0080"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50443"
FT                   /db_xref="GOA:D5BBK9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBK9"
FT                   /protein_id="ADF50443.1"
FT                   /translation="MLPILIVFTSSERFYPQFFFCARMWAKFIIFGMGFYRRTQGSHKL
FT                   DKNGSYMFVANHYSMLDIMLMLATVNHPFVFVGKKELAKIPIFGFFYRKTCILVDRKSQ
FT                   QSRQAVFNEAQRRLKQGNSICIFPEGGVPDDENIILDEFKEGAFKLAIDHQIPVAPLTF
FT                   HDTKKRFSYTFLSGSPGKLRVTIHDFIPTKGKTQQDRKELKDKTHEIIYEELKSPSL"
FT   gene            complement(81672..83153)
FT                   /locus_tag="ZPR_0081"
FT   CDS_pept        complement(81672..83153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50444"
FT                   /db_xref="GOA:D5BBL0"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBL0"
FT                   /protein_id="ADF50444.1"
FT                   /translation="MKEKKNIDRLFQEKFKDFEHTPKEDVWKNIAEKLQEKQEKKPVIL
FT                   PLWYKLGGVAAVLAIILAGVYFLQNSPANFTEPQITFDIEESQLPSIKTPSDSILNTAN
FT                   KTLEKITETSKNSSKTTKKAEQRQDALIPSGAVANQTSKTISGSDTPSNNSASEKTNIK
FT                   SSNITSHQSKNEQDLAHLDQKNEDKATENQSKSTDVISLVNKTGEDQITAIDSVKTKAD
FT                   EDYENAVALFEKEKNQEATSEEVKTASKKGKVSISPFAAPVYYDNLGSGNPIDPSFASN
FT                   QTSSEVTMAYGVKVAYAVSEKIKIRSGINKVSMNYQTRDIAYNYAIASSSLANINYDTG
FT                   SENIRIASNSKNSPASPVFDGQENGFVPSLNMPRENGSLSQNFGYIEVPVEIEYNLIDK
FT                   KIGLKLIGGASSLFLDENSVSVNGQNGTIELGESNNLESLSFTTNIGMGIDYQLNDKFR
FT                   LNLEPTFKYQLNSFSNTNGVNPYFFGVYTGFSFEF"
FT   gene            complement(83150..83692)
FT                   /locus_tag="ZPR_0082"
FT   CDS_pept        complement(83150..83692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0082"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50445"
FT                   /db_xref="GOA:D5BBL1"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBL1"
FT                   /protein_id="ADF50445.1"
FT                   /translation="MSLEKLIKRCKQNDIKAQEELYRLYAGKMFGLCLKYSDSYAQAED
FT                   NLQDGFLTIFDKIGQYKHQGSFEGWMKRIMINTTLQKYRKEKLYSISNEDQIEETTVEY
FT                   EESSLPLDFLLSIVQQLPQRYREVFNMYVLDGYSHKEIAGILQISEGTSKSNLSRARSL
FT                   LKESIESNQHNSSAKTL"
FT   gene            complement(83807..84262)
FT                   /locus_tag="ZPR_0083"
FT   CDS_pept        complement(83807..84262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0083"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50446"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBL2"
FT                   /protein_id="ADF50446.1"
FT                   /translation="MKRIVLILACICTLSGCSIDDDGSSLSLSLAEITDAQLPDYFETG
FT                   EIYNFPINYMPANGCEQFYGFDINREINGNVRDIYVFAVTARYLDRTDCDEATEQERTL
FT                   KDIVITGNENTEYIFHFWIGEENEEAKYLDITVPVGKPEENEEPTQE"
FT   gene            complement(84403..84879)
FT                   /locus_tag="ZPR_0084"
FT   CDS_pept        complement(84403..84879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50447"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBL3"
FT                   /protein_id="ADF50447.1"
FT                   /translation="MKKIILFLSIAFSFAACNIDDDGPGISYTYVEILDATLPAYFIVD
FT                   EEYEIDITYDIGSDCNTFSSFEYNGRPHQEHDSIFEFYVNAIVSYDPNNVANCTDTGLI
FT                   KTTNWTENFKLNSDQYEVIRFNFLSGTNTDHTAKYLTRDILVGEPEDTPEETTE"
FT   gene            complement(84996..85496)
FT                   /locus_tag="ZPR_0085"
FT   CDS_pept        complement(84996..85496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50448"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBL4"
FT                   /protein_id="ADF50448.1"
FT                   /translation="MKKTSLILFLALAVSLISCNDDDGPSIAYQYAKITGHNLPAFIEY
FT                   SETYDLKATFELPDACHKFVDFNGQFYEMEDAEDTLVVDIVALTSYDPNVTECNEEGDL
FT                   TQTKSILQNDFNLSKITSNEDRYKSVRFRFVNGINSATNKYEFLTVDVPVGEPEATPEE
FT                   PAE"
FT   gene            complement(85613..86632)
FT                   /locus_tag="ZPR_0086"
FT   CDS_pept        complement(85613..86632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0086"
FT                   /product="RecA"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50449"
FT                   /db_xref="GOA:D5BBL5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBL5"
FT                   /protein_id="ADF50449.1"
FT                   /translation="MSNDKEKDAKLKALKLTLDKMDKTYGKGTVMKMGDQAIENIPSIS
FT                   TGSLGLDLALGVGGYPRGRIIEIYGPESSGKTTLTLHAIAEAQKSGGIAAFIDAEHAFD
FT                   RFYAEKLGIDIENLIISQPDNGEQALEITDNLIRSGAIDIIVIDSVAALTPKSEIEGEM
FT                   GDSKMGLHARLMSQALRKLTSTISKTNCTVIFINQLREKIGVMFGNPETTTGGNALKFY
FT                   ASVRLDIRRSTQIKNSSSEVMGNKTRVKVVKNKVAPPFKTAEFDIMYGEGVSKIGEIID
FT                   IGVDYEIIKKSGSWFSYEDTKLGQGRDAVKTILKDNPDLMDELEVKIKDAIKVAKEEA"
FT   gene            86846..88087
FT                   /locus_tag="ZPR_0087"
FT   CDS_pept        86846..88087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0087"
FT                   /product="collagenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50450"
FT                   /db_xref="GOA:D5BBL6"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBL6"
FT                   /protein_id="ADF50450.1"
FT                   /translation="MTSTGKIELMAPAGNFESLQAALDNGADSIYFGVEQLNMRARASI
FT                   NFTLNDLPEIAKRCEAKRVRTYLTLNTIIYDHDLSIVKTLLDKAKAANLTAVIAMDQAV
FT                   IAYARQIGMEVHISTQINITNIETVKFYALFADTMVLSRELSLRQVKKICDQIEKEQIK
FT                   GPSGNLVEIEIFGHGALCMAVSGKCYLSLHSHNSSANRGACKQNCRKKYTVIDQESGFE
FT                   VELDNEYMMSPKDLCTLDFLDQVIDAGTKVLKIEGRGRAPEYVAKVIKTYREAIDAYYE
FT                   ETYSKEKVGIWMEELKKVYNRGFWSGYYLGQKLGEWSDGSGSHATQKKVYVGKGMHYFP
FT                   KANIGEFKIEAYDIKLGDTLLITGPTTGAQEVELSEMLVNDEQLETASKGDSCTIKLPF
FT                   RIRNSDKLYKIVKA"
FT   gene            88144..88317
FT                   /locus_tag="ZPR_0088"
FT   CDS_pept        88144..88317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0088"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50451"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBL7"
FT                   /protein_id="ADF50451.1"
FT                   /translation="MAPSEFQMSKKDGKSVLLHSKEKKSFYTLKSHDDSIFAECLQAQN
FT                   ACPVKIITAKKL"
FT   gene            88348..89379
FT                   /locus_tag="ZPR_0089"
FT   CDS_pept        88348..89379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0089"
FT                   /product="rhodanese-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50452"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBL8"
FT                   /protein_id="ADF50452.1"
FT                   /translation="MQLYNKLSAKEREALIEEAGEDRLTLSFYAYAKIGNPKLFRDHLF
FT                   VAWNSMDVLGRIYVAHEGINAQLSVPAKRFNEFKEFIDNIYFLEGCRLNIAIEQDSKSF
FT                   LKLKVKVRDKIVADGLNDASFDVTNKGIHVDAATFNQLLDDPNTVCVDMRNHYESEIGH
FT                   FQGAVTPDVDTFRDSLPIIEKDLEEHKEDKNLLMYCTGGIRCEKASAYYKHRGFQNVYQ
FT                   LEGGIIEYARQVKNQQLENKFIGKNFVFDHRRSERISDDVIAHCHQCGKACDTHVNCAN
FT                   EACHLLFIQCEECAMEMNNCCSEDCMKVNALPYEEQKELRKGKRNSNKIFKKGRSEVLK
FT                   YKS"
FT   gene            89595..90764
FT                   /locus_tag="ZPR_0090"
FT   CDS_pept        89595..90764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0090"
FT                   /product="PSP1 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50453"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBL9"
FT                   /protein_id="ADF50453.1"
FT                   /translation="MACSSCSTDKDGKPKGCKSNGTCGTDSCNKLTVFDWLSNMSLPNG
FT                   VEPFDCVEVRFKNGRKHFFKNTENLSLSMGDVVATEASPGHDVGMVSLTGELVRIQMKK
FT                   KKVTPDSEEVLKIYRKATQKDIEVWEEARAREEKIKTRAREIAIRLNLSMKISDIEFQG
FT                   DASKATFYYTADDRVDFRQLIKEFAREFNTRIEMRQIGLRQEAARLGGIGSCGRELCCS
FT                   TWLTDFRSVSTSAARYQQLSLNPQKLAGQCGKLKCCLNYELDTYLESLKTFPKSDIKLH
FT                   TKKGTAVCQKIDIFKGFLWYAYEGEWMTWHKLTVDQANQIIEANKKRESIGSLEEFEVM
FT                   LQMEEEQPDFNNVVGQDSLTRFDNPHPKKKRRNKKRRKKNKPSSSRNEK"
FT   gene            90754..91245
FT                   /locus_tag="ZPR_0091"
FT   CDS_pept        90754..91245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0091"
FT                   /product="gliding motility lipoprotein gldH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50454"
FT                   /db_xref="InterPro:IPR020018"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBM0"
FT                   /protein_id="ADF50454.1"
FT                   /translation="MRSNFILILAISSLCFWSCDSKMVYDEYKSVNQWNKDSIVSFDIG
FT                   ELDSLKAYNLFINIRNNSEFKYSNLYLITEIQFPKGKVISDTLEYEMARPDGEWLGTGF
FT                   GDVKENKLWYKEHVRFKEPGEYRVNIRHAMRKNGEVNGIQNLDGITDVGFRIEKTTQNN
FT                   "
FT   gene            91251..93572
FT                   /locus_tag="ZPR_0092"
FT   CDS_pept        91251..93572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0092"
FT                   /product="bifunctional transglycosylase/transpeptidase
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50455"
FT                   /db_xref="GOA:D5BBM1"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBM1"
FT                   /protein_id="ADF50455.1"
FT                   /translation="MAESRKKQTKPKQSNRKYIIGFWTLFGVGVLAVIFFFLLAGWGVF
FT                   GKMPTFEELENPETNLATELISSDGETLGKYYRENRTPIKYDDLPQHLVQALVATEDER
FT                   FYKHAGIDARGTVRAAVYLGAKGGASTITQQLSKQLFTEDFSTDNTFERVLQKMKEWVI
FT                   ATRLERQYTKEEIITMYLNKYDFLYQAVGVRSASRIYFDKEPKDLKPEESAVLVAMLKN
FT                   SALYNPVRRPDLVENRRNQVFVQMYKNGFLTEQQKDSLQQTEMKITFSPEGHDDGIATY
FT                   FREYTRQFLTDWIEENPKPDGEKYNLYRDGLKVYTSIDSKMQEYAEDAVTKHLAHIQQE
FT                   FDRQNKNNRTSPFRDIDQSMIDNIINGSIKRSARYSKMKREGKSEEEILASFDEPREMR
FT                   IFSWKGDIDTTMTPRDSIRYYKSFLQAGLMSMDPTTGEVKAWVGGTNFKHFKYDHVKQG
FT                   KRQVGSTFKPFVYATAIDQLKMSPCDTLPLNRFTIPAGKYGNIKDWSPRNSGSGDDVYS
FT                   GMMSLKEALANSVNTVTARVIDKTTPGNVISLISKLGIDTEGFPTGPAIALGTADISLY
FT                   EMVSAYSTFANKGVRVKPVLITRIEDKNGTVLFQNVPETYDVMSEEAAYVTVNLMEGVT
FT                   RYGSGARLRGTGREVRLDYQRAVTGYPYDFKNPIAGKTGTTQNQSDGWFMGMVPNLVTG
FT                   VWVGAEDRAVHFPGITYGQGATMALPVWGMYMKSVYANEDLNISQDDFERPENLSISVD
FT                   CATYGKSNNPDSGAVEELDF"
FT   gene            93938..94636
FT                   /locus_tag="ZPR_0093"
FT   CDS_pept        93938..94636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0093"
FT                   /product="succinyl-CoA:3-ketoacid-coenzyme A transferase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50456"
FT                   /db_xref="GOA:D5BBM2"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBM2"
FT                   /protein_id="ADF50456.1"
FT                   /translation="MISKTVNNVAEALEGVHDEMTFMLGGFGLSGIPENAISELVRLNI
FT                   KNLTCISNNAGVDDFGLGLLLQKKQIDKMVSSYVGENAEFERQMLSEELEVELIPQGTL
FT                   AARCQAAQQGFPAIYTPAGYGTEVALGKETREFDGKMYVLEEAFKADFAFIKAWKGDRV
FT                   GNLIFKGTARNFNPVMCGAAKVTVVEVEELVEPGELDPNFIHIPGIFVQRIFEGKNYEK
FT                   RIEKRTVRER"
FT   gene            94736..95038
FT                   /locus_tag="ZPR_0094"
FT   CDS_pept        94736..95038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50457"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBM3"
FT                   /protein_id="ADF50457.1"
FT                   /translation="MIIDYSEQLKVHKHYEIASQLIRSGTSIGANIWEAQSSESRKDFG
FT                   HKLKIADKEAKEVEYWLLLCKSSEHIKNYDEELDGKLLSIQKLLSRIISTNKSRG"
FT   gene            95116..95769
FT                   /locus_tag="ZPR_0095"
FT   CDS_pept        95116..95769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0095"
FT                   /product="succinyl-CoA:3-ketoacid-coenzyme A transferase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50458"
FT                   /db_xref="GOA:D5BBM4"
FT                   /db_xref="InterPro:IPR004164"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBM4"
FT                   /protein_id="ADF50458.1"
FT                   /translation="MLDKNGIAQRIAKEVKDGFYVNLGIGIPTLVANFVRDDIQVEFQS
FT                   ENGILGMGPFPLEGEEDADLINAGKQTITALPGASFFDSALSFGMIRGKHVDLTILGAM
FT                   EVAENGDIANWKIPGKMVKGMGGAMDLVASAENIIVAMMHTNRAGASKLLKKCTLPLTG
FT                   VGCVTKIVTNLAVIEVTEDGFKLLERAPGVSVDEIKAATEGELVVDGEIPEMKL"
FT   gene            complement(95764..96486)
FT                   /locus_tag="ZPR_0097"
FT   CDS_pept        complement(95764..96486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0097"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50459"
FT                   /db_xref="GOA:D5BBM5"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019288"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBM5"
FT                   /protein_id="ADF50459.1"
FT                   /translation="MELQKLNIEHVLFLDIETVPEYASFEDLDETKQQLWTEKTKYIRK
FT                   DEHSPADFYPRAGIWAEFGKIVCISVGFLSLKDGIRNFRLKTFWGEEKSILIDFSSLLN
FT                   EHFSKPYHLLCAHNGKEFDFPFIARRMIIHNIELPEKLNSIGRKPWEIPHLDTMELWRF
FT                   GDYKHFTSLKLLTNVLGIPSPKNDIEGSQVYEVFYTENDVQRIIKYCERDVVAIAQILL
FT                   RLKQEALLKDSEISTVPL"
FT   gene            96485..96586
FT                   /locus_tag="ZPR_0096"
FT   CDS_pept        96485..96586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0096"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50460"
FT                   /db_xref="GOA:D5BBM6"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBM6"
FT                   /protein_id="ADF50460.1"
FT                   /translation="MYSDFQYFKLYFCFLKSKSTFLIIIGINYLFAS"
FT   gene            96672..98594
FT                   /locus_tag="ZPR_0098"
FT   CDS_pept        96672..98594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0098"
FT                   /product="peptidase S9 prolyl oligopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50461"
FT                   /db_xref="GOA:D5BBM7"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBM7"
FT                   /protein_id="ADF50461.1"
FT                   /translation="MYKPMKKLMLVMSLVFSGTFVFGQKTMTPEKLWQVERISVLGLDK
FT                   NGEQLFYKVSIPNMEENDYTSKYYQIPAEGGTAKEISKEEVAVASDRNISPNGEYQLFN
FT                   KEVHIENVQSKDIYKNLDKSDAYVYSDLDIRHWDTWQNGNYSHVFYKKVGEEDSEGIDI
FT                   MPDEPYYTPQKPFGGEEDYCWSPDGKSIYYVSKKLKGKDYAISTNTDIYKYNLETKETE
FT                   NITEENKGYDTNPAFSSGGALAWLQMKADGYEADKNDIVVLENGVKQNLTANWDGTVNS
FT                   FLWAKNGEEIYFTAPVDGTIQLFKVNYPGKKRIAAVVEQLSEGQFDVTGIVAEKKKELL
FT                   VTRTDMNHAAEVFRFNLKKKTFEQVTNVNTELYAALDLPKVEKRYVSTTDGKKMLVWVI
FT                   LPPDFDASKKYPTLLYAQGGPQSALSQFYSFRWNFQLMASQGYIVVAPNRRGMPGHGVA
FT                   WNEDISKDWGGQVMDDYLSAIDEIAKEHYVDNDRLGAVGASYGGYSVFYLAGIHNNRFK
FT                   TFIAHDGVFDTRSMYGTTEELFFVNHDFGGPYWEKENADAQKAYNEFNPITKVANWDTP
FT                   ILIYQGGKDYRVPIEQGLGAYQAAQLLGLKSRLVYFPDENHWVLQPQNALVWQNEFFKW
FT                   LKETL"
FT   gene            complement(98685..100397)
FT                   /locus_tag="ZPR_0099"
FT   CDS_pept        complement(98685..100397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0099"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50462"
FT                   /db_xref="GOA:D5BBM8"
FT                   /db_xref="InterPro:IPR025291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBM8"
FT                   /protein_id="ADF50462.1"
FT                   /translation="MNYLKELPSKMAIAFRRFPLTLVWVLFGSIYMIGLIETDANLFRG
FT                   FYAETLVLILGVSWLIGVQFFNEGFSNNLTVWVIRLLTLTGLILYYLSFPDYENSTSIT
FT                   FTRWFILFISGHVLIFFAPFTRQWSTLDYWNYLHRIIIAISRSALFSGIIYLGLSLALL
FT                   AIENLFSINIRDEIYADLLVICLGIINTFIYLSDFPTTIHQTQQLNYSKALDVLIKYIL
FT                   IPIVLLYLLIVYAYSLKILITWELPEGWVSYLITILSITGFIIHIIIEPVREKHQDLVV
FT                   NKFYPFFYLSLFPLFILLFVAIFTRLSEYNFTEKRYFLLVIALWILGISVYVLTSKKKR
FT                   LSIIAISFFALCLLSISGPWNAFKVSINAQGKELSRLIERTKKTDLSKEEIDRFLNISR
FT                   YLKDRNKLFLIDEELGFSTDYITSSYNSGSLILDSIYGENNYSKSINSNSNYFYFQNFR
FT                   KTRVIDINGYEKFIDISLVDYPKSNYSLEVENEYIILKDSDKQLFKYNLTQDLKRKIKL
FT                   YQQLNEAPAESFEYTIINEFGDFKLIINTMNGNIKNNEFTFNTIDGYILIKLH"
FT   gene            complement(100394..101545)
FT                   /locus_tag="ZPR_0100"
FT   CDS_pept        complement(100394..101545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0100"
FT                   /product="secreted beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50463"
FT                   /db_xref="GOA:D5BBM9"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBM9"
FT                   /protein_id="ADF50463.1"
FT                   /translation="MKKFLRFLKYFLGILILLIALLYIFDYDYILKGIKVTYLKGHKTA
FT                   YIDDYPEFDNRLVKADSLSLQPWPESKNYNSVKATDSLKNLNKKLNTAAFLIIKNDSIW
FT                   FEDYYHQYSAKSKTNSFSMAKSVVVALLGKAIRDGYITSIDEPVSHFYPQYDIRLTVGD
FT                   LASMSSGLNWNESYYNPFGQTAKAYFDDNIRKVILDLKVVDTPGKNFKYLSGNTELLAM
FT                   VLEEATNKTLSDYLSESFWQPLGMQSDALWQLDSEESGMEKAYCCIASNARDFAKFGKL
FT                   FKQNGQWNGQRLINPSFVRTMKNPRFEDTPYYGYGLWLSDYKDKEIFYMRGILGQYVIV
FT                   IPEDDVIIVRLGQGLLKRNGEDKHSPDFYRYIDEAYKMLNIQK"
FT   gene            complement(101710..101955)
FT                   /locus_tag="ZPR_0101"
FT   CDS_pept        complement(101710..101955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0101"
FT                   /product="methylated-DNA--protein-cysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50464"
FT                   /db_xref="GOA:D5BBN0"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBN0"
FT                   /protein_id="ADF50464.1"
FT                   /translation="MALLEIPFGKTCSYMELSKKLGDPKAIRAVASANGKNPLWIVVPC
FT                   HRVIGSDGSLTGYAGGLYRKKWLLALESPAAQQSLF"
FT   gene            complement(102137..103228)
FT                   /locus_tag="ZPR_0102"
FT   CDS_pept        complement(102137..103228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0102"
FT                   /product="CBS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50465"
FT                   /db_xref="GOA:D5BBN1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBN1"
FT                   /protein_id="ADF50465.1"
FT                   /translation="MCSILEAALLSFTPSYIKIKKQEGKHYAEVLANFKKDIDKPLIAI
FT                   LTINTVAHTVGSILVGVQAEKTYGDGSNAVGIVSGILTLGILILSEIIPKTLGATYWDK
FT                   MGAFTANTLRLMIAPLKYTGLLWLLMLTTRLIGKSAKVNTMSREEFAAITEAAEEEGVF
FT                   EENESTVIKNMLVFKSVVAKDIMTPFSVAITEDESMSIADFHHSHKNLKFSRIPVYKDK
FT                   SNNISGFILKDDVLEEMIKQNGQSKLETLKREIFVTTSEVPIPDLFDIFIRKRTHISIV
FT                   TDEFGNVVGLVTMEDIIETLLGLEIMDESDSIEDMQKLARKSWERRAKRLGLIQRREEA
FT                   QPEELQNEDNVSEDSSGDRQNKG"
FT   gene            complement(103417..103899)
FT                   /locus_tag="ZPR_0103"
FT   CDS_pept        complement(103417..103899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0103"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50466"
FT                   /db_xref="GOA:D5BBN2"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBN2"
FT                   /protein_id="ADF50466.1"
FT                   /translation="MDTSSTLIGLTLFVLFMGPIFYALYRQGLKERKNKKALQNLAKTN
FT                   NINLDYTEISNSLVLGLDKTQHKLLILEPVNAMQHQIIDLSEVNKTSVIKRSVTFTEKE
FT                   RRKTKIIQVSIELLSKSNHKRITEILFYDEDGADNNDMETQLFAASRWNSLIQTSL"
FT   gene            complement(103999..104316)
FT                   /locus_tag="ZPR_0104"
FT   CDS_pept        complement(103999..104316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50467"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBN3"
FT                   /protein_id="ADF50467.1"
FT                   /translation="MLTALLSTIGISQPQTSAYVYQDSAKNTSSFKQSDITKAFVFEEP
FT                   GSYDVQSNQEDPAFSPVFFSNYLQLDVRTIPQQTLQISWNFIQDHKSKLETQIFPFHFF
FT                   S"
FT   gene            complement(104640..105626)
FT                   /locus_tag="ZPR_0105"
FT   CDS_pept        complement(104640..105626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0105"
FT                   /product="delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50468"
FT                   /db_xref="GOA:D5BBN4"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBN4"
FT                   /protein_id="ADF50468.1"
FT                   /translation="MLKRNRRLRTNEAIRSLVRESLVTPDDFQAPLFVVEGSGIKQEIA
FT                   SMPGYYRYSLDLLKNEVQELWSLGIKSVLLFVKVEAKLKDNRGTEAINPNGLMQRAIKA
FT                   VKETLPEMIVMTDVALDPYSEFGHDGIIENGEVLNDPSVEVLAKMALSHAEAGADFVAP
FT                   SDMMDGRILAMRNILEQNSFFNTGIMSYSAKYASAFYGPFRDALDSAPVDAQDIPKDKK
FT                   TYQMDPSNRDEAIRETLMDIDEGADIVMVKPGLCYLDIVRDLKNNVNVPISVYQVSGEY
FT                   SMIKAAAEKGWLDHDAVVMEQLTAIKRAGADFISTYFAKYAAKLLQR"
FT   gene            complement(105729..106019)
FT                   /locus_tag="ZPR_0106"
FT   CDS_pept        complement(105729..106019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0106"
FT                   /product="S23 ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50469"
FT                   /db_xref="GOA:D5BBN5"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBN5"
FT                   /protein_id="ADF50469.1"
FT                   /translation="MKDYKYLVWQKAHQLTLDVYKLSAKYPKEEIFNLVSQIKRLSRSI
FT                   ATHIAEGCGRKSDKDFARFLYISFGSANELEYQILLSKDLNFISPEEFEIL"
FT   gene            complement(106071..106973)
FT                   /locus_tag="ZPR_0107"
FT   CDS_pept        complement(106071..106973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0107"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50470"
FT                   /db_xref="GOA:D5BBN6"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBN6"
FT                   /protein_id="ADF50470.1"
FT                   /translation="MKDQFYQYIQNLQDTITSKLEEIDGKATFKEDLWKRKEGGGGRTR
FT                   VIENGNVFEKGGVNISAVHGPLNPAMQQYFKVGDVNFFACGLSLVIHPKSPMVPTVHAN
FT                   WRYFEMYDKEGNTLDQWFGGGQDLTPYYLFEEDAIHFHRVSKNACDKHDPKFYPEYKKK
FT                   CDEYFWNAHRDEARGIGGLFFDYLKDNESHSITDWYNFVTEVGNSFLEAYVPIVEKRRD
FT                   LEYNQHHRDWQEVRRGRYVEFNLVHDKGTLFGLKTNGRIESILMSLPPHVQWVYDHHPQ
FT                   SGSEEAKLMEVLEKPKEWV"
FT   gene            complement(106975..107373)
FT                   /locus_tag="ZPR_0108"
FT   CDS_pept        complement(106975..107373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0108"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50471"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBN7"
FT                   /protein_id="ADF50471.1"
FT                   /translation="MLNKNYRDEEKERIDAQLRSIMEMGHVPDEWEEIRLDLDRKLKEA
FT                   VGIGLDEMENLPEEKLMEILANLDLEFSHYEALGDILLNSIGLEAEEKQNDLAQKTLLI
FT                   YKAAQEVSRTFSFSLTQKINEARSWIDD"
FT   gene            complement(107455..107934)
FT                   /locus_tag="ZPR_0109"
FT   CDS_pept        complement(107455..107934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0109"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50472"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBN8"
FT                   /protein_id="ADF50472.1"
FT                   /translation="MAIWARIQRLNFKEIFILLQLFLPNPFYIFPTYHATRETMKLCDR
FT                   LYGRKHYQDNRENAFRHAYWNFLIAEKIFHKNNSVEASLIWAKKITDLHERLAPNKALV
FT                   RAMDLHNNEVGRNLFSNNPKGNAVEHLQDMMKSAVKINASNLSILDKNQLVFIKD"
FT   gene            complement(107934..108962)
FT                   /locus_tag="ZPR_0110"
FT   CDS_pept        complement(107934..108962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0110"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50473"
FT                   /db_xref="GOA:D5BBN9"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBN9"
FT                   /protein_id="ADF50473.1"
FT                   /translation="MIKNDLFLRALKGETVERPPVWMMRQAGRYLPDFMKLKEKYDFFT
FT                   RCRTPELAAEITTMPIEQVGTDAAILFSDILVVPQAMNVEIEMKPGVGPFLPNPVRSPL
FT                   DVNDIIVPDVYEELGYVYDAIKLTKQRLNDEVPLIGFAGSPWTILCYLVQGQGSKNFDK
FT                   AKEFCFKRPDAAQVLLQKITDTTISYLKGKVKAGVDAIQIFDSWGGLLSPTDYQTYSWK
FT                   YIQQIIDALKDEIPVIAYGKGCWFALKEMSQSGAAALGVDWTCSAMNARYLSGGQITLQ
FT                   GNFDPSRLYSSPQEIKKMTTQMIDEFGKDRYIANLGHGILPDIPVRNAQAFVDAVKEYK
FT                   PR"
FT   gene            complement(109088..109738)
FT                   /locus_tag="ZPR_0111"
FT   CDS_pept        complement(109088..109738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0111"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50474"
FT                   /db_xref="GOA:D5BBP0"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBP0"
FT                   /protein_id="ADF50474.1"
FT                   /translation="MATVLSTKKLTATQKHLLLGAKIGLVEYNAINIEFLPISSNIDLA
FT                   ENAIITSKNAFKAIQEKIRIKKAFVVGSKTAALLQKNDIEVVEVADNALALAKKIIVNH
FT                   RDKHFIFFCGNKRREELPLQLKQHKISFEEIQVYKTSLNFAKFKQEFDGILFFSPSGVE
FT                   SYFRKNTIVEATAFCIGATTANSVKKHTENIKIANQPSIENVIVQVVKKYNKS"
FT   gene            complement(109744..110658)
FT                   /locus_tag="ZPR_0112"
FT   CDS_pept        complement(109744..110658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0112"
FT                   /product="porphobilinogen deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50475"
FT                   /db_xref="GOA:D5BBP1"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBP1"
FT                   /protein_id="ADF50475.1"
FT                   /translation="MNKVIRIGTRDSELALWQAKTVQSALEKLGHQTELVPVKSTGDLN
FT                   LDVPLYEMGITGIFTKTLDIAMLTGKVDIAVHSMKDVPTALPKGIVEAAVLKRANTKDI
FT                   LIHKGTDFLDAQGTIATGSLRRKSQWLHRYPTHEVVDLRGNVNTRMQKLEDSNWNGAIF
FT                   AAAGLERIEIKPENFIDLDWMIPAPAQGAMLVVALEKDEFTRTAIGALNHYQTDLEVHV
FT                   EREFLRTLEGGCTAPIGALAKIDNDNILHFKGALFSLDGSQKIEVEKRIAADNVAEFGK
FT                   FCAKEILAKGGAKLMKQIKTVLN"
FT   gene            complement(110655..111908)
FT                   /locus_tag="ZPR_0113"
FT   CDS_pept        complement(110655..111908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0113"
FT                   /product="glutamyl-tRNA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50476"
FT                   /db_xref="GOA:D5BBP2"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBP2"
FT                   /protein_id="ADF50476.1"
FT                   /translation="MESSISKGRHFYIIGLSYKKADAEIRGHFSLTEEAKTKLLEQAKY
FT                   EGIDGVLATSTCNRTEVYGFAAHPFQLIKLLCEHTHGTVEEFEKVAYVYKNRQAISHMF
FT                   RVGTGLDSQILGDFEIISQLRIAFAQSKKIGLSNAFTERLVNAVIQASKRIKNETEISS
FT                   GATSVSFASVQYILKNVADISNKNILLFGTGKIGRNTCENLIKHTQNKHITLINRTKDK
FT                   AEKIAGKFSLTVKDYADLQAEIRNTDVLIVATGAQNPTISKELLYCKKDLLILDLSIPK
FT                   NVAEDVEELDNVRLVHLDHLSQITDGTLQRRKKFIPEAEAIIIEVEGEFNKWLETRKFA
FT                   PTIKALKKKLRMMKDAELDFQRKKIADFNDEQAEIVSNRIIQKIMKHFANHLKEDSNTT
FT                   DESLELIQKVFQLEEQVR"
FT   gene            112110..113006
FT                   /locus_tag="ZPR_0114"
FT   CDS_pept        112110..113006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0114"
FT                   /product="HTH domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50477"
FT                   /db_xref="GOA:D5BBP3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBP3"
FT                   /protein_id="ADF50477.1"
FT                   /translation="MEEVKNIAVGITEETKVEDGFYIFKFQNETSDKQIVEREVDVSFI
FT                   QFHFNVKGESKFLFNRGRYELPLAEEKSLILYNPQLNLPLNLVLGPKSWLISLVISIKK
FT                   FHALFSEEANYISFLSTENKDKKYYKDSPISPSMAIALNQVMNFNLTPTIKNLYFKAKA
FT                   YELLSLYFNRAEDANIEQCPFLSDEENILKIRRAKDIVIARMAEPPSLQELSDEINLSL
FT                   KKLKEGFKQIYGDSVYSFLFDYKMEYARKLLDSGEYNVNEVGLKVGYSTASHFIAAFKK
FT                   KFGTTPKKYLMSLPATH"
FT   gene            113245..113913
FT                   /locus_tag="ZPR_0115"
FT   CDS_pept        113245..113913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0115"
FT                   /product="class I glutamine amidotransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50478"
FT                   /db_xref="GOA:D5BBP4"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBP4"
FT                   /protein_id="ADF50478.1"
FT                   /translation="MANAQQNISVFYKTAGFKHESIPTGIQALKEIAADNGWKVIATDD
FT                   AEKFVSELSNIDAVIFLSTTGDIFTEDQQEKFTNYIENGGNFFGIHAASDTEYDWPWYG
FT                   KFIGAYFESHPRTQEATVIVEKPKNHMVAHLPKRWTRTDEWYNFKNINSNIQVLLTLDE
FT                   TSYEGGKNGDFHPHAWYQEFEGGSKMVYTGGGHTKESYAEPLFREHLKRCIQFLLDKRD
FT                   "
FT   gene            114118..115152
FT                   /locus_tag="ZPR_0116"
FT   CDS_pept        114118..115152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0116"
FT                   /product="ferrochelatase (protoheme ferro-lyase)"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50479"
FT                   /db_xref="GOA:D5BBP5"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBP5"
FT                   /protein_id="ADF50479.1"
FT                   /translation="MSKGVLLVNLGSPDSTDPKDVKKYLGEFLMDGRVIDLPYFFRALL
FT                   VKGIILNTRPKKSAEAYQKIWWEEGSPLIVLSERLQGKVDETTSVPIALAMRYGTPSIY
FT                   DGLKELKEQGVDEVLLFPLYPQFAMATTETILVLAEELRQKHFPEMKFTSVPAFYNHPD
FT                   YIRVLGNSIQERLQNLDFEHLLFSYHGVPERHIRKSDITNSHCKIDGSCCQTASSAHQF
FT                   CYRHQCYETTRLVAEYLNLKEGTYSVSFQSRLGFDPWLKPYTDRTIERFGKQGIKKMAI
FT                   VTPAFVSDCLETLEEIAMEGEEIFHEVGGKEFTVVPCLNDREDWVKMLSRWVDEWAHQK
FT                   PVEA"
FT   gene            115152..116501
FT                   /locus_tag="ZPR_0117"
FT   CDS_pept        115152..116501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0117"
FT                   /product="C-5 cytosine-specific DNA methylase:Multi
FT                   antimicrobial extrusion (MatE) protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50480"
FT                   /db_xref="GOA:D5BBP6"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBP6"
FT                   /protein_id="ADF50480.1"
FT                   /translation="MAKVSSEALGNESIGKLLIRQALPASVGILVMSLNILVDTIFVGN
FT                   WIGSTAIAAINVVLPISFFIAALGMSIGIGGSSIISRALGADNHKKALKTFGNQITLTL
FT                   LLCVTLVILGLVFINELIPAFGGKGDIFEPAKIYYRIVLYGVPILALNMMGNNVIRAEG
FT                   KPTFAMVSMIIPSVGNIIGDYLFINVMDLGMYGAAWATTGSYMLCFLYIFWFFVFSGHS
FT                   ELKIDFSHFRLDLPILQEIGSLGFVTLARQAVVSVIYLLMNNILFDLAGEDGVAVYAII
FT                   GRMLMFALFPVLGITQGFLPIAGYNYGAEKYKRVQSTINKAILYACLMGCVVFGLIMGF
FT                   SKEIAMVFTQNEAIIERTPGAMRWVFAATPIVALQLIGAAYFQAIGKAVPALLLTLSRQ
FT                   GFFFIPLILILPNYYGEIGVWISFPIADVLSTMVTGYFLNREIRKNLKQD"
FT   gene            116539..117087
FT                   /locus_tag="ZPR_0118"
FT   CDS_pept        116539..117087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0118"
FT                   /product="membrane protein, UPF0093"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50481"
FT                   /db_xref="GOA:D5BBP7"
FT                   /db_xref="InterPro:IPR005265"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBP7"
FT                   /protein_id="ADF50481.1"
FT                   /translation="MEYYNYIKSLHLIFVITWFAGLFYIPRLFVYQIEAFDKPEPDKSI
FT                   LGNQLKLMAKRLWFIITWPSAILATLFAIILLIMQPVWLQQGWMHVKLGFVILLIAYHL
FT                   KTHHIFKQLQVDKVKYTSGQMRLWNEGSTLILFSVIFLVIVRNALDWIYGVIGIFALGI
FT                   LLMLGIKLYKKIRARNPDA"
FT   gene            117187..118641
FT                   /locus_tag="ZPR_0119"
FT   CDS_pept        117187..118641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0119"
FT                   /product="two-component system sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50482"
FT                   /db_xref="GOA:D5BBP8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBP8"
FT                   /protein_id="ADF50482.1"
FT                   /translation="MKLLKLSLRTRIFISMILLVLGASILIAGVTIYQYKQEAEAYHRE
FT                   RLERKEQAIRENINFVLASTTYMVNTENIPSIFKQNQKIYEMSQVHEMQINIYDLEGKL
FT                   LISSKENFFKDTTDYQIDKPILAKLDASSNRRYLMKGETNGEKFQSSYTYITDQRFKPL
FT                   AILYLPYLQDDSVLNRDLNDFLMRLGEVYLFMLALAIILSYFLSKYITKSLKIISEKIN
FT                   QTRLDKRNQKIELSNASEEIYALISAYNSMIDELEESAVKLATGEREQAWREMAKQVAH
FT                   EIKNPLTPMRLSVQSFERRFDRNDPEIEHKVNEFCDTLINQIDTMSSIASAFSNFAKMP
FT                   AQQNETLNVPKITKLALDIFNENYIIFNSEKEEILAKFDRTQLIRVVTNLVKNAIQAMD
FT                   NTKDPKIVVSIDEEPDNVCISICDNGHGISAENREKIFEPKFTTKNSGMGLGLAMVKNI
FT                   VETYKGSINFTSKPGKGTIFKVRFPK"
FT   gene            118704..119486
FT                   /locus_tag="ZPR_0120"
FT   CDS_pept        118704..119486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0120"
FT                   /product="3-hydroxybutyryl-CoA dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50483"
FT                   /db_xref="GOA:D5BBP9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBP9"
FT                   /protein_id="ADF50483.1"
FT                   /translation="MSYQNILVEEENEILYITIDRPSKLNALNRDTIQELHEAFSEAKD
FT                   DNEVKVIILTGSGEKAFVAGADISEFADFSPEEGKQLAAEGHAKLFDFVANFPKPVIAA
FT                   VNGFALGGGLELAMAAHFRVASENAKMGLPEVSLGVIPGYGGTQRLSQIVGKGRAMEMI
FT                   MTAGMIDANQALQYNLVNHVTTQEELLEFTEKLAGKILNNSLVAIEGAIKAINASYEKG
FT                   VNGFEVEMNEFGKAFGTEDFKEGTSAFLNKRKAEFPGK"
FT   gene            119577..120653
FT                   /locus_tag="ZPR_0121"
FT   CDS_pept        119577..120653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0121"
FT                   /product="radical SAM superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50484"
FT                   /db_xref="GOA:D5BBQ0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBQ0"
FT                   /protein_id="ADF50484.1"
FT                   /translation="MSKSQEYIKGRGAQSNVANRFDANTHEFRDDFLNYCAAEGDDFQE
FT                   SKTVTIDTFPKTIVNKVESPDVGMAYSLNPYQGCEHGCIYCYARNSHEYWGFSPGLDFE
FT                   QKILVKRNAVELLEKKLRSKKWQARPIVMSGNTDCYQPVEKQLEITRKLLQTFLKYRHP
FT                   VGIITKNALVLRDLDILEELHNDRLVHVNISITSLQEETRRILEPRTASIKKRLETVEK
FT                   LSAKGIPVNVMMAPIIPSVNSHEIMPLVKEIANRGALSVGYTIVRLNGAIGGIFTDWIK
FT                   KTMPNRADKVLHQIENIHGGSLNDSRFGTRMKGEGEFADQVKQQFKIARNLYLKDRQRR
FT                   VVNCNLHEEYKDGQMKLF"
FT   gene            120917..122023
FT                   /locus_tag="ZPR_0122"
FT   CDS_pept        120917..122023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0122"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50485"
FT                   /db_xref="GOA:D5BBQ1"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBQ1"
FT                   /protein_id="ADF50485.1"
FT                   /translation="MNNTDPVYIRPTGSGDTLFDFVRCLLVGIFSLALATLIFLIFRSK
FT                   LNYRKLVYIGGQYVRYYLIFVLLTYGTIKIFKLQFGEPYLIRLVTPLGEMSPMGLAWNY
FT                   MGFSKTYTVFAGWSETIAAILLMFKRTRTLGAVVGFGVMLNVFMMNISYDIPVKLFSLH
FT                   LCVFSAFLILIDGRRMLNVFVLNRDVSKYKFVSPFSKKWKNYTLQIVKFLVLILIVYLN
FT                   LINAMRSQYLYGDLGPKHKLYGIYELNEFALNHTKRPALLNDSVRFRRLIFDSPNRVYI
FT                   QKMNNEGIYYQTETDTIAQKIYLKEQDSTKVGVLHYKNEAESDADVFEFEGIFKNDSVY
FT                   FKTERKGREDFLLNNRGFHWISEYPFNR"
FT   gene            122507..123298
FT                   /locus_tag="ZPR_0123"
FT   CDS_pept        122507..123298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0123"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50486"
FT                   /db_xref="GOA:D5BBQ2"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBQ2"
FT                   /protein_id="ADF50486.1"
FT                   /translation="MPELPEVAYQKKYADATILHKKIVEIETGDKKIYQSAKADFEKIL
FT                   TDNAFESTSRIGKYLFLKLKKNGVLVMHFGMTGKLDYYQHDDTPKYTQLKLIFEDHSKL
FT                   AFTCPRKFAKLYLAKSVEEFQQSHNLGADALAITEKEFLKICDGRSGTIKGLLMNQSLI
FT                   AGIGNMYADEVLFQTKIHPKTKVNTLSQKQLKSIFDKIEEVLKVVKEARIEGKRVPESY
FT                   LTRIRKEGEGADCPRNNGKIEQTKVSGRTTYFCPVCQKEIQ"
FT   gene            123540..125702
FT                   /locus_tag="ZPR_0124"
FT   CDS_pept        123540..125702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0124"
FT                   /product="secreted prolyl oligopeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50487"
FT                   /db_xref="GOA:D5BBQ3"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBQ3"
FT                   /protein_id="ADF50487.1"
FT                   /translation="MQLELIFNITPSEDGYTATLDVPAQGASGIELDSVILQDDTVTIR
FT                   SAKMQMTYTGKITGDSIEGTYKQRVQEYPLKLNKTVKKKPGNTALPSSEEELKKLAAKE
FT                   TGGYNYSVEDYFRTPQTFAFQLSPNGDHIAYMKRRDSGERDLYLMDTETKKESLLKKQE
FT                   QDLIRGFSWANDERILYLQDKGGDENYHVYGVDINGANDKELTPFEGVRVNIIESLKED
FT                   KEHIIIQMNKDNPQQEEPYRLNINSGEITKLYTVKEGEPPVAGYDFDREGNLRAISRIV
FT                   DGVNTELLYKIDGEFKLVKLTEFGDEFGISSFNPGSANPDDAYVISNLEGDKIEIQLYD
FT                   LKKNKKINTVFSNDTYDVSGMALSKKRNYEIDYFSYTGEKTQIIPVSDTYKKIYNRLKQ
FT                   EFGDKQFFTVGRTDDESKYMIAVTSDKIVGEYYLYDVEADEVSLLYKLLPHLKEEDMAS
FT                   MKPITFKSRDGLTLHGYITLPHNYQEGMQVPLVVNPHGGPQGIRDSWGFNPEAQLFASR
FT                   GYATLHVNFRISGGYGKEFLKAGFGEIGRKAMDDVEDGVDYVIEQGWVDKDRIAIYGGS
FT                   HGGYAVLRGMTKTPEKYACGVDYVGVSNLNTFMETIPPYWEKYRELLYKIWYNPGIPEE
FT                   KKIMDEISPALHVDEIKNPLFVVQGANDPRVNINEADQIVETLRSKGVEVPYMVKYDEG
FT                   HGFAKEENRLDLYKAMMGFFAEHLKN"
FT   gene            complement(126200..126856)
FT                   /locus_tag="ZPR_0125"
FT   CDS_pept        complement(126200..126856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0125"
FT                   /product="HD domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50488"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBQ4"
FT                   /protein_id="ADF50488.1"
FT                   /translation="MTNKDLIIENTIQFVKDTLKNAEGGHDWFHIERVLNNAKLIAKTE
FT                   EANDFIIQLGALLHDIADSKFHNGDETVGPKVATEFLQSQQVNADVIEHVVKIIQNISF
FT                   KGGNVEQQFHSTELDIVQDADRLDALGAIGIARTFNYGGFKGRPLYDPEIAPKLNMTKE
FT                   EYKASNTPTINHFYEKLLLLKDRMNTKTGTEIAQKRHQYMESFLDQFYAEWNGEA"
FT   gene            complement(126860..127492)
FT                   /locus_tag="ZPR_0126"
FT   CDS_pept        complement(126860..127492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0126"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50489"
FT                   /db_xref="GOA:D5BBQ5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBQ5"
FT                   /protein_id="ADF50489.1"
FT                   /translation="MGGYSAHKKSVDIFNFFLLRCLNILGTRFVVENKHNIPVERPCIF
FT                   VANHQGVYDIPPIIWYLRKHHPKFVSKKELGKGIPSISFNLRHGGSVLIDRKNRRESLL
FT                   KMAKFAKYLKETNRSAVIFPEGTRSRDGQPKKFAASGMQMLFKQMPHALVVPITINNCW
FT                   QLLKDGSFPLTIGVKLRMKVHKPIEIDSTDPESLVALVERTIIADIR"
FT   gene            complement(127751..128161)
FT                   /locus_tag="ZPR_0127"
FT   CDS_pept        complement(127751..128161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50490"
FT                   /db_xref="InterPro:IPR009474"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBQ6"
FT                   /protein_id="ADF50490.1"
FT                   /translation="MYPADLVKPMREDLTSIGFEELHTVEDVEAAMKKEGTTLVVVNSV
FT                   CGCAAANARPGARMSLQNAKTPDNLYTVFAGVDREATDVARGFMVPFPPSSPSMALFKD
FT                   GELVHMLERHHIEGRPAEMIAENLTGAYDEFC"
FT   gene            complement(128193..128396)
FT                   /locus_tag="ZPR_0129"
FT   CDS_pept        complement(128193..128396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50491"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBQ7"
FT                   /protein_id="ADF50491.1"
FT                   /translation="MAPGYRMYIKPKTAKSHFIIDRNFLAKITFTKLTAFIVRAAIYAR
FT                   QLYKKLGLTADFHEAELNLISL"
FT   gene            128371..129078
FT                   /locus_tag="ZPR_0128"
FT   CDS_pept        128371..129078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0128"
FT                   /product="DnaJ domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50492"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D5BBQ8"
FT                   /protein_id="ADF50492.1"
FT                   /translation="MYMRYPGAIIGFIIGTLLDNWNRSSGGFLQSMMAGKQASSVSPGD
FT                   FELNLLSLCALVIKADGKVSQTELDYVRSYFVRAYGKERANATFRTFNDVIKNRELSAS
FT                   RISQYLASRTQYPTRLQITHFLFGIAQADGSVSTSEANMIQQIASYLKIGAKDFESIKA
FT                   MFLKQTPESAYKILEIDKSASDADVKKAYRKMVKKYHPDKLEHMDEAYKKGAREKFDKV
FT                   QEAYETIQKERGF"
FT   gene            129270..129782
FT                   /locus_tag="ZPR_0130"
FT   CDS_pept        129270..129782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50493"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCI0"
FT                   /protein_id="ADF50493.1"
FT                   /translation="MRATLRFLFLLVFLVGCAGDDEEEIECSLEKNALLDSYYSPQFLI
FT                   RLVDASGENLLENGSIDPEIITIQSASGNSDFVYIPEIENTATNTIASEIQYSLGVFMA
FT                   GGKETYKYQISVEGFETTDLVIRAEQIEEPCYSYIIPISASINGEVLAQIEVSETELLV
FT                   ILPLVAQ"
FT   gene            complement(129798..130289)
FT                   /locus_tag="ZPR_0131"
FT   CDS_pept        complement(129798..130289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0131"
FT                   /product="thioredoxin-like subdomain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50494"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCI1"
FT                   /protein_id="ADF50494.1"
FT                   /translation="MAKKMIKNLQIFILFLALPILSYSQKVNTINWLNFEQLEDSLARK
FT                   PKKTFIYFYADWCVYCKKMEQNAFKNAEIIEKLNSDFYAVKMNAESTDTINFEGQKFYN
FT                   QQAESMRNGIHQIPLLLASRENFEFSLPVILILDEKFRVKNREFEYLTTKKMMELISIH
FT                   "
FT   gene            complement(130316..131077)
FT                   /locus_tag="ZPR_0132"
FT   CDS_pept        complement(130316..131077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0132"
FT                   /product="metallophosphoesterase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50495"
FT                   /db_xref="GOA:D5BCI2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCI2"
FT                   /protein_id="ADF50495.1"
FT                   /translation="MIIPEGKKVYFSSDNHLGAPTKEASKPREAIFVKWLDEIKEDAAA
FT                   IFLLGDLFDFWFEYKHAVPKGFVRVLGKLAELKDSGIPIYFFIGNHDLWMENYFEEELN
FT                   IPTYRKAQEFEFNGKNFLIGHGDGLGPGDYGYKRMKKVFTNPFAKWLYRWLHPDIGIPL
FT                   AQYFSVKNKLISGDEDAEFLGEDNEWLIQYCRRKLETKHYDYFLFGHRHLPMEIKLKED
FT                   SKYINTGDWITHYTYAEFDGNDLQLKKLKDK"
FT   gene            complement(131127..131504)
FT                   /locus_tag="ZPR_0133"
FT   CDS_pept        complement(131127..131504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0133"
FT                   /product="rhodanese-like domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50496"
FT                   /db_xref="GOA:D5BCI3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCI3"
FT                   /protein_id="ADF50496.1"
FT                   /translation="MNPIIPAIVIVILLGSYFVLKNYNNRKRDQSLKGKNISQFQILDV
FT                   RTPREFKQGHIKNAINFPLGIINSDSLKKLNKELNYITYCAHGIRSVKASKILKENGFK
FT                   VTNGGSIKDLQKLIAYSENRN"
FT   gene            complement(131553..132002)
FT                   /locus_tag="ZPR_0135"
FT   CDS_pept        complement(131553..132002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0135"
FT                   /product="6-pyruvoyl tetrahydropterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50497"
FT                   /db_xref="GOA:D5BCI4"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCI4"
FT                   /protein_id="ADF50497.1"
FT                   /translation="MAKIRITKQFSFETGHALYGYDGKCRNVHGHSYKLSVTVIGEPIT
FT                   DTENVKYGMVIDFGDLKKIVKSEIVDQFDHATVFNQNTPHIELAKELKNRGHHVILVDY
FT                   QPTSENMVIDFAEKIKKHLPDHIQLHSLKLQETESSFAEWYAIDN"
FT   gene            131976..132191
FT                   /locus_tag="ZPR_0134"
FT   CDS_pept        131976..132191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0134"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50498"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCI5"
FT                   /protein_id="ADF50498.1"
FT                   /translation="MFGNPDFCHTEILSLPCVIIFPVKFKLKLYKIDSGFFREYLKAKV
FT                   LKVYPILKIIASAFFYPGKFELTLKM"
FT   gene            132470..132673
FT                   /locus_tag="ZPR_0136"
FT   CDS_pept        132470..132673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0136"
FT                   /product="thiamine biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50499"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCI6"
FT                   /protein_id="ADF50499.1"
FT                   /translation="MITVNVNNQNHSFKEPVKLDELLEQLNIQPLGIAIAINNEIISKP
FT                   QWEHTLLEEGNNVLVIRATQGG"
FT   gene            132725..134581
FT                   /locus_tag="ZPR_0137"
FT   CDS_pept        132725..134581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0137"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50500"
FT                   /db_xref="GOA:D5BCI7"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCI7"
FT                   /protein_id="ADF50500.1"
FT                   /translation="MKPNQLPRGEAISRTPFPNSEKIYVRGQLHENVNVPMRKINLDDT
FT                   VDKFNGIRTPNEPVLVYDTSGAYTDPNVEIDVRRGLKPIRQQWIAAREDVQQLSRLSSE
FT                   YGRQREENKKLEKLRFQRIRKPLKAKPGQNVTQMHYARKGIITPEMEFIAIRENQKLQE
FT                   INQITQQHPGESFGASIPKVITPEFVRDEVAKGRAIIPSNINHPESEPMIVGRNFLVKI
FT                   NANIGNSAVSSSIEEEVEKAVWACRWGADTIMDLSTGKNIHETREWILRNSPVPIGTVP
FT                   IYQALEKVNGKAENLTWEIFRDTLIEQAEQGVDYFTIHAGVRLKYIPHTAKRLTGIVSR
FT                   GGSIMAKWCLAHHQESFLYTHFEDICEIMKAYDVAFSLGDGLRPGCIADANDYAQFAEL
FT                   ETLGELTKIAWKHDVQCFIEGPGHIPMHMIKENMDKQLAECGEAPFYTLGPLTTDIAPG
FT                   YDHITSGIGAAMIGWYGCAMLCYVTPKEHLGLPNKEDVKEGVITYKIAAHAADLAKGHP
FT                   GAQHRDDAMSKARFEFRWEDQFNLALDPDTARAYHDETLPSENAKVAHFCSMCGPNFCS
FT                   MKITQDVRNYAKENGLDSEEAIKKGMEEKSEEFKKKGSEVYL"
FT   gene            134665..135261
FT                   /locus_tag="ZPR_0138"
FT   CDS_pept        134665..135261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0138"
FT                   /product="putative thiamine phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50501"
FT                   /db_xref="GOA:D5BCI8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCI8"
FT                   /protein_id="ADF50501.1"
FT                   /translation="MLIVISAEKLIENEESQLKSMFDAGLETLHIRKPEVSFEELKTWL
FT                   ENFEPGYRSKMVLHQHHELAREFGLKGVHLPEYFRTSLKETLEDYVNTFQHLKFTVSTS
FT                   FHQKEEISRTSIFDYCFLSPIFNSISKTGYVGKTFQVLDIQQKVIALGGIDAAKIPLAY
FT                   NMGFYGVAVLGAVWLQEDPIHSFIKIQQQYESVFN"
FT   gene            135269..135916
FT                   /locus_tag="ZPR_0139"
FT   CDS_pept        135269..135916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0139"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50502"
FT                   /db_xref="GOA:D5BCI9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCI9"
FT                   /protein_id="ADF50502.1"
FT                   /translation="MNLPKEISCLHYISQGKDREEHLANITRVLKAGANWIQLRIKEMP
FT                   QKEILKTAILARELCAKYKAKLIVNDHVKVAKTCNADGVHLGQEDTDVLEARKILGKDK
FT                   IIGGTANTLQHCLEHLENGVDYIGLGPLRFTSTKKELSPVLGFSGYQELIEKYSQQENT
FT                   VPIIAIGGIKVNDIEELRKIGLSGVAISSLLTHSKDPKNEIQQILDRFAVRV"
FT   gene            136442..137242
FT                   /locus_tag="ZPR_0140"
FT   CDS_pept        136442..137242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0140"
FT                   /product="thiazole synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50503"
FT                   /db_xref="GOA:D5BCJ0"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCJ0"
FT                   /protein_id="ADF50503.1"
FT                   /translation="MGARAIKKYKMKKLKIADKSFDSRLFTGTGKFSNSGLMREAVLAS
FT                   ESELVTVALKRVEAGNTEDDMISSLAHEKLSLLPNTSGVRDAKEAVFAAQMAREALGTN
FT                   WVKVEIHPDPKYLLPDAIETLKACEELVKLGFVVMPYIHADPVLCKRLEDVGAQCVMPL
FT                   GAPIGTNKGLKTFDFLEIIIEQSNVPVIIDAGIGAPSHAAFAMEMGADAVLVNTAIAVS
FT                   KNPVQMARAFKMAVESGRMAYEAKLAGTGKIAQASSPLTQFLYE"
FT   gene            137235..138341
FT                   /locus_tag="ZPR_0141"
FT   CDS_pept        137235..138341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0141"
FT                   /product="thiamine biosynthesis protein ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50504"
FT                   /db_xref="GOA:D5BCJ1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCJ1"
FT                   /protein_id="ADF50504.1"
FT                   /translation="MSSFKTLLAKYDWDEVLESIQHKNAQDVECALSAVKPDLEDFKAL
FT                   ISPAAKPYLEPMATKSKLITKKRFGNTMQMYAPMYLSNECQNICTYCGFSLTNKIPRRT
FT                   LTDAEILKEAEFLKKKGYQHILLVTGEANRTVGIDYLSNAVRLLTPHFANISIEVQPLD
FT                   LEEYERLVDDGLYATLVYQETYHRETYKIHHPKGKKSNFDYRLETPDRLGKAGIHKIGI
FT                   GALFGLEDWRADSFFTALHLKYLQKTYWKTKYSISFPRLRPFSGGLEPKVEMTDPDLLQ
FT                   LICAYRILDEDVELSISTREQEKFRDHIAHLGITSMSAESKTNPGGYVVEPQSLEQFEI
FT                   SDERSTERIATMLRKNGIEPVWKDWEKF"
FT   gene            138564..138758
FT                   /locus_tag="ZPR_0142"
FT   CDS_pept        138564..138758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50505"
FT                   /db_xref="GOA:D5BCJ2"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCJ2"
FT                   /protein_id="ADF50505.1"
FT                   /translation="MSENKISLNTILTLGFIAIFSVLLAINLIFKDILGDNLTPILMMG
FT                   LGYFVGYYAFRGLRILGNK"
FT   gene            complement(139001..139900)
FT                   /locus_tag="ZPR_0143"
FT   CDS_pept        complement(139001..139900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0143"
FT                   /product="PfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50506"
FT                   /db_xref="GOA:D5BCJ3"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCJ3"
FT                   /protein_id="ADF50506.1"
FT                   /translation="MTQKLKAVSFGEILYDIFPNSEKIGGAPLNVASRLSANGIDTTMI
FT                   SSVGQDEKGKNLLEYLKSRKIDHSLVAKTPDFPTGVVNVELDKNGSASYTIEYPAAWDK
FT                   IDISENMIEKVNTSDAFIFGSLVCRDQKSRETLNELLQYAKFSVFDINLRPPHYKKEVL
FT                   EDLILKADFIKFNDDELYEIAAMFDSPFHSLEQNLSYMAKITNAKTICVTKGSHGAVLF
FT                   TEGKLYYNSGYKIKVADTVGAGDSFLGSLISKLLQQETPQKALNYACAIGALVASQEGA
FT                   NPKFSAEEIEKFMFPDRV"
FT   gene            complement(139902..140666)
FT                   /locus_tag="ZPR_0144"
FT   CDS_pept        complement(139902..140666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0144"
FT                   /product="YflG"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50507"
FT                   /db_xref="GOA:D5BCJ4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCJ4"
FT                   /protein_id="ADF50507.1"
FT                   /translation="MSISTEAELNGMKKISEVVAITLKLMRAFTKPGISTKELDDYGGE
FT                   ILKSYGAKSAPFETYGFPGYTCISVNNEAAHGIPSENKILKEGDLINIDVSAELNGFWA
FT                   DNGGSFIIGKDLNNHQPLVDASKNILQKAISQIKGGVKIADIGYLMETEAKKSGFKVIR
FT                   NLAGHGVGRSLHEKPENILNYRIKSNRERFKKNTTVAIETFIATKSTIAVEQNDGWTLI
FT                   GNKGGYVTQHEHTIMVTDGLPLILTAANEIWN"
FT   gene            complement(140688..142265)
FT                   /locus_tag="ZPR_0145"
FT   CDS_pept        complement(140688..142265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0145"
FT                   /product="glycosyl hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50508"
FT                   /db_xref="GOA:D5BCJ5"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCJ5"
FT                   /protein_id="ADF50508.1"
FT                   /translation="MKILRPAALIAFLLMISCKHDTKDSQTDENKTASIQTDEDFRPAF
FT                   HFSPKENWMNDPNGMFYLNGTYHLFFQYYPEDNKWGPMHWGHATSKDMITWKEQDIALF
FT                   PDEKGYIFSGSAVVDHNNTSGFGDGTTPPVVAMFTYHDAKAAEEGRIDYQSQAIAYSLD
FT                   EGKTWTKYKENPVIKNPELQDFRDPKMNWDEANNQWLMALSAKDRAYFYTSENLKDWKK
FT                   VSEFGENYAAQDGVWECPDFFPMKVENSEETKWVLIQSTNPGGYNGGSATQYFVGNWDG
FT                   KNFTPEADLHGKNIDHPYWLDFGKDNYAGVTWSNIPKEDGRTLFMGWMSNWLYAQEVPT
FT                   ETWRSAMTIARKLTLKKEDDKYIITSTPVKELEKYIGETITKWKVTDEDHAIIDTNELD
FT                   LTKAQVSFLIPKITKDVHLSLSNDSGDHFKFGFKKAENEFYIDRSESGITDFGKEFAST
FT                   ISTGRRISTSDSLQVNMILDNMSIEVFYDDGETVMTEIFFPKQPYTSLKINEGVPVIDI
FT                   EANEFNFN"
FT   gene            142671..142772
FT                   /locus_tag="ZPR_0146"
FT   CDS_pept        142671..142772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0146"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50509"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCJ6"
FT                   /protein_id="ADF50509.1"
FT                   /translation="MAFKKLILEKVYITNHNNFWKVEVLLFCINGLF"
FT   gene            complement(142746..144038)
FT                   /locus_tag="ZPR_0147"
FT   CDS_pept        complement(142746..144038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0147"
FT                   /product="PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50510"
FT                   /db_xref="GOA:D5BCJ7"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCJ7"
FT                   /protein_id="ADF50510.1"
FT                   /translation="MKLSKKKLFKIHSWIGTKLSILFFIVCFSGTMATLSHEMDWLFIS
FT                   EIRAKPQKEFASRNTIISNLKKQYPNAQISYWMRAEEPYLCDIIYTKVDGRQTYVFANP
FT                   YTGKIQGNANLTFQRFFRDLHYFLFMPFYQFGYLVVLSFAFLLLISFLTALCFYKKWWR
FT                   KLFKLETTKGPLVFFRSLHRLVGLWSIPFSILFSATGIWYFIERTNIADVRTAVNPKPP
FT                   KLEYSNANNDSINLTYTIDYDRITQVAQKAIPYFKPEGINIPNTKNEPVYVRGNSDVPL
FT                   VRQRANRVYINPYNYKVVKIQNAKNISNIMWINDIADPLHFGYWGGLTTKIIWFFIGLG
FT                   ISSLILTGIWITLKRKALQRKKKQISILGKWKFVNWGIYILLIISMYIQLVSRYHTSST
FT                   GILVISCGWIVILLLTYYVFVHRLKKAVNTK"
FT   gene            complement(144041..146509)
FT                   /locus_tag="ZPR_0148"
FT   CDS_pept        complement(144041..146509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0148"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50511"
FT                   /db_xref="GOA:D5BCJ8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCJ8"
FT                   /protein_id="ADF50511.1"
FT                   /translation="MKKNYFLYFFLLALFNTAYGQNISIHGKVFSDSGTPIHNANVFVL
FT                   NSSTGAMTNKNGHYELKNLAPGKYTIKASYLGYESINKSITVKEGTKAELDFLLNESAT
FT                   QLQGVEIIGRKERNYKNTTSFIGTKSATPLIDVPQAVSYVTKEVILDQAAFTVNDVVKN
FT                   VSGVNQFSFYNDLTIRGFRVQGQRNSSMLLNGSRMMTSFWSQQIIPHVERVEVIKGPAS
FT                   ALFGNASPGGTINTVTKKPLQTTKQSISASMGSFNTFRLLSDFTGPMSKDKKLLYRLNL
FT                   GYQNTDGFRDLQFNKNIVVAPSFSFIPNEKTRLNLDVVYQDNKGRLDRGQAVFGDGDLY
FT                   STPITTSLSAENDYLNEQNLNVTLSFQHKFNEHISFNSSYMNSGYDEDLLEHRTANNFL
FT                   ALGDGSYDITKVAMRVFNRKRSWNNQNFTNYLNVDFNLGAIENKFLVGYDYFQQELEPG
FT                   GSQLEANAYLLKNGKATNSFSVAKKDNYVLDENGNPVANVAPFDLTSTNGNAMRNMSNY
FT                   VYGIRNYDRYKQTGNGIYLQNQFQYKKFNLLVGLRYDDFTDYLNYETAEEEKISQDKFI
FT                   PRIGMVYKLKPNVNFYGTWVKGYQPQTATTINNPEAGGPFDPLTSELFEAGIKTEWFNK
FT                   RLSATLAVYSLSQKGALYNANDASNSDLLKQIGEEKSEGVEVDIYGQIMPNWSVIMNYA
FT                   YNHAYFTEADESTLATFGNQKPNAPRNTFNFWSKYIIDHGDLNGLGFGLGYDYVGERNG
FT                   SIVRDPELIPVFPSYGLFNAAIYYKVNKFQIQLNINNVFDKTHWVGGYDFLRAFPGRPR
FT                   NIMSTVSYTF"
FT   gene            complement(146900..147169)
FT                   /locus_tag="ZPR_0149"
FT   CDS_pept        complement(146900..147169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50512"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCJ9"
FT                   /protein_id="ADF50512.1"
FT                   /translation="MRYKTNPNWYENELIVDVKEVTEEEAKRRLEEHPDKWKKTEDGIE
FT                   LSDEDALTLIKTSVIIDHWSTLDFQIEDKESFVVGYIKTKSRTE"
FT   gene            147377..147544
FT                   /locus_tag="ZPR_0150"
FT   CDS_pept        147377..147544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50513"
FT                   /db_xref="GOA:D5BCK0"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCK0"
FT                   /protein_id="ADF50513.1"
FT                   /translation="MEDNKKATLKLAWLFAPLPMAIGIGSNCFNILKAVFWKYWDVFQV
FT                   LNVFPAFHFF"
FT   gene            complement(147830..148111)
FT                   /locus_tag="ZPR_0151"
FT   CDS_pept        complement(147830..148111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0151"
FT                   /product="protein containing GIY-YIG catalytic domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50514"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCK1"
FT                   /protein_id="ADF50514.1"
FT                   /translation="MHFVYIIYSQKVDQFYIGETEDIENRLLKHNTGFFKNSFTAKTND
FT                   WKLFFSISCYNRTQAQKIEKHIKKMKSRKYIQNLKKHPNISKKLLLKY"
FT   gene            complement(148156..148232)
FT                   /locus_tag="ZPR_0152"
FT   tRNA            complement(148156..148232)
FT                   /locus_tag="ZPR_0152"
FT                   /product="tRNA-Asn"
FT   gene            complement(148287..148363)
FT                   /locus_tag="ZPR_0153"
FT   tRNA            complement(148287..148363)
FT                   /locus_tag="ZPR_0153"
FT                   /product="tRNA-Asn"
FT   gene            148482..148676
FT                   /locus_tag="ZPR_0154"
FT   CDS_pept        148482..148676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0154"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50515"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCK2"
FT                   /protein_id="ADF50515.1"
FT                   /translation="MSLKIHGLYIYIKNVNIASQPDVDAIVNAANAKLPPGSSMRFTNR
FT                   EINFRKTTNLKIKYSISIL"
FT   gene            148704..148883
FT                   /locus_tag="ZPR_0155"
FT   CDS_pept        148704..148883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50516"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCK3"
FT                   /protein_id="ADF50516.1"
FT                   /translation="MVIPEISTGIFCYSKINAVELVFNTILTEAEGLKHLQRLKFVLFR
FT                   TEDLEFYKNRLAEI"
FT   gene            148958..150367
FT                   /locus_tag="ZPR_0156"
FT   CDS_pept        148958..150367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0156"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50517"
FT                   /db_xref="GOA:D5BCK4"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCK4"
FT                   /protein_id="ADF50517.1"
FT                   /translation="MFDFTATYTDQYQLAMSQVYFKNGKRNTKAVFDYYFRKIPYGSGF
FT                   AIFAGLEDLLEIITNLRFSKEDIQFLKQYDFEDDFLEYLENFKFSGNIYSVQEGDVVFP
FT                   TRPVLQVEANLIEAQIIETILLNLLNFQTLIATKASRMRLVSRERTLLDFGLRRAQGPG
FT                   GYYATRAAMIGGFNGTSNVIAGRDLDIPVSGTMAHSFVQSYDDELTAFREFARGRPKAC
FT                   VLLVDTYDTLKSGVPNAITVAKEMEEQGQKLMAIRLDSGDLAYLGKRARQLLDAAGLEY
FT                   VKIAASNQLDEFVIKSLQEQDAPIDIYGVGTNLVIGKPDAALDGVYKLTFSDGKPRIKI
FT                   SESLIKTTLPHRKQVYRMKDKNGECAGVDVIVMENENDTELSKVFHPSEPYKFLDVSAY
FT                   QKEALLQPVMENGIMKIKKRTLSEIAAYSKSRLAELPLEYKRFNNPHIYKVSISEKLKA
FT                   ERDRLISEHKM"
FT   gene            150374..150976
FT                   /locus_tag="ZPR_0157"
FT   CDS_pept        150374..150976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0157"
FT                   /product="bifunctional pyrazinamidase/nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50518"
FT                   /db_xref="GOA:D5BCK5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCK5"
FT                   /protein_id="ADF50518.1"
FT                   /translation="MKALLLIDVQNDFMPGGALAVPDGDKIVPIINKIQHQFDLVLATQ
FT                   DWHPEGHASFASTHHKNLYEVIDLNGIDQVMWPDHCVQGSRGADFHPKLKLNKIEAIFR
FT                   KGTDPEIDSYSGFYDNAHLKSTGLSGYLKEKGINELYFAGLAGDFCVAFSVKDALAEGF
FT                   AAFLIEDATRAIDAAGFEKAKAEIVEKGGKILYADEV"
FT   gene            151002..151586
FT                   /locus_tag="ZPR_0158"
FT   CDS_pept        151002..151586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50519"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCK6"
FT                   /protein_id="ADF50519.1"
FT                   /translation="MSFFSCKNDTSTKVETEVTSMDPYMAPPDSIPERTSAAALDLKKY
FT                   QLFIDTTKTSVFYQQLDSVITSEVRKHENSIFKLVEIKKYNDQFLLYEPCDGTIPRYYI
FT                   SKGAIDIYGQNENIHFKLKDFMLSAGNQVLFKDERDRSLSLKEVNEKVIRLKYGDSRAV
FT                   YVTKIENIPQFEMMVNNCFGQKIKEFDKFQE"
FT   gene            complement(151627..152385)
FT                   /locus_tag="ZPR_0159"
FT   CDS_pept        complement(151627..152385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0159"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50520"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCK7"
FT                   /protein_id="ADF50520.1"
FT                   /translation="MKRIRIIFLIGFLCISSPYSFGQVLHEIGVTAGPAAITSDYGQRG
FT                   EFRNFYYNTGFGVGFQHYMNFVYTGNNYRTSYFKDFFRVRTEIDYFHSYLNHYGPISYQ
FT                   NNPRGEMLRAMHGETNIFEIGTQLEWHFTQIREFLIFSERFSPYITAGIHAVYYIPDAY
FT                   SDLGPIDNPRVLFPAFQGGLNLDSGFTYNFVFGGGTRYRLGRNSDLVAEIKWQYYGSDY
FT                   IEGLNVQGPQNKSNDWTIWLNFGYIHYLNF"
FT   gene            152587..153930
FT                   /locus_tag="ZPR_0160"
FT   CDS_pept        152587..153930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0160"
FT                   /product="glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50521"
FT                   /db_xref="GOA:D5BCK8"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCK8"
FT                   /protein_id="ADF50521.1"
FT                   /translation="MEKNIQDFLDKVSKRNQNEPEFLQAVHEVAETIIPFIEQNKKYQN
FT                   AKLLERMVEPERVIMFRVSWLDDEGNIQINRGYRVQMNSAIGPYKGGLRFHPSVNLSIL
FT                   KFLAFEQTFKNSLTTLPMGGGKGGSDFDPKGKSDNEVMRFCQSFMLELSKHIGHNTDVP
FT                   AGDIGVGAREVGYMFGQYKRLRNEFTGILTGKGLSYGGSLIRPEATGYGNVYFTQNMLK
FT                   TKGEKLQGKTVVISGSGNVAQYAAEKAIELGAKVVTMSDSGGYIYDEEGIDADKLQFIM
FT                   ELKNEKRGRINEYTQKYTNAKFYADKSPWEVKCDVALPCATQNELEEADAKKLVENGCM
FT                   CVGEGANMPCTPEAVEVFRGAKILFSPGKASNAGGVATSGLEMTQNSLRYNWTSEEVDN
FT                   KLHEIMNDIHEKCVEYGCDEDGYVDYVKGANIAGFVKVADAMLAQGVV"
FT   gene            154017..154736
FT                   /locus_tag="ZPR_0161"
FT   CDS_pept        154017..154736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0161"
FT                   /product="DNA repair protein RecO"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50522"
FT                   /db_xref="GOA:D5BCK9"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCK9"
FT                   /protein_id="ADF50522.1"
FT                   /translation="MIVNSKAIVISALKYGEADLIVNLYSLESGLRTYMLRGILKSKKG
FT                   KFKVSQFQLLTQLEIVASHKNKGTLEYLKDAKVINTYTSLHTNMIKTSLVMFIAEVLKS
FT                   AIREEEANPALYHFLETAFSWLDLHDKTANFHIMFLLKLSGFLGFQPDDLNTEQPFFNL
FT                   LEGTFEPVKTNDYCVEGENLDILRAFLNVNFNDMQRVKLSGEQRADFLRMLLQYYELHI
FT                   EGFRKPKSLTVLNEIFN"
FT   gene            154802..157132
FT                   /locus_tag="ZPR_0162"
FT   CDS_pept        154802..157132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0162"
FT                   /product="TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50523"
FT                   /db_xref="GOA:D5BCL0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCL0"
FT                   /protein_id="ADF50523.1"
FT                   /translation="MLDSATEEPLSNVMIFNAEKTKTSLSNFEGRADISKFDSTEELFF
FT                   QHISHEVLKIKKSAIKNQIVYLQEDQNKLDQVVLSVAKFQLQKDEIPQKIVSIDKEDVL
FT                   LNSPQTSADLLESTGKVFVQKSQLGGGSPMIRGFATNRVLISVDGVRMNTAIFRSGNLQ
FT                   NVINIDPLTIERAEVILGPGSMVYGSDAIGGVMNFYTLKPRFSFGAETSVSGNFYGRYS
FT                   SANNEQTLHADVNLGRRNWAFQTSISYSDFDDLKMGKHGSDSYLRTEYAARENGEDVIL
FT                   KNEDPLIQKPTGYTQLSLLEKVKYMPNETWNFSLGLIYSETSDVPRYDRLYRRRNDQLR
FT                   SAEWYYGPQRWFLGDFKINKKGNGDVYDKAQFTLAYQFFEESRHDRDFGKEILFNTKEN
FT                   VGAYSANLDFEKTFGGSKLFYGVEYVNNQVNSEGYQENINSGSRQQTVSRYPDNSSWQS
FT                   LAAYATYQLQIQEALNFQSGLRYNHILLDAQFEENLYDFPFRDADINTGALTASAGINW
FT                   KQNRFLQWRVNASTAFRAPNIDDVGKIFDSEPGSVVVPNPDLKPEYAYNAEVGVNWTPA
FT                   ENIRFGLTGFYTWLEEAMVRRDFNLNGKTEIDYQGEASNVQAIQNASNAHVYGVEGSVE
FT                   VDFSVALRMASKISFTDGEEELDDGSSAPLRHAAPIFGNTHLIWHKKKLKLDLFAEYNG
FT                   EISYTDLATSEQGKAYLYAIDANGNPYSPSWYTLNLTGQYDLDENWLLSVSLENITDQR
FT                   YRTYSSGIAAAGRNLIISARFRF"
FT   gene            157219..157398
FT                   /locus_tag="ZPR_0163"
FT   CDS_pept        157219..157398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50524"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCL1"
FT                   /protein_id="ADF50524.1"
FT                   /translation="MKKLLILMICVLGALSVNAQVKHVKLARDTSEKPVFIINDQIIAG
FT                   NSILKSIPEEYFLK"
FT   gene            157395..157679
FT                   /locus_tag="ZPR_0164"
FT   CDS_pept        157395..157679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50525"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCL2"
FT                   /protein_id="ADF50525.1"
FT                   /translation="MKVFKYKAIGSKVLFVDQQNPGIVTLEIQKKFGTKSQSEINKFFG
FT                   LDNETDIYVNGYLVEDKSLKLYSSSIAKVEVLEKDHLRLKTAVLNISLN"
FT   gene            157787..158542
FT                   /locus_tag="ZPR_0165"
FT   CDS_pept        157787..158542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50526"
FT                   /db_xref="InterPro:IPR005901"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCL3"
FT                   /protein_id="ADF50526.1"
FT                   /translation="MKRVLLISIIFNLCFCATAQNLKIIYKMDYSAEQKDLSKIENMMV
FT                   RKYRKNEIAALPYVELILLIQGKTSKFYTESIMPFENRDMQSGYNAALVSANGRRVFYK
FT                   ENNAKFIFEDIDGKNYKILANTEKYNSWEITKEYKMILGYKCFKAKMEYKTYDRYMEPL
FT                   WVPVEAWFTPEISVSTGPLDFDGLPGLILEATKDDRITYVVTEIKRREDVIIEIPTAKK
FT                   TITYQEKDTIVKKQLLEIKKRSEMYGTEF"
FT   gene            158648..159370
FT                   /locus_tag="ZPR_0166"
FT   CDS_pept        158648..159370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0166"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50527"
FT                   /db_xref="InterPro:IPR005901"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCL4"
FT                   /protein_id="ADF50527.1"
FT                   /translation="MVFIVFPTYGQINFGEVEYAIVLGELPEPEPEPDKKDVIHRMFEV
FT                   SQQYVERMTAILKFDRSKALFKLKDGMAVDRKPYYNFSKVMVGLDKVYLTEADSNKLVI
FT                   RKEAFNEWYIIKEKTKGTGEWKISSAYKMIDGFKVFKATTTEVTENSKGKFKYEVVAWF
FT                   APEIPFFGYGPVGYGGLPGLILELQINRSYLPMTYKLKSIKFSNKALEIKYLEGKEISR
FT                   EALDALYKKATANIIKSK"
FT   gene            159367..160074
FT                   /locus_tag="ZPR_0167"
FT   CDS_pept        159367..160074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0167"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50528"
FT                   /db_xref="InterPro:IPR005901"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCL5"
FT                   /protein_id="ADF50528.1"
FT                   /translation="MIRILKFWSILLLSFSAFSQKGTICHYKIVDFKEFEIKKPDDETH
FT                   RYAVNTLNQAVEATLKFDFVLQFNDSVSSFQLVNQMDNDANKPGAAAIGHAVIGKGEFY
FT                   QNSKKGIWLKTSETTGKKYTVQDSIDFDWVVTKETKTINGFTCFKAELPENKQIKEVWF
FT                   TPQIPTSFGPLGFGGLPGLIVEVKRGTFVLSLVEISTNQPVNIKKPDFGTLISAEKYSK
FT                   MMDKMRGTIFKKN"
FT   gene            160076..160783
FT                   /locus_tag="ZPR_0168"
FT   CDS_pept        160076..160783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0168"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50529"
FT                   /db_xref="InterPro:IPR005901"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCL6"
FT                   /protein_id="ADF50529.1"
FT                   /translation="MKNVFSLLFMFSVLTGYAQDSGIATYKKEWINLYSESAAGRQDKI
FT                   ANPQKYREYRELEKLQKELTKQLAYKLKFDKNRSFFYLEDLLNIGNEADLALAKGPYQG
FT                   EYYFNRKTDSVIWAIKALGEKFLVNLDKIDWKLEKERKTISGYSCFKASAKIPLESGKL
FT                   QSVVAWYTREIPLNYGPLQYNGLPGLVVQLETGSELYTLTKIQQKKITINVPGKGTSIS
FT                   ESDFFKQFENFKL"
FT   gene            160780..161517
FT                   /locus_tag="ZPR_0169"
FT   CDS_pept        160780..161517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0169"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50530"
FT                   /db_xref="InterPro:IPR005901"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCL7"
FT                   /protein_id="ADF50530.1"
FT                   /translation="MKKCYICLIFLCFTFTVIAQSGIATYKKEWTSFGSEEGMKELKKT
FT                   NSQRYREYSKMKLARDRLAKRLKYELKFDKNEAEFKLPELMSVDDDPYMALATGPSDGI
FT                   YYSNLKTGNSFFFTDSFNNSTYLIEYPPYKWEITNEQRMINGFSCFKAKGTLKTWDGSL
FT                   EVWFAPQLNIPLGPRGVTGLPGLVVQVEYGAELFTLIDIDLEEKPAEIKKPEAAHEVTL
FT                   AEWKEIQAKANNKIKSLIKSDKE"
FT   gene            161529..161930
FT                   /locus_tag="ZPR_0170"
FT   CDS_pept        161529..161930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0170"
FT                   /product="biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50531"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCL8"
FT                   /protein_id="ADF50531.1"
FT                   /translation="MKENLTILICFLGFSMGINAQSSIENNNIFYLNVFINANKTIYVE
FT                   EEKTSFQDVQNQVTKMLRKQPFKLDQQIIFRIFGDKDLDMGYIIDVNAEMRKAIQENIK
FT                   TERYLLETKKLNIDGQNWFQKIDLKALKQ"
FT   gene            161927..162649
FT                   /locus_tag="ZPR_0171"
FT   CDS_pept        161927..162649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0171"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50532"
FT                   /db_xref="InterPro:IPR005901"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCL9"
FT                   /protein_id="ADF50532.1"
FT                   /translation="MKDLRCFLLICFFGFSLNAQSLDVVYGVSTELALTKEQLEKIPAQ
FT                   IRENYKQLFKNLKYIKFRLQINDQESLFKMQESMKNEALSGFAFTRIMAVFSGTYYSNS
FT                   QEDICLNQVNAFGRGFIISSKMSSIKWQLSKEKKSIKGFKVYKATGFEIIKNSAREHEI
FT                   SIIAWYAPEINLAFGPANYVNLPGLILELKRNRNTYTVESIEEKEVIEIEKPSKGKQVT
FT                   QAEFEEIGAKVMKNFGSN"
FT   gene            162817..163467
FT                   /locus_tag="ZPR_0172"
FT   CDS_pept        162817..163467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50533"
FT                   /db_xref="InterPro:IPR005901"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCM0"
FT                   /protein_id="ADF50533.1"
FT                   /translation="MKEQYINPKASDDYKYFQKVMQKEVKEILPHLNFFVLSNRQSFQF
FT                   TFERPMSLDNKPDAFINYATTLVFNGKSIYGNVLEKKSYYIPRVLEKTRMVDQNALNWK
FT                   ITDEKKDILGQECFKAYVIPSESYEDYDKYIPIYAWFAPNLNYQAGPTAYANLPGLILE
FT                   LETNLLKYTAVDLSLTKKKVEVINKENLDILSHKMFVQFYDEWNKNNRPSKFN"
FT   gene            163578..166256
FT                   /locus_tag="ZPR_0173"
FT   CDS_pept        163578..166256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50534"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCM1"
FT                   /protein_id="ADF50534.1"
FT                   /translation="MLRLLFLIGIITAISSLKSDAQTIHSGTVKDSANAPLHGANLIAI
FT                   PDSDDLNMAFSISDEKGRYRLNLEKDSSYVIEISYLGYQKIIDSIIASRDIQKDYTMQA
FT                   SNESLEEVLIKKKMAVVVKEDTTIYRTDVFKTGEERKLREVLNKLPGVEVDREGTITVN
FT                   GKKVDKLMVDGKTFFTGDSKLAVENIPADAVDEVEVLDNYSEIPFLKGLEDSDKMAMNI
FT                   KLSEGKKKFAFGDIEVGGGVEDRYSLHPTLFYYSPKTSVNVIGDFNNTGQKSFSMQDYI
FT                   NFEGGYLSLMDRPNASSIYNDDFAQFLRNEDFTYNKNEFGAFNIAQEITSALDLNAYTI
FT                   ISNNKLETLEEYNITYIDEERGLDEFRETRQNNDLFFTLNKLQLRYRPNADEDLTYDAY
FT                   VKTSSATANGILNSFTPVDSTFINTMAKPDGIDFTQHVNYSKQFSFEHTTTLNVDYKYS
FT                   KNENDKDWLFNEPIFNTIIPFVEEDSLHLFQQVNTTLNQASLDLKHYWVLNNTNHIYPA
FT                   LGVSFSDQRFSTLDEQQLDSGEINSFTEVDFNNDVHYRLVDQYVGFQYKTMFGDLILKP
FT                   GLFYHYYLWQVTQFADEITNETKPVLLPEFESEYKLGGSEKLRLNYSMRSSFANASSYA
FT                   NRYRLSSFNRIYRGNEDLENQLYHRLSLSYYKFSLFKGINYNFFFNYSNRVRSILNTTI
FT                   LEGINQISSPVYTDLPNETYSFRGSFTKRLNDFRLTVDGNASLSSYSRIVNQNTIAYDS
FT                   EHYGYGLRIRTTFDDFPNLDVGYEHDFSAFGSDNFQNRFVQFQPFARLEYDFLNGFILK
FT                   ADYEYNYYQNQENDQVNRFQIGNASLFYNKLDSAWSFEVEVNNMLDANFRRENSFSEFI
FT                   VTDSRIYLQPRTVLLKIAYKL"
FT   gene            complement(166469..167488)
FT                   /locus_tag="ZPR_0174"
FT   CDS_pept        complement(166469..167488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0174"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50535"
FT                   /db_xref="GOA:D5BCM2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCM2"
FT                   /protein_id="ADF50535.1"
FT                   /translation="MKSLLSTKHYKVMKSIYVGIDISKNTLDFCVRSSGVASFHKIGNK
FT                   TKSIRKLLKSIAKIDSKAFIAMENTGYYNYNLYQTLKGFDFNVYVIDPKHIKRSIGLVR
FT                   GKNDKVDAKRIAIFIERNHQDFECWEPCSEAIRSLKILMGQRRSKIKQRKGIKQQMADL
FT                   KDIVFNGSTRKLIKINQKAIKELDRHIHEIETLIRAEIKSDPVLQEQLKRIKTVPGIGD
FT                   VTAWMIAIKTEGFQRLTDPRKLACFAGVVPFEQQSGTSLKTRPRVSKMADMALKSVLQM
FT                   AAMRAVRMQNDLQVYYLRKVEEGKNKMSVLNAVRNKLLHIAMALIKNQTNYKNRLELS"
FT   gene            168333..171758
FT                   /locus_tag="ZPR_0175"
FT   CDS_pept        168333..171758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0175"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50536"
FT                   /db_xref="GOA:D5BCM3"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCM3"
FT                   /protein_id="ADF50536.1"
FT                   /translation="MSTKFPEYKGLDLPKVAEETLKYWKENQIFEKSITSRDGEKPFIF
FT                   FEGPPSANGLPGIHHVMARSIKDIFCRYKTQKGFQVKRKAGWDTHGLPVELGVEKELGI
FT                   TKEDIGTKISVEQYNEACKNAVMRYTDIWNDLTEKMGYWVDMDDPYITYKPKYMETVWY
FT                   LLKQIYNKGLIYKGYTIQPYSPKAGTGLSSHELNQPGTYQDVSDTTVTAMFKTKKETLP
FT                   AGLKEHEEDVFLIAWTTTPWTLPSNTALTVGPKIEYVTVKTYNQYTFEPITIVVAKELA
FT                   LKQFDKKFKQVESEEELKAYKEGDNLPAGKAGKIPFLIGENYKGKDLVGIAYEQLLPYT
FT                   LPFENPENAFRVISGDFVTTEDGTGIVHTAPTFGADDALVAKQATPPVPPMLVKDENDN
FT                   LVPLVDLQGKFRPEMGEFAGKYVKNEYYDDAEVPEKSVDVEIAIKLKEENRAFKVEKYV
FT                   HSYPNCWRTDKPILYYPLDSWFIKVTEVKDRMHELNTGINWKPKSTGEGRFGNWLANAN
FT                   DWNLSRSRYWGIPLPIWRTEDGREEKIIGSVEELKIEITKAVEAGVMDKDIFADFKIGD
FT                   MSEENYANVDLHKNVVDTITLVSDSGKAMKREADLIDVWFDSGSMPYAQWHYPFENKEK
FT                   VEKDWRKADFIAEGVDQTRGWFYTLHAIATMTFDDVAYKNVVSNGLVLDKNGQKMSKRL
FT                   GNAVDPFETLSVYGPDATRWYMISNANPWDNLKFDIEGIGEISRKFFGTLYNTYSFFTL
FT                   YANIDNFTYAEADVKLEERPEIDRWILSELHTLIEKVDKFYADYEPTKATRVISEFVQE
FT                   NLSNWFVRLSRRRFWKGDYQQDKISAYQTLYTCLETVAKLSAPVAPFFMDALYKDLNQT
FT                   TKKENYESVHTALFPVFDEKFVDKSLERKMEKAQTISSLVLSLRKKEMIKVRQPLQRIM
FT                   IPVLDKKQGEEILAVQDLIKSEVNVKEVELIDDASGILVKQIKPNFRVLGPRFGKEMKH
FT                   VVAKINQLQAEDIATIEKEGKIEIEVNGEMIILDASEVEISSQDIEGWLVASSGNITVA
FT                   LDVNISPELKKEGVARELVNRIQNMRKDSGFEVTDTINVQLQKDGIIEDAVADNITYIK
FT                   TETLTAALELAEVVKDGVDVEFDDVTTKLLITKN"
FT   gene            171766..172149
FT                   /locus_tag="ZPR_0176"
FT   CDS_pept        171766..172149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0176"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50537"
FT                   /db_xref="GOA:D5BCM4"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCM4"
FT                   /protein_id="ADF50537.1"
FT                   /translation="MSTEVKERFSDAELAEFKELIQGKIAKAKEQLEIYQNAYKNDGNN
FT                   GTDDTSPTFKAFEEGSETMSKEANSQLAIRQEKFIRDLKNALMRIENKTYGVCRVTGKL
FT                   INKERLKLVPHATLSIEAKNMQR"
FT   gene            172396..173028
FT                   /locus_tag="ZPR_0177"
FT   CDS_pept        172396..173028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0177"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50538"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCM5"
FT                   /protein_id="ADF50538.1"
FT                   /translation="MKIANRYWMFLLCFFTGTVIVVAQKDTQNILNSDFKEVIIDANEV
FT                   FKINIFSEKRKTLKYRSHSEGEYLNDIRLTTSLKNGKLYIETQYPEQLVGGFDKLSAHK
FT                   VFSLEVDLYLPEYKILMISSNSASLIVSGKFESFSANLQRGYCNLKDFEGNATINTYKG
FT                   DIDAEVVSGEVMAKSRHGKVLVDQKLYGMHQIKLTSINGDISVRKTK"
FT   gene            173066..173674
FT                   /locus_tag="ZPR_0178"
FT   CDS_pept        173066..173674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0178"
FT                   /product="lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50539"
FT                   /db_xref="GOA:D5BCM6"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCM6"
FT                   /protein_id="ADF50539.1"
FT                   /translation="MSLKKAGLIIFIVLLIDQVSKIYIKTHFELGDEYKVLDWFRILFV
FT                   ENEGMAWGTKIPGQYGKLALTLFRLVAIFGIGYWLVDSVKKNGSRILITSISLIFAGAF
FT                   GNIIDSVFYGITFNDSYNKVATFLPEGGGYGTLFHGKVVDMLYFPLYEGYLPEWIPFWG
FT                   GKFFTFFEPVFNIADSSISIGVVLLLLFNKRAFPKEEKE"
FT   gene            complement(174901..175029)
FT                   /locus_tag="ZPR_0179"
FT   CDS_pept        complement(174901..175029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0179"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50540"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCM7"
FT                   /protein_id="ADF50540.1"
FT                   /translation="MRKLEYRRYLFYAEFGVLNAEMKIGNQETRSKRKTILFDLKM"
FT   gene            complement(175107..175670)
FT                   /locus_tag="ZPR_0180"
FT   CDS_pept        complement(175107..175670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0180"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50541"
FT                   /db_xref="GOA:D5BCM8"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCM8"
FT                   /protein_id="ADF50541.1"
FT                   /translation="MNKTDLRKKYKALRIDLSPEVIEEYSLKIANNLLQLDVWEGDFYH
FT                   LFLSIAEQKEVDTEFILHILQGKDKNVVIPRTDIEHNNLINYLLTETTKIKKNRWNIPE
FT                   PVDGIEIPSAKIDVVFVPLLAFDKNGHRIGYGKGYYDKFLSNCKPNIIKIGLSFYEAEE
FT                   AFQDVYPSDIPLDYCVTPKKVYRF"
FT   gene            complement(175663..176649)
FT                   /locus_tag="ZPR_0181"
FT   CDS_pept        complement(175663..176649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0181"
FT                   /product="succinylglutamate desuccinylase / aspartoacylase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50542"
FT                   /db_xref="GOA:D5BCM9"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCM9"
FT                   /protein_id="ADF50542.1"
FT                   /translation="MPQITKENVLEILGKKILPGKSATINLNMAKLYTTTSVEVPVIIE
FT                   RSKNPGPVVLITAGIHGDELNGVEIVRQLISKEINKPKCGTTICIPVVNVFGFLNMARE
FT                   FPDGRDLNRMFPGTKNGSLASRFAFQFVQEILPIADFCLDFHTGGASRFNVAQIRVKKG
FT                   DKHSIELANIFKAPFTIVSTTITKSYRETCSKMGIPILLFEGGKSQDSNKEIAKQGVEG
FT                   TMRILDHLNMLKSKFELPDAHAEPILIENTTWMRAKYSGLLHLKIPCGKFVEKGEYIGT
FT                   ITDPYGKFRHKIKSRNQGYIINVNESPIVYQGDAIFHISTASKVIDE"
FT   gene            complement(176658..177530)
FT                   /locus_tag="ZPR_0182"
FT   CDS_pept        complement(176658..177530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0182"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50543"
FT                   /db_xref="GOA:D5BCN0"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCN0"
FT                   /protein_id="ADF50543.1"
FT                   /translation="MNIKILSRNTQLYSTKRLVEAAMKRKHTVEVVDPLKCDIVIERRN
FT                   PNIYFKGDYIKDVDAIIPRIGSSVTFYGTAVVRQFEMMGAFTTTESEALVRSRDKLRSL
FT                   QVLSRAKIGLPKTVFTNYSRDVSGVISQVGGPPLVIKLLEGTQGVGVVLAETKNAAESV
FT                   IEAFNGLQARVIVQEFIKEAKGADIRAFVVDGHVVGAMKRQGKEGEFRSNLHRGGSAEA
FT                   IELSDEEEIAAVKATKAMGLGVAGVDMIQSSRGPLILEVNSSPGLEGIEKATGKDIAKT
FT                   IIRYIEKHA"
FT   gene            complement(177520..177966)
FT                   /locus_tag="ZPR_0183"
FT   CDS_pept        complement(177520..177966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0183"
FT                   /product="protein containg DUF785"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50544"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCN1"
FT                   /protein_id="ADF50544.1"
FT                   /translation="MSESKKRIIGRFDKADFPVLDLEGISVKIDTGAYTSSIHCDEIIE
FT                   KDDVLYCKFLDEEHALYNGKEFIFKDYDIIYVRSSNGMIQKRYQIESKIKLFNKIYKIS
FT                   LSLSSRQEMRFPVLLGRKFLSNKFIVDPQLIDLSFNNQHQTNEH"
FT   gene            178153..179955
FT                   /locus_tag="ZPR_0184"
FT   CDS_pept        178153..179955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0184"
FT                   /product="UvrABC system protein C"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50545"
FT                   /db_xref="GOA:D5BCN2"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCN2"
FT                   /protein_id="ADF50545.1"
FT                   /translation="MEIPALDVQLKTLPDSPGVYQYFDKNGKILYVGKAKNLKKRVTSY
FT                   FTKRHDSHRIGVMVKKIHEIRHIVVSSETDALLLENNLIKKLQPRFNVMLKDDKTYPWI
FT                   CIKNERFPRVFPTRRLIKDGSEYYGPFTSFKTVNTLLDLIKGLYKLRTCNYDLVEDKIR
FT                   DNKYKVCLEYHLGNCKGPCEGYQGEAEYNRNIEHIRQIVKGNFKDSLSQFREQMQEHAE
FT                   NMEFEDAQRIKNKIEVLENYQSRSTVVNPKINNVDVFSVISDEGYGYVNFLQLMHGSII
FT                   RSHTIEMKKKLDETDEELLELGITEIRQRFNSKSPEIYVPFKVDAGDDIKVTVPKLGDK
FT                   RKIVELSERNAKYYRQERFKQMKIVDPDRHVNRVMAQMKEDLRLSVEPRHIECFDNSNI
FT                   QGTNPVAACVVFKNGKPSKKDYRKFNIKTVEGPNDFASMEEVVYRRYKRLLNEGEELPQ
FT                   LIIVDGGKGQLRSGLKALETLGLRGEVAIIGIAKRLEELFYPGDPVPLYLDKKSETLKI
FT                   IQQLRNEAHRFGITFHRNKRSKSALNTELDSIKGIGEKTVVELLKSFRSLKRVKEASEK
FT                   SLADVVGSAKARIVYDYYHPESSE"
FT   gene            179956..182178
FT                   /locus_tag="ZPR_0185"
FT   CDS_pept        179956..182178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0185"
FT                   /product="patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50546"
FT                   /db_xref="GOA:D5BCN3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCN3"
FT                   /protein_id="ADF50546.1"
FT                   /translation="MKKVICILFFCSSLLSFSQEEKLKVGLVLSGGGAKGLAHIGALKA
FT                   IEEAGVHIDYIGGTSMGAIIGGLYASGYSASELDSIVKNTNFNILIQDEIPRKSMTFYE
FT                   KRNTERYALTLPFDHFKLGFPSGLSKGQNIYNLMSGLTVHLDDETDFSKLPIPFFCVAA
FT                   DVETGAEIILDKGSLAKSVAASGAIPSLFSPVKIDGRLLIDGGVVNNYPVEELRRRGAD
FT                   IIIGVDVQDSLLNRKDLKGVFDIFTQVSNFRTINDMKHKIPLTDIYIRPDIARFSIMSF
FT                   EEGSAIIDSGKVAGDKRISALKQLAQKQKSHPEPYHRKIVDTLHLSQIELAGNTNYPRS
FT                   FIMGRLRLQTPGKFSLSQINESIDFLSATGNFDKINYFLTQDNGEDTYTLNLNLDESEN
FT                   KTFLKLALHYDELYRSAALVNLTRKSSIFTNDVTSLDLIVGENVRYNFQYYIDKGYYWS
FT                   IGMKSRFNSFDTPVDYALIQDAINGGDLNVNKIDVDFKDFTNQFYVETLFKQVASLGMG
FT                   AEHKYLKISSETINSEGEDVDVPGTEFENNHYYSAFGYLKYDSFDNKYYPKKGFYFHGD
FT                   FHIYPFSSIDDFNEFSIAKGKIGYVFTPIKNLSVRIFSETGFKIGDSEQQSLDFFLGGY
FT                   GNNLINNMVPFYGYDFLSLGADSYIKSLAEVDVEIFKNNHITLSGNFANVENKLYSSGN
FT                   WLSMPDYSGYALGYGVETFLGPMEVKYSYSPEVKESQWFFSLGFWF"
FT   gene            182178..182321
FT                   /locus_tag="ZPR_0186"
FT   CDS_pept        182178..182321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50547"
FT                   /db_xref="GOA:D5BCN4"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCN4"
FT                   /protein_id="ADF50547.1"
FT                   /translation="MRFKLKYFLISLSIFIIEFLIARFINGGFIRNVLGDYLVVLFSAY
FT                   IF"
FT   gene            182338..182541
FT                   /locus_tag="ZPR_0187"
FT   CDS_pept        182338..182541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50548"
FT                   /db_xref="GOA:D5BCN5"
FT                   /db_xref="InterPro:IPR021257"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCN5"
FT                   /protein_id="ADF50548.1"
FT                   /translation="MAIFVLLLAYFIEFLQYLKILKILGIPRSTFTTMVLGSSFDWGDI
FT                   VAYTLAFLSIIGIAKVFNNKAC"
FT   gene            complement(182882..183892)
FT                   /locus_tag="ZPR_0188"
FT   CDS_pept        complement(182882..183892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0188"
FT                   /product="luciferase-like monooxygenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50549"
FT                   /db_xref="GOA:D5BCN6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCN6"
FT                   /protein_id="ADF50549.1"
FT                   /translation="MSDIKLGILDQSIVRTSSTAGEAVKETIETAILAENLGYHRFWIS
FT                   EHHNSTFIAGSAPEVLMARLGAETSQIRLGSGGVMLPNHSAFKVAENFRMLEALYPGRI
FT                   DLGIGRAPGGDGVSAKLLNPSSTFQEDDYIQQLQQLNHFFRDHALVNNSPVYAIPQIKT
FT                   IPQQWILSSSGGSARIAADLGLNLAVAKFINGSVPPSVVDRYRKHFKPTEDQQEPKALI
FT                   ASFVMCGETEEEANQMRKYIDYILLQFDKGNYQSLPEFEDIRNHQFTSFEKQRLHYNAG
FT                   RIISGTPDRVKEKITNLAKDFEVDEVIISTMSFNKELRLKSFELVAEAFSISSTS"
FT   gene            184094..185263
FT                   /locus_tag="ZPR_0189"
FT   CDS_pept        184094..185263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0189"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50550"
FT                   /db_xref="GOA:D5BCN7"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCN7"
FT                   /protein_id="ADF50550.1"
FT                   /translation="MPFYHKLGKIPHKRHTIFKKPDGSLYYEQVFGTIGFDGMSSISYH
FT                   EQRPTQVKEVRKSYSVKPVISKVNNLKSYRLKGFQVQPTRDYLGSRKVILTNSDVDIIL
FT                   AAPQKSTDNYFYKNADSDELLFIHRGSGKLRTHLGNLDFKYGDYLLIPRGTIYKIDFDT
FT                   EDNRLFIVESRRPIYTPKRYRNWFGQLLEHSPFCERDLRQPYELETNNEKGDFLIKIKK
FT                   QGEIFDTVYATHPFDVVGYDGYNYPYAFSIHDFEPITGRIHQPPPVHQTFETDAFVVCS
FT                   FCPRKYDYHPESIPAPYSHSNIDSDEVLYYVDGDFMSRNDIESGHISLHPAGIPHGPHP
FT                   GAVERSIGKTETEELAVMVDTFKPLQLTEDAMAIADETYYRSWLEDEDK"
FT   gene            185293..186435
FT                   /locus_tag="ZPR_0190"
FT   CDS_pept        185293..186435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0190"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50551"
FT                   /db_xref="GOA:D5BCN8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCN8"
FT                   /protein_id="ADF50551.1"
FT                   /translation="MSKDNSSLQLEKVIPEAEDFLPILGTDFVELYVGNAKQAAYYYQH
FT                   AWGFQPVAYSGLETGRKDSVSYVLQQGKIRIVLTSPLEPSGEINAHIDKHGDGVKFVAL
FT                   WVDDAKKSYEETTKRGAKSYVEPYELEDEYGKVVISGIHTYGETVHLFIERGDYKGPFI
FT                   PGYRTYAPLAKSEETGLKYIDHMVGNVGWNEMNKWCEFYAKVMGFAQMVSFDDNDISTD
FT                   YTALMSKVMSNGNGRIKFPINEPAEGKKKSQIEEYIDFYNGAGVQHIALATDNIIETVT
FT                   ALRNRGVEFLYVPETYYDDLLDRVGDIDEELAPLKELGVLVDRDDEGYLLQIFTKPVLD
FT                   RPTMFFEIIQRKGAQSFGKGNFKALFEAIEREQDLRGTLK"
FT   gene            186732..187508
FT                   /locus_tag="ZPR_0191"
FT   CDS_pept        186732..187508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50552"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCN9"
FT                   /protein_id="ADF50552.1"
FT                   /translation="MTHRLTITILLVFFALTSHQAQNAYDTGEWFKFRIHYGPFNASYA
FT                   TLEVTDDYLNGTPVYHIVGEGKSTGMLHWFFKVNDNYETFIDRKNGKPYKFIRQIDEGG
FT                   HTKDLEIDFDHRSNTAYVHDKKHDKKKTYSTKENIHDMLSAFYYLRSNINEDALQPGHE
FT                   IYLNLFIDDENMDFKVKFLGREVIKTKFGKVNALKFRPYVMAGRVFKEQESLTFWVSDD
FT                   KNKVPLKIEADLAVGSLDADLDAYKGLKYPFRIIID"
FT   gene            187510..188475
FT                   /locus_tag="ZPR_0192"
FT   CDS_pept        187510..188475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0192"
FT                   /product="tryptophan 2,3-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50553"
FT                   /db_xref="GOA:D5BCP0"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCP0"
FT                   /protein_id="ADF50553.1"
FT                   /translation="MEIKPEIAERIELLEEKFRNSGQDMGSYLDGLLYDRYLTYWDYIS
FT                   LDTLLSLQKPETHFPDEEIFLTYHQITELYFKLIIHEQKQVIENPNLTAPYFIEKLNRI
FT                   IRYFRVLINSFDIMIKGMEREQFLKFRMALLPASGFQSAQFRMIEFYSTPVENLVDHKI
FT                   RKNFSLNNSIEELFENIYWKKGGIDLKTGEKTLTLKQFEKRYTPRFLRIANEVKGKTLY
FT                   GRYQALAASEKNNPKLIEALRTFDSSVNVNWLLMHIGAAYRHLDHGKKTVKATGGTNWK
FT                   EFLPPGFQKISFFPELWNEEEHEEWGKEWVNHMFNIENKN"
FT   gene            188479..189711
FT                   /locus_tag="ZPR_0193"
FT   CDS_pept        188479..189711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0193"
FT                   /product="M23 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50554"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCP1"
FT                   /protein_id="ADF50554.1"
FT                   /translation="MKKFSFLFLLLLVFAGCKEETKDKAVAETKKPAPKPIVKEFGFVL
FT                   DDFDVVIDTIERGDNFGYILDNHGVDRGKVFEISEKVKDTFNPARITAGKKYIILKAKD
FT                   SAHTPLHFIYQNNKIDYTVLNIGDSVSAYTSKKPVSVKRREVSGVITSSLSEAMQAQGL
FT                   SNLLVYQLSDIYQWSIDFFKLQKGDQFKMIYHEKYIDDTIFAGIESVEAAVFKHSDRPF
FT                   YAFNYETDSVTGQASFYDEEAKALQSFFLKAPLNYSRISSRYQRRRFHPVQKRWKAHLG
FT                   TDYAAPTGTPIKTTADGVVIASSYTSGNGNYVKVRHNQKYTTQYLHMSKRNVRNGQAVK
FT                   QGDVIGFVGSTGLATGPHVCYRFWVNGKQVDPYRQNLPTAKQIEDGKKDEYFAFIEPLK
FT                   TALDKIPYKNI"
FT   gene            189783..191414
FT                   /locus_tag="ZPR_0194"
FT   CDS_pept        189783..191414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0194"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50555"
FT                   /db_xref="GOA:D5BCP2"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCP2"
FT                   /protein_id="ADF50555.1"
FT                   /translation="MKNINPTKTEAWKKLEAHYNETKDQSLKSLFENDSERAAKFTTKW
FT                   EDFYVDFSKNKITEETKSLLIDLANECGLKEAMDAYFGGEAINKTEGRPVLHTALRASK
FT                   NADIKVDGENVMNEVEEVKAKIKAFSSEVIQGITKGYTGRNFTDIVNIGIGGSDLGPVM
FT                   VTEALEFYKNHLNVHFVSNVDGDHVHETIKDLNPETTLFVIVSKSFTTQETLTNATTIR
FT                   NWFMKTAPEDEVSKHFIAVSSNVAKVKEFGIDENNIFPMWDWVGGRFSLWSAVGLSISL
FT                   AIGYPNFDALLSGAQKMDEHFKETAFENNIPVLAGLLSVWYNNFYKAESEAVIPYSQYL
FT                   HRLPAYLQQAVMESNGKSTDRNGDKVDYQTGAIIWGEPGTNSQHAFFQLIHQGTKLIPA
FT                   DFIGYKVSLFDDKDHHYKLMANFFAQTEALLQGKTEDEVREELSSKGMSEDEIKELLPF
FT                   KLFDGDKPTTSFLIDKLTPESLGKLVAMYEHKIFVQGVIWNIFSYDQWGVELGKQLAST
FT                   ILNDMDSKAIENHDSSTSSLLKVFLG"
FT   gene            191785..194337
FT                   /locus_tag="ZPR_0195"
FT   CDS_pept        191785..194337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0195"
FT                   /product="putative TonB-dependent outer membrane receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50556"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCP3"
FT                   /protein_id="ADF50556.1"
FT                   /translation="MRKLLALALFFATATIFAQGTITGTVIDSEMDGPLPGANVMVVGS
FT                   KTGTTTDFDGNFSLEVKSSTGTLEVSFVGFKTKQVQFSLSGGSQDLGEIVLEADDNALD
FT                   EIVITSFSLAIDRKTPVAVSTVKAETIETKLGNQEFPEILKTTPGVYVTKQGGGFGDAD
FT                   IRMRGFNSENIAVMINGVPVNDMENGRVYWSNWAGLSDVTRTMQTQRGLGAAKVAVPSI
FT                   GGTINIVTKSTDAKKGGSVIASTGNDGLQKFGATVSTGKTENGWAATISASKISGRRFA
FT                   DGLEFEGYNYFVNIAKEINENHELSLTAFGAPQRHGQRETLHPIEDYQRSSRGIKFNSD
FT                   WGYRNGQVVNVQDNFYHKPQISLNHYWTISDKTELSTAAYVSFGTGGGGGYTGNADLRS
FT                   VDSDYRPAPYLPLNLDRVVSENAANGADGSETILYDSRNDHFWTGLLSTVSTEVGEGWD
FT                   LVGGIDLRYYKGRHFQEVKDLLGGQYWADDSNVNDPNRSTKEGDKINYYNDGLVLWEGG
FT                   FAQAEYSNDLVSAFVSLNASNTSYKRIDYFRYADDGPDKETDWINFFSYGAKGGANFNL
FT                   DDNHKVFGNVGYFERAPFFNTVFLNNRNIANDDAENQKIFSAELGYGFRNQNLRVDFNL
FT                   YRTAWKDKTLARSFVQGNQQIFANILGVDALHQGIELEFEYKATDRLNITGMMSLGDWK
FT                   WDNNIDNVDILAEDGTTVLGTINVAIDGVEVGNSAQTTAALGLNYEVFPSTFLRGDFTY
FT                   YDRYFADFDPTVRDSVDLQGPFELPDVGLLDLGLTHKFEFGSFDATINANVFNVLDTEY
FT                   ISDAREGNVKDPDYRGLVDSNVWYGFGRTYSVGAKINF"
FT   gene            194318..196063
FT                   /locus_tag="ZPR_0196"
FT   CDS_pept        194318..196063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0196"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50557"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCP4"
FT                   /protein_id="ADF50557.1"
FT                   /translation="MLKLTSKNLTMKKIYILLLLFIGATLIGCDPMDDIHEQVNDQIDS
FT                   EGALADKSIVLTEDDYGFLGLSFPNFNSEDDARLLIPDLLSERYPYYGKNSSINVIYDI
FT                   YDPIRVKLYEVTSQDYSAIGLEEGYFTSSSQVYEALGEIFPQAESGDYVDLQYRTVAEE
FT                   IPYEINAEDFDLIGEKLGSDYPDAAPSAAQYSNFDRREGRDAYWDNDMILEAINVVLED
FT                   NFEDVTNQIYNVSYAIYDGSAGTESMTVQFNGNEYVAFGGTSYQISASDFDEIGSEFAE
FT                   KFPDPASNAADYSNFDRRDGRDTQWTDAMILEAVDFLLNQQFPNATDGSKFAVTYAVYT
FT                   GSAGTEVINVVKTDGAYVIDSNASTATITTRNVYAYTNGSWGRPFTLDMEDYEAMGQSY
FT                   PNFSNEDQALYRIGIYLGMQYPYAEEGDVTAVAYDLYSSGETSTEYVNYIFEDGEFNVV
FT                   PSTRTASLQFGLNDEGVWVPDNTIRYTLTGNDFATIASALQDKYPDPVSSMLRYNNFDT
FT                   RSDNGAYWSPDMILEATRIVLNNMAPNAEVGQKYVVTYAVYDGSNTTNSISLIKNEAGE
FT                   WVINE"
FT   gene            196185..197837
FT                   /locus_tag="ZPR_0197"
FT   CDS_pept        196185..197837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0197"
FT                   /product="VcbS"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50558"
FT                   /db_xref="GOA:D5BCP5"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCP5"
FT                   /protein_id="ADF50558.1"
FT                   /translation="MKKNFFFAFLLGSFFLGCSSSDEGTPNEPGNPQEENPVAVDDNFS
FT                   TIENVEVTFSGNDILQNDEIVDKARLFSIDIESSEGGTISDNRDGTYTYVPPADFHGED
FT                   TFMYSLCVPGDSDRCSEATVTIQVDKPGPPTANDDTYEVAEDGTLTIRNYGDNDDLVGD
FT                   AMITEVESSSGNATVSIDGENNIIYEPNEGFAGSDTFTYTICNDDENTSCDTATVTIEV
FT                   IDEGNPYAEDDTVIVNTNDAETIFAELLANDNLIDGATLTSIDGSSSEGTVTLNNDGSV
FT                   TYVPSAGFTGEDTFEYSICDDDQPEASCSTATVTVQVVAPIAFNIPADLQDYYDDVTFT
FT                   ENSDFLKLALSNFTVAAHETILAYTDRHDYLYSADADPDTPGNVILMYSGESRSDDEYQ
FT                   TQEPPGDDETFNTEHIYPQSRLSAADAVTDLHHLRSIDIDVNSERSNYPFADGNGEYGL
FT                   VGNNEQWYPGDDWKGDVARMVFYLNIRYGENIETVGNLDLFLKWNREDPVSEFEMQRNN
FT                   VIEAAQGNRNPFIDNPYLVTLIWGGSDAENRWE"
FT   gene            197916..198299
FT                   /locus_tag="ZPR_0198"
FT   CDS_pept        197916..198299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0198"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50559"
FT                   /db_xref="GOA:D5BCP6"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCP6"
FT                   /protein_id="ADF50559.1"
FT                   /translation="MLTIASISAIIGWVSGKEYSAGNFRISLFTLIVSHIQLLIGIVLY
FT                   FVAPYFKMWGEVGMGGVMGDSTLRLYNVEHPLMMIIAIALITIGYSKHKKKLTSTPKFK
FT                   TLAIFYTIALVVLLSRIPWNAWL"
FT   gene            complement(198335..199375)
FT                   /locus_tag="ZPR_0199"
FT   CDS_pept        complement(198335..199375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0199"
FT                   /product="endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50560"
FT                   /db_xref="GOA:D5BCP7"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCP7"
FT                   /protein_id="ADF50560.1"
FT                   /translation="MTTKLLPVLFLLYCGIGFSQDQDTYDVLTIAFYNTENLFDTQNDD
FT                   FTFDDDRTPEGKDAWTKEKYELKLNHIGQVVSEIGTELSGHSPEIIGLCEVENIRVLED
FT                   LLNTEKLQNKNYKIIHFDSPDRRGIDNALLYNTKVFTPTQSRNIEVLIRNEEGKRIYTR
FT                   DILVATGRIQNENFAFLVNHWPSRSGGEKASRNYRKSAALVNRKICDSLWAIDPSLKII
FT                   NMGDFNDDPKNKNVKNVLKTSESPNQFQFYNPMLKLYKKGVGSLAYRDNWNLFDQILIS
FT                   GAMMTKNYEHFQYYKAGVFKKDYLVTSTGQYKGYPFRSYGYNGYLGGYSDHFPVYLYLI
FT                   KKKNPR"
FT   gene            199484..202303
FT                   /locus_tag="ZPR_0200"
FT   CDS_pept        199484..202303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0200"
FT                   /product="TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50561"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCP8"
FT                   /protein_id="ADF50561.1"
FT                   /translation="MKGLVFFWMISMSFGFLQAQERLISGKILNANSQEVIAGVSVSIE
FT                   NHFLKETTDGNGGFTLKFDDLEMGNYILNISKPGFESLRLPVLLDQASLNLGVIRLIPD
FT                   VIEEQSQLGTINLSENQLDDDQIDAGFSSILTAGKDAFLNAAAYDFSQTYFKPRGYDSQ
FT                   YGKVMINSIPLNKIQNGRPQWSNWGGLNDVQRNQDFNFGLTAVDNSFGSLAGTTNFVMR
FT                   ASKYSKGGRLTLSAANRSYRSRIMATYSSGELKNNWFYTLSLSGRFAEEGYIEGTSYKA
FT                   KSAFLSVEKKINKNHSLNVAAIYTPNIRGKSAAITNEVFNLKGRKYNSYWGFQGDEIRN
FT                   SRQRRVEEPILMLNHFWDLSENTKINTNVAYQFGHIGNTRIDYGGTNLVRFNDEVSYEG
FT                   GGQNPDPAYYQNLPSYFLRSEGRENYEAAYKSAAAFRENGQLNWQAIYDANMAETNNGN
FT                   NAVYALTADRYDDHSMYLNAIVDHTINAMFKLNGGINFRHLQSHNYAKIDDLFGANHFL
FT                   DIDFFAEPINDYSLEQVAQSDVQNPNRLVSQGDIYKYNYDLNATSLQAFSQLQFATKNI
FT                   ETYFSANVSSTSYERFGNYQNGLFPDNSLGRSKELNFIDFGLKSGITYHFTGRHSVSSN
FT                   LFFASNPPTLQNSFANPRQNNTVVQDLDSEQMYSVDATYRYRSPNFNFKVSGYFTQFRN
FT                   VTDVSFYYVDGLSGLGRNTTTAFVQEILYDAEKQHLGIEFGAEAQVTSTIKLKSAVALG
FT                   QFIYSNNPNLYLTSNSFAGNVNYGETRLKNYRLANGPQQALQLGFEYRDPNYWWFGFTA
FT                   NYFANAFINVSPLLRTANFATDTDGLPLENYDAQLARKYLKQENLGNYFLLNAIGGKSW
FT                   KLGDYYVGVFISLNNILDQLYKTGGYEQSRNANFTSLQEDRQRETPVFGNRYWYGYGTT
FT                   YFANLYVRF"
FT   gene            202350..203672
FT                   /locus_tag="ZPR_0201"
FT   CDS_pept        202350..203672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0201"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50562"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCP9"
FT                   /protein_id="ADF50562.1"
FT                   /translation="MKTDDYEVPQSQLPENVSTEGTKISLRAVKNSYNEETGEIYTFSG
FT                   DQYFEAYVISSDRAGNFYNELILQDHPENPEAGIQILIDENALYQRYNFGRKVFVKLNG
FT                   LSISKNNGLIQLGKQNRGDLDPIVSSEIDEHLIRSEIVEEIIPLQINIGDFSSDLLSTY
FT                   VQLNHIQFNRNLFSPSNSTFAAEVFDQYDGLRQIEECGSDDTALLSTSTYADFRWLNLP
FT                   ENSGSILGVLGRDFYDDFYIIQVNSSEDLLFKGERCDPEFFSCGTNTTEGETILFEENF
FT                   AEITNENKLDPLGWTNLNVNGGEERFVDATANGNRTIRISAYNTGENPLEAWLITPSID
FT                   LSQSQNEVLSFDIKASYDNGTILQVYLSEDFDGDPKNANWHLLEANIPMGPSSQSGESF
FT                   KNSKIDLSCFTAEVYIGFCYQGRDPSRTTTYDIDNIKVTGE"
FT   gene            203711..204106
FT                   /locus_tag="ZPR_0202"
FT   CDS_pept        203711..204106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0202"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50563"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCQ0"
FT                   /protein_id="ADF50563.1"
FT                   /translation="MKLKLFLIFAVFGICFMSAQDLEGSWKWTSPDGSQQFDIELEKIS
FT                   DKEYRGKHCAIFDNGERIDCASDDTFSIVLLKISEGNFAGTIESSYEQSQGKIRMQYHT
FT                   QEDVLYFNLTKNPPGIFYLPTEAILTR"
FT   gene            complement(204107..204832)
FT                   /locus_tag="ZPR_0203"
FT   CDS_pept        complement(204107..204832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0203"
FT                   /product="membrane or secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50564"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCQ1"
FT                   /protein_id="ADF50564.1"
FT                   /translation="MRIIFSFIALWIFQLTNAQSVEGSWELILENEIPTELTTVRIYQD
FT                   GFFAEGTKQGDYEFKNAKGGIYETEGSSYTEKFEFNSADKEKVGSINNLAIEVSKDTLR
FT                   LKGQDFSQTWLKIGDYQDDLSGVWIITGRQKNGEMQRRETGDRKTIKLLSGTRFQWIAY
FT                   NSATGEFFATGGGSYLPKYGRYIENIEFFSKDDFRVGASLTFDYQILNNEWHHRGKSSA
FT                   GDAIYEIWSPYKTEEIIRD"
FT   gene            204906..205106
FT                   /locus_tag="ZPR_0204"
FT   CDS_pept        204906..205106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50565"
FT                   /db_xref="InterPro:IPR012550"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCQ2"
FT                   /protein_id="ADF50565.1"
FT                   /translation="MAARKNKKELIGDIHTSYSKLREDFEGIPLKLTKAKELAGHAKDT
FT                   RMSVCKLISIKENPGGGVKSL"
FT   gene            complement(205232..206452)
FT                   /locus_tag="ZPR_0205"
FT   CDS_pept        complement(205232..206452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0205"
FT                   /product="HflX-like GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50566"
FT                   /db_xref="GOA:D5BCQ3"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCQ3"
FT                   /protein_id="ADF50566.1"
FT                   /translation="MIEKTDLSYEKAVLIGIITKDQNEDKLEEYLDELEFLTYTAGGEV
FT                   AKRFSQKMDFPNPKTFIGSGKMEEVRIYVSENEIGTAIFDDELSPAQQKNIEKILKCKV
FT                   LDRTNLILDIFAQRAQTSYARTQVELAQYEYLLPRLAGMWTHLERQRGGIGMRGPGETE
FT                   IETDRRIVRDKISLLKKKLATIDKQMEVQRGNRGQLVRVALVGYTNVGKSTLMNTISKS
FT                   EVFAENKLFATLDTTVRKVVIRNLPFLLTDTVGFIRKLPTQLVESFKSTLDEVREADLL
FT                   LHVVDISHPNFEEHIDSVNQILDEIKSSDKPSVMVFNKIDQYVPEEIAEDDLMTERTTA
FT                   HYTLTEWKQTWMNRLGDNVLFISALEKENMEHFRKKVYEAVRKIHITRFPYNNFLYPEY
FT                   DKYGEEK"
FT   gene            complement(206573..207469)
FT                   /locus_tag="ZPR_0206"
FT   CDS_pept        complement(206573..207469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0206"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50567"
FT                   /db_xref="InterPro:IPR021428"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCQ4"
FT                   /protein_id="ADF50567.1"
FT                   /translation="MKKILLSLLIFGGVLNAQAQDSDSDEQKEGWTTEGNIQLLFNQSA
FT                   FNAEWTGGGTSNIAGNLIFNYDFNYLKDDFTWDSKILVDYGLTKQKGDEFPRKTSDRLE
FT                   FNSVAGKQVEDSNWFYSFFTNFRTQVTKGYTFSKDAETGETIRTERTSFFSPAYLQFGP
FT                   GMLWKKSENFYVNIAPATARFIFVDSDFTSVEGYQDGDYFGVDKGSSSRFELGASVSAY
FT                   AKFDIIENVKMENILNLYSNYLEDPQNVDIDYTMNVKMKINDLLSTNFIFQTIYDDNAV
FT                   GAFQVREVFGLGFNYSF"
FT   gene            complement(207490..208005)
FT                   /locus_tag="ZPR_0207"
FT   CDS_pept        complement(207490..208005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0207"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50568"
FT                   /db_xref="InterPro:IPR018914"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCQ5"
FT                   /protein_id="ADF50568.1"
FT                   /translation="MATEEIINRVANSKLVTFNLEDYYPKGQRVTFDISSWLLEGFVLR
FT                   ESAFREEAKNYDWSQYQDCYVALYCSTEAIIPAWAYMLIATYLQPYAKKTVNGSLEDLE
FT                   SILYTEVIQQMDLSALADKPVIIKGCANKPVPKNAYLLLINKLQPIVKSIMYGEACSSV
FT                   PLYKKPKN"
FT   gene            complement(208015..208338)
FT                   /locus_tag="ZPR_0208"
FT   CDS_pept        complement(208015..208338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50569"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCQ6"
FT                   /protein_id="ADF50569.1"
FT                   /translation="MEQEIDTQELGEKIVKVLKTIYDPEIPVDIYELGLIYDVMVSTDY
FT                   DVKILMTLTTPNCPVAESLPREVEEKVKSLDEVEDCEVEITFDPPWSQDLMSEGAKLEL
FT                   GLL"
FT   gene            complement(208340..208768)
FT                   /locus_tag="ZPR_0209"
FT   CDS_pept        complement(208340..208768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0209"
FT                   /product="protein containing fe-S metabolism associated
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50570"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCQ7"
FT                   /protein_id="ADF50570.1"
FT                   /translation="MSKSIREIQEEIIDEFSMFEDWMQRYEYMIELGKSLPLIDEKYKI
FT                   EENLIKGCQSKVWVHAELNGEKLEFTADSDAIITKGIVAILIRAFSGHHPSDILEADTQ
FT                   FIDEIGLKEHLSPTRANGLVSMIKQLKMYAIAYQTQLK"
FT   gene            complement(208761..209210)
FT                   /locus_tag="ZPR_0210"
FT   CDS_pept        complement(208761..209210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0210"
FT                   /product="protein containing META domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50571"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCQ8"
FT                   /protein_id="ADF50571.1"
FT                   /translation="MAILAIFSSILLSACKQEHQPKETPNISQTERKTLNNSEISGKYS
FT                   VKTLNNNTENLGNLIFDFNSEEKRLAITTDCNNITAEYEIGKNKLQFSNAISTRKFCQG
FT                   AMDNENTISKVLPKIEKFSFSEKELKLLSNDNKVLISLIKTEKSE"
FT   gene            complement(209215..210453)
FT                   /locus_tag="ZPR_0211"
FT   CDS_pept        complement(209215..210453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0211"
FT                   /product="cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50572"
FT                   /db_xref="GOA:D5BCQ9"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCQ9"
FT                   /protein_id="ADF50572.1"
FT                   /translation="MSTATEALAYNVEKTRKDFPILKREINGYPLVYFDNAATSQTPQQ
FT                   VIDVIVDYYSNYNANIHRGVHALSQEATDKYEQARKKIQEHFNAKKTHEIIFTSGTTHG
FT                   INLVANGFASLLHKGDEIIVSALEHHSNIVPWQILAEKTGAVLKVIPMNQEGELIYPAF
FT                   EELLSEKTKLVFVNHVSNALGTVNPIKKIIDKAHQYDAAVLVDGAQAAPHIKADVQALD
FT                   VDFYVVSAHKMCGPTGVGMLYGKEEWLTKLPPYQGGGEMIATVTFEKTTYADLPHKFEA
FT                   GTPNICGGIAFGAALDYINTIGIEKIAAYEEELLHYATKKLLEIDGMEIYGVSKEKTAV
FT                   ISFNINGMHPYDIGTILDKLGIAVRTGHHCAQPIMDFYKIPGTVRASFSFYNTKEEIDV
FT                   FIKAVVKAKTMLT"
FT   gene            complement(210502..211815)
FT                   /locus_tag="ZPR_0212"
FT   CDS_pept        complement(210502..211815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0212"
FT                   /product="FeS assembly protein SufD"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50573"
FT                   /db_xref="GOA:D5BCR0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCR0"
FT                   /protein_id="ADF50573.1"
FT                   /translation="MELKDKLVSSFLAFDEQYQVGDDVHQIRSQAIKDFETIGFPSKKE
FT                   EAWKYTSLKSTLKHDYSIFPKEENAIEYSQIKKYLIHDIDTYDLVFIDGIYSSHLSNTT
FT                   HDKIDVCLMSSALNKDKFKPVIDNYFNKLAPKNGLNALNTAFTKEGAYIHIHKNIMADK
FT                   PIQIINFSTGNESSLLLQPRNLIVVDENSHVQIIEKHQSLTSHPVLTNSVTEIFADRRA
FT                   IVDYYKIQNDKETSSLIDNTFIEQKDESNCSVHTFSFGGNLTRNNLNFYQKGERIDSTM
FT                   KGVTIIEGKQHVDHNTLVHHIYPNCESHQDYKGIFSDKSVGVFNGKVVVEKEAQKTNAY
FT                   QANNNILVDDKATINSKPQLEIFADDVRCSHGCTIGQLDEEALFYLQSRGIPRKEARGL
FT                   LMYAFANNVLESVKIPEIKKRINNLIAEKLGVELGFNL"
FT   gene            complement(211892..212644)
FT                   /locus_tag="ZPR_0213"
FT   CDS_pept        complement(211892..212644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0213"
FT                   /product="FeS assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50574"
FT                   /db_xref="GOA:D5BCR1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCR1"
FT                   /protein_id="ADF50574.1"
FT                   /translation="MLKIKNLHASIEGKEILKGIDLEINPGEVHAIMGPNGSGKSTLSS
FT                   VIAGREEYEMTDGEIIFENEDLAELDPEERAHKGIFLSFQYPVEIPGVSVTNFMKTAIN
FT                   AHRKANGLDDMPANEMLKLIREKSELLEIDRKFLSRSLNEGFSGGEKKRNEIFQMAMLE
FT                   PKLSILDETDSGLDIDALRIVSNGVNKLRTENNAVLVITHYQRLLNYIVPDVVHVLIDG
FT                   KIVKTGGKELAYELEERGYDWIKQEKAV"
FT   gene            complement(212687..213076)
FT                   /locus_tag="ZPR_0214"
FT   CDS_pept        complement(212687..213076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50575"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCR2"
FT                   /protein_id="ADF50575.1"
FT                   /translation="MKKVLFIFLVLFTIASCKDDTAKAVQENNTAEEETEQDTVPTVSG
FT                   KFIFTEKDAILRGDDFIYNVEIDSLSRNLGKQVEAYKTDDFEMVPVKVKGKIKQSPRQT
FT                   GIKKNIELREIVAILTDSIRNKRQE"
FT   gene            complement(213096..214541)
FT                   /locus_tag="ZPR_0215"
FT   CDS_pept        complement(213096..214541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0215"
FT                   /product="cysteine desulfurase activator complex subunit
FT                   SufB"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50576"
FT                   /db_xref="GOA:D5BCR3"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCR3"
FT                   /protein_id="ADF50576.1"
FT                   /translation="MAYTEDDLKKELETKEYEYGFYTDIESDTFPVGLNEDIVRAISKK
FT                   KEEPEWMTEWRLEAFRAWEQMEEPEWANVHYKKPDFQNISYYSAPNKKPKYDSLDEVDP
FT                   ELLDTFKKLGISIDEQKKLAGVAVDVVMDSVSVTTTFKKTLAEKGIIFCSISEAIKEHP
FT                   ELVKKYIGSVVPKKDNFYAALNSAVFSDGSFCYIPKGVRCPMELSTYFRINQAGTGQFE
FT                   RTLVIADEGSYVSYLEGCTAPMRDENQLHAAVVELVALDDAEIKYSTVQNWFPGGKDGK
FT                   GGVFNFVTKRGLCEKNAKISWTQVETGSAVTWKYPSCILKGDNSVGEFYSIAVTNNYQQ
FT                   ADTGTKMVHLGKNTRSTIISKGISAGKSQNSYRGLVQINPRADNARNFSQCDSLLMGNA
FT                   CGAHTFPYIEAKNKTAKVEHEATTSKIGEDQIFYCNQRGIDTEKAIALIVNGFSKEVLN
FT                   KLPMEFAVEAQKLLEISLEGSVG"
FT   gene            complement(214578..214967)
FT                   /locus_tag="ZPR_0216"
FT   CDS_pept        complement(214578..214967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0216"
FT                   /product="S23 ribosomal protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50577"
FT                   /db_xref="GOA:D5BCR4"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCR4"
FT                   /protein_id="ADF50577.1"
FT                   /translation="MATIKQFEDLEIWQKAREICRIVYETKKNTNLKNDFKLYNQLNGS
FT                   SGSIMDNIAEGFERNGNREFIQFLSIAKASCGETRSQLYRAFDRGYLNDDDFEDFKTKV
FT                   ISLSRQINGFIDYLQKSDFKGTKFK"
FT   gene            complement(215005..215334)
FT                   /locus_tag="ZPR_0217"
FT   CDS_pept        complement(215005..215334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0217"
FT                   /product="HesB/IscA family iron-sulfur cluster assembly
FT                   scaffold protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50578"
FT                   /db_xref="GOA:D5BCR5"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCR5"
FT                   /protein_id="ADF50578.1"
FT                   /translation="MIKVSEDARKKISALMEEEGFNSLQDFVRVGVKSGGCSGLSYELK
FT                   FDKSKADDDKLFEDNDIKIVVDKRSVLYLAGTILEYSGGLNGKGFIFNNPNAQRTCGCG
FT                   ESFSL"
FT   gene            215640..216692
FT                   /locus_tag="ZPR_0218"
FT   CDS_pept        215640..216692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0218"
FT                   /product="thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50579"
FT                   /db_xref="GOA:D5BCR6"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCR6"
FT                   /protein_id="ADF50579.1"
FT                   /translation="MFDNSEPTKTSLSELGEFGLIDHLTKNFSPKHASTIKAIGDDAAV
FT                   LDFKDKQTLVSTDMLVEGVHFDLAYMPLKHLGYKAVMVNASDIYAMNGKATHITVSIAP
FT                   SNRFPVEALEELYAGIQLAADLYNIDVVGGDTTSSTSGLFISISVFGEAEKEDVVYRSG
FT                   AQANDLLVVTGDLGAAYMGLQVLEREKQVFKANPNAQPDLDQYTYLIERQLKPEARKDI
FT                   PPLLKGLGVKPTSMIDISDGLSSEVIHLCKNSKTGVNLYEEKVPLDPAVISVCEEFELD
FT                   STMIALSGGEDYELLFTIAQSDFDKIKGNPNLTVIGHMTEESAGMHLITRANQAIPLVA
FT                   RGWNSMKSED"
FT   gene            complement(217078..217191)
FT                   /locus_tag="ZPR_0219"
FT   CDS_pept        complement(217078..217191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50580"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCR7"
FT                   /protein_id="ADF50580.1"
FT                   /translation="MKDLGQNSAKSFNNIDSALIKLMAFLYPNLLFVQNNP"
FT   gene            complement(217458..218858)
FT                   /locus_tag="ZPR_0220"
FT   CDS_pept        complement(217458..218858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50581"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCR8"
FT                   /protein_id="ADF50581.1"
FT                   /translation="MILASLTIVFYSCQGDDNDDITSQEFDPSRPVEVLGFTPESGGAG
FT                   QRLVIYGKNFGTDPSIVTVLIGGKEAKVINVNGESLYCLVPKQAFDGDIEVRVGEEERQ
FT                   VKAYATNNFDYQRKMVVSTLIGYKNDRGDEPWKDGKFKSDNQNDMASGFWEPSFMKFDP
FT                   MNPKHLWVVFDFNNGLYKIDFADSTVVKVRSDFDRPRSIDFTNDGKYMIIAEDRGGEND
FT                   RATYRLSRDKDWQDREILTRYKNCNGASVHPVNGELYFNSYEKGQFFRFDLNKYFEDGL
FT                   GDKDYEQLFVVQDPGWEYKIFIHPTGNYAYIVVINKHYILRIDYNWEKERFNQPYLVCG
FT                   KLSNDGGYQDGVGSSVRLNKPYQGVFVKNEDYVEAGKTDEYDFYFTEQGNHDIRKLTPE
FT                   GSVTTFAGRGSSSINPDPWGYVNGDLREEARFDQPTGIAYNEEEKAFYIGDKSNHRFRK
FT                   IALEEAQE"
FT   gene            complement(219008..219982)
FT                   /locus_tag="ZPR_0221"
FT   CDS_pept        complement(219008..219982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0221"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50582"
FT                   /db_xref="InterPro:IPR025371"
FT                   /db_xref="InterPro:IPR032509"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCR9"
FT                   /protein_id="ADF50582.1"
FT                   /translation="MNTKLLIPIILLIIFSSCNDEWTDEQFENYISFKAPITNSEGVTD
FT                   IYIRYKAEEKTTYQLPLIVSGSKTNTQNKTVHVALDPDTLETLNYERFQTREDFYYREL
FT                   KSKYYSFPSEVEIKAGENTSLMNIDFALKDIDMAEKWVLPLTIEDDPSYTPNPRKNYRK
FT                   ALLRINPFNDYSGTYSGTALKTVMEGYENETPIVKSEIKSYVVDENTIFFYAGNIDEDR
FT                   QDRRSYKIFATFDGNGGVTFDVDNPDMNFQVNKTASYTITEQMDEIRPYLLHRYLTINN
FT                   IDYTFSDYTMVPNVDINYKVSGSLILERQLNTQIPDEDQQIEW"
FT   gene            complement(219994..222051)
FT                   /locus_tag="ZPR_0222"
FT   CDS_pept        complement(219994..222051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50583"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCS0"
FT                   /protein_id="ADF50583.1"
FT                   /translation="MNKNIFYKTLLILFISGFILSCSDDYLDSSRYFKDRLTEEKVFQS
FT                   KVYSEEWLANIYEELKGINADVASKAVTPHNFADDMYYGDRDSEYDPSKNELSYNMFKM
FT                   GRYNENDKQGTWTQSYRGIRNASTFIHNIYMNTEMSEQEIKDYRGQARFARAYLYWLLL
FT                   RKYGPIPLLPDEGLDYTDSYDDLAIPRSPYEDCAEFISNELLLAAQEMEALGMVRGQDG
FT                   SARPTVGAALAARAKVLIYAASPLANGNTSSYATQLVDDQGRQLLSSDYQEEKWAKAAA
FT                   AAKDVMDLGVYQLYTVPVQETGDNATIVPPADNNFSEKSWPEGWADIDPEKSYAQVFDG
FT                   TLPASGNPELIFTRGNNQGGENIRQMVAHQLPRSATGWNTHGLTQKLVDAYYMDDGADV
FT                   PGKDLEIGRGNGSQRVDGFVTQEDYEAGLFRPLLPGVSLQYANREPRFYASVAFNGSFW
FT                   PLLNESQERNRNQQVFYYRDNPNGNGFNSSNAYWLRTGIGMKKYVHPNDTYEGGNEDKI
FT                   VFKPEPAIRYADILLMYAEALNELDGSYSIEAWNGGNHNISRSISEMQKGIHPIRIRAG
FT                   VPDYSTSVYNDKDALRKKLKRERFIELLAEGQRYYDLRRWMDAAEEESLPIYGCNILMN
FT                   REERELFHQPVAVWALETTFSDKMWFWPIGLTELKRNKRLTQNPGWNYND"
FT   gene            complement(222064..225441)
FT                   /locus_tag="ZPR_0223"
FT   CDS_pept        complement(222064..225441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0223"
FT                   /product="tonB-dependent Receptor Plug domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50584"
FT                   /db_xref="GOA:D5BCS1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCS1"
FT                   /protein_id="ADF50584.1"
FT                   /translation="MKTFLLLLCTTVFGFSPKTSFSQENIVISKDQKASIDDVFHIIRA
FT                   QTDYTFIYAKSLFENTPEIQLKKGDINIDSLLNRISKNADVFIRKNPDHTITIKKSDRN
FT                   SRSRSDSQTVSQQLEIKGRVITANDKLPLPGASIIEKGTMNGVVTDFNGDFSISITNKN
FT                   AILVISYVGYATKEIPVNDQTNFEIVLEEDTDSLDEVVIVGFGKQKKISLTGAVSTVDV
FT                   EDMKQNPTSSISNALAGNVAGIMGMMQSGQPGRNISEFWIRGISTFGGGTNPLVLVDNI
FT                   ERDLNELNIEDIKSISVLKDAAETAMYGSRGANGVILITTKRGSAGKININFKDEFIYN
FT                   TRTITPDFEDGVSYANLLNEARITRNEGPIYQPEELEILRLGLDPDLYPNVDWKDELLR
FT                   DGAMTYRANLNMSGGGETSRYYVSGSYINEGGMYEIDESLKDDYNTNANYKRWNYRLNA
FT                   DFDISKTTIAKVGVAGSLSKRNSPGLGDVDFWGSLFGYSPIRTPIIYSNGYVPAIGTGN
FT                   QTNPWVMATQTGFNENWVNKVQTNVTIEQDFGFITEGLRMRGIVGYDIENSNNIQRRKW
FT                   PEQWRADRARDANGDLVFTHISDPSELFQSSTSSGNRLEFYDLMINYDRSFGNHDIGGA
FT                   IRLTRDAFVQTVDLGGDIKNGISRRNQALAGRVLYNWKSKYFINFNFGYTGSENFAPGK
FT                   QYGFFPAISGAWNIAGEQFFKEHLSWLKLFKIRYSYGKAGNDQLMNGERFPYLYTISEL
FT                   FTDDGEATGGYRWSDYGSDRYFGGIIYSQVASSNVTWEVATKQNLGFDIETKAITANLD
FT                   FFNEKRTGIYMERNYLPAMVGLESIPRANVGIVRSRGFDGRFQYTRQIGEVTLSARSNI
FT                   TYSKNEIVERDEENNVYPYQNQEGFRVGQSRGLIALGLFEDYDDIRNSPTQTFGTYQPG
FT                   DIKYKDVNGDGIIDDGDRVAIGATRRPNLIYGLGASVNWRGFGLGVHFQGAGKSTFSTY
FT                   GKTVYAFSEGEWGQVMKGVMGNNRWIDADISGDPATEDPNASYPRLSYGENPNNFREST
FT                   FWLRDGRYLRLKTLDVGYNLPKSITSRVRVQNIRLYVVGTNLVTWSKFKLWDPELATPR
FT                   GEDYPPAKSLTFGISLNL"
FT   gene            complement(225602..226765)
FT                   /locus_tag="ZPR_0224"
FT   CDS_pept        complement(225602..226765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0224"
FT                   /product="putative anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50585"
FT                   /db_xref="GOA:D5BCS2"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032508"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCS2"
FT                   /protein_id="ADF50585.1"
FT                   /translation="MMTKTIEKAIIRYITGTASADELTMLSKWVEKPSNQKQLQTFIED
FT                   YYAIQYNIYEPNTDRAVHRLLSSIKKRKTLDYKKKRHYFIKYAAAIVTILSLIGGYTFK
FT                   ENLFTNELSQSAKEEIKAGTDKAILTLGDGSKIQLGEQEVYTSEKFGSNGSTLEYFDHD
FT                   KHSSNTTNYHYLTVPRGGKFMIKLSDGTKVWLNSDSRLKYPEKFKKGESRKVELVYGEA
FT                   YFDVSSSSKNNGADFRVYNKGKEIQVLGTQFNIKAYNEEQQIFTTLVEGKISFKYEDHE
FT                   KILSPGQQAIYNLKNKVILTKTIDIYNEISWKDGIFSFDNKPLGDIMKVLSRWYDVKFI
FT                   FSNEQTKNEQFIGILSKDQEIESILLQLKNSGIIKNYKIKNSEIEIE"
FT   gene            226880..227446
FT                   /locus_tag="ZPR_0225"
FT   CDS_pept        226880..227446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0225"
FT                   /product="ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50586"
FT                   /db_xref="GOA:D5BCS3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCS3"
FT                   /protein_id="ADF50586.1"
FT                   /translation="MYKDNHDLIERLKNGEDSAYSYLLQLYHRQLFVYVVTLTRDRDLA
FT                   EDIIQNVFLKLWEYRSRLNPDYSIKNFLYRSSYNEFVNNYNKNKGITYFDKVFLENAEQ
FT                   VAMNSDFELLERKMEIVFEGVSLLPDKCAEVFILSKREGLTNIEIADYLNISLKTVEGH
FT                   LTKAYSILRERLGTKIESFLLLLFR"
FT   gene            complement(227499..228206)
FT                   /locus_tag="ZPR_0226"
FT   CDS_pept        complement(227499..228206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0226"
FT                   /product="alpha/beta fold hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50587"
FT                   /db_xref="GOA:D5BCS4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCS4"
FT                   /protein_id="ADF50587.1"
FT                   /translation="MLLHGFLESKEIWRDYLELLSKERQVITIDLLGHGETGNIAPIHS
FT                   MEDMADSVIEVLNYLEIEKANFAGHSMGGYVIMALLKKYPEKIPKISLINSTPAEDTPE
FT                   KKENRERVAGLVSKNKSAFVSMAISNLLTSENNKKFKSEIEILKNEAQKMSLEGIIAAT
FT                   LGMKNRMDSTEIFKEFKGEKFIVVGMQDPVLDVADTLQIAKKTNAEIIEFPDGHLSFIE
FT                   NRDQLMHFLKSKA"
FT   gene            complement(228337..229662)
FT                   /locus_tag="ZPR_0227"
FT   CDS_pept        complement(228337..229662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0227"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50588"
FT                   /db_xref="GOA:D5BCS5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCS5"
FT                   /protein_id="ADF50588.1"
FT                   /translation="MGDNFEITVMKYDQIDRKLFIKNRKNFMERMVPGGLAVFNANDVF
FT                   PIGADSTMPFQQNRDLFYLSGVDQEEAILVLFPDAPKPEHREILFLTETNPHIAVWEGE
FT                   KLTKEKAFEVSGIKTVYWLQDFEKIFFEVMAQSETIYFNKNEHYRVQGSIQTETRDDRF
FT                   IKWCKEKYPAHQVAKSNPILQRLRAVKDPIELDLMQQACDITEKAFRRALKFTKPGVWE
FT                   YEIEAEYWHEMIRNRSKGFAYTPIIASGNNANVLHYTENNQQCKAGDLILLDTGAEYAN
FT                   YSSDMTRSIPVSGRFTDRQKQIYNAVNKVKTEATKWLIPGTMWDEFHKEVGKLMTSELL
FT                   NLGLLDKADVQNENPDWPAYKKYFMHGTAHNIGLDTHDYGILTEPMKANQVFTVEPGIY
FT                   LPDEGFGIRLEDDVVIQEKGEPFNLMRNIPIEADEIEEIMNS"
FT   gene            complement(229874..230638)
FT                   /locus_tag="ZPR_0228"
FT   CDS_pept        complement(229874..230638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0228"
FT                   /product="short chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50589"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCS6"
FT                   /protein_id="ADF50589.1"
FT                   /translation="MSNFKDKTAIITGGSGSIGYTTALELAKKGANVLLVDIDEESLKE
FT                   KESAAKKENLNISYVVADVSKPEDVKNYVETCIERYGKIDYFFNNAGIEGKVAPLEEYP
FT                   DDIFDKVMEVNVKGTYLGMKHVIPKIEDGGSIVITSSVAGLQGSPKMVSYITSKHAVIG
FT                   IMRTAALELGKRNVRVNCVNPGSVDNRMMRSLEDGVNPGHGDDVKKAYEATIPLGRYAT
FT                   PEDISHMVCFLFSDKASYANGQTFVIDGGMKA"
FT   gene            230927..232585
FT                   /locus_tag="ZPR_0229"
FT   CDS_pept        230927..232585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0229"
FT                   /product="asparagine synthetase B"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50590"
FT                   /db_xref="GOA:D5BCS7"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCS7"
FT                   /protein_id="ADF50590.1"
FT                   /translation="MCGIVCAFDLKEKSDDLRPQLLEMARCLRHRGPDWSGIYSNDNAI
FT                   LAHERLAIVDPISGGQPLLSKDGNLVLAANGEIYNHKKLREQCQDYEFQTASDCEVILA
FT                   LYKQKGARFLDDLNGIFGFAIYDVENDEYLIARDHMGIIPLYIGWDQNGTFYVASELKA
FT                   LEGKCTKIELFPPGHYLSSKEEGFQKWYERDWMEYDAVKDNHTSIEELREALEKAVHRQ
FT                   LMSDVPYGVLLSGGLDSSITSAVAKKYSEKRIESDDKDAAWWPRLHSFAIGLEGSPDLA
FT                   AAQKVADHLDTVHHEIKFTIQEGLDAIKDVIYHLETYDVTTIRASTPMYLMARTIKSLG
FT                   IKMVLSGEGSDELFGGYLYFHKAPNAKEFHEETVRKLDKLHQYDCLRANKSLCAWGIEG
FT                   RVPFLDKEFMDVAMRINPQDKMINGERIEKWVLRKAFEDYLPESVTWRQKEQFSDGVGY
FT                   SWIDTLKELVNAEVTDEQLKNSHFKFPIQPPSSKEEYYYRTIFSQHFPSDAAALSVPSV
FT                   PSVACSTPTALEWDESFKNMNDPSGRAVANVHSDA"
FT   gene            232940..233602
FT                   /locus_tag="ZPR_0230"
FT   CDS_pept        232940..233602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0230"
FT                   /product="Succinate dehydrogenase, cytochrome b558 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50591"
FT                   /db_xref="GOA:D5BCS8"
FT                   /db_xref="InterPro:IPR011138"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCS8"
FT                   /protein_id="ADF50591.1"
FT                   /translation="MGGFLKSSIAKKVAMALSGLFLVLFLLQHFTINFTSVFSEDLFNE
FT                   LSHFMGTNFLVQSILQPVLIFGVIFHFVMGFVLEAKNRGARNVKYVKYNGGANSSWMSR
FT                   NMIYSGLVVLAFLVLHFYDFWVPELVHKYVESHPEDASRYYGELVAKFQDPIRVAAYCL
FT                   SFVFLSLHLLHGFSSSFQSMGWNNKYAKGVRGLTVAYAIIIPLGFIFIALFHYINNL"
FT   gene            233615..235618
FT                   /locus_tag="ZPR_0231"
FT   CDS_pept        233615..235618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0231"
FT                   /product="succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50592"
FT                   /db_xref="GOA:D5BCS9"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011280"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCS9"
FT                   /protein_id="ADF50592.1"
FT                   /translation="MSVLESKIPEGPLKDKWTKHKNDINLVNPANKRNIDIIVVGTGLA
FT                   GGAAAATLAELGYNVKTFCYQDSPRRAHSIAAQGGINASKNYQGDGDSDYRLFYDTVKG
FT                   GDYRSREANVYRLAEVSGNIIDQCVAQGVPFAREYGGYLDNRSFGGVLVSRTFYAKGQT
FT                   GQQLLLGAYSAMNRQINRGKIQSFNRHEMMDLVLVDGKARGIIARDMVTGELERHSGHA
FT                   VVLASGGYGNVFFLSTNAMGSNVMAAWRAHRRGAYFANPCYTQIHPTCIPVTGDHQSKL
FT                   TLMSESLRNDGRIWVPKKKEDAIAIREGKKKPTELSEEERDYYLERRYPSFGNLVPRDV
FT                   ASRAAKERCDAGFGVNKTGQAVYLDFASAIKRYGKEAAFTSGHKNPSEAEIIKLGKEVV
FT                   ESKYGNLFQMYEKITDQNPYETPMMIYPAVHYTMGGLWVDYNLQTTIPGCYAAGEANFS
FT                   DHGANRLGASALMQGLADGYFVLPYTIGDYLSKDIRTGKIPTDSPEFEATEKEVKDKID
FT                   RLMNAGGKHSVDTYHKKLGKIMWEKCGMARNEQGLKEAIEEIKALREDFWQNVKVTGTA
FT                   ESKNAELEKAGRVADFLELGELFAKDALHRNESCGGHFREEYQTEDGEALRDDENFKYV
FT                   AAWEYKGQPSDAVLHKEELIFKNIELKTRSYK"
FT   gene            235748..236440
FT                   /locus_tag="ZPR_0232"
FT   CDS_pept        235748..236440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0232"
FT                   /product="succinate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50593"
FT                   /db_xref="GOA:D5BCT0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCT0"
FT                   /protein_id="ADF50593.1"
FT                   /translation="MVSYPIDGIEGDMSFLEMLDVLNEELVAKGEDPVEFDHDCREGIC
FT                   GACSLQINGEPHGPDKLITTCQLHMRSFKDGDTIVIEPFRANAFPVVKDLIVDRSSFDR
FT                   IQQAGGYVSINTSGNTIDANSIPVNKHDADDSFAAATCIGCGACVAACKNASAMLFTSA
FT                   KVSQYALLPQGQVEATDRVMNMVRQMDAEGFGNCTNTGACEIECPKGISLENIARMNRE
FT                   YLSASTKG"
FT   gene            236667..237086
FT                   /locus_tag="ZPR_0233"
FT   CDS_pept        236667..237086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0233"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50594"
FT                   /db_xref="InterPro:IPR025748"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCT1"
FT                   /protein_id="ADF50594.1"
FT                   /translation="MFSCNSAQNSENMNPTLIAEGNLYGNGNDGLVENNMVLKNQTEWK
FT                   EVAAKLNKLNANIKEDQIKAVDFKKQMVIVLIDQQRTKGGYAIKISGVKNKEESVVINL
FT                   RKSQTEGMATMVMTQPYYVGTIPKTDKEIEFEEVK"
FT   gene            237091..237720
FT                   /locus_tag="ZPR_0234"
FT   CDS_pept        237091..237720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0234"
FT                   /product="phosphoesterase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50595"
FT                   /db_xref="GOA:D5BCT2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCT2"
FT                   /protein_id="ADF50595.1"
FT                   /translation="MKINIQHNHFQLACSGVSYWEEQKTLLVADVHLGKISHFRKYGSA
FT                   VPQTAVQTNFDRLDQAVVQFQPLKIIFLGDLFHSALNAEWNLFENWFQNQKAEVILIAG
FT                   NHDIIAPWHYEKLGVKVFQELHIDDFRLTHHPEEKQGSFNICGHIHPGYRLVGLAKQHL
FT                   KLKCFFRSRNQLILPAFGEFTGAFLMKPEAEDQVFVCAKAEVIRVN"
FT   gene            237951..238298
FT                   /locus_tag="ZPR_0235"
FT   CDS_pept        237951..238298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0235"
FT                   /product="hopJ type III effector protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50596"
FT                   /db_xref="InterPro:IPR014984"
FT                   /db_xref="InterPro:IPR038604"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCT3"
FT                   /protein_id="ADF50596.1"
FT                   /translation="MDLLKYLEQVASDPKSADFKQTINLIDEYYQFSPASFKNGQIYNE
FT                   AGNNNGSCKIFALGLLKGLSKETTLALFGEHYFDGVLKDPEGNSHQNIRNFMDTGWSGI
FT                   AFDTEALQPVK"
FT   gene            238465..240168
FT                   /locus_tag="ZPR_0236"
FT   CDS_pept        238465..240168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0236"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50597"
FT                   /db_xref="GOA:D5BCT4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCT4"
FT                   /protein_id="ADF50597.1"
FT                   /translation="MNSRWTIKPNPNPDIVNSLMQSLGVGKPIARLLAQRGINSFEEAK
FT                   KFFRPNLKDLHDPYLMRDMDKAVARIEKALAEEENIMVYGDYDVDGTTSVALMSSYLKT
FT                   RYPNVATYIPDRYNEGYGVSYQGIDFAADNDISLIIALDCGIKAIDKVAYAREKGIDFV
FT                   ICDHHRPGEKIPEAAAVLDPKREDCEYPYKELCGCGVGFKLIQALAEKRGDSIQVLLPY
FT                   LDLVATAIGADIVPITGENRILAYHGLHVINVAPRQGFKAILSQLKKETITITDVVFVI
FT                   APRINAAGRMKHGLHAVELLTEEKEEQAQQFASEIEYHNSHRKDTDKSITAEALVQIEE
FT                   LEEQERLSTVVYADHWHKGVIGIVASRLTETYYRPTLVFTKSGDKLAASARSVKGFDVY
FT                   NALEACQEHIEQFGGHMYAAGLTIKEEEYDNFKRKFEEVVAETIDRKLLTPEISIDAEI
FT                   ELDEITPKFWRILKQFAPFGPGNMSPLFMSRNLTDSGFGKCVGNEHTHLKCKVSQLNNT
FT                   ASFDVIGFNLGEKLELIQNKKSFSAVYAVDENEWNGNVSLQLKLKDLKEV"
FT   gene            240374..240502
FT                   /locus_tag="ZPR_0237"
FT   CDS_pept        240374..240502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50598"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCT5"
FT                   /protein_id="ADF50598.1"
FT                   /translation="MKISEIDEYFYYANGMYPLGLPVRKSLSKLISLFRFASFWYN"
FT   gene            240666..241028
FT                   /locus_tag="ZPR_0238"
FT   CDS_pept        240666..241028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0238"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50599"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCT6"
FT                   /protein_id="ADF50599.1"
FT                   /translation="MEDVDVIYHNDTGISFKWKNGIGNTDENRVQLVFKDMGFYLLPEE
FT                   VMLFSENIRVARRRNPQCFRCLSSDVCERNILLKSPLQKMDFAVNAFELNEICDLVEGT
FT                   IFKLQLNYYLEYVAKN"
FT   gene            complement(241143..241601)
FT                   /locus_tag="ZPR_0239"
FT   CDS_pept        complement(241143..241601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50600"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCT7"
FT                   /protein_id="ADF50600.1"
FT                   /translation="MPVYKLTTTILLFSMSLFMSCSTDDAEVVIEKLSYEVLLESQLSY
FT                   YEEEKIPKQYQVFTSQEDWLAFIPTIERVNPDHAKTLRNISFDFNNNNLIIVIGEFFNS
FT                   CCSQITINQIFKRNNKIIINFEESEPGMAGALSQTYLVLKTSRSRQHQ"
FT   gene            242062..242724
FT                   /locus_tag="ZPR_0240"
FT   CDS_pept        242062..242724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0240"
FT                   /product="iron dependent repressor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50601"
FT                   /db_xref="GOA:D5BCT8"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCT8"
FT                   /protein_id="ADF50601.1"
FT                   /translation="MTLSEENYLKSIYHLEKKYTRGVSTNALAEEMETKASSVTDMIKK
FT                   LSEKELVNYKKYQGVKLSEKGNAIAVQIIRKHRLWEYFLVEKLDFNWDEVHDIAEQLEH
FT                   IKSDELIAKLDKFLDYPKRDPHGDPIPDAEGNFANLEKKILAEFDKGEHGVCVGVKDSS
FT                   AAFLQYLDRNKIKLGKSISILEKEQFDGSMILKMNNKELTISKVAANNIYLKPVEVE"
FT   gene            242846..244609
FT                   /locus_tag="ZPR_0241"
FT   CDS_pept        242846..244609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0241"
FT                   /product="manganese transport protein mntH"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50602"
FT                   /db_xref="GOA:D5BCT9"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCT9"
FT                   /protein_id="ADF50602.1"
FT                   /translation="MDPGNWATDLAGGSQFGYSLLWVLLMSNIMALLLQSLSTRLGVVR
FT                   GMDLAQASREEYPPFVNFMLYIFAEIAIAACDLAEVVGMAIGLQLLFGLPLLWGVSITV
FT                   FDSFLLLFLLNKGMRKMEAFIVALIAIIGGSFLLELFLAKPDIPEVLGGFVPSIPNNDG
FT                   LYIAIGIIGATVMPHNLYLHSSLVQTRKIEKTKKGILQALLFNFIDSFIALNLAFFVNA
FT                   AILILAASVFFKNGMFEVAEIQDAHKLLEPLLGSSLAPILFALALIAAGQSSTLTGTLA
FT                   GQIVMEGYLNLRIQPWVRRLITRLLAIVPAFFTIIYFGERATGELLILSQVVLSLQLGF
FT                   AIIPLIHFVSDKKTMNGFHIKWPLIIASWIISLVIVLLNAKLVFDELKSWITSVEDATY
FT                   IWVFIVPITIAVILLLVFISLWPLFKEKLGRGWITNHAPHKNPQTIEVIAEKNFKHIAI
FT                   AIDFSGSDKKSISAALQIGGKNAKYTLLHTVETPGAFIYGTQIKDYETDKDREFLKNYK
FT                   SQLEALGYHTDINLSFGTPKKAIPKLLNSAEANFDLLVMGRHGHKMIKDILLGTTVDVV
FT                   RHRVEIPIFIT"
FT   gene            244621..245445
FT                   /locus_tag="ZPR_0242"
FT   CDS_pept        244621..245445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0242"
FT                   /product="ZIP family zinc transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50603"
FT                   /db_xref="GOA:D5BCU0"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCU0"
FT                   /protein_id="ADF50603.1"
FT                   /translation="MMNQIIAYFETLDPVLAAFYATLFTWGLTALGASLVFFFKKMNRM
FT                   LFDGMLGFTGGVMVAASFWSLLAPGIEMSPGEGFEKTIPAVVGFGLGALFIFGLDKILP
FT                   HLHVNFNTTEKEGIKTPWHKSILLVLAITLHNIPEGLAVGVLFGGAAAGFEGASIAGAV
FT                   ALAIGIGLQNFPEGFAVAMPLRGQGFSRRKSFNYGQLSAIVEPVAAVLGAWAVMTFQPI
FT                   LPYALSFAAGAMIFVVVEEVVPESQQSKYTDVSTLGFIGGFMVMMTLDVGLG"
FT   gene            245491..245904
FT                   /locus_tag="ZPR_0243"
FT   CDS_pept        245491..245904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50604"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCU1"
FT                   /protein_id="ADF50604.1"
FT                   /translation="MTMKKIILILILLVNGVSLSAQSEVARLQSFLKVGEQLDCGNYSI
FT                   VFKKVISDSRCPKSVTCVWAGTAEVLLEIRKADEVYEEYRIEIGSFIDVYFQLPQLANI
FT                   HLKLLGLAPYPETPQKIKQSEYKVTIQLEELLD"
FT   gene            complement(245901..246053)
FT                   /locus_tag="ZPR_0244"
FT   CDS_pept        complement(245901..246053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50605"
FT                   /db_xref="GOA:D5BCU2"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCU2"
FT                   /protein_id="ADF50605.1"
FT                   /translation="MELIQHILVFITFLTAVGYLITKFVWKPAFLKKKAQKEKACGMSD
FT                   CGCSH"
FT   gene            complement(246090..248192)
FT                   /locus_tag="ZPR_0245"
FT   CDS_pept        complement(246090..248192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0245"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50606"
FT                   /db_xref="GOA:D5BCU3"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCU3"
FT                   /protein_id="ADF50606.1"
FT                   /translation="MTGKQINVALIGNPNTGKTSVFNQLTGLNQKVGNYPGITVEKKEG
FT                   ICKLPRGLKAHIIDLPGTYSLNASSLDENVVIELLLNKNDKDFPDVAVVVSDVENLKRN
FT                   LLLFTQIKDLGIPTILVINMADRMERKGISLDIDILEERLKTKIALVSARKRTGIDKLK
FT                   ELIINSRNISTEPCVNASVIDPDYFGNLRKAFPKQSIYKLWLVITQDVNFGNINRNEID
FT                   KTSGFNTKSSSELKRLQQKETIHRYQFINGVLKETLRVDSNAAKDLRSRLDRVLTHKVW
FT                   GYVIFFAILLLIFQAIYDWSSYPMDLIDSTFASLSEFTKANLPEGVFTSLIAEGIIPGL
FT                   GGIVIFIPQIAFLFLFISILEETGYMSRVVFLMDRIMRRFGLSGKSVVPLVSGTACAIP
FT                   AVMATRNIENWKERLITILVVPFTTCSARLPVYLIIIALVIPDETFLGFNLQGLMLMFL
FT                   YLLGFGTAIFSAWILNGILKIKSKSYFVIEMPNYKVPLLKNIGINVVEKTKSFVFGAGK
FT                   IILAISIILWVLASYGPGNDFNNAEEIIRSNYTEQNIPTEEIEQEIASYKLKHSYIGIM
FT                   GRGIEPVVAPLGYDWKIGIAIISSFAAREVFVGTLATIYSVGSDEEETIKNRMAAETNP
FT                   VLGGPLFTLASGVSLLLFYAFAMQCMSTLAIVKKETNSWKWPVLQLVIMSVFAYVVALI
FT                   AFQVLN"
FT   gene            complement(248189..248419)
FT                   /locus_tag="ZPR_0246"
FT   CDS_pept        complement(248189..248419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0246"
FT                   /product="ferrous iron transport protein A"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50607"
FT                   /db_xref="GOA:D5BCU4"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCU4"
FT                   /protein_id="ADF50607.1"
FT                   /translation="MKVTVAHLKRGERGIIKEFSADNVPLKLLEMGCLPGNEVELVQTA
FT                   PFKDPMYLNINGSHLAIRKETALQIEIELIK"
FT   gene            complement(248601..249209)
FT                   /locus_tag="ZPR_0248"
FT   CDS_pept        complement(248601..249209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0248"
FT                   /product="electron transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50608"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCU5"
FT                   /protein_id="ADF50608.1"
FT                   /translation="MWSIYSLLKPEEKLTIYQPDMVNSELVDTTMQYVRKYHRIKDFKL
FT                   VNQNGDTITNADYKDKIYIADFFFTTCMTICPIMTDHMVKIQERIKDDPEVLLLSHTVM
FT                   PRIDTVAQLKRYAEEKGVIDSKWNLVTGDKKQIYDLARKSYLAAKSEGDGGKYDMVHTE
FT                   NFVLIDKNRQIRGFYDGTNPEAIEELMEDLKILKKEYQE"
FT   gene            249199..249312
FT                   /locus_tag="ZPR_0247"
FT   CDS_pept        249199..249312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50609"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCU6"
FT                   /protein_id="ADF50609.1"
FT                   /translation="MDHIIIIQRIPKVIMKILYLERNLRIANFYAKLRSGG"
FT   gene            249428..250747
FT                   /locus_tag="ZPR_0249"
FT   CDS_pept        249428..250747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0249"
FT                   /product="family M50 transmembrane peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50610"
FT                   /db_xref="GOA:D5BCU7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCU7"
FT                   /protein_id="ADF50610.1"
FT                   /translation="MDPFIVKAIQLLLSLSLLIVLHEFGHFIPAKLFKTRVEKFFLFFD
FT                   VKFALFKKKIGDTVYGIGWLPLGGYVKISGMIDESMDKEQMAQPPQEWEFRSKPAWQRL
FT                   IIMLGGVTVNLVLGFLLFMMILFVWGTNYVGPDEMPEGFAVVDEFKEFGFEDGDRVLKV
FT                   NGEELQNSLDINRKLFMRDVNTVTVLHQNGAEETINIPENIGEQMFEDGIMQPFIPIQR
FT                   PILDSVAAKTAADVAGLQKGDSIISINDQEIGYWHEMTKNTRANKNKEMEIVFKRDGEI
FT                   KSVMATPDEDGILGVTPRRDFEVKTQQYSFAESISEGFKDGYWTLRDYVYQFKYVFTKK
FT                   GATQVGGFGAIGGMFPDAWNWQAFWHTTALISIILAFMNILPIPALDGGHVMFLLYEMI
FT                   TGRKPNEKFMEYAQMVGFFILIALVLYANGNDIYRAIFDK"
FT   gene            complement(250858..251775)
FT                   /locus_tag="ZPR_0250"
FT   CDS_pept        complement(250858..251775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0250"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50611"
FT                   /db_xref="GOA:D5BCU8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCU8"
FT                   /protein_id="ADF50611.1"
FT                   /translation="MKIVKISLLLMALAILSCKENNKGKNAAEEKIPTETSKIEVQGHR
FT                   GERGHSPENSIPGFIAAIDKGVDVVEMDVVMSKDGKVVVSHEPFMSSAYVLTPAGDTIS
FT                   KQQEKDYNLFTMTYDSIKKFDIGSKGNTAFPEQKRSKTYKPLLSEVIDSIENYIVSNNL
FT                   DPVHYNIEIKSDPTEYEKSQPKPAEFVQFVMQVLEEKGIIPKINIQSFDVAILEEMHQA
FT                   YPDVLLAYLVGSGEFEENMKKISFTPQIYSPYYKLLDQEKVTEIKQSGMKVIPWTVNEQ
FT                   ADIDRVKTMKVDGIITDYPERAIE"
FT   gene            complement(252020..253594)
FT                   /locus_tag="ZPR_0251"
FT   CDS_pept        complement(252020..253594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0251"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50612"
FT                   /db_xref="GOA:D5BCU9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032285"
FT                   /db_xref="InterPro:IPR032288"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCU9"
FT                   /protein_id="ADF50612.1"
FT                   /translation="MKRTILATAIFLLGVSGFAQQMATGYVFEDQNENGKKDRNESGIA
FT                   NVSVSNSQQVVVTDTNGKYEIPVGDDNIIFVIKPSGYVPKINENNLPEFYYIHKPNGSP
FT                   KSEFAGVKPTGKLPKSIDFGLIPSEEKETFTALIFGDPQPYNLEEIEYFTKGIVTEVEG
FT                   IKDVPFGLSLGDLVGNDLDLFSPYIKAVKKVGIPWYNLMGNHDMNFDATEDKLSDETYE
FT                   AHFGPANYAFNYGKVHFIVMDDILYPDPRDMKGYLGGFRKDQLDFIANDLNYVPKDHLV
FT                   VLAWHIPLFEPEDNNTFRDEDRERLFSILSEFPHTLSLSAHTHIQRQDFFGKDEGFNRD
FT                   KPHHEYNVGTTSGDWYSGKLNKEGIPISVMRDGTPKGYAFIHFDGNSYKINYKVAGENE
FT                   NYQMKVFAPKVVAKGRRTQAGIFVNFFMGTQGDKVLYRIDGGEWHPMQYTERTDPSYEF
FT                   LVNEWDLTEELMPGRRSSNPIKSTHLWRGNIPTNLDTGKHSIEVKAIDMFGKTYTSKSS
FT                   YRLEEAI"
FT   gene            complement(253622..255073)
FT                   /locus_tag="ZPR_0252"
FT   CDS_pept        complement(253622..255073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50613"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR041662"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCV0"
FT                   /protein_id="ADF50613.1"
FT                   /translation="MMNKITSNLLIILAVITFTACTSDFEETNSDPNRIEEISPATLLN
FT                   PIIYSLASHNAGRANAITFDLMQVSLPYPSVSGGLHRYDVSMGIGNSSWSNYYRWLKNI
FT                   QEMKAAAIINEDVNYEAIALTLNAMVYANLTDLFGPVPMTQAVMAEEGILYPEFDTQEE
FT                   IYTKILADLETANALYDTTRDMVYLQDILFQNNVERWQKFTNSLHMRLLLRISNRQPNS
FT                   FQQLADMVNNPATYPVFESTEESAILQVTGVEPNVSPWGRPQDFRLSVKIASFFIDNLN
FT                   TWEDPRRPVIATTATQTDENQNTINIGYKGIPSAYDGPESQFTYNASTFNIEQVTNPMQ
FT                   IFFLSYAEVEFIKAELAQRGFINEDAATHYENGVIAAMEQLEVEEIPTNYFENPEAAYN
FT                   GTLERIMLQKYYALYFTDYQQWFEYRRTGFPELPTTEAMFNDGVMPSRFYYPTDLAIEN
FT                   PKGYAQGVELLGGSDDINTKVWWDQ"
FT   gene            complement(255084..258527)
FT                   /locus_tag="ZPR_0253"
FT   CDS_pept        complement(255084..258527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0253"
FT                   /product="tonB-dependent Receptor Plug domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50614"
FT                   /db_xref="GOA:D5BCV1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCV1"
FT                   /protein_id="ADF50614.1"
FT                   /translation="MNTKLQFFRKLCAYYLLLSFLLLTGSAIASTNNKNFNEILIKLSV
FT                   RNANLADVFSEIESKTEFTFVFDETVTKSKEKFNFMGKKQRLSTILGLISSRTGLKFQQ
FT                   INKTISVLKAIPQQKIWGKVLDDEKLPLPGATIIEKGTSNGVTTDFDGNFSISISSYPT
FT                   ILEVSFMGFKTQEITATSTDEPLEIILQENANALNEVVVTALGIKREEKQLGFSQATVD
FT                   GESLSQTAPTNWSSGLKGKVAGMNISSSGSGPINSQQITLRGNSSFDLNGNYALIVVDG
FT                   VPINTEMTTSGSGSAYMGEDSPIDYGNGISNLNFDDIESVSVLKGPGAAALYGSRAANG
FT                   VLMITTKSGKKSKGLGITINSITSFDRIQRWPDYQYRYGQGNNYTNADGELYYSYGSSE
FT                   DGGSTGGTSSAWGPEFNDQEFFQYDPSVQGQSLERQEWRPYKDNRKDFWQTGVTTQNNI
FT                   AIQGGGKDGSMRASLAHTKNEWIMPNTGYERVTASLNSKYNISEKISLGAVVNYNNQWS
FT                   DNLPSTGYNNGSIAYFMIFQNPNVDLDWYRPIWQEGQENIQQIQPFSSYIDNPYLIAYK
FT                   SLNTLNSHQIVGNLNANIKLAPHFNLMLRTAINTYNQEREQKRPYSINRYAEGYYQTQD
FT                   VFKQEINNDFLLSYENKFKDFSLSASIGGNNRIEKRRLNNASVTGLVVPDVYKLSNGKN
FT                   APSLYTSDQNKEVNSLYGLMTWSYKDQIFLDITGRNDWSSTLPKENWSFFYPSANTSFI
FT                   LSDIFNFSGKGIEYLKYRFSYAQVGNDTSPYQTRKYYSQNNFPSSATVPTTLYNRDFKP
FT                   EISTSYETGFEARFLNNRISLDATVYQISTENQIIAVPLNWDTGYSSAILNAGKVRNRG
FT                   IELTLTGKIINNDKLKWSSTLTWSKNEGEVFNLPDNIENQYIIDQGGQASLIAKVGGSP
FT                   TAIYGYKFVRSPEGQIVYDSKGLPAYPESGDIRYVGDAMPDWRAGLYNQITLGNFDFSF
FT                   TLDGQYGGIIYSQTHHKLTQQGKLKFTYEGRDNMSIVGDGVVLNADGSYSPNTTEVAVQ
FT                   EWYNRYYRRANVESNSFEASYLKLREINLQYRFPAKWLNNTGIQSLSLSAFGRNVAMLT
FT                   DFPIYDPETAALNGNRIMPGVEIGQMPSPATYGVNLKLSL"
FT   gene            complement(258612..259544)
FT                   /locus_tag="ZPR_0254"
FT   CDS_pept        complement(258612..259544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0254"
FT                   /product="fecR protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50615"
FT                   /db_xref="GOA:D5BCV2"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032508"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCV2"
FT                   /protein_id="ADF50615.1"
FT                   /translation="MKVEEFKKLAEKYTHKKVNSQERLAMDIFFSKMQEANKNVLVPIS
FT                   SEKREKLFYNIQQNLTIKRKRTPLKKYLAMAAAGFTTLLMLGFFTGMFSNNYTTIIAEK
FT                   GEKKEIKMDDGSVIFLNGNSSITYENNFTEERTVKLQGEAFFKVARDTAHPFTIKSKDL
FT                   ETRVLGTSFNIKSYKDQVPMVSVNTGKVEVIPLKNPEYKVILTKDQQASFKENRKPKIS
FT                   KGDSRDFNAWTRKMIILKNISLEHTAKIIENWYDVNIQFADDSLKQLKITGKFNDEKLS
FT                   NVLKSLALIKNLKIDSTNKKQIIIRKNPI"
FT   gene            complement(259711..260295)
FT                   /locus_tag="ZPR_0255"
FT   CDS_pept        complement(259711..260295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0255"
FT                   /product="putative ECF-type RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50616"
FT                   /db_xref="GOA:D5BCV3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014327"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCV3"
FT                   /protein_id="ADF50616.1"
FT                   /translation="MEKEISKLTDATLYRLFKDKDPDAFQAIFDKYWKRLYSYAYKIYQ
FT                   DELICEDIVQEVFISLWEKLADTEIVHLEGYLFRAVKYRIANHIRDLKFTELHESILLQ
FT                   IPYPTTASKNIEFEEFEQQIKTLIEKLPPKCREVFKLSRYEQLSNTEIASKLNLSTRTV
FT                   ETHISNALKFLKNNIDPYQISLLITTMFIKG"
FT   gene            260600..261238
FT                   /locus_tag="ZPR_0256"
FT   CDS_pept        260600..261238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0256"
FT                   /product="2OG-Fe(II) oxygenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50617"
FT                   /db_xref="GOA:D5BCV4"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCV4"
FT                   /protein_id="ADF50617.1"
FT                   /translation="MKEELFEQLDFTVNQQYEQIIDDLLEKQYSIVDDFFDPLEILKLR
FT                   SSLLHKYEEDKFKKSAIGNRTNELIEKAIRGDFILWMNEAEAGETEKIFFHKINNLIEY
FT                   LNRTCFMGILHKEFHYAVYPKGTFYKRHLDTFQNDSRRKLSIVSYLNDENWLKTNGGEL
FT                   VIYKEDGSEEVIYPLPGRVVIFESQILEHEVKEVKNSERLSITGWLKTR"
FT   gene            complement(261421..261549)
FT                   /locus_tag="ZPR_0257"
FT   CDS_pept        complement(261421..261549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50618"
FT                   /db_xref="GOA:D5BCV5"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCV5"
FT                   /protein_id="ADF50618.1"
FT                   /translation="MQSTLPENEETFEILSFLSGYGFWMILAIILVILVLYKKFRK"
FT   gene            261695..261805
FT                   /locus_tag="ZPR_0258"
FT   CDS_pept        261695..261805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50619"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCV6"
FT                   /protein_id="ADF50619.1"
FT                   /translation="MVVQVVEKKACFLIYLKLANAAINKAKEIVKLGVSL"
FT   gene            complement(261881..262363)
FT                   /locus_tag="ZPR_0259"
FT   CDS_pept        complement(261881..262363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0259"
FT                   /product="Predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50620"
FT                   /db_xref="GOA:D5BCV7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCV7"
FT                   /protein_id="ADF50620.1"
FT                   /translation="MPIANSREKNKMIEIKRTSSSETDFQHLVSELDGELSKRNGETNE
FT                   FFAQYNKIDQIKHVIIATIDDKPVGCGAMKAYDSDTMEIKRMFVPIEMRGKGIAVHILK
FT                   NLEKWAKEMNYSKCILETGNKMLEAIRLYEKSNYKVVPNYGQYNGIEDSICFKKHL"
FT   gene            complement(262444..262608)
FT                   /locus_tag="ZPR_0260"
FT   CDS_pept        complement(262444..262608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50621"
FT                   /db_xref="GOA:D5BCV8"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCV8"
FT                   /protein_id="ADF50621.1"
FT                   /translation="MKVLPLDTLGDKAEMLGAFTGEIAAMMMPFAFFVIVAFLVYRIFK
FT                   KKKLHRDAR"
FT   gene            complement(262612..263379)
FT                   /locus_tag="ZPR_0261"
FT   CDS_pept        complement(262612..263379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0261"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50622"
FT                   /db_xref="GOA:D5BCV9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCV9"
FT                   /protein_id="ADF50622.1"
FT                   /translation="MTTTRENGSLYTSIENNIGIIEFGHPASNSFPGVLLDRLEKAICE
FT                   YSDQPEVKVILLKSEGEKAFCAGASFDELMAVENMQQGKVFFSGFAKVLNAMRTCKKLI
FT                   IGRIQGKTVGGGVGLIAACDYAMATEAAAIKLSELSIGIGPFVIAPAIERKIGIAALGE
FT                   LTLAAHEWKTAYWAKDKGIFARVFESTKDLDKEIGIFAEKLASYNPEALLEMKRVLWQG
FT                   TENWSTILMENAAISGELVLSDFTRNALAKFKK"
FT   gene            263503..264726
FT                   /locus_tag="ZPR_0262"
FT   CDS_pept        263503..264726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0262"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50623"
FT                   /db_xref="GOA:D5BCW0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCW0"
FT                   /protein_id="ADF50623.1"
FT                   /translation="MAIDKSLALRKDIEDVNEIPGIHKLLNVISCSSNMRFVAIARVTE
FT                   ERWITAVSKDDIEFGLRPGDELAVESTICNEIRQHHIPVVIEDVDHNTIFCNHHTPKQY
FT                   GFKSYISYPIFLKDGSFFGTLCAIDPKPAKINNDGVRDMFKLYTDLISYHLESIHKLRQ
FT                   ANRKIKKQDEIAELRETFVAILGHDLRNPVGTTRICADMLLSSKIPEAAKKQAEIIKST
FT                   SYRMQSLIDNLLDFAKGNIGEGISLNLSEDNNKLEKELGEVITECKIINEDRLIESEIS
FT                   LHQKVDCDTTRMAQLLSNLLNNAIKHSISKKPVLVKISSSSSQFSLSVINHGETIPKKN
FT                   QRELFKPYFKSKAKNNENGLGLGLYIASEIAKAHHGNLGVTSEDGVTSFNFSMPVESSL
FT                   ESTGTLLG"
FT   gene            complement(264723..266063)
FT                   /locus_tag="ZPR_0263"
FT   CDS_pept        complement(264723..266063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0263"
FT                   /product="multi anti extrusion protein MatE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50624"
FT                   /db_xref="GOA:D5BCW1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCW1"
FT                   /protein_id="ADF50624.1"
FT                   /translation="MAKLDTSAVSFKNINRIAIPAIIAGIAEPLISLTDIAVIGNVESN
FT                   SVEALAAAGIVGSFLSAVIWILAQTKTAISAKVSQHLGANRLHAVKTLVPQTIVFNLLL
FT                   SLFIYGITAPLATFIFSAYNAKGLILEYSVSYYQIRAIGFPLTLLTFTIFGVFRGLQNT
FT                   SWAMKCSLSGAVVNILLDYLLVYGIEGYIPAMHLEGAAYASLAAQTTMLIMALWFFFKK
FT                   TPFHLKPSLKLNPEFKPLLVMAANLFLRTLSLNIAIMLANAYATDYGENYIAAQSILMN
FT                   IWLFFSFFIDGYANAGNAIGGKLLGAKDYKNLWELSKKISKYAVLIALILMAICGIFYN
FT                   QIGILFNKDEVVLALFASAFWIVLLMQPINAIAFMFDGIFKGLGEAAYLRNLLLVATFL
FT                   GFTPALLISDYFGLKLYAIWMAFLVWMLIRASGLVIKFRRKYLNKEV"
FT   gene            complement(266088..266522)
FT                   /locus_tag="ZPR_0265"
FT   CDS_pept        complement(266088..266522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0265"
FT                   /product="GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50625"
FT                   /db_xref="GOA:D5BCW2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCW2"
FT                   /protein_id="ADF50625.1"
FT                   /translation="MIDKGINQWNENYPSKEKLATDIDKNELFKLVNTENEIMGIIVLT
FT                   PEMDEEYLPIPWITENKNNLYVHRLATDPSFWGLGNGKKLMDFAEEFARKHHYTSIRLD
FT                   TFSQNKRNHRFYESRGYQRLGDIFFPVKSEHPFHCYELVL"
FT   gene            266521..266658
FT                   /locus_tag="ZPR_0264"
FT   CDS_pept        266521..266658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50626"
FT                   /db_xref="UniProtKB/TrEMBL:D5BCW3"
FT                   /protein_id="ADF50626.1"
FT                   /translation="MASAQRSVRRFISERSFGRAGLIIRFKKLFYFNKIYKFASVKMGD
FT                   "
FT   gene            266649..266725
FT                   /locus_tag="ZPR_0266"
FT   tRNA            266649..266725
FT                   /locus_tag="ZPR_0266"
FT                   /product="tRNA-Ala"
FT   gene            complement(266751..267326)
FT                   /locus_tag="ZPR_0267"
FT   CDS_pept        complement(266751..267326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50627"
FT                   /db_xref="InterPro:IPR027823"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDN6"
FT                   /protein_id="ADF50627.1"
FT                   /translation="MNRFLIFFLLLGLKTSAQFNEKGNLYYEETIKLHGKSTQEIKEKL
FT                   HEWLLSEFEQSNIKASKNTENEMIVDITSGVDIKQGSASIPMDIYFGILSNFKDNELSI
FT                   QLSHIDIGPTQTPVKINFPDFEAFKSEMQETVDRLSGEAKAKNQAILDDEKKMKSIYER
FT                   GLQNHDQMLTAVKSYIRGLVERLKVYMK"
FT   gene            complement(267493..268392)
FT                   /locus_tag="ZPR_0268"
FT   CDS_pept        complement(267493..268392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50628"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDN7"
FT                   /protein_id="ADF50628.1"
FT                   /translation="MEITRKKNIQIEGKHNKPILCDLFFQDDQKPKPVVIFCHGYKGFK
FT                   DWGAWDKMAETFAEKGYFFVKFNFSHNGTTPENPTEFLDIEAFGDNNYSIELDDLQSVI
FT                   DWLLVPDFPDAIQIDVSHINLIGHSRGGAIAIIKAANEKRITRLVTFAAPTDLGAKFPT
FT                   GKDLEKWEKKGVQYIVNTRTKQQLPHHYQFYKNYKENKERLNVKNATKKLEIPHLIAHG
FT                   SNDTTVSISCSGELFEWSPISKLLLVENANHVFEASHPWEKEDLPEKFQYLLDRTFPFI
FT                   AAEVQDLIDEYGDNDDDN"
FT   gene            complement(268399..271140)
FT                   /locus_tag="ZPR_0269"
FT   CDS_pept        complement(268399..271140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0269"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50629"
FT                   /db_xref="GOA:D5BDN8"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDN8"
FT                   /protein_id="ADF50629.1"
FT                   /translation="MKSFIRQVLEQLQKEDTPISDLVFILPSKRAGAFLLNELSQLTSS
FT                   TIFAPKIYSIEEFTEEVSGLKSIDNTTTLFEFYEVYQKLTPKEELESFETFLAWAQSLI
FT                   HDFNEIDRYLIDAEKFFNYLADIQDINHWSKQHRTELIENYLKFWDQLPQYYSVLKENL
FT                   FEKEQGYQGLIYRSAASKVAVYASKNSNQEYVFLGFNALNSAEQVIFQELLQQNLAKVF
FT                   WDIDNVFLKDYHHEASLFIREYLKDWPFYKENPFHPEIEEYREAKDISITGIPKNIGQA
FT                   KYLAELLANKSEAELEKTAIVLGDESLLLPILNSLPPNVKDLNITMGFPLKNAPVTSLF
FT                   NSLFDLHTKSGSSYYYKNVIAIINHPSLHQILKPYASKFIQKINKENTVYLKYEEIEAN
FT                   FPATLQEFISWCFKSWENSAKKAILHFQNIVFSIKDSLTQEKAGKLQLEFLYHFHKLFN
FT                   QLQTLNTTYPHINSLTALRNFYNEIMSTQSLDFQGRPFKGLQLMGMLESRALDFENVII
FT                   TSVNEGTLPSGKSNNSFIPYDLKKSYNLPTYREKDAVYTYHFYRLLQRATKVTLLYNTE
FT                   SGGLNSGEKSRFLTQLEIEKQPNHLLKINTVSPKVPKVNNELKVIGKTPAMIEKLKDLA
FT                   NYGFSPSALTSYIRNPLDFYYQYVLGVKEEEEVEETVAYNTLGTVIHDSLEVFYKPLEG
FT                   ELLKEIHILDFRKRIDQEVSTQFYKSYTKSPILQGKNYLIFEIAKRYLSNFLDLENDRL
FT                   KKGEAIRIEKIEKNLKSKINISSLDFPVYIRGKVDRVENCNGITRIIDYKTGKVEQSKI
FT                   EIVDWENITTDYDKYSKSFQVLAYATMMKNEENIPLPLEGGIISFKNLKAGLLKFAKRE
FT                   KPRGGSKDFSINEDTFLAYEDQLEKLITEICNPAIPFTEKEI"
FT   gene            complement(271206..272618)
FT                   /locus_tag="ZPR_0270"
FT   CDS_pept        complement(271206..272618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0270"
FT                   /product="thrombospondin repeat-containing OmpA/MotB family
FT                   outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50630"
FT                   /db_xref="GOA:D5BDN9"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDN9"
FT                   /protein_id="ADF50630.1"
FT                   /translation="MKHLSRLIVLSMIVLGISSASAQDENNPWALSIGTNAVDFYPTNN
FT                   GAPLSNGFFDEYFNAGDHWNILPSVSQLTVGRYIGAGLVAEIDGSINQISDFGDRAVDD
FT                   LSYYSVDGSINYSLRAMLNDGWFDPVVGIGGGYTWIGNQDADDLENLDAPTLNGSLGIN
FT                   FWFTDNLAIFVESKYKHAFEPEMGQHFQHSAGLKFMFGGTDTDGDGIYDKNDECPETPG
FT                   LPEFNGCPDSDGDGIQDSMDDCPNEAGLAEFNGCPDTDGDGVPDPEDDCPETPGLAELN
FT                   GCPDADGDGIPDNEDECPEEAGPEENNGCPYEDTDGDGVIDPEDDCPEVAGTVANNGCP
FT                   EPTVEVINELNEYSNTVLFDFNKATIRSESEKALNSIIEIMEEYPNTVFHIGGHTDSVG
FT                   SDEYNLKLSKERAASVRQFLVDGGIPANRLTSEGYGESRPIATNSTEAGRQENRRVEIS
FT                   LDKDKEMKDSNM"
FT   gene            complement(272797..273993)
FT                   /locus_tag="ZPR_0271"
FT   CDS_pept        complement(272797..273993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0271"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50631"
FT                   /db_xref="GOA:D5BDP0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDP0"
FT                   /protein_id="ADF50631.1"
FT                   /translation="MYGSIKEHLQKEIEEIKDNGLFKRERIITSPQDAVIKINTGQEVI
FT                   NFCANNYLGLSSHPEVIQAAKDTMDTHGFGMSSVRFICGTQDIHKELEQKIADFYGTED
FT                   TILYAACFDANGGIFEPLLTKEDAIISDSLNHASIIDGVRLCKAARYRYQNGDMADLEA
FT                   QLKAANENGARFKLIVTDGVFSMDGLVAPLDEICDLADKYDALVMIDECHATGFIGEKG
FT                   IGTLEEKDVLSRVDIITGTLGKALGGAMGGYTTAKKEIIELLRQRSRPYLFSNSLAPSI
FT                   VGASLKVFEMLEKDDSLRNKLKENTKYFKQGIKDAGFDIIDGDAAIVPVMLYDAKLSQD
FT                   MADKLLEEGIYVIGFFYPVVPKEKARIRVQLSAAHKKEHLDQAIKAFTKIGKELGVID"
FT   gene            complement(274037..277159)
FT                   /locus_tag="ZPR_0272"
FT   CDS_pept        complement(274037..277159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0272"
FT                   /product="UvrD/REP family helicase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50632"
FT                   /db_xref="GOA:D5BDP1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDP1"
FT                   /protein_id="ADF50632.1"
FT                   /translation="MANNFTIYNASAGSGKTFTLVKSYLSLLFKSGKTDTYKNILAITF
FT                   TNKAVHEMKTRIVESLYAFTKKPVPESSKALLEAVAKETAHSKEEIQEKSVAILKNIIH
FT                   NYAAFEVSTIDGFTHRVLRTFAKDLGLPVNFEVELDTDKILNEAVDRLINRTGKDEKLT
FT                   KVLVDFSLSKADDDKSWDIGRDLLEIAKLLVNENNQFYLQQLQPKTLQDFETFRKKLKQ
FT                   QITNNQAEIAQKADQFFELITNSGIDATDFSGQYLPKHFLKLRANESPNFSSKWVEKME
FT                   NEGILPLKKGKMALGEAIQPQILDLFIHTKKLFFSLEFYTEIGKRLTQLSLLNALNREI
FT                   QQIKEERQILLISEFNPMISAQVKDQPAPFIYERLGERYQNYFIDEFQDTSQMQWENLI
FT                   PLIDNKLSMESLPNETSSLMLVGDAKQSIYRWRGGKAEQFIDLSNEGNPFQIQKQVYNL
FT                   PDNYRSAAEIVNFNNRFFGYAADFLGHPQYSNLFKQSAQNPKKSGSGYVNISFIEAENR
FT                   EEEQEVYPEKVIEIINNLDTKGFKRADICILTRRKSEGVAIASTLNEKEIDVVSSETLL
FT                   ISRSPEVHFICNLLKFSITPENNELKLSIFAFIQEYLLSLKDPHAVISEKIKENGNNFF
FT                   TWLQEFEFDFNLDFLNEYSVYESCEYIIRSFGLVKDSNAYIQFFLDFVYETTQKDTEGI
FT                   QGFLEIWEQENDKLSIIAPQQENAVTIMTIHKAKGLEFPIVIYPFANSDFKDTRKDSLW
FT                   VPNDEHLNDIPVSYINASSKMENWGEIPDALYTQLLFQNELDTLNVLYVACTRPVKQLY
FT                   ILSKLDLDRNGNESASKTSGLLIGYLKQNKLWKDEQKSYEFGEMEPPTSKEIENLGITL
FT                   QHFYSSATQNHAVNIVTRSGSLWDTKQQEAIEKGEIIHDLLAEINTEKDLKPVLKNAIA
FT                   NGIIAEEVSETIENILNSIITHPELEVYFSETVKNDNEREIITKSGERLRPDRLNFKEH
FT                   LVSIIDYKTGAFDTKHERQINNYGETLSNMGYQIDKKILVYTNKAISLRFV"
FT   gene            277412..278020
FT                   /locus_tag="ZPR_0273"
FT   CDS_pept        277412..278020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0273"
FT                   /product="superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50633"
FT                   /db_xref="GOA:D5BDP2"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDP2"
FT                   /protein_id="ADF50633.1"
FT                   /translation="MAFALPELKYAFDALEPHIDAKTMEIHHDKHHAGYTTKLNNAIEG
FT                   TDLEGKTIENILKNLDLSNSAVRNNGGGFYNHSLFWEVMSPDGGGKPEGELAEAIDTAF
FT                   GSFDAFKEEFSNAAAGQFGSGWAWLCVHDGGKLEICSTPNQDNPLMPEVGCGGTPILGL
FT                   DVWEHAYYLNYQNKRPAYIDAFFNVIDWKEVASRYAKEK"
FT   gene            complement(278284..280182)
FT                   /locus_tag="ZPR_0274"
FT   CDS_pept        complement(278284..280182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0274"
FT                   /product="amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50634"
FT                   /db_xref="GOA:D5BDP3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDP3"
FT                   /protein_id="ADF50634.1"
FT                   /translation="MSDAIKHECGIAQVRLLKPLEYYKEKYGTAFYGVNKMYLLMEKQH
FT                   NRGQDGAGFASIKLNVQPGERYISRIRSNQSQPIQDIFEQINQRINDEMKEHPEYADDV
FT                   ALQKRKIPYLGELFLGHVRYGTFGKNSIESVHPFLRQNNWMHRNLIVAGNFNMTNVNQL
FT                   FNNLVELGQHPKEKADTVTIMEKIGHFLDSEVRKLYKKLKKEGYTKQQASPHIAEQLNV
FT                   AKILKKSSKDWDGGYAMAGLMGHGDSFVLRDPSGIRPCYYYKDDEVVVVASERPVIQTV
FT                   FNLNFEDIKELDPGHAIITKKNGNVSITKIIEPLERKACSFERIYFSRGSDAEIYKERK
FT                   MLGRLLMPEVLKAINYDTINTVFSFIPNTAETSFYGMVEAAQDELSRQKNEAILAEKDT
FT                   LTDERLQEILAHRLRTEKIAIKDVKLRTFITEDSSRDDLVAHVYDVTYGVIKKEDNLVI
FT                   IDDSIVRGTTLKKSIIKMMDRLNPKQIVVVSSAPQIRYPDCYGIDMARLEDLVAFRAAL
FT                   ELLKDDNNYKLVEEVYEKCKQQVNLKDKDVQNFVKEIYEPFTDEQISAKISELLSEPTV
FT                   EASVKVIYQSVDNLHKACPKNLGDWYFTGDYPTPGGNRVVNRAYINFFEGNKDRAY"
FT   gene            complement(280312..281247)
FT                   /locus_tag="ZPR_0275"
FT   CDS_pept        complement(280312..281247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0275"
FT                   /product="PfkB family carbohydrate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50635"
FT                   /db_xref="GOA:D5BDP4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDP4"
FT                   /protein_id="ADF50635.1"
FT                   /translation="MNAIMSKLVIVGTVAFDAIETPFGKTDKILGGAGTYIGLSAANFN
FT                   VDSAIVSVVGGDFPQKYLDLLSSKNINIDGIEIVENGKTFFWSGRYHNDLNSRDTLDTQ
FT                   LNVLADFNPVVPEVYKDAEYVMLGNLHPLVQLSVLDQVKNPKLVVLDTMNFWMDNTLED
FT                   LKKVIAKVDVITINDEEARQLSGEYSLVKAAREIEKMGPEYVVIKKGEHGALLFHKEKV
FT                   FFAPALPLEEVFDPTGAGDTFAGGFIGYLAHTDDISFENLKNAIIYGSNLASFCVEKFG
FT                   TERMKNLSKEDINMRLEEFKKLTQFKIALK"
FT   gene            complement(281319..281780)
FT                   /locus_tag="ZPR_0276"
FT   CDS_pept        complement(281319..281780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0276"
FT                   /product="ribonuclease HI"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50636"
FT                   /db_xref="GOA:D5BDP5"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017290"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDP5"
FT                   /protein_id="ADF50636.1"
FT                   /translation="MQEQVRIYTDGAARGNPGPGGYGIVMEWVGKSYKKEFAQGFKHTT
FT                   NNRMELLAVIEALKKLKKPNLNIRVFTDSKYVVDAVEKKWVFGWEKKNFKDRKNADLWK
FT                   DFLKEYRKHQIVFTWIKGHNNHPQNERCDALAVKASKEKELLEDTGFKN"
FT   gene            complement(281784..282383)
FT                   /locus_tag="ZPR_0277"
FT   CDS_pept        complement(281784..282383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0277"
FT                   /product="phosphoribosylglycinamide formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50637"
FT                   /db_xref="GOA:D5BDP6"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR004607"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDP6"
FT                   /protein_id="ADF50637.1"
FT                   /translation="MSDQPKNNNVRKIVIFASGSGSNTENIIRYFENSENIKVVAVFSN
FT                   KRNARVLRRAYDLDVQALHFDRDSFYHSNDVLHVLKDIDPDLIILAGFLWMVPKNIIEN
FT                   FPNRIINVHPALLPNYGGKGMYGMRVHEAIITNKEKESGITIHFVNEHYDEGEHIFQAK
FT                   TIIEEHDSPESLASKIHELEHHHFPMVIEQLLKKDS"
FT   gene            282531..282767
FT                   /locus_tag="ZPR_0278"
FT   CDS_pept        282531..282767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0278"
FT                   /product="acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50638"
FT                   /db_xref="GOA:D5BDP7"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDP7"
FT                   /protein_id="ADF50638.1"
FT                   /translation="MSDIASRVKAIIVDKLGVDENEVVNEASFTNDLGADSLDTVELIM
FT                   EFEKEFDIQIPDDQAENIATVGQAISYIEDAKK"
FT   gene            282814..284037
FT                   /locus_tag="ZPR_0279"
FT   CDS_pept        282814..284037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0279"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50639"
FT                   /db_xref="GOA:D5BDP8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDP8"
FT                   /protein_id="ADF50639.1"
FT                   /translation="MGALTPIGNNISEYWDGLVNGKSGSGPITHFDPEKFKTKFACELK
FT                   DFNPLDHFDRKEARKLDKFTQYAMVASDEAIADSGIDLDAVDKYRVGVIWGAGIGGLET
FT                   FQNEVLNFAAGDGTPRFNPFFIPKMIADIAPGNISIKHGFMGANYTTVSACASSANAMI
FT                   DALNNIRLGYSDVIVSGGSEAAVTIAGMGGFNAMHALSTRNESPETASRPFDATRDGFV
FT                   LGEGAGALILEEYEHAKARGAKIYAEVIGGGLSSDAYHMTAPHPDGNGVVRVMENCLRN
FT                   AGIKPEDVDAINTHGTSTPLGDVAELKAITKVFGDHAKNININSTKSMTGHLLGAAGAI
FT                   EGIASVMAMQHGIVPPTINHENVDENIDPSLNLTLNKAQKREMNIVMSNTFGFGGHNAC
FT                   VAFKKLTE"
FT   gene            284182..284775
FT                   /locus_tag="ZPR_0280"
FT   CDS_pept        284182..284775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0280"
FT                   /product="putative ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50640"
FT                   /db_xref="GOA:D5BDP9"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/Swiss-Prot:D5BDP9"
FT                   /protein_id="ADF50640.1"
FT                   /translation="MKDPSGNPINYERLEFLGDAMLGSVIASHLYQEVPEGDEGYLTKM
FT                   RSKIVSRKHLNELGKDLNLIRFVKSNIPNDQFGVNIHGNIFEALVGAIYLDRGYKYCNR
FT                   FIYNRVIEPYVDIETLEGRVISYKSLLIEWCQKQKKEFNYQVYEDTGRDELKHFAVKLW
FT                   IDKKVIAKARATSKKKAEEKASKRAYYALQNKMN"
FT   gene            284893..285381
FT                   /locus_tag="ZPR_0281"
FT   CDS_pept        284893..285381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0281"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50641"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDQ0"
FT                   /protein_id="ADF50641.1"
FT                   /translation="MQAHKMLLDEVEEVDFKLIAIYANLEPYKMAFLLNRFLNLKLMRS
FT                   RFDVDFNHKDVQAMYALFTYKDLANYRDYYLVSNKFKGKARKILNAGSLFLEEEVRPLE
FT                   VNLIPQYKKVDFFLKIEENIEDQQVHQLVNLIGRIPQVQAAYKIHVDQLKSKQNLIFE"
FT   gene            285381..286811
FT                   /locus_tag="ZPR_0282"
FT   CDS_pept        285381..286811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0282"
FT                   /product="pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50642"
FT                   /db_xref="GOA:D5BDQ1"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDQ1"
FT                   /protein_id="ADF50642.1"
FT                   /translation="MPTNKKTKIVATLGPATSSKDTLKEMLQAGVNVFRINFSHANYED
FT                   VRERVQMIRDLNEEEGFTAAILADLQGPKLRVGTMKEDVVVAQGDEIVFATGERFEGSK
FT                   ERVYMNYDAFPRDVNEGERILLDDGKLIFEVVSTNRENEVVAKVIQGGPLKSKKGVNLP
FT                   NTNISLPALTEKDVKDAEFACKLEVDWIALSFVRHEKDIIELQDLIKEHTDYKIPIIAK
FT                   IEKPEGVENIEKIVAYCDGLMVARGDLGVEIPAQEVPLIQKKLVLVAKKARIPVIIATQ
FT                   MMETMITSLTPTRAEVNDVANSVMDGADAVMLSGETSVGQYPVQVIQKMASILRSVENS
FT                   PLIKVPHDPPHVRTKRYITKSVCFHAAHMANEIKAKAICTLTNSGYTAFQISAWRPESH
FT                   ILVFTHNKRILNRLSLLWGVKAFYYDKYSTTDETIDDINNIAKSGGFVTQGDFTINLAA
FT                   MPISSKGMVNTLRVSEIE"
FT   gene            complement(286907..287971)
FT                   /locus_tag="ZPR_0283"
FT   CDS_pept        complement(286907..287971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0283"
FT                   /product="DNA polymerase IV 2"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50643"
FT                   /db_xref="GOA:D5BDQ2"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR024728"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDQ2"
FT                   /protein_id="ADF50643.1"
FT                   /translation="MDAFYASVEQLDNPELRGKPIAVGGSSQRGVVSAASYEARKFGVR
FT                   SAMSSVIAKRNCPDIIFVKARFDRYREISQQIRSIFFEYTDLVEPLSLDEAYLDVTENK
FT                   KGNPSATMIAREIREKIKQKTGLNASAGISVNKFIAKVASDINKPNGQKTVNPEEVLDF
FT                   LEQLEIRKFYGVGKVTAEKMYRLGIFTGKDLKSKSEAYLADHFGKHGPYYYNVVRGIHE
FT                   SEVKPNRMRKSLGAERTFSENISSEIFMLEKLTNIAEEIERRLQKSKVAGKTVTLKIKY
FT                   SDFTLQTRSKTISYFISSKELILEMAKELLYQEKMKDSVRLLGISLSNLNTDSPSVKTK
FT                   EEKKEVAVQLKFDF"
FT   gene            288092..288766
FT                   /locus_tag="ZPR_0284"
FT   CDS_pept        288092..288766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0284"
FT                   /product="NAD dependent epimerase/dehydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50644"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDQ3"
FT                   /protein_id="ADF50644.1"
FT                   /translation="MEKTAIVLGATGLTGRHLVEELLKNENYTKVSLFSRSKLGKVHAK
FT                   LEEHLIDVLKLESHKEAFKAHDVFCCIGTTKAKTPDKEKYKKIDYGIPVTAAKLAAKNG
FT                   AECFVVISAMGADANSRIFYNRIKGEMEQDVMVANIPNIYIFRPALIVGDREEKRIFEK
FT                   VATHAFKLFNFMLVGNLKKYRSVRCENIAKAMMHVANFWYSDSIIKSNKINELAAKYDG
FT                   RN"
FT   gene            288753..289220
FT                   /locus_tag="ZPR_0285"
FT   CDS_pept        288753..289220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0285"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50645"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDQ4"
FT                   /protein_id="ADF50645.1"
FT                   /translation="MVEIERKFLVKNEDFKAEFYQKNRITQGFLNTDPLRTVRIRIKDE
FT                   TAFLTVKGKNNEAGLSRFEWEKEIDKTEAEALLKLCEPGMIDKARFLVKSASHIFEVDE
FT                   FYGENEGLIVAEVELASETENFEKPKWLGQEVTGDPKYYNSQLSKNPYKSW"
FT   gene            289238..289705
FT                   /locus_tag="ZPR_0286"
FT   CDS_pept        289238..289705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50646"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDQ5"
FT                   /protein_id="ADF50646.1"
FT                   /translation="MILSLIFISCHTDKSTSAEEDKEEKEDKISAEEMSKHLQEDGFKS
FT                   FTYKEGDTTYLMQQYYMVFLKTGPNRDQDSLSLAKLQQQHMAHLERMGNEGYASLIGPF
FT                   EDSSDIKGIAVYNTRTLKEADSLANLDPMVKAGRLTIEVHPWWTAKGNKLN"
FT   gene            complement(289702..289998)
FT                   /locus_tag="ZPR_0288"
FT   CDS_pept        complement(289702..289998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0288"
FT                   /product="putative thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50647"
FT                   /db_xref="GOA:D5BDQ6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDQ6"
FT                   /protein_id="ADF50647.1"
FT                   /translation="MSTFGDIIADENPVLIDFYADWCGPCKTLAPILKEVKTELGENIK
FT                   IIKIDVDKNQQLAAKYQVRGVPTMMLFKNGAQLWRQSGVIQKQDIINIIKSKA"
FT   gene            289991..290116
FT                   /locus_tag="ZPR_0287"
FT   CDS_pept        289991..290116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50648"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDQ7"
FT                   /protein_id="ADF50648.1"
FT                   /translation="MLILFVLRGGLSLLKFHKIPQYFFTILMLQLYVNLGNSEEN"
FT   gene            complement(290142..291254)
FT                   /locus_tag="ZPR_0289"
FT   CDS_pept        complement(290142..291254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0289"
FT                   /product="adenylate cyclase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50649"
FT                   /db_xref="GOA:D5BDQ8"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDQ8"
FT                   /protein_id="ADF50649.1"
FT                   /translation="MGKYYAVNFYSFSNQYPFVTKIIKQIIFWIFAYGLLFLIIHFTAL
FT                   SVLQAMGRPTDISISGVLTLFLSLGALLGLALGIIDHFLKNYMFRNRSLGFNILVGGVL
FT                   YFTVLTSIIFLLRYIVIEFISGTFLNQYTEHIIRMNWEYYNVIILSYTLFMTLVLSFIN
FT                   QMTNKFGPGLILPFLLGKFRYPAEENRLFMFLDLKDSTQLAEKLGHLRYSAFIQESFMD
FT                   INQMVKKYNAQIYQYVGDEIVVSWPLRCFDSSLAIEFFYAVHKRFQHKKEHYLRAYDHV
FT                   PVFKAGAHQGLVTAVEVGDIKREIAYHGDTLNVASRIEGLCKTYDKLILISGKVNENPK
FT                   IGENFIVKPLGPQKLEGREMSVDVFCVAEK"
FT   gene            291451..292647
FT                   /locus_tag="ZPR_0290"
FT   CDS_pept        291451..292647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0290"
FT                   /product="mutator family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50650"
FT                   /db_xref="GOA:D5BDQ9"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDQ9"
FT                   /protein_id="ADF50650.1"
FT                   /translation="MKKEDLFSDEFLKQFKSGDELNGFLKQLQKRGIEKMLEGELDGHL
FT                   GYDKSQKSDNPNTRNGFGQKRVCTSFGESQIQVPRDRDASFNPMIVPKRGNMVDGIENV
FT                   IVSLYAKGMSNSDIEEQIREVYNFEVSTSTISRITEKVTEDIVAWQNRPLEPVYLIVWM
FT                   DGIVFKVRENSKVINKTIYIAVGLRRDGKKEVLGLWLGKNESAAFWMSVLTDIKSRGTE
FT                   DILITATDNLNGFTDTIRNVFPESKTQICVVHQIRNACRYVVWKDKKAFTADMKHIYNA
FT                   PNQQAAKAALDDFAKLWESKYSYAIKSWRDNWEDLTIFFEFPLEIRKIIYTTNLIENLN
FT                   GKIRKYTKNKLSFPTDEAVMKSVYLATREATKKWSMPIRNWGIILNQFLTIYEKRVRL"
FT   gene            complement(292777..294174)
FT                   /locus_tag="ZPR_0291"
FT   CDS_pept        complement(292777..294174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0291"
FT                   /product="OprM-like outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50651"
FT                   /db_xref="GOA:D5BDR0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDR0"
FT                   /protein_id="ADF50651.1"
FT                   /translation="MKFLIKFKFIGLSLVVLSLQSCFVAKDYEQPDIIEEENFRTDSIP
FT                   QDSLTMANVSWRDMFTDPILQNHIEEGLQNNIDIRVALQQILYAEAYLKQGKAGYFPSI
FT                   TGNASVTRQELSSNSQFGGFFSSLDQYEISADLSWEADIWGKIRSQKRAYEASYLQSVA
FT                   AHQAVKTTLISNIASTYYQLLSLDEQRKVTERTIENREKSLETNKALKEAGNITEVGVK
FT                   QTEAQLYTAQALLVDINNQIRLLENTMSILLGKEPQDINRSVLADQTIETELKTGVPAQ
FT                   LLRNRPDVIQAEYGLVNAFEMTNVARANFYPSLTLTATGGFQSLDLGELIDTNSLFATI
FT                   VGGITQPIFQRRQIKTQYEASQAQQEQARLQFRQAFLTATKEVADALYNYEAASDKIEI
FT                   KEKEYSAYETATNYSQELLDNGLANYLEVLTARENALNSRLDLINAKYSQLNSMVNLYQ
FT                   ALGGGWQ"
FT   gene            complement(294182..297322)
FT                   /locus_tag="ZPR_0292"
FT   CDS_pept        complement(294182..297322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0292"
FT                   /product="AcrB/AcrD/AcrF family membrane transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50652"
FT                   /db_xref="GOA:D5BDR1"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDR1"
FT                   /protein_id="ADF50652.1"
FT                   /translation="MLKTFIERPVLSTVVSILLVILGVLGLTALPITQYPDIAPPTITV
FT                   STSYPGANAETILESVIVPIEEQINGVEGMTYLTSTATNNGTAEITVFFDQEIDPDIAA
FT                   VNVQNRVARANPLLPAEVKQTGVTTQKQQTSALMFLSFYSTNKDYDDTFIQNYLKINVI
FT                   PEIQRVNGVGNVNVFGQKDYAMRIWLQPEKLTAYNLVPSDVIAALNEQSLEAAAGALGE
FT                   NNGEAFSYTIKYSGRFKTEKEYKNIIIKALGDSEYLRLKDVAEIELDAQSYNGGSMTKG
FT                   NPAVNMAIFQTKGSNARDIIQTIKVKLEDIEANLPEGIEIYIPYDTNNFLNASIDKVVH
FT                   TLVEAFILVFIVVFIFLQDFRSTLIPAIAVPVSIIGTFFFLNLFGYSINLLTLFALVLA
FT                   IGIVVDDAIVVVEAVHAKIDEGADNAKNATLDAMHEISGAIVSITLVMAAVFIPVTFIT
FT                   GPTGVFYEQFGITLIVAIFISAVNALTLSPALCALFLKTHNEKEDKKKNFLQKFYAAFN
FT                   RGFNATINRYGKSLQFLYKNKWISALILILAVAGIWWTSSTTPTGFVPDEDRGLLFVNV
FT                   ELPAGASIDRTSQVNNELYQKIKDIPGVEGVSVINGRSLISGAGSNYGLGFVKLQDWEE
FT                   RDTDELSLKAITGKLFGIAATIPEANIIFFAPPSIPGFGNSAGFEVNLLDRSGSSFEEL
FT                   DAANQEFIGKLMQRPEIQYAQSSFNTKYPQYEINLNVPLAKDKGVSVSEIFSTLQGYIG
FT                   GIYAADFSRFGKQYRVYVQALPQDRATKSDLNRLYVRTESGEMSPITQFVTLKRVYGPQ
FT                   SVTRFNLFNSTKLTGATNPGFSSGDAITAIEEVASTLPGNYGTAYSGLTREEVNAGNQT
FT                   TTIFLLSIVFVYFLLAAQYESYLLPLSVLLSLPLGVFGAYLTTKLAGLQNDIYFQIALI
FT                   MLIGLLAKNAILIVEFAIQRRKRGESIVDAAIDGAKARLRPILMTSFAFILGLMPLVLA
FT                   SGVGAEGNRAIGTGAAGGLLIGTITGVFVIPMLFILFQWLQEKIGKKPEAVNTNNQE"
FT   gene            complement(297342..298478)
FT                   /locus_tag="ZPR_0293"
FT   CDS_pept        complement(297342..298478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0293"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50653"
FT                   /db_xref="GOA:D5BDR2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDR2"
FT                   /protein_id="ADF50653.1"
FT                   /translation="MRKSILNISLLAGILLLISCGNDSEKSQQAAGAQAQQAKPYPVIE
FT                   IITKTVEGNTSYPVNIEGIVNSEIRAKVSGYINKVMVDEGEKVKKGQILFKLETQSLNQ
FT                   DAQAAQANVNAAQVEVDKLKPLVEKDIISEVQLETAKAKLQQAKSSYNSIAANIGYANI
FT                   KSPVDGYVGSIRLREGALVSPTSQQPLTTVADISKVYAYFSMNETDYLNFLQNKRGESF
FT                   DEIIKNLPNVKLRLANGTMYSEEGRIETINSQVNANTGTVSFRAVFDNSSRILTNGNSG
FT                   SILIPEVYKDAVVVPQSATFEQQGSIMVMKVGEDNKVTSSAIKTKDEIGSLYIVESGIK
FT                   QGDKIVAKGVSKIRPGSEIKPQPLPFDSIAEPIEKIFK"
FT   gene            complement(298498..298980)
FT                   /locus_tag="ZPR_0294"
FT   CDS_pept        complement(298498..298980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0294"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50654"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDR3"
FT                   /protein_id="ADF50654.1"
FT                   /translation="MECCSEEKKKLIEEVGLHFEKAKQMSPLAARIYAIMILSPYDGHT
FT                   FDEILEMTCASKSSVSTQLNLLLQLKKVEYFTKSGDRKRYFRASKSYLINTLKEDLERV
FT                   KEEIALINKITEFNSLYNQHKYEEHGVISVLFRAYLIKQQGNMKDTIEKMSKFKNQ"
FT   gene            complement(299062..299889)
FT                   /locus_tag="ZPR_0295"
FT   CDS_pept        complement(299062..299889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0295"
FT                   /product="phospholipase A1"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50655"
FT                   /db_xref="GOA:D5BDR4"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDR4"
FT                   /protein_id="ADF50655.1"
FT                   /translation="MKILFALFTFCFLLKPVYAQRLTKEELQDSVKTIPSFTIHKDNYF
FT                   ITGVPTHTGISKKTADAKYQVSFKQLLFRKKVPQDSYLFLKYTQKAFWNIYEFSSPFKE
FT                   INFNPGIAYSKYFYDKSNKVNSLATLALEHESNGRDSIYSRSWNFVSLEYHWAISKKLV
FT                   AGVKAWLPFYYKESNPDLMDYSGYGQLNFDYEFIPNRLYAQLMLQKGLSLDWKGAARPR
FT                   ILYNPFNSVNQFLVLEWFTGYDENLIEYDRYRSVIRIGFLLKSNEFDFLRARK"
FT   gene            complement(300064..301128)
FT                   /locus_tag="ZPR_0296"
FT   CDS_pept        complement(300064..301128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0296"
FT                   /product="L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50656"
FT                   /db_xref="GOA:D5BDR5"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDR5"
FT                   /protein_id="ADF50656.1"
FT                   /translation="MKNLLLLLSIFVFIACGNTSEKETTPAFTSEAKPQDDIPNFGIVI
FT                   HGGAGTILKENMSDSLEKAYKTKLEEAIRTGHEILANGGTAIEAVQRTINVMEDSPLFN
FT                   SAKGAVFANDETNQLDASIMDGKTLNAGAVAGVTNIKNPINLAYEVMENSEHVLLAGKG
FT                   AEEFATQRGLEIVDPSYFYTENRFKSLQKVKEREREKSGNKTAANYDSFIKDSKFGTVG
FT                   CAALDKNGNLAAGTSTGGMTNKKWNRIGDSPIIGAGTYANNATCAVSSTGWGEFFIRGV
FT                   VAYDISALMEYKGLSLQEAAAEVIQKKVPEMGGDGGIIAIDHDGNVAMEFNTAGMYRAT
FT                   MNKKGELKIGIYGE"
FT   gene            301306..301920
FT                   /locus_tag="ZPR_0297"
FT   CDS_pept        301306..301920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0297"
FT                   /product="putative 3-hydroxyanthranilate 3,4-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50657"
FT                   /db_xref="GOA:D5BDR6"
FT                   /db_xref="InterPro:IPR010329"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDR6"
FT                   /protein_id="ADF50657.1"
FT                   /translation="MPRYLSIFGVLLFILCNFRFKNYIMAVAKPFNLTKWIEENRDTLK
FT                   PPVGNRNLYREADDYIVMIVAGPNARKDYHYNETEELFYQLEGNIEVHIQDEGVKKTMK
FT                   LGPGDMYLNPAKVPHSPVRHENSLGLVVERKRVDLPGEDGLLWFCDHCNHKLHEVYFPL
FT                   EDIEKDFLKHFKDFYASEDLRTCDNCGEVMPTDPRFVADED"
FT   gene            301954..303507
FT                   /locus_tag="ZPR_0298"
FT   CDS_pept        301954..303507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0298"
FT                   /product="aldehyde dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50658"
FT                   /db_xref="GOA:D5BDR7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDR7"
FT                   /protein_id="ADF50658.1"
FT                   /translation="MSQIAKDFGIDKALEELGLQDINNGTSTGKDFFSGGEIIESYSPV
FT                   DGALIGKVKATTPEDYEKVITTAEKAFKEWRTMPAPQRGEIVRKFNDELRRLKEPLGKL
FT                   VSYEMGKSYQEGLGEVQEMIDICDFAVGLSRQLHGLTMHSERPGHRMYEQYHPLGVVGI
FT                   ISAFNFPVAVWSWNTALAWVCGDACIWKGSEKTPLTSVACQNIAARVFSENGVPEGISC
FT                   LITGDYKVGELMTKDERIPLISATGSTRMGKTVAKEVAGRLGKSLLELGGNNAIIVTPD
FT                   ANIKNTVIGAVFGAVGTCGQRCTSTRRLVVHEDVYDKVKNAIVDAYQQIKIGNPLDENN
FT                   HVGPLIDKDAVKNYQAALEKVVEEGGKVLVEGGVLEGEGYESGCYVKPAIAEAENHFEI
FT                   VQHETFAPVLYIMKYKGDVSNALELQNGVRQGLSSAIMTNNLREAERFLSVEGSDCGIA
FT                   NVNIGTSGAEIGGAFGGEKETGGGRESGSDAWKVYMRRQTNTINYTTELPLAQGIKFDL
FT                   "
FT   gene            complement(303627..305315)
FT                   /locus_tag="ZPR_0299"
FT   CDS_pept        complement(303627..305315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50659"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR010602"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDR8"
FT                   /protein_id="ADF50659.1"
FT                   /translation="MLQYQLQSYTISSDHELLDNENHITSKIREILESIHPDVLKGKGY
FT                   LLKKLPRLIKQYPRVPALKNFLATLHKERGEMEQAFKANRWLVKEHPNYLFGRLNLAAE
FT                   YLENDQLEKIPEVLGEMMELKSLYPNREEFHIEEFIAFNQISVLYFLAQDEIEQAEMRV
FT                   DMMVKVAPDHPKTEYAQDRIKQFMLIKAAERKQRENEEYHSPAVTDRRSHLQTDKAPVF
FT                   NFPIQMQWLYEEDYDFPKNKLETILKLEREPLIEDLKKLLNDSIARYDYFMEDDEMDLL
FT                   LFPIHTLFILEELNAEQALPEIFEILKQDEDFYEIYFGDFANNVVASILFTFGENNLQQ
FT                   FFDFLKTPNLYGLSKSYVSEGIAFLANEKSALRESIQSHYKDLLLYFIAEKQNENLIDH
FT                   EAYGLIIADIIDLRMEELLPQIKELYQLNLVAKSINGEFDSIEEAFKKPEFISEQAKLP
FT                   KADLFKKYEIWKADYEAYLEKEFNDFDEELEDDDFSLYDRFFEDEEPEDDFDMDDVPFD
FT                   EEAFQHLIMNNEDQQPIIKQKEPGRNDPCPCGSGKKYKKCCLNKK"
FT   gene            305442..306296
FT                   /locus_tag="ZPR_0300"
FT   CDS_pept        305442..306296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0300"
FT                   /product="bacterial regulatory helix-turn-helix protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50660"
FT                   /db_xref="GOA:D5BDR9"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDR9"
FT                   /protein_id="ADF50660.1"
FT                   /translation="MFVGVMATATFFTCKPSTKLQPYIAYYYFHESDDEDFQQSFTYYP
FT                   HYKNALTIYKNVDYNILPDFSVEVSSAKKDSLKVVYSKLYQNLGRVRINGKFVKIGVVF
FT                   QPLGIQHFIKEVYSEVFSKPINFTNPFGLKFNEVLDQVFLTSIISEKANLLDKFFQQQC
FT                   LGFEEERIIGAVNKIIESKGMISVSALARDLDIHRKTLLRLFQKHLDCSVEEYRKLVRF
FT                   RFALEKIQQQNNINLTTVSAEHYYDQSDFIKQFKKLTQLSTKKFMVAVSKLGDEDTFWN
FT                   FNG"
FT   gene            306630..307505
FT                   /locus_tag="ZPR_0301"
FT   CDS_pept        306630..307505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0301"
FT                   /product="beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50661"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDS0"
FT                   /protein_id="ADF50661.1"
FT                   /translation="MNNIYFSLILLVVISSGFAQTNPELQKMADADQSERMSGNINWVE
FT                   LNKKDSIRLAKATQLFNDGELETAKDYYNAGIIFQHGKDTIASKMAVESFKKAIEMDST
FT                   LNRWWYAAAVDRDLMRREEPQIYGTQYVSNSSTNGKLKRYKIDTTKITDKERIYYRVET
FT                   LEEQKQKERIMNLKSIFSFYVENSSIEKTIALIKNEKAKGKTSVYNVSESAINSFGYQL
FT                   MGQNKLDESLKVLKLNTALYPKAANTWDSYGEILLKLGKEKEGIKAYKKSLALDPNNEN
FT                   AKNIIRKSED"
FT   gene            complement(307517..308242)
FT                   /locus_tag="ZPR_0302"
FT   CDS_pept        complement(307517..308242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0302"
FT                   /product="LytTR family two component transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50662"
FT                   /db_xref="GOA:D5BDS1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDS1"
FT                   /protein_id="ADF50662.1"
FT                   /translation="MMRNKSFTCYIIDDEPPAVRILEKFIQQLEVLSLLGSSNKSLEAL
FT                   NEIQLKKPDILFLDIQMPDLTGIQLSKLINYSPYIIFTTAYAQFAVEGFQVNAIDYLLK
FT                   PIAFPRFIEAIEKIKERQQTTPLDGLIAPTQDYFFVKTDGKNRFQKVALPDILYLESIK
FT                   NYVVIHTKNEQIVTYSTLKSIQESLPELSFIQVHKSYIVALDKIEKTDNYEVWIDGKDL
FT                   PLGDTYKHGFFEAIHQRKL"
FT   gene            complement(308251..309282)
FT                   /locus_tag="ZPR_0303"
FT   CDS_pept        complement(308251..309282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0303"
FT                   /product="histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50663"
FT                   /db_xref="GOA:D5BDS2"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDS2"
FT                   /protein_id="ADF50663.1"
FT                   /translation="MNEKQEIRYNLLFWGLFVGMDLYFEFLLGKYETFSLWLLLHKIGF
FT                   FFLQALIFYWVYLGVAPYTIPQKRWLKLIGGIVISIFLFAGIRYVIEEVIIYQITGAHN
FT                   YSDYSRRWLFYIYDNSYYAFRIILLSLVFYGVKYLLTVNQELHQLQLDKKQAELRVLKS
FT                   QLSPHFLFNTLNSFYADALEVDLNLSNDILKLSEMLRYITYENDTEIVPLKGELTFLQH
FT                   YIALFERRFDNKLYIESRFPENPEEYQIPSLLLIHFIENTFKHGILDDPLQPVWLDISI
FT                   DNMYLKMEVNNAVKAGDNYDEKGIGYKNIRQRLDLIFGKTYALNIDEEKNYFKVFLQFP
FT                   LTR"
FT   gene            309574..311946
FT                   /locus_tag="ZPR_0304"
FT   CDS_pept        309574..311946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0304"
FT                   /product="protein containing tonB-dependent Receptor Plug
FT                   Domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50664"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="InterPro:IPR041700"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDS3"
FT                   /protein_id="ADF50664.1"
FT                   /translation="MLCFCFACIQLHAQHQINGKIIDKKTGEALAYANVLIKDPDNKSI
FT                   ITYAYSNEKGVFILEDIELDVILLEVDMMGYQSYHTILEGDALHSELEIRLAEDASQLE
FT                   EVNIIAKKKAIRISGDKMIFNLEKLGIITSSNGLEALRQLPGVSLDKDENVQFRGNADV
FT                   QLMINGKPTLLKGDALREYIRSLSGQNIENVEIIAQPSARYDASGTAGIININLKQPKA
FT                   ASFSGNVYSSVGYAEYFKNRNGLNLYYNDSKWNINLGANYNRNNSVNHRNITQTIQLED
FT                   SIKVLDQQNEWLPKTISKNFTAGIERNFSKNHKISTAFNYANSHSGELTLGTTNEYGND
FT                   NLYRQVKLRKEIEEPTKNTSGNLFYNYISDSLDTQLDVQLNYADYEKSQEGLLQNTYPI
FT                   NPTPQNEFLLDIFEEIHYKLFTAQADGQHRFSKQLKLESGAKLSRIKMNYSSDYAANDS
FT                   SQLFIPEDLLTNNFTYKEQLFSAYIQGSYQLGKWNVLTGIRAEYIDYSGFSEQLNQTNS
FT                   NNYIAWFPSMSINYEKENHQYRLSYSRRIGRPNYLDLNPYYQYLDPYTLEIGNPALQPQ
FT                   FYHSFEFNYIYKNAMSASLYGNFYNDQLTSVIDYRDNENYNLLFTANGATGNRLGISLN
FT                   LPFEPVDWWNFQFSFDGYHTREESKIVNFSYDRSGFGYSMEMYHNLTLKDNWTLNASGF
FT                   YSGRSQSGNSVMNPLYDISVNVKKMLLDDKLKLELGCQNILKKSMWNSVIQQDNVTTHW
FT                   INRWETRKFVFGATYNFGKGTSKKVKPTSLQEESSRM"
FT   gene            311951..312052
FT                   /locus_tag="ZPR_0305"
FT   CDS_pept        311951..312052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0305"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50665"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDS4"
FT                   /protein_id="ADF50665.1"
FT                   /translation="MLQRFQSISGFYKIEDKEVNNANAKNQYVKKTK"
FT   gene            complement(312061..312645)
FT                   /locus_tag="ZPR_0306"
FT   CDS_pept        complement(312061..312645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0306"
FT                   /product="PhnA protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50666"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="InterPro:IPR013991"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDS5"
FT                   /protein_id="ADF50666.1"
FT                   /translation="MSVLEKKLVDRSGHKCELCGYEHDLQIYQVPPTSEGTLEDSILAC
FT                   ETCVAQIEDPEKVEPNHWRCLNDSMWNEHLPVQIVAWRMLNRLRAVGWPQDLLEMMYLD
FT                   EDALAWAKATEDTQDESEKIIHKDSNGNILADGDSVVLIKDLDVKGANFTAKRGTPVHR
FT                   ISVVWDNAEQIEGRVEGQQIVILTQYVKKTK"
FT   gene            complement(312773..313996)
FT                   /locus_tag="ZPR_0307"
FT   CDS_pept        complement(312773..313996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0307"
FT                   /product="peptidase family S41"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50667"
FT                   /db_xref="GOA:D5BDS6"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDS6"
FT                   /protein_id="ADF50667.1"
FT                   /translation="MTISQTSLKKLNSKKTYQKLLIFTFIFFGTYSALGQTSACDCLTV
FT                   LDDASSLIQHSKSYKVQIKKEDREQEFQQWKDKIVLQIKKDNLRSFFCAGYLQKYITFI
FT                   NDRHNQIYKIPETVAEHIPTYQKPIDTTKVKDKISGIYYAGRDQIFVKKETDSLWYGIT
FT                   LKSASEGWEKGKIRLKIQKTKEGHLELFEFYPNGVLSYQNNITINDGRIQRTFWNKANR
FT                   YFFQINHEQNFNYKSVNKNFDYIGIKTLSRTRNLMKEAEAFYEKNLKNLRKENLIVDLR
FT                   NNGGGATKQAAPLFKWLKKNKHIKQVFVLINFQTASAAELTALQLKKDRRTIIAGENSR
FT                   GMLAYGYGNQSFSAKTKCPEFSVNFSTKHKNGKLNQYEKKGITPELYLQNTSNWINQIL
FT                   EFNEKNQL"
FT   gene            314328..314720
FT                   /locus_tag="ZPR_0308"
FT   CDS_pept        314328..314720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0308"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50668"
FT                   /db_xref="GOA:D5BDS7"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDS7"
FT                   /protein_id="ADF50668.1"
FT                   /translation="MSIFSKDTIEEEHKKKQADFQEEDVETVLDEEEKIKSKFESKNAL
FT                   RRYFDDAQLLFNLVRDYASGEYRDIPFNIVAAVGAALLYVLSPIDLIPDFIPVIGYLDD
FT                   AAVIAFCLSLIERDLAAYKVWKNSKS"
FT   gene            complement(314795..315799)
FT                   /locus_tag="ZPR_0309"
FT   CDS_pept        complement(314795..315799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0309"
FT                   /product="family 2 fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50669"
FT                   /db_xref="GOA:D5BDS8"
FT                   /db_xref="InterPro:IPR005067"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDS8"
FT                   /protein_id="ADF50669.1"
FT                   /translation="MALENIRLEVMKTIESKVDGFIDKYLIPVDNIWQPTDLLPNLQGE
FT                   EGMEHVKQIREEAKELGYDFWVVLVADMVTEEALPTYESWLMDVEGVDQQRRADGEQNP
FT                   WSKWVRHWTGEENRHGDTLNKYLYLSGRVNMREIEKTTQHLINDGFDIGTGRDPYKNFV
FT                   YTSFQELATNISHKRVGQLAKKKGNKMLGKMCNIIAGDEMRHYMAYREFVKTIFEHDPS
FT                   EMMLAFHDMMKKKIVMPAQFLRESGEGIAQAFENFSNAAQRLGVYTTYDYIEILKKLNE
FT                   YWEIDKMRALTDEAEKARDYLMKLPDRMTRIADRIAIPQDQYQFKWVEPNGII"
FT   gene            complement(315965..316696)
FT                   /locus_tag="ZPR_0310"
FT   CDS_pept        complement(315965..316696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0310"
FT                   /product="metallophosphoesterase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50670"
FT                   /db_xref="GOA:D5BDS9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDS9"
FT                   /protein_id="ADF50670.1"
FT                   /translation="MGRTLSIGDIHGGLKALKQLLHDKVKVTTEDTIIFLGDYVDGWSD
FT                   SANVVSYLIELAKDFDCIFIRGNHDDLTHQYLKSGAITDRWVIHGGQSSIDGYAKLSSK
FT                   EIQQHLLFFSAMQNYYIDDQNRLFVHAGFTNLHGPENEYYDTGFYWDRTLWEMAISLDP
FT                   NIEKTSEFYPKRLQIFDEIFIGHTPVTRIGESLPVNKASIWNIDTGAAFKGSISALDIN
FT                   TKEVWQSDPVYTLYPNEDGRN"
FT   gene            complement(316698..317834)
FT                   /locus_tag="ZPR_0311"
FT   CDS_pept        complement(316698..317834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50671"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDT0"
FT                   /protein_id="ADF50671.1"
FT                   /translation="MINKRLLIKNLLAHNDENSFYDKKLQLNIGEKEGKAKFLKHICAL
FT                   ANSNPKNNSYIVIGVKDEDNDIVGIDFFDDSKIQNLINAYLSNPPKVIYENIPFPHLPD
FT                   NLVVGLVTIRPNNGRICSLRKNIWKYYGGSIFLRDGSISMPKDFDIKIEDENSEVVASI
FT                   EKHAQNNIELTLNGVFDFIKHHKKLNPTYQVFKEYFVVCWAGKKKYAKGEIYFSRVDIA
FT                   LINEQVKLFYSDLDEVSISSDANSFKILEYVHLGLPNSYKYYPLEEVTIHFKDNATYEI
FT                   QSELVFQPPLFDKNTLYHIYNSNNMLVERLKKLLPLTKNQRKDVKNLPSTYLLCYLNGF
FT                   GEAMEKLEEAKPFLKKYSSQAYHYYKESTRILRKVKYS"
FT   gene            complement(317831..318586)
FT                   /locus_tag="ZPR_0312"
FT   CDS_pept        complement(317831..318586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0312"
FT                   /product="NADP-dependent L-serine/L-allo-threonine
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50672"
FT                   /db_xref="GOA:D5BDT1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDT1"
FT                   /protein_id="ADF50672.1"
FT                   /translation="MKTALITGATSGIGKATARIFAEEGFNLIICGRREGRLNELKEEL
FT                   RKITEVLSLSFDVRDKEEVFKKIENLPPDFSNIDILINNAGNAHGLDPIQDGSIDDWEA
FT                   MIDINLKGLLYVSKAVIPGMIDRKSGHIINIGSTAGKEVYPNGNVYCASKHAVDALNQG
FT                   MRIDLNGKGIRVGAINPGLVKTEFSEVRFKGDAEKAEKVYQGFEALRPEDIADIIRFVV
FT                   TRPYHVNIADLIVMCTAQATSTIVDRKLL"
FT   gene            318752..319558
FT                   /locus_tag="ZPR_0313"
FT   CDS_pept        318752..319558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0313"
FT                   /product="starch-binding domain-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50673"
FT                   /db_xref="GOA:D5BDT2"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR025491"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDT2"
FT                   /protein_id="ADF50673.1"
FT                   /translation="MRKQFLNFKTLFLLVFTGLALASCSDDDDSAGAEGNARISVRMVD
FT                   APGDYDAVNIDVEAVRVQTGVEEDENEGWVTLDTEAGIYNLLELTGGVSQLLADEEIAP
FT                   GYAGQIRLVLGNDNTIVVNGEEFPLATPSAQQSGLKLNINEELEPGEEYLYILDFDVDE
FT                   SIVTQGNGGYTLKPVIRLSVEDDAGKIVGKVHPSEFRSLVTATNASNRISAYTNASGEF
FT                   ALYGVPEGTYQIKVEPDPISGLDPITRDNVEVDDDGTTDVETLFLE"
FT   gene            319721..319843
FT                   /locus_tag="ZPR_0314"
FT   CDS_pept        319721..319843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50674"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDT3"
FT                   /protein_id="ADF50674.1"
FT                   /translation="MRWFTKAVFRVYFEYILLNLSNFVKNFDQKIKNKAEFLYF"
FT   gene            320006..321010
FT                   /locus_tag="ZPR_0315"
FT   CDS_pept        320006..321010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0315"
FT                   /product="MoxR-like AAA family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50675"
FT                   /db_xref="GOA:D5BDT4"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDT4"
FT                   /protein_id="ADF50675.1"
FT                   /translation="MTDNQSSLDIASLNEKIERESAFVDVLTKEMNKVIVGQKHMVERL
FT                   LIGLLGQGHILLEGVPGLAKTLAINTLSQAVHGSFSRVQFTPDLLPADVVGTLIYNMKI
FT                   NDFSIKKGPIFANFVLADEINRAPAKVQSALLEAMQEKQVTIGDETFKLDKPFLVMATQ
FT                   NPVEQEGTYPLPEAQVDRFMLKTVIKYPQLEEEQLIIRANLKGSFEKVNQVVSIEQILR
FT                   AQQTVREVYMDEKIEKYILDIIFATRTPEKYRLEDLKPLISFGASPRGSINLATAAKCY
FT                   AFIKRRGYVIPEDVRAVVYDVLRHRIGITYEAEAENITSEDIIGKIVNEIEVP"
FT   gene            321086..321952
FT                   /locus_tag="ZPR_0316"
FT   CDS_pept        321086..321952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50676"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDT5"
FT                   /protein_id="ADF50676.1"
FT                   /translation="MDTKELLKKVRKIEIKTRRLSDHIFGGEYHSTFKGRGMTFSEVRQ
FT                   YQFGDDVRNIDWNVTARYNEPFVKVFEEERELTMMLVVDVSGSEFFGTQSQFKKEVITE
FT                   IAATLAFSATQNNDKIGLLMFSDQIENYIPPKKGKSHVLRIIRELLEFQPKSKKTDIGL
FT                   GLKYLSNVMKKKAIVFVLSDFMGDDYQQTLKITGNRHDVTGIRVYDQREKEIPNIGLVQ
FT                   MLDEETNEYITVNTGSKAVRRSYTEYYLGRVGYFEESFALSGAGVINTRVDESYVKKLL
FT                   GYFKRRG"
FT   gene            321963..323621
FT                   /locus_tag="ZPR_0317"
FT   CDS_pept        321963..323621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0317"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50677"
FT                   /db_xref="GOA:D5BDT6"
FT                   /db_xref="InterPro:IPR025489"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDT6"
FT                   /protein_id="ADF50677.1"
FT                   /translation="MKKNKLLDFIYKKHSFKKQFQAILIIAVAFFALPAMAQEAQVSAS
FT                   IDTAQIKIGEQILYQINVETDSTNLVVFPEGNTFSPLEVVESLGADTTRVQNKFQLLKE
FT                   YSLTQFDSGSYTIPQQRIIINNKPFLTDSMRVEVADVAVDTTQQQMYPIKPSVEVPKSF
FT                   SIPVWVWWLLLILVILGVSVFFFIKRRREKALENKLPPYEQAMKDLDELDKSTLIENRE
FT                   VKEYYSRLTYAVRRYLDEKVYDRAMESTSTELIDFLEAQQKSGVLHLHGKTLQNLKQIL
FT                   QRADLAKFAGSRPDVITAKEDRNKTRMIINDVKSSMPEPSEEELMQDEEYRQNKLSKKR
FT                   KKRLIFGISGGVLVIFIALAVLISSKGLDYVIDTYWGHPTKELLEGEWIRSEYGTPPVV
FT                   ITTPEVLVRKEMELSKDATQTYADAQMFAFGSLVSNFYTSLSTRIFTKKDQFDLKTGVD
FT                   GVYKELENQGAQNIVMKQEEFTTVNGAKGVKVFGTLEIKNPVNDEIKPKKYSILNFAEN
FT                   GGFQQITVIYDEDDSYADEISGRIINSVELIKLNN"
FT   gene            323621..324625
FT                   /locus_tag="ZPR_0318"
FT   CDS_pept        323621..324625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0318"
FT                   /product="von Willebrand factor(vWA) type A
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50678"
FT                   /db_xref="GOA:D5BDT7"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR033881"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDT7"
FT                   /protein_id="ADF50678.1"
FT                   /translation="MFANFTFENPEFFWLFILLPVAIAWYFWKRNLQTPALRMSSIQGF
FT                   KAKSSILAKLRPVLFILRILALALLIVALARPRTVDVSTRTNSTQGIDIVMAIDVSASM
FT                   LARDLQPNRLEATKAVGEEFIKGRPSDRIGLVLYSGESFTKTPITSDKSVVLRALEDVE
FT                   FNNILESGTAIGSGLATSVNRLKDSKAESKVIILLTDGVNNSGFIDPKVASELAKEFGI
FT                   KVYTIGVGTNGMALTPVGIAANGRFQFGNRQVEIDEDLLKQIADETGGKYFRATNNEKL
FT                   EDIYDEIDQLEKTEIEEFKYTNYDEKFRPFALLAGALLLFELLLRYTLFRSFI"
FT   gene            324634..325677
FT                   /locus_tag="ZPR_0319"
FT   CDS_pept        324634..325677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0319"
FT                   /product="von Willebrand factor (vWA) type A
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50679"
FT                   /db_xref="GOA:D5BDT8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR024163"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDT8"
FT                   /protein_id="ADF50679.1"
FT                   /translation="MLVFEEEIYFWLFLVIPVILVLFIFLLIWKRKARKSFASDELLQK
FT                   LAPNKSNFKPMLKLILVCLALACLVVALVNPKMGTTMETVKREGVDIVFAIDVSKSMDA
FT                   EDIAPSRLEKSKQIVRQILGGLGSDRVGIIAYAGSAFPQLPITTDYAAAKMFLQALNTD
FT                   MISSQGTAIGDAIDLATTYYDDDNQTNRVLFIISDGEDHEGNVESIADEAAEKGIRIYT
FT                   IGVGTEKGGPIPIKRNGVVQNYKKDQNGETVITKLDPNTLQQIASEANGEYIEGNVTAK
FT                   VAETVQDLLKNIEKTEFEAKQFADYQSHFQWFLGLCFIFLFLDLFLLERSTAWIKKLNL
FT                   FNETKKD"
FT   gene            325679..326593
FT                   /locus_tag="ZPR_0320"
FT   CDS_pept        325679..326593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0320"
FT                   /product="aerotolerance-related protein BatC"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50680"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDT9"
FT                   /protein_id="ADF50680.1"
FT                   /translation="MRTAKMTFAQHSFFLILILLFSRVGIAQQNDETEKLIKEANAYMN
FT                   QAEEALSENDFAGAEAAYRKAIAKDPSNTTAKYNMGNLYYNREKSGESQSRFVEANKVS
FT                   ENKEDRHKINHNLGNSFMKQKKYKEAVEAYKNALRNDPTDDETRYNLALAKKKLEEEQQ
FT                   QNKDNNDNQDNQDNKDQNEDQKDQDQDNQGDKGEDKDQDGKPKDEGDNEKQDPKDGEGD
FT                   QENEKPQDQDPNEQNKGDQDQKDQKGKPDQQKQQQPQPAQGQLSPQQIKNLLEAMNNQE
FT                   EKTQDKMNAEKAKAVKTRSDKDW"
FT   gene            326762..328537
FT                   /locus_tag="ZPR_0321"
FT   CDS_pept        326762..328537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0321"
FT                   /product="aerotolerance-related protein BatD"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50681"
FT                   /db_xref="GOA:D5BDU0"
FT                   /db_xref="InterPro:IPR025738"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDU0"
FT                   /protein_id="ADF50681.1"
FT                   /translation="MKLKLIILSLFLFTTSLLSAQVKFTAEVSREQIGINERLRVDFNM
FT                   NKDGDNFTPPSFTGFKVVGGPNQQVSNSWVNGKSTFSKTYSYYLEPNSKGTKTIGQAQV
FT                   TVAGTVYKTSPVNVEVGDAVERPQDGNDAAIVPEDNLHFVAEVSKPNPYLNEAVTVTYK
FT                   LYVSERIGISNFRMLDNPSFPDFWSQTLNMNGYRFEQGTYRGEPYRYAVVYKTLLYPQK
FT                   TGKLEIDPVAISVSVDVPSQRRSIFGGVIYQTVEKRVTSASREIDVKPLPTQGKPANFT
FT                   GAVGSFEFSVDPSKTTLDAGESLTASVKVRGRGNLMLFELPDLTVPSSLEIYEPERKEN
FT                   FSSTLNGTQGSLTEDYTIVPTRKGKYPIPGLNFSYFDPRSETYKSISTDDIVIDVENGP
FT                   VGAPTNSATKDNNTVASNKQPVNLSGDQFRYIKLNANLKPLNAPAFFRSWLFWALLIIP
FT                   LLILPLIIMFGKKREARANDITGNRIRKADKLARKYLSEARKNLGQQQEFYIALERAMH
FT                   NYLKAKLHIQTGEMSKERINEILTERGVDQATTTQFIEILKSCEFARYTPASMDTMKQD
FT                   YDKAANVISTLDKQL"
FT   gene            328540..329289
FT                   /locus_tag="ZPR_0322"
FT   CDS_pept        328540..329289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0322"
FT                   /product="aerotolerance-related protein BatE"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50682"
FT                   /db_xref="GOA:D5BDU1"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDU1"
FT                   /protein_id="ADF50682.1"
FT                   /translation="MKKIFFILLVFCTTIGFGQNEALFEQANKAYADGNYEDAIKKYES
FT                   ILDKGETAVSLYYNLANAHYKLNHIAPSIYYYEKALQLAPNDADVKNNIQFARNMAMDD
FT                   IENVQRTGIAKTIDDLIATFSFNTWAMLAIVFMVLFVILFLFYYYGRTTLSKRIFFITS
FT                   MVSILLCIVSVYFAFSQQNIQLNNNYAIVFAEEAGVRSEPNLRGEPAFLLHEGTKAKLL
FT                   EKYQEWYKIEIADGKQGWMLKENLKEL"
FT   gene            329561..330193
FT                   /locus_tag="ZPR_0323"
FT   CDS_pept        329561..330193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0323"
FT                   /product="Carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50683"
FT                   /db_xref="GOA:D5BDU2"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDU2"
FT                   /protein_id="ADF50683.1"
FT                   /translation="MDFYKQILENNKQWVSSKLDSDPEFFKRLENGQQPPLLWIGCADS
FT                   RVPANEIIGTQPGEVFVHRNIANMVIHTDMNMLSVLDYSVNALKVQHIIVCGHYGCGGV
FT                   KAAMDNQSIGLIDNWIRHIKDIYKMHVRELETIKDEKARWDRFVELNVIEQVYDLAETS
FT                   IIQNAWKNKQKVVIHGWVYGVGTGIVKDLNVHLTGNENLDEVYNLKF"
FT   gene            complement(330252..330800)
FT                   /locus_tag="ZPR_0324"
FT   CDS_pept        complement(330252..330800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0324"
FT                   /product="colicin V production protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50684"
FT                   /db_xref="GOA:D5BDU3"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDU3"
FT                   /protein_id="ADF50684.1"
FT                   /translation="MNTIDIILGIVLLYGLIRGFFRGLFAEVAALVGLIAGIYGAIYFS
FT                   YILSDFLARHVNWDEGAINLFAFAITFILILFLVTLAGKFLTKVANLAALGMINKILGA
FT                   VFGLLKLAFLASVVIMFFRATEEQIDLVEDKTIEESVLYQPIAMLAPVLLPTILKEARE
FT                   RDIWNPLDNSEAKEDQQGE"
FT   gene            complement(330832..331269)
FT                   /locus_tag="ZPR_0325"
FT   CDS_pept        complement(330832..331269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0325"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50685"
FT                   /db_xref="GOA:D5BDU4"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDU4"
FT                   /protein_id="ADF50685.1"
FT                   /translation="MDNFEPQKEPKPKYISRRFLAGCIDYTIVNTIAFMFIFTVGTPDN
FT                   EGVYHLEGLPSLIPILFWLFLIVCTETWFGATVGNSMVRLKPVTLSGYATNISFTQSLQ
FT                   RHLLDPIDMFFFGVVGILVIQSSDKNQRLGDIWAKTTVTKY"
FT   gene            331326..331682
FT                   /locus_tag="ZPR_0326"
FT   CDS_pept        331326..331682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50686"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDU5"
FT                   /protein_id="ADF50686.1"
FT                   /translation="MARDEKLKERWENLQQKLANQFADGEVMELDAVIYIIGVQELGQL
FT                   HRRFKKDQKVDLMHIAICRLLEPYGYYEFDYFDDDGWPHYKVLEQLPNLKAGEQSVLMK
FT                   EAIVQYFLEKEYIS"
FT   gene            331683..332372
FT                   /locus_tag="ZPR_0327"
FT   CDS_pept        331683..332372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0327"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50687"
FT                   /db_xref="GOA:D5BDU6"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDU6"
FT                   /protein_id="ADF50687.1"
FT                   /translation="MNALLFFTDFPNDSGPIYTETVAGRFPVEPFNTFSNIFFLAIVIY
FT                   FSYRVYKNFRAQLFLSFALPVLFIGWIGGTIYHATRSHEIWLLMDWVPIDILCLSASLY
FT                   FASKASSKKRQVLGLMLLVLLLVLGVRFIPFRSHGQTYSYIATAIGLLLPIGIHVYQTR
FT                   FKHFRFMAFAVISFIMAISFRVLDRYIHFSMGTHWLWHSFGAFSVFFLMKYVFHDAETS
FT                   KVINQFD"
FT   gene            332465..333484
FT                   /locus_tag="ZPR_0328"
FT   CDS_pept        332465..333484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0328"
FT                   /product="phenylalanyl-tRNA synthetase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50688"
FT                   /db_xref="GOA:D5BDU7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDU7"
FT                   /protein_id="ADF50688.1"
FT                   /translation="MIDKIKEHITDVKAFNATTKEEIENFRIKYLGKKGILNGFFAEFK
FT                   NVPNEQKKDFGQTVNELKTAAQEKVDELKERLDSLEEEKGVYGDLSRPSEPLEIGSRHP
FT                   ISIVKNQIIEIFSNIGFNVSEGSEIEDDWHNFTALNLPEYHPARDMQDTFFIQTDPDIL
FT                   LRTHTSSVQVRYMEDNKPPIRTISPGRVFRNEAISARSHCIFHQVEGLYIDKNVSFADL
FT                   KQTLLYFTKQLFGKSKIRLRPSYFPFTEPSAELDIYWGLETETDYRITKGTGWLEILGC
FT                   GMVDPNVLKNCNIDPKEYSGFAFGMGIERIAMLLYQIGDIRMFYENDVRFLEQFKSSI"
FT   gene            333504..333746
FT                   /locus_tag="ZPR_0329"
FT   CDS_pept        333504..333746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50689"
FT                   /db_xref="GOA:D5BDU8"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDU8"
FT                   /protein_id="ADF50689.1"
FT                   /translation="MSLLREQQLLKYELTAKMELMKKSGFIILAVIVLGVAAYLAIAVL
FT                   KITIGLIVLAIAAVVLFVLWHMIKHKWEEKFESES"
FT   gene            333759..334154
FT                   /locus_tag="ZPR_0330"
FT   CDS_pept        333759..334154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50690"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDU9"
FT                   /protein_id="ADF50690.1"
FT                   /translation="MKKDIEIPKVEKVHVAAVREFNEEFQAEEWNAYIINNKNVSIEMI
FT                   LIVAKGYDGTKETSVMRHKLEKLPPHSFAKIEFIQDAVLELTNEYQVTFFAEHKMFEKT
FT                   FVFKKNTVSKDKQKDLPIIPKMGILAE"
FT   gene            complement(334214..335878)
FT                   /locus_tag="ZPR_0331"
FT   CDS_pept        complement(334214..335878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0331"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50691"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR013211"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDV0"
FT                   /protein_id="ADF50691.1"
FT                   /translation="MSKRLLAGWIILSILVISCSDSNNNFDENEYTQENFKINNDAGTL
FT                   ENVLNRNGAGVLSISSITAIKANRSKQAVEDEDPQVSNIALEQIATVDPPIVDGTTLRA
FT                   SHVKIDGNYAYVTYMMEGEAYLGGVDIINIEDKTNPFVTSRVTSDIVDFTSAYFSNGRL
FT                   YFASAVDTDELLNLEYRANLGYVNVSAGNFLQNFQLKPIEGNVAVDISGFDDKIIGVSG
FT                   ATGVLGLYDAVSLETIAEQPIPDLRSIAYGNNKIAVLSGSEGLAMYNPGDLSVLNRINT
FT                   PNLASESKRTIAFKDQAILVAEGGNGVGIYDSNSGNTLQQLSIPLPVDSAYDSEDVVTN
FT                   AVSIAGDFILMANGGAGFGIAKLDENNTLVEEGIVDLEGSSNYIQSDGDYIFVASGTGG
FT                   LKIIKVSQPEATDNFAACESYDVYRGNSNLNVNSNQVMAYRGAATLKNLNVGGDFTFCG
FT                   SINIQNSTNLDSQGTFNMRGAMAVGIFGRNHDLNINSGSVLRIEGTLVVYGNLNLNSGS
FT                   TLEFVGNGSRIHVFGNVRQNSGSTVIGNYIDTSNKLK"
FT   gene            complement(336000..336995)
FT                   /locus_tag="ZPR_0332"
FT   CDS_pept        complement(336000..336995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0332"
FT                   /product="NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50692"
FT                   /db_xref="GOA:D5BDV1"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDV1"
FT                   /protein_id="ADF50692.1"
FT                   /translation="MSTTSNIAVIGGGSWATAIVKMLTENLEKVHWYMRSVYAVEHLKR
FT                   HEHNPNYLSDVEFNINQLQLSNDINEIVDSADVLIFAIPSAFLKSELDKLTVPLEGKTI
FT                   FSAIKGIVPESSLIVGEHFNKFYNIGFENIGVITGPCHAEEVALERLSYLTIACSDEDK
FT                   AKMLAGFLSSDYIKCKTSDDIVGTEYAAVLKNIYAIAAGIAHGLGYGDNFQSVLMSNAI
FT                   REMKKFIKKVHKMKRNINDSAYLGDLLVTGYSVFSRNRMFGNMIGKGYTVKSAQMEMSM
FT                   VAEGYYATASAYKINEERKAKTPIINAVYTILYEGKNPKKTFKKLADKLD"
FT   gene            complement(337345..337929)
FT                   /locus_tag="ZPR_0333"
FT   CDS_pept        complement(337345..337929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0333"
FT                   /product="nicotinic acid mononucleotide
FT                   adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50693"
FT                   /db_xref="GOA:D5BDV2"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDV2"
FT                   /protein_id="ADF50693.1"
FT                   /translation="MNKKIGLFFGTFNPIHIGHVIIANHMAEFSDLDEVWLVVTPHNPH
FT                   KKKSTLLDNHNRLDMVFMACEEFEHLQPSDVEFRLEQPNYTVKTLAHLQEKYPTNEFCL
FT                   IMGEDNLKTFHKWKNYEVILDNHSLYVYPRKSGGKVENQFKDHPKITRVDAPVIEISAT
FT                   FIRDSIKEGKFIKPMLPAKVWEYVIHNNFYK"
FT   gene            complement(337931..338503)
FT                   /locus_tag="ZPR_0334"
FT   CDS_pept        complement(337931..338503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0334"
FT                   /product="guanylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50694"
FT                   /db_xref="GOA:D5BDV3"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDV3"
FT                   /protein_id="ADF50694.1"
FT                   /translation="MKEGKLIVFSAPSGSGKTTIVRHLLKQDDLKLDFSISATSRAPRP
FT                   NEIDGKDYYFLSLEDFKKKIKNDEFLEWEEVYRDNFYGTLKAEVERIWEKGKHVIFDID
FT                   VVGGLDIKKIYPEKTLAVFVKPPSIEELKIRLKKRKTESMDKINMRVAKASIELATAPQ
FT                   FDFIIENNDLEVALKEAHDLVADFIKK"
FT   gene            complement(338535..339395)
FT                   /locus_tag="ZPR_0335"
FT   CDS_pept        complement(338535..339395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50695"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDV4"
FT                   /protein_id="ADF50695.1"
FT                   /translation="MTGFGKSVLQLPNKKITIEIKSLNSKNLDLNARIPSQYREKELIM
FT                   RNTISSALKRGKVDFSLYVEQSGDETSASVNAETVKNYIKQMQDLNLPNIGSKHDIQLL
FT                   EIAMRLPDALKTEREEIDETEFAEIEKALEEALAEINEFRTAEGAALEKDLKLRVSNIA
FT                   DLLNEIMQINPERVENVRERLRKGIEDLKENVDENRFEQELVYYIEKYDITEEEVRLKN
FT                   HLSYFTETLDTEDSNGRKLGFIGQEMGREINTIGSKSNYAPMQQLVVQMKDELEKIKEQ
FT                   VLNVL"
FT   gene            complement(339500..340462)
FT                   /locus_tag="ZPR_0336"
FT   CDS_pept        complement(339500..340462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0336"
FT                   /product="protein containing alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50696"
FT                   /db_xref="GOA:D5BDV5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDV5"
FT                   /protein_id="ADF50696.1"
FT                   /translation="MPVIESTYTAPHLFKNPHIATIFAATLRKVNFTTEKRERLELSDG
FT                   DFLDLDWAFSKKQTKKLVIAMHGLAGNANRPYMLGMGKIFTNNSWDYCAMNFRSCSGEI
FT                   NRLYRSYNAGATEDLEDVLNYVLRKNNYEQIALIGFSLGGNLLLKYLGERDQLPQPIKV
FT                   AVAVSTPCDLGASLEALNLPKNKLYSKRFEKNLKDQLFERQLAFPKELEKQQISACNSL
FT                   LAIDELYTSRAHGYTSASEYYKKCSCLQFLPNIKIPTLLLNAENDTFLSSASFPKKIAQ
FT                   ESTFLYLETPKHGGHVGFIQYKKIYYQEERALQFTQNHL"
FT   gene            340571..341062
FT                   /locus_tag="ZPR_0337"
FT   CDS_pept        340571..341062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0337"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50697"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDV6"
FT                   /protein_id="ADF50697.1"
FT                   /translation="MYTKEFEIRWSDIDANRHLANTAYINFMSHTRMGFLMENGFGQKD
FT                   LAKHNLGPVVFYEHVYYFKEVFAGEPVKVSLQLKGLSEDGMYFEFVHNFYDSKGRNFAS
FT                   CEMMGGWIDLKERKLTGLPPEMVENLDSLTHTDDFKVLTKEDTRKHGRKPQDIDPELLT
FT                   "
FT   gene            complement(341109..342005)
FT                   /locus_tag="ZPR_0338"
FT   CDS_pept        complement(341109..342005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0338"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50698"
FT                   /db_xref="GOA:D5BDV7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDV7"
FT                   /protein_id="ADF50698.1"
FT                   /translation="MDKRLLAIFAATGASAIYGLNHTIAKGVMPSHIEAFGFIMLRVLG
FT                   AAILFWILSPFAPKEKVEKKDWPRMLCCAIFGMCINMLFFFKGLSLSTPINSSVIITVS
FT                   PVMVLILASIILKEKITLLKGVGIAFGLSGALALVVFSTDSVTNAPNIPLGNLMFIVNA
FT                   FSYGLYLVIVKPLTKKYHAITLMKWLFLMGVFLNLPVTYSEFVAVDWFHLPFDAIWRMA
FT                   FVVAGTTFSTYLLNIYALKQLSASTISVFIYLQPLIAIIYAILVGADQLTTIKVAAGLL
FT                   VFVGVYLVSFKKTKTRA"
FT   gene            complement(341998..342351)
FT                   /locus_tag="ZPR_0339"
FT   CDS_pept        complement(341998..342351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50699"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDV8"
FT                   /protein_id="ADF50699.1"
FT                   /translation="MKKIYYLSTCDTCKRILNDIEAPADFELQDIKTDEITKKQIEEMQ
FT                   ALVGSYESLFSKRARLYKERDLKNKDLSEEDYKALILEHYTFLKRPVIINGKEIFIGNA
FT                   KKNVAAAKESIHG"
FT   gene            complement(342511..343281)
FT                   /locus_tag="ZPR_0340"
FT   CDS_pept        complement(342511..343281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50700"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDV9"
FT                   /protein_id="ADF50700.1"
FT                   /translation="MKKFLLVLLASLMLYACEEEKKENLIFTNYNIEKAYKKCNPEKGN
FT                   CTFINLNFPVAKGKETVAKKINDSIEHHIIEIVSGFNPDNNPETMEEMVDGFIANYGSY
FT                   REDFPETDIPWEATVFAEITSETPKLLSIDFNSYTFTGGAHGYGSNTYMNFNPETGAVY
FT                   THKDLFTPAFKDFVEKDFRNKENIPEGENINSTGMFFENDEFHLPANIGFRNDKLILTY
FT                   NPYEIAAYVEGQKTYEYNLNEVSNYLKIDFSEKE"
FT   gene            343438..344580
FT                   /locus_tag="ZPR_0341"
FT   CDS_pept        343438..344580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0341"
FT                   /product="Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50701"
FT                   /db_xref="GOA:D5BDW0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDW0"
FT                   /protein_id="ADF50701.1"
FT                   /translation="MKFNTKTIHGGQKNVDPAYNAVMPPIYQTSTYAQSTPGGHKGFEY
FT                   SRSGNPTRAALERSLASIENGDYGMAFGSGLAAIDAVIKLFKPGDEIVSTNDLYGGSYR
FT                   LFTSIFENLGIKFHFIGMQEAENIESYINENTKLIWVETPTNPMMNIIDIEATAKIAKK
FT                   HHILLAVDNTFATPYLQQPLDLGADIVMHSATKYLGGHSDVVMGGLVVKDKALADKLYF
FT                   IQNASGGVCGPQDSFLVLRGIKTLHLRMQRHCENGEKIARFLKEHPGVAQVNWPGFEDH
FT                   PNHEIAKKQMKGFGGMISFSTTQGTAESAVKILENLKVFTLAESLGGVESLAGHPASMT
FT                   HASIPKEEREKTGVVDSLIRLSVGIEDGDDLVEDLKQALG"
FT   gene            complement(344902..345177)
FT                   /locus_tag="ZPR_0342"
FT   CDS_pept        complement(344902..345177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0342"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50702"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDW1"
FT                   /protein_id="ADF50702.1"
FT                   /translation="MRVYRRERKKHLETTLKGIGAALTEGYRWNSPNTFLVYTSESRAL
FT                   ATLEVSVHLDRNEDLPTDRYYVEINIPDDIEILELKHKDLPAKWDS"
FT   gene            complement(345177..345545)
FT                   /locus_tag="ZPR_0343"
FT   CDS_pept        complement(345177..345545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50703"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDW2"
FT                   /protein_id="ADF50703.1"
FT                   /translation="MERVSIIRKGLPYESIEFISNKSNLPIKHILHLLQMPQTTYNKKK
FT                   KDKDLLSGRDSELVLVLTEVLEFGLEVFNSEKEKFQRWLQKTNISLGGAAPISLFDSLT
FT                   GIQEVRNRLNRLEYGNLA"
FT   gene            complement(345869..347092)
FT                   /locus_tag="ZPR_0344"
FT   CDS_pept        complement(345869..347092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0344"
FT                   /product="cysteine desulfurase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50704"
FT                   /db_xref="GOA:D5BDW3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR011340"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDW3"
FT                   /protein_id="ADF50704.1"
FT                   /translation="MDIEFVRKQFPALDKDFIFMDNAGGSQILGKVIQRINGYLIHHNV
FT                   QLGASYKVSKEAGEKLAWATKQIAKFINANRTEEVIIGPSSSMLFRILSLSISRKWQEG
FT                   DEVIVTNTDHEANISPWTDLKEKGIKIKIWKANPETMELELSELKKLLSKKTKLVAVTH
FT                   CSNILGTINPIKEITQMVHQNGSLVCVDGVAYAPHRQIDVQDLDIDFYTFSWYKTYGPH
FT                   LALMYGKYDLLLEMDGINHYFFKKDDIPYKFQPGNFNFELTYSLLGITEYFHEFYKQHF
FT                   PEDKDSAVLMLKKSYEVIATHEQKLTKRLLDFLNEHQKVKIIGTPEADALKRVPTISFI
FT                   HEDLKSNEIVEQIDDYRIGIRFGDFYAKKLVEDFDLTKNNGVVRISLVHYNTEEEVKRL
FT                   IWALGKVI"
FT   gene            complement(347098..349479)
FT                   /locus_tag="ZPR_0345"
FT   CDS_pept        complement(347098..349479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0345"
FT                   /product="secreted dipeptidyl-peptidase IV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50705"
FT                   /db_xref="GOA:D5BDW4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDW4"
FT                   /protein_id="ADF50705.1"
FT                   /translation="MTKFTLRFSNFAILTFIAFSSFLLQAQQSDLSVEKIMQDPKWMGT
FT                   FPSGIHWGIESENIYFQYNLENDPEDSLYKINISNQSKIIKVSQQEKENMIPRYGDYND
FT                   KRTEMLFTENGKLFLYNIRKASKKELIDLGERIIDPQFMADDSKISFILNDNAFIYDLD
FT                   KGSITKLTNINKGTKREEKEKKLSDKNEWIQDENLELLEVVNQRKEKAEASKVYRKSKA
FT                   RDDSYAFYTGDKQISGISISPNGKYVSFNLIKRERGDNTEVPDYVDQSGYTKELPARSK
FT                   VGDDKTEVELALYNIEKDTVFMVSTDQLEGIKDLPDYVKDYPDKEWEEKVREVITSPAY
FT                   FSENGEKAIVSIRSKDNKDRWIAQLHLEDGSLTVLDRQRDEAWIAGPGLGWSFGGGTLG
FT                   WLPDNKHIYFQSEATGYSHLYVLNVDNGEKKDLTPGDYEVFDPELSNNKKYWYLTTSKE
FT                   GPDVRHFYKMPVMGGKMEKLTNMTGNNQVYLSPDEKYMAIYYSYSNKPWELYLKKTGKG
FT                   EAKQLTSGQSEAFSNYDWRIPKLIEFEAKDGAMVPARLYTPSEETKNNAAVVFVHGAGY
FT                   LQNVHQWWSSYFREYMFHNLLTDLGYTVIDIDYRGSAGYGRDWRTGIYRHMGGKDLSDQ
FT                   VDGAKYLIKNHDINPDKIGIYGGSYGGFITLMAMFTEPDTFTAGAALRSVTDWAHYNHG
FT                   YTSNILNEPINDPIAYRRSSPIYFAEGLEGDLLIAHGMVDVNVHFQDVVRLSQRLIELG
FT                   KDNWEMAIYPVEDHGFVEPSSWTDEYSRILKLFNESLLNK"
FT   gene            349720..351273
FT                   /locus_tag="ZPR_0346"
FT   CDS_pept        349720..351273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0346"
FT                   /product="aminopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50706"
FT                   /db_xref="GOA:D5BDW5"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDW5"
FT                   /protein_id="ADF50706.1"
FT                   /translation="MKTKLQLAFVSMVLAATTSFAQQPDPMVQEIVTEATENSQLKKLG
FT                   HELLDVIGPRLVGSPQMEQAHDWAVKTYADWGIAAENQQWGTWKGWERGITHIDLVAPR
FT                   LRTLEGRQLAWSPSTSKKGVTAEAIILPEAKDSADFQSKLNQVKGKFVLLSFNEPTGRP
FT                   DYNWEEWATEQSFEKMKKERSEAENDWRARIKATGYSSRELPEILEKAGAEGIITLNWS
FT                   SGFGVNKVFSAYTRDIPTVDLSLEDYGLVFRMAENGDKPELHIVATSKDLGEVPTFNTI
FT                   ASIEGSEKPEEYIVLSAHFDSWDGGTGATDNGTGTLVIMEAMRILKKVYPNPKRTIIAG
FT                   HWGSEEQGLNGSRAFVKDHPEIVENIQAVFNQDNGTGRVVNLSGNGLVDAYDYLGDWLS
FT                   AVPDSISNQIETNFPGMPGRGGSDYASFLAAGAPAFNLSSLSWSYWNYTWHTNRDTYDK
FT                   IVWDDVQSNAILAAILAYKASEDADKTSRKQRVLPINQRTGEQSTWPEPRDATRRGGLD
FT                   "
FT   gene            complement(351400..352548)
FT                   /locus_tag="ZPR_0347"
FT   CDS_pept        complement(351400..352548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50707"
FT                   /db_xref="InterPro:IPR021445"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDW6"
FT                   /protein_id="ADF50707.1"
FT                   /translation="MANNSTRFYENLPALNIPVSTLVGDIGHFHRVPDSWHIVAADIKN
FT                   STKAIAKGQHNSVNLIATGAVIAIINIAYKAKINIPFFFGGDGAIALVPQEILHETLNA
FT                   LQKHKKNTLKNFKLELKTGSLPVKTIYQEKIQLKIAKLKVNDDLNIPVVLGDALHYAED
FT                   LIKNTLPQQEIIPDHKPLDLEGMECKWDKIKPHKNGQEVVSLIVISKDDTKSSKIFAEV
FT                   LKAIDDIYGSPSRRKPITARRLKLKANLHKINAEMKAKLGKFNLPYLLKSWMIGQYGKH
FT                   IWLKKDNSKIYLKKLVALTDTLTIDGRINTVISGTPQQRDALTGYLDNLENSGKIAYGI
FT                   HVSEESIMSCYVRDINTHEHIHFVDGGNGGYTKAAKSLKRKP"
FT   gene            complement(352563..353552)
FT                   /locus_tag="ZPR_0348"
FT   CDS_pept        complement(352563..353552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50708"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDW7"
FT                   /protein_id="ADF50708.1"
FT                   /translation="MKKITLFILISFFMITANAQNANIDKEAFAHTFSIVAKDPGTGEM
FT                   AIAVQSHWFSVGSLVSWGKSGVGVVATQSFVNPAYGPNGLKLMSGGMSAKDALEELVKQ
FT                   DEGRDYRQVAFLDVQGNVAAYTGKLCVEAASHIEGDNFSVQANMMLNNKVVPAMAEAFK
FT                   AHENLPLAEKMIEVLKAAQNAGGDIRGKQSAALIVVGPKKVENSWEEKKIDLRVDDHQN
FT                   PILELERLLKTARAYEHMNKGDLAVEKGEVDIALEEYGIAEEMFPDNLEMKFWKAVAMA
FT                   NSDRLKEALPVFATIFEEDDNWREMITRLPKAGLLNLTEEEIDQITDL"
FT   gene            353829..353900
FT                   /locus_tag="ZPR_0349"
FT   tRNA            353829..353900
FT                   /locus_tag="ZPR_0349"
FT                   /product="tRNA-Arg"
FT   gene            complement(354836..355705)
FT                   /locus_tag="ZPR_0350"
FT   CDS_pept        complement(354836..355705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0350"
FT                   /product="helix-turn-helix domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50709"
FT                   /db_xref="GOA:D5BDW8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDW8"
FT                   /protein_id="ADF50709.1"
FT                   /translation="MQTNIHREITPLSPQDSFLVFDRIKEKFDFPIHFHPEFELNFILN
FT                   GKGVRRIAGDSMEEIGNIELVLIGPNLQHGWEQHKCINTDIQEITVQFHNDLFDSKLLS
FT                   RKIMKPIRDLFQRSAHGILFSEKIAEEIKPKLLNLSKIAGIDYFLELISILHDLANSRN
FT                   QKLLSSYISSNKDFENSDKIKIIYDYVQQNYQKKISLSEASDLVNMTPISFNRFIKKRT
FT                   GKTFIEYVNDTRIGYASRWLIEKELSISEIAYLCGFNIANFNRVFKKAKNCTPSEYRLE
FT                   FRGIKRVL"
FT   gene            355952..359110
FT                   /locus_tag="ZPR_0351"
FT   CDS_pept        355952..359110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0351"
FT                   /product="tonB-dependent Receptor Plug domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50710"
FT                   /db_xref="GOA:D5BDW9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDW9"
FT                   /protein_id="ADF50710.1"
FT                   /translation="MISDKMIKKYVQEGKIYFPAIEFIAKVKLAFLFVFFLGLLSKSSE
FT                   ISALNLQESRIDITGTVVDSESVPLPGVNILVKGTSKGVTTDFDGNFSIEDVPEDAVLV
FT                   FGFLGFDTQEVPVNSRTIIKVVMEAAIGALDEVMIVGYGGTVKRSDVTGSVSQVEVEQL
FT                   KDIPGGSVESLLQGRVAGLQITTSSQAPGAGASVRIRGGSSLRGSNSPLLVVDGFPIGD
FT                   AGNLQQINPADIESIEILKDASASAIYGSRGANGVILVTTRNPKNGKTVINVRQQTTVS
FT                   QFTSELNLWRNPVLLAQLSNESRINGGFPPLYIGEVASTGLYYPSVQELQNGDWPHNVR
FT                   WDDIVFRDTPINNSTTIDVSSSNEKTNFSFSGNYFTEQGVYIEDDYSKFNYNLNVDHKL
FT                   YDNFRITFSSIGSKGKRNNNGGLAYWRSPIIPVYDENGDYYLTNNNDFNHPIALTENRV
FT                   NKNKTIDFLSFLGLEWDIIPSLKLTSRLNYKFGNSISDQYFPKTYTEAGEFNNGVASIG
FT                   NYQAETIISETFANYNKTFGVHKLGVTAGFSYQNDVIRTSNLGASDFVNEVLQNENLGA
FT                   GNPERNTVGNNLIETELVSGIFRVNYEFREKYLFTFTSRADGSSKFGENNKWAIFPSGA
FT                   IGWKAGEENFIKELEIFDLLKFRASYGISGNQGISPYQTLSRYGVSEYYNNGNWVTVIG
FT                   PGYEVGRTGQGGIEVLWGGIPNPDLKWETTAQVDFGVDMGFFNDRLQVIFDYYEKHTDD
FT                   LLQERILPISSGFDRMWVNEGSIANKGIELTLDGTLIQSNDFTLGATAIFYRNRNEVTG
FT                   LGSTTESGNLIDPNTGMEFRFSGNSLAMFRAFPNLLAVGQPVNVFYGYKTDGIVQNLEE
FT                   GVSAGLEGDLAQPGEFKYVDVNGDGVISVDDRTIIGDPNPDFTASFNLSLNYKKFDASI
FT                   FFNGVFGNDVLNTQSFNQPSNQPLRWTPDNPTNSFPSLRDGRQVEFSDWWIEDGSFVRI
FT                   QNLNLGYSFEIDSLVSARVFVNATNLYTFTKFDGYDPEVGGDGIYWGGYPRLRQGTIGL
FT                   TLTF"
FT   gene            359120..360613
FT                   /locus_tag="ZPR_0352"
FT   CDS_pept        359120..360613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50711"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDX0"
FT                   /protein_id="ADF50711.1"
FT                   /translation="MNTKNILLILLCAGLISSCDLKEEPYGFYSEDNFLKSAEDFEAGV
FT                   GYAYDALTFLEYSRTIFYLGDLPSETVGIKPDEGAGSQELDSWQIQNYPTNPKLVNFFK
FT                   YAYIAINRANIIIDQAPGAQIDMDIKNRYLGEAYFLRAWNYFNLVRYFGLVPIHTTNVS
FT                   TLDQTAAPLATNLDEVYNLILSDVRKAEELLGIDQRTGRADKVAAQSLAAKAYLFIASA
FT                   KENNVPLYSEMDRDVKQMYDSVAHFSGKVLYDQSVYRFDDNLLDIFDVEKPKGPEHIFL
FT                   MSMDRTGMIEGDYSKISKLFIPYIAGGDIYLDDKNGNFTKSHDGFGTFQTKETFYASFP
FT                   ENDLRAELMIIDSVYNQSGDLIANYPNDFQYRFSRKYVDPLFIGDKTSTKPYLIRFSDV
FT                   ALVYAEAVGPTPEAYELVNYIRERAGVEPLNPNLGLEEFREAILQERAWELAFEGHRLP
FT                   DLRRFNKVTTLVEEASGLSPEQVAFYPLPQIEIDLNQGL"
FT   gene            360646..361584
FT                   /locus_tag="ZPR_0353"
FT   CDS_pept        360646..361584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50712"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDX1"
FT                   /protein_id="ADF50712.1"
FT                   /translation="MNNLKKILAFILISIALSCVKDPLEEIESGEWNNERSIINIAFQN
FT                   QVGKAEVLRNDENSGTIITAINVDAVPDLSAISLETIELSYGAKASLKPGETLNFENND
FT                   QSATISVSSPTGKTREYTIYVTSFQETILGTYDITNLVVYGGTGPEYGGGAVLPLTSKP
FT                   WVWPETDGPQAELDNTITFEIEGITEEGNTYGKIINDPGPDGLYADFTFVADPVTDVNH
FT                   YYRKIPKGEGTWLRNYNTGNLIITFSDGTSVSGNFVGAGTEDLGNGLSKTITQNALVFN
FT                   LNGTNDWDKIYSDYDKFVKNPRKFWIDLTKL"
FT   gene            361965..362888
FT                   /locus_tag="ZPR_0354"
FT   CDS_pept        361965..362888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0354"
FT                   /product="mannase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50713"
FT                   /db_xref="GOA:D5BDX2"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDX2"
FT                   /protein_id="ADF50713.1"
FT                   /translation="MSGDYPAVYSIDFAEIMDGRSEGNTMNEHRKRTILEARGRGEVIM
FT                   ANAHLNNPVTGGDSWDNSNSTVAKEILSSGSQANIVFKSWLDKLAVFVKDLKDDKGNAI
FT                   PIIFRPFHEHTQSWSWWGTSNTTQEEFINLWKFTVDYLKNEKGVHNLIYAISPQLDGVG
FT                   TKSNLLYRWPGDNYVDFIGLDSYHGTNSTALTINTRNLAELSKEKQKPVGITETGIEGI
FT                   RQGNGQEYPMYWTEEILNPIIGKDISMVIMWRNKYDPSHSGHHFYGPYIGHSSADNFVE
FT                   FYESSFTLFSGDLPDMYRMPDGVTVN"
FT   gene            363122..364006
FT                   /locus_tag="ZPR_0355"
FT   CDS_pept        363122..364006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0355"
FT                   /product="putative glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50714"
FT                   /db_xref="GOA:D5BDX3"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDX3"
FT                   /protein_id="ADF50714.1"
FT                   /translation="MEYLYKISGGKIMAGQHNKEPNSDPDKWTEYIKETTDKYPALWSG
FT                   DFLFQKDDIDNRWIMIHEAREQWNNGAIINLMWHGCPPDIGEPCEWDTGLLNAQLTDAQ
FT                   WNELLTPDSALYNKWISRMDDIAVYLQFLEDEGVEVLFRPFHEMNQGLFWWAGRPGPNG
FT                   TAALYRLTHDYLTKTKGLSNLIWVWDMQDLSRDFEDYNPGDEYWDVFAFDIYDNGYDIS
FT                   WYNYILPIVGDKPMAIGECSKVPSASVLENQKRWVFFMPWAELVKESNTEEQIKEIYKH
FT                   KSVITRDEMPGWN"
FT   gene            364147..365982
FT                   /locus_tag="ZPR_0356"
FT   CDS_pept        364147..365982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0356"
FT                   /product="Na+/glucose symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50715"
FT                   /db_xref="GOA:D5BDX4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDX4"
FT                   /protein_id="ADF50715.1"
FT                   /translation="MLQGLDIAIIIAYLIATILIGLALRKKAQKSKDDYLLGGKDLPWY
FT                   MLGLSNASGMFDISGTMWLVTLTFVYGLKSIWIPWLWPVFNQVFLMIFLATWLRRSQVT
FT                   TGAEWIHFRFGKGKGGNRSHSIIVVFAILSCLGFLAYGFIGLGKFVEIFIPWDVVSAYI
FT                   PFNVPAEYIPHFYGIIFTLFAVFYSILGGMSGIVWTDVLQYSIMTISSIAIAVIAWHAM
FT                   GDNTLNVPEGWSNPLFGWELDIDWTGIIDEVNAKIASDQYSLFGLFFMLMVFKGILSSI
FT                   AGPAPNYDMQKILSTKSPLEAAKMSAFSLAALIPTRYLMVGGFSILAILFYDELRLETA
FT                   GILDFEKILPAAIEQFVPVGLLGLLLAGLLAAFMSTFAGTLNAAQAYLVNDIYLKYNPE
FT                   ASSKGVKNMNYGSGIIVVLISIVLGFFVLDVNSILQWIVSALYGSYVISNTLKWYWWRF
FT                   NGEGYFWGMVSGIIPAMIIPLLTDTLDLYYFPVILVISLAGSIIGAYSFAPTSEKVLID
FT                   FYKKTKPWGFWKPILEKVKKEDPQFEKNTNFSRDMFNVLVGVIAQTLLVLIPLYLILHE
FT                   NIPFLVAIAVLVICVIILKKNWWDHIKNEENINLK"
FT   gene            366057..367190
FT                   /locus_tag="ZPR_0357"
FT   CDS_pept        366057..367190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0357"
FT                   /product="glycosidase, PH1107-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50716"
FT                   /db_xref="GOA:D5BDX5"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR028583"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDX5"
FT                   /protein_id="ADF50716.1"
FT                   /translation="MNNHQEFLQKPNKPQPESNGIVQRYQNPVVTAAHAPLHWRYDFNS
FT                   ETNPLGLERIGINATFNPGALKWKGKYILALRVEGADRKSFFAIAESPNGVDNFQFWDK
FT                   PVVLPQTGEPDTNVYDMRLTLHEDGWIYGIFCTERKDKSNPDTSAAVANAGIARTKDLV
FT                   NWERLPDLISNSGQQRNVVLHPEFVNGKYALYTRPQDGFIEVGKGGGIGLGYVEDLTNP
FT                   VLEDEKIVNHKVYHTIYELKNGLGPAPIKTEEGWLHLAHGVRNTAGGLRYTLYLFMTDL
FT                   NDISKVTYQPAGYFMAPDYQETVGDVPNVLFANGWIADDDGKVYIYYASSDTRSHVAVS
FT                   SVEKLLDYVKNTPQDGFTSASSVNTIIELIDRNKSLL"
FT   gene            367193..368386
FT                   /locus_tag="ZPR_0358"
FT   CDS_pept        367193..368386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0358"
FT                   /product="N-acylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50717"
FT                   /db_xref="GOA:D5BDX6"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR028584"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDX6"
FT                   /protein_id="ADF50717.1"
FT                   /translation="MTKISQQFKDEISSELNEIQKYWEQYGIDNKNGGFVGRRDYSNKQ
FT                   IFGAPKGVILNTRILWTFSAIGNFKKDDDLRFYANRAYEYLNKNFRDREFEGVFWELDA
FT                   LGKPVNKRKQIYAQAFAIYALSEYFIFSGKEEAKDWALSIFELIEKYARDENLNGYIEA
FT                   FQVDWSPIEDMRLSSKDKNSTKTMNTHLHILEAYTTLFQISKSQTVKEALGNLIQLFIK
FT                   KFYDSKNHHFQLFFDNNWGIEGNIVSFGHDIEAVWLLIEAAKAVDNQKFLSEIEIMTID
FT                   VAETFLKEAYVENSGVINEKNLDTGQLDEDRHWWPQIEAMVGLNYAYLISGKEYFIKAQ
FT                   KDIWQFVKDHIVDKENGEWFFRIDKYNIPYKEEDKIGMWKCPYHNSRGCIYLLKMDN"
FT   gene            368790..370448
FT                   /locus_tag="ZPR_0359"
FT   CDS_pept        368790..370448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0359"
FT                   /product="carboxylesterase type B"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50718"
FT                   /db_xref="GOA:D5BDX7"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDX7"
FT                   /protein_id="ADF50718.1"
FT                   /translation="MNRRVFFGKTGISIAACGISFFSPLASRKWDRESEDLISEDDQQL
FT                   FIGEDIAVAQTKYGKVKGFLQRGIMVFRGIPYGLDTSGKNRFMPPQPPKPWKGTLPVVF
FT                   YGNTAPQNIYNRSPKSYSAFVDHWNYDEVSEDCLRLNIWSPGIDGFKRPVLVWLHGGGF
FT                   SNGNGIEQDGYNGENFSRDGNIVFCSINHRLGPFGFADFSGISEKYKYSGNVGMLDIVA
FT                   ALKWINENIQNFGGDPNNVTIMGQSGGGDKVCTLANMSETKGLVHKAVALSGSNTRALD
FT                   NSYTRQLGRFILKEANLKDDEIDRLQEIPWPEYQRLAYKAAEKLQEQTGKTFIRGSFAP
FT                   NADGDVIPAGEYFENKENRPDIPLLLCSTFHEWNPNRDSPELENISLNEVIDKLENKFG
FT                   DRSKEIVGAYSINFPNARPIEIWALILSNRQTIIETANAKLKQNSSVYLAWFGWESPLF
FT                   DGRHRSFHCLDISFWFLNTDRMITHTGGGISPRKLSKKMSESLIAFMKTGDPNCNSLPS
FT                   WPKYTKENVETMILDNQCSVQYNPDKRGRLSIINS"
FT   gene            370460..371944
FT                   /locus_tag="ZPR_0360"
FT   CDS_pept        370460..371944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0360"
FT                   /product="glucosylceramidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50719"
FT                   /db_xref="GOA:D5BDX8"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="InterPro:IPR033453"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDX8"
FT                   /protein_id="ADF50719.1"
FT                   /translation="MRKLRLLLFCFQITISSWAQKSPESIESWVTTNDRNSLLEKQNNR
FT                   IFFKKENSSRHPSIIIDPQRSMQTIDGFGFALTGGSAEHLMKMSALKRTELLNELFGSG
FT                   EEDIGISYIRLSIGSSDLNSFTFSYNDLKDGETDYDLKKFSLAQDLKDVIPVMKEILEI
FT                   YPEIKIMASPWSAPIWMKTNNNIRGGKLKKDCYEVYAQYFTKYIQEMRKLGIFIDAVTV
FT                   QNEPMNSRNTPSMSWFWFEQANFIKNYLGPNLEKNNLKTKILIFDHNTDRPDYPLSILQ
FT                   DTLASKYIDGSGFHNYRGDMEAMSWVHTARPDKNIYFTEQMLTEKPESSTINIVDPVNR
FT                   LIIGALSNWSRNVILWNLAADPNNDPHTGNGGCTMCQGAITIDGNSVSRNVAYYTIGHI
FT                   SKFVKPGSTRIFSTQGDEPSIFLYQDEQRPNVYRTGIRNNSQVLPNIAFRTTENKIVLI
FT                   VGNDTLETQTVKIQYNGNYASVKLKGGSVGTYIWHY"
FT   gene            371955..373112
FT                   /locus_tag="ZPR_0361"
FT   CDS_pept        371955..373112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0361"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50720"
FT                   /db_xref="GOA:D5BDX9"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDX9"
FT                   /protein_id="ADF50720.1"
FT                   /translation="MKMRYFLIGLQFLLSGINFLNAQEKAFSTEGWWEPEGEKFSPVVH
FT                   EDRSITFRLNAPQADNVTLLFGEWDIVEKKMKKDDLGNWSINLKNVESGIYQYNFLINN
FT                   SFKKLDPVNPNIKVGTNIYGSIVEVPDTPARFDQLQEVPHGEVHIITYRSIVLDKTRKM
FT                   YVYVPKIYQELKDVKFPVLYLRHGGGDNEGSWINDGRANIILDNLISQGKSKPMLIVMS
FT                   NGLIDGSWSSGSTIEGMNTLEEELINDIIPLIENRYHVSKNKKDRAIAGLSMGGGQSVV
FT                   IGLRNPNLFSFVGDFSAGLLSDPDIDLSTYIPDLFKMADSINQNIDLLWISCGSKDPRF
FT                   LGHKKFHSILNKHGIKNEFHQGSYGHEWQFWRSQLKDFSKQIFIK"
FT   gene            complement(373928..375508)
FT                   /locus_tag="ZPR_0362"
FT   CDS_pept        complement(373928..375508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0362"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50721"
FT                   /db_xref="GOA:D5BDY0"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDY0"
FT                   /protein_id="ADF50721.1"
FT                   /translation="MNDNVLDDAQVAFQLDPEKLSQLIIENNEGVKTSSGSIAIQTGTF
FT                   TGRSPKDRFIVKDEITKEPVDWGSINQPINPQNFARIKKDILDYLEGKKIYKRFAYACA
FT                   LDKYRLNIEFISEYAWSDLFIHNMFLRLKESELKNFTKEWTVINAPGFKAHPEIHGTHN
FT                   SNFTVISFKEKTVLIGGTGYTGEIKKGIFSALNFLFPVYHDVLPMHCSANVGKDKDTAL
FT                   FFGLSGTGKTTLSADPERELIGDDEHGWDPNNTIFNFEGGCYAKVINLNEKSEPDIFNA
FT                   IKAGALVENTVVKNSEIDFNDSSITQNTRVSYPIHYIENIQIPSVGSTPKNIFFLTADA
FT                   FGVLPPVSKLTASQAAYHFISGYTSKIAGTEAGIVEPLPSFSACFGAPFMPLHPTKYAE
FT                   MLNKKIKESGANVWLINTGWTGGAYGVGTRIKLKYTRAMVNAILDGSINPDYTYKDYHI
FT                   HSVFGVAQPRTCPGVPDAVLSPRKTWDNDSAYYKAAFKLSNAFRENFEKFESYANEDIR
FT                   RGGPQRFDF"
FT   gene            complement(375785..376924)
FT                   /locus_tag="ZPR_0363"
FT   CDS_pept        complement(375785..376924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50722"
FT                   /db_xref="GOA:D5BDY1"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDY1"
FT                   /protein_id="ADF50722.1"
FT                   /translation="MEELYARITEKLEKLYGTFESDKKRFKNSSNSKIARDLGYSDAQF
FT                   SRLINGTATPGEYERTLQNVDRVLKIKELEKNATTSNLPKPETSRKKNWLIGILAALLL
FT                   ISLTLLILDLQATKTNVEDYPRDYTLRWAFETEFVNPYTKLEELPADCNFPCYKLQGQW
FT                   ELNKKYKIPLYIETDGFHYQATSVKMYTRCAINIEPDGSLLEGYEYQKHEIWYDMTESN
FT                   ISTFMNNNDVRNGEGSYYETLDFNKDSRFVKVATVHTLFRNRFTIGDSISRDGQVIGRD
FT                   LVPVPQDILKDKLSEEKVIFINKKLNLIARNGLEDFSRPINCAESPLPGIDFHDVKEGD
FT                   LMKFTCKLTTNRVPSVYTKAFKLTRQFIKSTCRQSLDDE"
FT   gene            377534..379069
FT                   /locus_tag="ZPR_0364"
FT   CDS_pept        377534..379069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0364"
FT                   /product="sodium:sulfate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50723"
FT                   /db_xref="GOA:D5BDY2"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDY2"
FT                   /protein_id="ADF50723.1"
FT                   /translation="MINDVQNISGNRNPDRKEPKKWKNFALLLGPIMFCVLQFVEPPKT
FT                   LSPEAFEILSVAIWMAIWWVSEAVPIAVTALLPIVLFPLTGALTLESTTPSYGHKYVFL
FT                   YIGGFILALAIERWQLHRRIALNILNIVGSKVKYIILGFMVSTAFLSMWISNTATAVMM
FT                   LPIGVAIIKQFGAKTSKKREKKLGRALMLSIAYSASIGGFASLIGTPPNLVLAGVIEEL
FT                   YGVKISFMQWMQFALPVSILLLFLCWIYLTKFAFKISDEVFPGGHKEIKSMLKDLGKIS
FT                   YEEKAVLIVFILTALAWVFRSFIQIFIPIIDDTIIATIAAITLFMISAKSSNRRLLLWS
FT                   EAVKLPWGIILLFGGGMALAKGFTDTGLADWIAAQFSYLKGMELFFLMLILVAAVNFLT
FT                   EITSNLATTAMLLPVLAPIAFSMGIHPYMIMVAATLAASCAFMLPVATPPNAVVFGSGY
FT                   LKISSMVKVGVVMNIVSILIVTLITYFLLPYLWDIDKFHFPQVFRQFMDTPNL"
FT   gene            379104..380396
FT                   /locus_tag="ZPR_0365"
FT   CDS_pept        379104..380396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0365"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50724"
FT                   /db_xref="GOA:D5BDY3"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDY3"
FT                   /protein_id="ADF50724.1"
FT                   /translation="MIFKISKDFRQGYVIASIIYIFGIHNLVAQPKTLNKGEKILSSLS
FT                   INGSGQLWLRYSDLNPGTQINNNEVQDFWDISVRRYRLGFKGEVSDKIDFALLLGNNNI
FT                   NIKSPNTSPILLELYMSYKLSDHIIITAGKNPWTGLSRYAAPSSSNSLGLDVNFASGPF
FT                   LNFQDDLYRKFSIAAHGIAGKFDYRAVLSKPMNRVSSSSLSEDAKLTYNPNAVYTSAYV
FT                   KYQFRELEPSTPFSGGTYHGTKNILNIGAGFTSQTKSSQSLTSQNDTLTHGARSFAIDA
FT                   YYEQALTNNHSWTLYAAYINHDIGPNYVRNLAANNIADAGTGISFNGVGNAIPVNGTGD
FT                   ILVFQAGYLQKFQKDMFIEGVQPYFLTQYSDLEKLEDPIMLYEGGVSFLMNGHNSKFVL
FT                   GYQNWPVVMKDSSIKNSRNSLVVLMYQFKFK"
FT   gene            380630..380755
FT                   /locus_tag="ZPR_0366"
FT   CDS_pept        380630..380755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0366"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50725"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDY4"
FT                   /protein_id="ADF50725.1"
FT                   /translation="MARIVFLVGAILKQKEIARLKKQLKEAELERDILKKAIGIF"
FT   gene            380878..381702
FT                   /locus_tag="ZPR_0367"
FT   CDS_pept        380878..381702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0367"
FT                   /product="transposase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50726"
FT                   /db_xref="GOA:D5BDY5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDY5"
FT                   /protein_id="ADF50726.1"
FT                   /translation="MLAVSKSGYYHWLKSGPSTLWKDNQKLSSLIKDIFEDSHQSYGAP
FT                   RIKAELKALGFKVSKPRVARIMKANYLYAKRKRKFRTTTDSNHKYPTAPNLLNQCFSVA
FT                   RANQVWVSDITYVETNQGWSYLTVIIDLFNRKVIGWALSDTLNTKDTIIKAWQMAITNT
FT                   TLTQPLIFHSDQGIQYAYQRFTNLLKSYNGLVKQSMSRKGNCWDNAVAESFFKSLKVEW
FT                   VYWHKYKLRSQAELSIFQWIETWYNNRRRHSYLGNRTIKEFEIEMYNQKLAA"
FT   gene            complement(381772..382404)
FT                   /locus_tag="ZPR_0368"
FT   CDS_pept        complement(381772..382404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0368"
FT                   /product="cytidine/deoxycytidylate
FT                   deaminase/nudix/methyltransferase domains protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50727"
FT                   /db_xref="GOA:D5BDY6"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDY6"
FT                   /protein_id="ADF50727.1"
FT                   /translation="MSLPNNLGMLKALCYLKMKDSKITGIPKTYSEIERKSNEIGFTMP
FT                   SDIYVGTLLKTLVSSKPKGHFLELGTGIGLSLSWMVDGMDAESKITSIDNDPKLVAIAK
FT                   SYFEQDKRVKIIGMDGTEWIKNYSGKAFDLIFADAWPGKYSEIEETLDLIKPGGIYIID
FT                   DMSVQPNWPDGHQEIVDQLIGYLENRKDFNLTKMNWSTGIIIATKKC"
FT   gene            complement(382486..383034)
FT                   /locus_tag="ZPR_0369"
FT   CDS_pept        complement(382486..383034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0369"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50728"
FT                   /db_xref="GOA:D5BDY7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDY7"
FT                   /protein_id="ADF50728.1"
FT                   /translation="MELKLADKKSELLEILRIQKENQSSNLSIDSANTNGFVTVTHSYE
FT                   MIEKMNSRAKQVIAKMDDQVIGYALVMLKEFEDLIPVLIPMFETFKKIEYNGQKLDQLN
FT                   YYVMGQICVQDHFKRKGIFKKLYEKHKEEYSKLYDYCVTEVSSSNLPSMLAHEKLGFKT
FT                   IYTFTDQTDTWNILLWDWN"
FT   gene            complement(383142..383243)
FT                   /locus_tag="ZPR_0370"
FT   CDS_pept        complement(383142..383243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50729"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDY8"
FT                   /protein_id="ADF50729.1"
FT                   /translation="MLRKLILILVNNTRQKASTLQQFITIYSSSVKF"
FT   gene            complement(383362..383958)
FT                   /locus_tag="ZPR_0371"
FT   CDS_pept        complement(383362..383958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0371"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50730"
FT                   /db_xref="InterPro:IPR018644"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDY9"
FT                   /protein_id="ADF50730.1"
FT                   /translation="MEKFVPKELEIDLFDGKPWISVVAFTMEKIRPKNLPYFPPISNFD
FT                   EINIRTYVKSNNKTGVYFLSIEGGKMLSCKIARGISELPYRFSKIKRANQKYQSENSYF
FT                   NDKLDIQFTIGNKITKKTKLINWLTERYALFQDTDKSINEFEIHHLEWPINEINLSKLE
FT                   LNYPRFKKLISEQPSKIHYSKGVKVLAWEKIKNDR"
FT   gene            complement(384228..385220)
FT                   /locus_tag="ZPR_0372"
FT   CDS_pept        complement(384228..385220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0372"
FT                   /product="alpha/beta-hydrolases superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50731"
FT                   /db_xref="GOA:D5BDZ0"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDZ0"
FT                   /protein_id="ADF50731.1"
FT                   /translation="MLISYSFFGQITSKINLNKTLSENLEKNEIEIADETRLYINDGTS
FT                   NELFYYALKPKEKIKGTLILLPPTAQKVENVINNNIELSELTFKNGILLIIPSINYNLY
FT                   LDSITLNFLNTAFKDAILKYQAPKNKIIIGGFSLGGMNAIRYVELSKENPNSTSINPVA
FT                   VYGIDPPLDLARIYYSFKRIKELNFSEVAVNEAKDYLAKLNKQFGGSPKEVPNIYSKNS
FT                   MYSKKKKGGGNAKFLMDTPIRIYSDPDIDWHLKERHTDLYDINALDQTAMINELRISGN
FT                   KDAEFINALGKGYRLNGMRHPHSWSLAEPNELMDWIIEKLNRNGDTAHN"
FT   gene            385880..387313
FT                   /locus_tag="ZPR_0373"
FT   CDS_pept        385880..387313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0373"
FT                   /product="phytoene dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50732"
FT                   /db_xref="GOA:D5BDZ1"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDZ1"
FT                   /protein_id="ADF50732.1"
FT                   /translation="MGKYDYDVVIVGSGSNGLAAAIYLQSKGLKTIVVEKESMLGGATK
FT                   TTELTLPGYKHDVGAAVLPMAYSSPFFQQLPLEDFGLEWIYPEIPFAQTLGNSNNFGAV
FT                   ACYQDIDKTAAQLGADESTYRKFMRTRIEDWPLVSNDILAPIKIPENPLQFLDFGRSAI
FT                   LSARTFTRLKFKTEESKVLFYGAAAHSTLPLNSTASASFGLVLMIMAHLNGWPFPKSGA
FT                   GQIIEALAKYYIHVGGEVKVNSAIEDFNQIPNSKVQVFDLTPKQLLTIKSLPLSALYQK
FT                   RLSNFKYGAGIFKMDWALRAPVPFKNKILRKAGTVHIGFSSSEIENSEKIVNQGKLPGT
FT                   PYVLLVQPSVFDHSRTPDSGHTVWAYCHVPNGNTQDCTKIIESQIERAAPGFGKLILKR
FT                   HLMNTRQLEEFDANLVGGDINGGKQDITQLFTRPVAKLSPYKTSNNNIYICSSSTPPGG
FT                   GVHGMAGFNAAKQVLKDHF"
FT   gene            387481..389607
FT                   /locus_tag="ZPR_0374"
FT   CDS_pept        387481..389607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0374"
FT                   /product="catalase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50733"
FT                   /db_xref="GOA:D5BDZ2"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024712"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR041399"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDZ2"
FT                   /protein_id="ADF50733.1"
FT                   /translation="MSTSEENKKSKDLASNTKDGKGKTMTTNQGVKVNDTNNSLKSGER
FT                   GASLLEDFILREKITHFDHERIPERIVHARGSGAHGVFELYESLEEYTKAGIFTDIKRK
FT                   TPVFVRFSTVAGNKGSADLARDVRGFATKFYTEEGIFDLVGNNMPVFFIQDAMKFPDLI
FT                   HAVKPEPDRDIPQAASAHDTFYDFVSHTTETLHNHIWVMSDRAIPRSFRMMEGFGIHTF
FT                   RLINAEGKSHFVKFHWKPLLGTHSITWDEAVKIHGADSDFHRRDLWEAIDSGQFPEWEL
FT                   GLQIIPEEDEHKFDFDILDPTKLIPEEMVPVQRIGKMTLNRNPDNFFAETEQVAFHPGH
FT                   VVPGIDFTNDPLLQGRLFSYTDTQLSRLGSPNFHEIPINRPINETHNNQRDAQMRMTVD
FT                   KGKSAYFPNSIGGGCPHLAKMAQGGFTSYEERIDAKKIRSRSSSFSDHYSQPALFYRSL
FT                   TDWEQEHVADAYTFELGKCTYDHIKERMLYVIKQIDKDLALKVADGLGMKIPSKIDQPV
FT                   NQAIGADANVEEHQPTPKKKYLKKSAALSLTHLNSDSIATRKIAFLVGDGFNGAQVKKI
FT                   KEALVSKNAVVHLVAPHGGTVKCDLGKEHPVDVALLTTESVLYDALYIPGGAKSIEALV
FT                   KAPKSVKFVNETLKHCKALAAEEDTFKLLDKTAISMFDKDAAILIGKTPKDFIKQIAAH
FT                   RNWDRQPTAMNIPV"
FT   gene            complement(389788..390504)
FT                   /locus_tag="ZPR_0375"
FT   CDS_pept        complement(389788..390504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50734"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDZ3"
FT                   /protein_id="ADF50734.1"
FT                   /translation="MKAGHMNDRKNDKSTGITTADCIHRISSKFKLKPEEIRKIYQLDQ
FT                   FNITRVFMTEEGSFDTKTGKYTSKNIPGNGKVCIQYFNDQAKSLYLTLQKIPTNEGMPE
FT                   ASSTLYELIEKSIGFFEKAQRASKRLFFQRLFNRHKILCLSYIKDLNSVFEKSHHHRDT
FT                   DEVALSNTIFVLQKKGRFYVMEKAIRLEEKLLEQIEKMLESVNKNDKRQTLLKFKSNLI
FT                   QHLQELKSIHNSVLLH"
FT   gene            390552..390698
FT                   /locus_tag="ZPR_0376"
FT   CDS_pept        390552..390698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50735"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDZ4"
FT                   /protein_id="ADF50735.1"
FT                   /translation="MPELCEIIAKNYINLNLNLISVIALAKTIEQNDGFITYQMNINLF
FT                   QII"
FT   gene            complement(390982..391572)
FT                   /locus_tag="ZPR_0377"
FT   CDS_pept        complement(390982..391572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0377"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50736"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDZ5"
FT                   /protein_id="ADF50736.1"
FT                   /translation="MNIISRQSGAAFILKKGEQLKIQSPQGNQVSDMVLFNLNDTREKI
FT                   SSGKTLDFEESILISRGNYLWSNRSEKMMMILEDTNGRNDFLLAPCSPETFEIMYHHKG
FT                   YHPSCFENLYRNLEAYDIFPDDIPTAFNIFMNVQFDTDGKLSVDPPTNTPQDYILFEAQ
FT                   KDLIVGLTACSAEDSNGGSFKEIAYEIIAQKNE"
FT   gene            complement(391662..392318)
FT                   /locus_tag="ZPR_0378"
FT   CDS_pept        complement(391662..392318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0378"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50737"
FT                   /db_xref="InterPro:IPR014988"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDZ6"
FT                   /protein_id="ADF50737.1"
FT                   /translation="MTSDKKATKVYNSFQDFIITNDHPCIMAKTVFSMNLVNLRTYNNL
FT                   GNLNQTKELYKDLKAYIKNYDFESNQFETFIAVFPNSPEFTEIQFEEQLWIQLNQLNAV
FT                   DEYDWDPSVSNNPNDDNFSFSIAGKSFYIVGLHPNSSRKARRSPYPAIAFNLHWQFEKL
FT                   RKMGTYDRVKTSIRERDEQFSGSTNPMLKDFGSQSEARQYSGRKVGELWECPFKK"
FT   gene            392666..393535
FT                   /locus_tag="ZPR_0379"
FT   CDS_pept        392666..393535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0379"
FT                   /product="putative oxidoreductase protein, short-chain
FT                   dehydrogenase reductase (SDR)family"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50738"
FT                   /db_xref="GOA:D5BDZ7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDZ7"
FT                   /protein_id="ADF50738.1"
FT                   /translation="MKDPRTKYPQPPFDTPLQKEPGDEYEMNPLPDYGEDSYKGNNKLK
FT                   DKVAIITGGDSGIGRAVAYAFALEGARVVISYLNEHKDAEKTAEVIRNKNGEVLLIDGD
FT                   IQQEKHCKHIIDKTLEHFGQIDIIVNNAAFQMSRTSLQEISAEEWDKTFRTNIHAPFYL
FT                   CKAAEPHLKPGSSIVNTTSVNAYSPSDNLVPYAATKGAIRNFTASMAQLWADKGIRVNA
FT                   VAPGPIWTPLIPATMPKEKVENFGKQTPLGRPGQPAELAPAYVMLASEDGSYTSGATIE
FT                   ITGGRYTL"
FT   gene            complement(393693..394271)
FT                   /locus_tag="ZPR_0380"
FT   CDS_pept        complement(393693..394271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0380"
FT                   /product="RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50739"
FT                   /db_xref="GOA:D5BDZ8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014327"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDZ8"
FT                   /protein_id="ADF50739.1"
FT                   /translation="MNHKVLNELLKKGDEHSFTLIFEALYQPLVAYMMQYVDKAADAED
FT                   IAQNTFIKLWERKDHLDLNISVKSYMYSTAYNMFIDTYRKKKKQQTYLDQLKSETLVSL
FT                   TEEPDELLEHKLKLVAKAVEALPERCRLIFIMHKKQGHSHKEIAHQLRISTKTVEAQLR
FT                   IAYTRLREELKNRPDLYLMVVTAKSPIFK"
FT   gene            394434..395492
FT                   /locus_tag="ZPR_0381"
FT   CDS_pept        394434..395492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0381"
FT                   /product="anti-FecI sigma factor, FecR"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50740"
FT                   /db_xref="GOA:D5BDZ9"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032508"
FT                   /db_xref="UniProtKB/TrEMBL:D5BDZ9"
FT                   /protein_id="ADF50740.1"
FT                   /translation="MQLEQWVKSSKRNTYYFKNAVEQDYLLTVYSRKDEKNPGFDDIFQ
FT                   QRKSSSRRIMPVTLLKYAAILVLGLFAAGVGYFYLNNQVEEEYNPGQITFTYANGETIS
FT                   LDENGEGTLTDKSGNALGVQKQGELDFRTSGTQSTTYNIIKVPRGKRFNLLLSDGSRVY
FT                   LNSESTLRFPANFPNTGNREVHLTGEGFFEVSKDTEHPFRVNAEKLQVEVLGTRFNVNA
FT                   YKGSQQITTTLAEGSVRLQQGQKQATLVPGEAGTWSGVKEPIRVAKVKVANNIAWIENR
FT                   LLFIDEPFVTILEKIERSYGVKIINNNPSLAATRFNGDFDLNTESVEDVMNAFTTIDFF
FT                   EYSYKNNIITIK"
FT   gene            395662..399159
FT                   /locus_tag="ZPR_0382"
FT   CDS_pept        395662..399159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0382"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50741"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE00"
FT                   /protein_id="ADF50741.1"
FT                   /translation="MFATKGSAQKFNIDLESVKVATVIEQIKKQSDYKFFYREDLLQDD
FT                   WKVNIQTNSASIKEVLQQLFDDLPVDYIIKKKQVILKSKTISNTNGQSVDNKGTIDQQE
FT                   IYGNVRDPNAYPLMGVTVWRKGSRTGAVTNEKGNYRIQAATGDTLVFSFLGFKKQEKLV
FT                   GDEKTLNVILQEEVNSLGEVTLLSTGYQNIQKERATGSFSVIESEELEKVPVNNVINQL
FT                   EGRVAGLQIDLLASDNTFVYGNQFGETEGNTSYKYRIRGQSTYQANDKPLLVIDGVPSE
FT                   LDIKNLNSNDIEKITFLKDAASASIYGARAANGVIVIDTKKGKKGATRINLSQNYTFSS
FT                   KPSLSSLPLMNSDQVLDLEQELLEKGVIYDPMGAGIYSSVPVSSGVELMLQNQRGTLSD
FT                   AELADKLSVLRGRNNYNQIEDYLLQAASSTNYNLSISGGQENYSYFTSASYAKEETQSK
FT                   GVDGKRLTLTANQNFELFDFAKVSTSLKGSFFNFKQNGLGVSPLSASRTTFLPYDQIVD
FT                   EAGNSVDYYRAFYSADIQNFEEAGYLPWSYNYLDELANSNNGIKEQNYSANISVTLPLF
FT                   DGLSAMGTYFIERSNTKQDNIYGENTYYTRDRINQAMYLNPTTQQLTRGIPLGAIYQRN
FT                   DYTESSQTMRGQLNYNNTFGKHAIDAIAGIELRQIRTEVSGGNLYGYNEQTQRSIDLPS
FT                   ATYTTIYGYNDNISYNQVATNQRRRFLSYYANAAYTFDTKYVVSGSVRLDDYNNFGVDK
FT                   SYRRTPLWSTGLKWNMSREDFLKDVETINNLSFRATYGFNGNISLTTFPFTNISIAGTD
FT                   YNLSRLPYAFIAAPANPALRWEKTGVLNFGLDFNLFDKRLGGSVEYYIKNSDDLIQDFP
FT                   VSEFYGLPNNNTLTRNTATLRGEGVDINLNGEWLRTPEFSINSTFVLSYNKNEVTDSRY
FT                   ENYSTFLNGTASAPPIVDYPLNSIFAFRSAGLDENGSTIVYDRNGDIVDAFTPLTEIED
FT                   MQYMGTQTPKYYGSFATTFTYKKLSLYALATYKLDYVLFNPSFGNYVSRYGSFEAYDLN
FT                   SDIADRWRAPGDEVNTNVPGAQGLGGYSLGRYLYSTDRVIDGDHIRLREISLSYDFSDL
FT                   VANSFLRNASLSLTARNLGLIWRANDDDIDPDFLPYTSGSLIRIPPTAMYSVGVNLNF"
FT   gene            399164..400585
FT                   /locus_tag="ZPR_0383"
FT   CDS_pept        399164..400585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0383"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50742"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE01"
FT                   /protein_id="ADF50742.1"
FT                   /translation="MMMKKHSLYILFLLMSVAFVSCDDYVDIKTEGRLYPEETENYRYL
FT                   LNQTSIFDASYSLVDVASDDIEMRKNYATYFENNYGTSDYYRPFKETYKWADSVYYAGD
FT                   TDNDLGVMYQGLYTANVVITEVMTSNNGTEAEKASLQAEALVHRAYIFLDLVNIFGKAY
FT                   DAETSETDLGIPMFTEPTVTEEVTRASIKAVYDQIVSDLQQAINGGLPATRRGTEVGFP
FT                   SLASAHALLARTYLYMGRYAEAQAEAENALSLQNSLLNMEDYIDTPDSGWPRRIENPEL
FT                   ILSKMSISSYKDAPALLTLNDELLNSFEEEDLRYQLYTRPISEMTYDQVSGGRAYCEGL
FT                   LTGEKRNAGPTVPEMLLIKAEGEARAGDTDAAMTSINKLRMARFKAEDYVPLTAADAEE
FT                   ALLKVLEERRKELMAKGGFRWFDLKRLNKDPRFAKTITHQYIDEVYTLEPEGDRYQFPF
FT                   ASSLFQYAPNLEQNP"
FT   gene            400595..402604
FT                   /locus_tag="ZPR_0384"
FT   CDS_pept        400595..402604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0384"
FT                   /product="Thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50743"
FT                   /db_xref="GOA:D5BE02"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE02"
FT                   /protein_id="ADF50743.1"
FT                   /translation="MRLFNVLKIIPVFTLLAISIVFTGNLWGQDQEEVFSVAPRYPKAG
FT                   DQVTLSYDASQTPLKNRDSLTAVVYTYADFQWNVKDLKLERTEENKWQGQLKLEPGIAL
FT                   INCVFYAKDTLDRGGANTYSWMINNAPGSYSGWGIMRNPNINEDFPQQLDSLSFIEDSV
FT                   TLMWLNNEMRDNPSSRSHIFYSGLRLLQRTNTEDQTGRIKEELNYILSFPALDLKQQYD
FT                   VQRSLELITGNETYVDSVENALLSKYPNGVLARDRAIKQLFREADPDERVKAYNAFVNQ
FT                   FPEEKFEGITTTTEELYYDKLFRSIAYTYILENKDYGFVFDNLTNASYTNLVDYAWHLV
FT                   SIPYTNESMSLDSLQVFADRIFPEIESREHEVPKAYRGKLSPNQWKAMALKAAASEYLT
FT                   YAKILNEQQDYKREAYYLNKIAALLKYENTEYNALYTQQLVRQDKMDEAVSFIAACLRH
FT                   NNTSPEMLQVLKDEYLKSGKELSDFKDYVAGLKTGAENQKEKEALLTELIKKPIEDFSL
FT                   ESSYGGMVNLKDQLGKIVVIDMWATWCAPCKKAMPGMKMVVDHYADDANVKFYFLDTQE
FT                   YVKDYKTKTAAFIEEKEYPFEVLYDAVNPENGKPEMVYTKYAKAFQFSGIPQKMIIDQN
FT                   GYLRWRSTGYEGSPSALADEIKTIVEYLKAESKS"
FT   gene            402634..404007
FT                   /locus_tag="ZPR_0385"
FT   CDS_pept        402634..404007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0385"
FT                   /product="protein containing alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50744"
FT                   /db_xref="GOA:D5BE03"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE03"
FT                   /protein_id="ADF50744.1"
FT                   /translation="MLFALSTGLSRGQSLWQGQYHAKRLLLEKTQNQNAKDSFFLSSPE
FT                   YYYNRLPLQRNYLSDSLILKNEEFNLVLKLKPQLDSTFTLVFANYEGEHPIQFDQVNAL
FT                   QPHSYPQHPKGTLPYTSTELVFSGKKTGIDYGGTLVIPNDHKHYPLAILLNGTGRQDRN
FT                   YTYSGHQFFTVLADALARNGIASFRMDDRGTGSTTGNFDNAGISDFTADAREALEYLKA
FT                   REHIDSRFIGLIGHSEGGVVASRLTAQDPDVKFMVSLSGVGVSGLQILDLQNTAILKAS
FT                   KMPDSLVNLQMEVYRELFKTVYNNQETDSLKTELEDRLGKWMKGKSLKTLEALQLADDR
FT                   DKTLIYRFYNSAKSKLYKEMILYNPKQYLPDIEVPVLVLNGDADIFVPASENVASFKEN
FT                   LINAPVVTTKIYPGLNHMYQHCKTCTSQEISMLDEVFAPEVLEDITQWIWEIYRDDNK"
FT   gene            404098..406203
FT                   /locus_tag="ZPR_0386"
FT   CDS_pept        404098..406203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0386"
FT                   /product="cytochrome c biogenesis protein, transmembrane
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50745"
FT                   /db_xref="GOA:D5BE04"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE04"
FT                   /protein_id="ADF50745.1"
FT                   /translation="MRLFITGIFFLIVSLAQSQIYDPVSFKPDVQKIDDTHYALSIHAS
FT                   IEPGWHLYAQNVPDGGPVPTQFEFTTSDAYELNGSVSEPQGHVVDDPIFEMRIKYFSDS
FT                   AEFQQVIERKTAEAFSVKASVEFMVCNDESCLPPTIKEVVFELEATAATLNEEATKPLQ
FT                   KTNEVEEQTVPKNGDATKSESTEVEVVNAEEQDTLTLKEGDQPIKKPNSDLENTKAEQE
FT                   EEAADSRNLISIFILSFLGGFAALLTPCVFPMIPMTVSFFTKQSKTRASGIKNALLYGL
FT                   FIIVIYVVLGSVVVAIFGADSLNALSTNVWFNLIFFGLLLVFAFSFLGAFEIVLPSSWV
FT                   TKIDSQADRGGLIGIFFMALALAIVSFSCTGPIVGTLLVESASQGGVAPIVGMLGFSMA
FT                   IALPFALFAAFPGWLNSLPKSGGWLNTVKVVLGFLELALAFKFLSNADLVLQLHLLERE
FT                   TFLAIWIAVFGGLALYLFGKITLPHDSPLAHISVGRLSLGLFVLAFVVYLIPGLWGAPL
FT                   QWISGFPPPAQYSESPYGVGNTKGVSGTSIELPPHAELGPLDLVTFKDYEAGMAYAKKV
FT                   NKPVMLDFTGYACVNCRKMEERVWPEPQVQQVLRDELILISLYVDDKKELPEAEQYVSE
FT                   TTGKKIKTIGNKWSDFQIKHYKANAQPYYVLIDNEGENLNDPRAYDPDVDSYLSWLQEG
FT                   IKNYNNK"
FT   gene            406207..408999
FT                   /locus_tag="ZPR_0387"
FT   CDS_pept        406207..408999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0387"
FT                   /product="peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50746"
FT                   /db_xref="GOA:D5BE05"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE05"
FT                   /protein_id="ADF50746.1"
FT                   /translation="MIYRIKNGLVLLIALLSFSLNAQQIDSPIPPKNFASGVLENGMHY
FT                   YVLHNEEPKERASFYFAQNVGSVLENDTQRGLAHFLEHMAFNGTQNFKDKEMLEYLEKN
FT                   GMKFGSEINAFTSFDETVYNINQVPVTNEKLLDSVLLILHDWSGYLSLTDAEIDNERGV
FT                   INEEWRSRNTAGFRANSKVWLDGFLKDSKYSKRMPIGLMDVVNNFEYDELRDYYKRWYR
FT                   PDQQAVVVVGDVDVKGLEAKIKKVFSSIPLKKDLPERPVFDVPIAAEFVYINSTDKELG
FT                   EPSLQYFVKRTPLDLSVVEKIKEDITGSFASYILNNRFSELVLEKNCPVLGVGFGVQEF
FT                   VRHLEILSLNARPKKDSLLSGLKYIVKEYTRFAEFGATPEELARAKAAFKTSLESSIAN
FT                   IAKRSNDSYAGEIYQDFFDKESVTDYGWTLSYQLRLLDQVTNESILDYLKRFKGDNGRG
FT                   VSIVGSDTNTYPDKEDIESALAEVAAQKLTPFKETSSDKKLINTDLKGSPVIKTENIEG
FT                   IDAKSYTLANGLKLALYPTDFDKEQVFMTAFSPGGSSLLSVEELPNTVVASYLVGQSGL
FT                   GELNKIELQKLLAGTETSLGVSINGYSESLSGSSKTKDLETLFKQIYLQFTAPRFDAQA
FT                   FEIIKQNLATNLIAKEKQVTSAFQDSLTLASTGHSKRSVLFDQKLIDNVTLEGASKVYR
FT                   ERISNANDFTFVFVGDFQESELLDLATKYLGSIPSTTKTEEVVNHNMRPAKGKTTVHLE
FT                   KEMETPQTTINVSFNGDMEYSKKNNLELYVLSQLLDKRYMERIREEEGGSYGVRVGGSV
FT                   SWEPIGNYNLSVSFNCNPDKTDELLKIVYGELKKMETSIGAEELAEIKSNYKKGVSENQ
FT                   RNNNYWLSNIANNLQKGTPVSDEAGSIALIESITTDDLMATAKLINSEPDIIEGVLMPK
FT                   "
FT   gene            complement(409114..409692)
FT                   /locus_tag="ZPR_0388"
FT   CDS_pept        complement(409114..409692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0388"
FT                   /product="ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50747"
FT                   /db_xref="GOA:D5BE06"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014327"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE06"
FT                   /protein_id="ADF50747.1"
FT                   /translation="MSQYSFKNNEKLIQRLQAGDSECFQYIFNELVEPLTAFIYTYTQD
FT                   EALAEDIVQHSFMKLWEKRTSLNPQAFLKTFLFTIAHNRFIDIYRKEKKQVYLTDTIYL
FT                   ETVLETEELNEENLKPRLEQIDKAIESLPKKCKEVFLLKRQHNLKNKEIAEYLGISIKT
FT                   VEDHISRALRLIRKQVLIWLILILSDFFN"
FT   gene            409901..411034
FT                   /locus_tag="ZPR_0389"
FT   CDS_pept        409901..411034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0389"
FT                   /product="FecR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50748"
FT                   /db_xref="GOA:D5BE07"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032508"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE07"
FT                   /protein_id="ADF50748.1"
FT                   /translation="MESKYTDFERLVEKFIQGDLSDEEQEKLDSLLNDKDNKSHFKEML
FT                   SLNYRLNKRWLKIEQAKKDKLFAKIMEVPPVKKLNPYQNLLRIAAIFAILLGGAVLYYA
FT                   SFEIQPVPEQVVTLDLDTGVHKQLEKGAKGVIAETNGVRIEQRGDTLTYITKNQDDVII
FT                   SFDEIHVPYGKSSVVALADGTLINLNAGSSLRYPNGFKAEGNREVFLTGEAYFQVSHDA
FT                   KRPFLVHTDDLEIEVLGTHFNVQAYADEKNSNTLLVNGVVQVKQKSNPEDAVVLKPGMQ
FT                   ASYTQGSKTLEIASVNTAPYIAWVKGQLYFDQADFPQIARILERKFDVQIQVNNTALKK
FT                   EKFTAKFKAESLEQILKSFNESYPFNYDIKQNTVVIN"
FT   gene            411250..414399
FT                   /locus_tag="ZPR_0390"
FT   CDS_pept        411250..414399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0390"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50749"
FT                   /db_xref="GOA:D5BE08"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE08"
FT                   /protein_id="ADF50749.1"
FT                   /translation="MKITLHEKQISILDFFEKVETITPYSFLYRVGDIDLNRRVNVSVD
FT                   QISLEKILSSLFTTEGIIYKVLDKQIVFSKKNETLVAKEVVEQQTVSGIVSSQKGEPLF
FT                   GVTVLIEGTRRGVSTDIDGKYTIVAEPGEVLVFNMLGFEKAYHTVTDQQVVNISLKEQT
FT                   SELDEVMVVAYGETSKRFNTGAVNQINAETIEEQPVNNPILALQGAAPGLFITQEAGRP
FT                   GGNVTVRIRGENSIGSSNRPLYVIDGIPYSDEPMNQFSYIGFPTKGNQSPLNSINPADI
FT                   ESISILKDADATAIYGSRGANGVILITTKHNKLSGKGLSVNVNVLTGVKEVGHMMDLLS
FT                   TPEYLALRRQAFENDGVVPDNSNAPDLTLWDQNLDMNWQEHLFGGTANFVNAQAGISTG
FT                   TARNSFSLNTSYNQEGTIYPGDFSYQRFSIRSRYSYQSQDDRFRLNLQANYSTDDNNSF
FT                   GGNFASVLLTPPNFNPYNEDGSLNWTITNPIAPLNASYVNKTNTLFADLNLAYEISDYI
FT                   TAKVLVGYNINNLDQQNKNPSTSLNPAYANYSWGSPNVQQGDTKRQTLNIEPQLTYKNQ
FT                   IGNGVFSALLGGTLMKRTQDNQTIDANNYSSDLFLDNIGAAGSYSIFVSNIDYRYLSGF
FT                   LRLNYNWNDKYLFNASVRRDGSSRFGPNNQYGNFAALGAAWIFSEEKFFKDQSVLSFGK
FT                   LRASYGSTGNDGIGDYGYYQLWTATSSINNESSTVLTPTALANLDYSWEKVLKFDVALE
FT                   LGFLKDRILLNANYYRNSTKDQLVGLPLPSQTGFTSVNANLPALIRNTGVELSLNTRNI
FT                   NSETFSWNTDFNITFQKNELVSFDDLEASTYANTYEVGSSILSQKGYLASVDPETGTYT
FT                   IQDLNNDGQITYADDRKILGDRLPKFYGGLQNNFTYKNWNLGFLFQFVKQEDYNYLNTV
FT                   YDAVGNRSNFEESVLNYWKQPGDQVSVPKPSTATSNAFFNSLSSSLHWDDASYIKLRNV
FT                   NLSYNLPATWVNQVGMQNARVYFQGQNLLTITSYKGLDPESKSTFAPPLRIVSLGVQTN
FT                   F"
FT   gene            414449..415792
FT                   /locus_tag="ZPR_0391"
FT   CDS_pept        414449..415792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50750"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE09"
FT                   /protein_id="ADF50750.1"
FT                   /translation="MLALLTLFSCEAYLEPDLSDNQLATSDVFASDATAISAINGVYGD
FT                   FMLRTDPINISNGSLSVMGGLCADELYDFTQTYQSYNINEVPFTAFGPDYYYWYDTYNI
FT                   IYSANAILEGLEDAPNVSEDLKVQLRGESYFVRAFLHFYLVNMYGGIPLITSTDYKENA
FT                   SKGRASVAEVYEQVITDLKSAEDLLTDEYPSDKKLRPNKYVVQAMLSRVYLYMQEWKLA
FT                   EDYTTKLINGPYALEDDVEQVFGIDNQETIWQLIPSNTNSTVVNEGRWFNPGQTPTYVL
FT                   TETALNAFDDADARFETWVDTVSYQNELYYYPAKYEPLGGSINQYSIMLRLGEQYLIRA
FT                   EARAEQDMPNEALEDLNKVRTLHGNLDAYASGMNKEEVLDKVFEERQVEFIGEWGHRWL
FT                   DLKRTGKADAVLSALKPQTWESTDVLWPINNSELQSNPKLEQNPGYND"
FT   gene            415854..416963
FT                   /locus_tag="ZPR_0392"
FT   CDS_pept        415854..416963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0392"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50751"
FT                   /db_xref="GOA:D5BE10"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR025380"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE10"
FT                   /protein_id="ADF50751.1"
FT                   /translation="MQCKNSDSNENSEEKEQFKISGKIKNQPDGMIYLEELDVPEGASS
FT                   LVDSVQLQNDQFTFSGKVDFPKWYAIKTSDTTEWPLRIVLSNEDITINAVKDSLYKAKV
FT                   NGASVYAEYQDYYDTYFEKIRSKARPIYQLLDSLNQGGKRELAKKERLMMDKKWEEMSR
FT                   FSDSITKLYVSNNPGSLAAPMIISERYIQYADPDRADELYQLLDPKAQSSFYGKKLSKA
FT                   LEGYKSVAVGSRAPAIKNQVDLEGNKIGLEDYKGKFVLVDFWASWCGPCRKENPNVLKA
FT                   YNTYHSKGLEILAISLDEKRELWEKAIKKDKLPWKHVSDLKGFKNQAAQDYMVSAIPQN
FT                   FLINPEGEIIATNLREEGLHEKLKEIFTN"
FT   gene            417311..418804
FT                   /locus_tag="ZPR_0393"
FT   CDS_pept        417311..418804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0393"
FT                   /product="aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50752"
FT                   /db_xref="GOA:D5BE11"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE11"
FT                   /protein_id="ADF50752.1"
FT                   /translation="MKKNMQKTTMSENLETYFQSFRRNTIGVNHEFKSVYGIQNQLYAD
FT                   WIASGRLYQPIEEVICNKIGPLMANTHSFSSETGKASTYAYHEARAIIKQHVNAGTDDV
FT                   LVTTGTGMTGALARLHRIMGLKAKQHLSGSLERPVVFISHMEHHSNQVPWQALDVDVVL
FT                   IAPDEKLQMSLENLETQLKKYADRKVKIGSFTACSNVTGAIAPFYQLAEMMHAYNGLCF
FT                   VDFAASAPYEVIDMHPENKNQKLDAIFFSPHKFLGGPGTSGVLVYDKKLHQNTHPDTPG
FT                   GGNVKWTNPWSDYGYHTDLETREDGGTPGILQVIRTALCLKLKELMDPKMMKLREKELL
FT                   DLFYEGVAEFPEIEVLGNREENHIGCVSFNVRAMHYNLVVRLLNDRFGIQVRGGWSCAS
FT                   SLAHYLFKIDSEQSEKMIQDIENQNLTDKPGWVRVSLHPIMTNAEVQSIIEALREIIQY
FT                   GKEWATDYQYNPKTNEFDSLRQDDTELKKGMKAMFLGLA"
FT   gene            complement(418944..419411)
FT                   /locus_tag="ZPR_0394"
FT   CDS_pept        complement(418944..419411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0394"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50753"
FT                   /db_xref="GOA:D5BE12"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE12"
FT                   /protein_id="ADF50753.1"
FT                   /translation="MKNWNFKVKNNPAEIKNNLQSSLASVHGFVIDIKSDNSSRITFKI
FT                   RKRLLYAWYIVYHNNLVVNGKLSRADNQDETDVHISFGQNILWKFVILAHLSLGLSFIA
FT                   AIVLGNNSGNSMYLLAALTFAIVLLLWFRLQKKHKNDVEEYKKLLSETLGF"
FT   gene            complement(419618..420112)
FT                   /locus_tag="ZPR_0395"
FT   CDS_pept        complement(419618..420112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50754"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE13"
FT                   /protein_id="ADF50754.1"
FT                   /translation="MNKIILIFILVTSFTYGQNQKINKDNPGTTKTDDYLEEDWRELSK
FT                   HGQHVEAASELIFLSMSDSTRNKHADYWHIGQVYAFDNQYKKAVFYIKESMKGKSENDD
FT                   EQFWWYYKGILAFLQKNKNELKKYYDLLEKNHTSYYSNNAKVLKRLFENFEEPYSQAYP
FT                   K"
FT   gene            complement(420315..420737)
FT                   /locus_tag="ZPR_0396"
FT   CDS_pept        complement(420315..420737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0396"
FT                   /product="XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50755"
FT                   /db_xref="GOA:D5BE14"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE14"
FT                   /protein_id="ADF50755.1"
FT                   /translation="MFIFEIMSTATKTSHIGRKISRIRELRGMKQEALAAELGISRQSV
FT                   SSLEQSEHIEDEKLEKVAKVLGVSKEAIENFSEELAINFFNSFQDSSNGTFNNHCTFNP
FT                   LDKLMESVEENKKLYERLLQAEKEKVTYLEKLLDKK"
FT   gene            complement(420795..420944)
FT                   /locus_tag="ZPR_0397"
FT   CDS_pept        complement(420795..420944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50756"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE15"
FT                   /protein_id="ADF50756.1"
FT                   /translation="MPHQEYMVKKNIIHALFILILGLNIQKRKHGDITKLQVLKKQLQP
FT                   NKVI"
FT   gene            complement(421208..422242)
FT                   /locus_tag="ZPR_0398"
FT   CDS_pept        complement(421208..422242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0398"
FT                   /product="hemin degrading factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50757"
FT                   /db_xref="GOA:D5BE16"
FT                   /db_xref="InterPro:IPR007845"
FT                   /db_xref="InterPro:IPR010413"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE16"
FT                   /protein_id="ADF50757.1"
FT                   /translation="MSTTSLKQRWETLKEEQPQLRIRNAAQALNVSEAELLATKINNGV
FT                   TRLVNKPKEILPEIESLGKVMALTRNESCVHERKGIYLNPSIGKSPVGLFVGEDIDLRI
FT                   FFMHWAFAFAVSEMARGKEHLSLQFFAEDGMAIHKIYLTPQSHVEAYKALVEKYKSEEQ
FT                   NTKLEISVFAEAPRYKNDNEVDLAGFQKSWEELKDTHHFFGLLKKHNISRSQALRLAPS
FT                   AYYADKIEKEKIVSMLEKVARQELPIMVFVGNPGNIQIHTGKINKTLWHQQWFNIMDPD
FT                   FNLHLNMDGVTNCWVVRKPTEDGIVTSIECFDKDDELIVQFFGKRKPGIPEIKEWQEVV
FT                   AQLQ"
FT   gene            complement(422239..423048)
FT                   /locus_tag="ZPR_0399"
FT   CDS_pept        complement(422239..423048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0399"
FT                   /product="hemin transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50758"
FT                   /db_xref="GOA:D5BE17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE17"
FT                   /protein_id="ADF50758.1"
FT                   /translation="MLAVNQLNIHIKNRKLLEDINFSIQPGELFAIIGPNGAGKSTLLK
FT                   ALTEEIKYSGEIRFQQESIKKWTTARLAKTRAKFSQHHQQDIPLPVNEVVMMGRYPYFV
FT                   SRPGITDLKVVAESLKLTEMSHFKDKSYNQLSGGEKQRIHLSRIFAQLTNNFQKKLMLL
FT                   DEPLNNLDVYYQHKVLEVIKDFVKKGNMAAIVMHDLNLAAQFADRIVLLKDGKTIKYGN
FT                   PKEVLTSKTICDVYDFPCKVMAHPLAKTPMIVFGEEKSASIIQNINP"
FT   gene            complement(423048..424058)
FT                   /locus_tag="ZPR_0400"
FT   CDS_pept        complement(423048..424058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0400"
FT                   /product="permease protein of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50759"
FT                   /db_xref="GOA:D5BE18"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE18"
FT                   /protein_id="ADF50759.1"
FT                   /translation="MSLGLTLLVVAFIASSLLGVYQLNWNDFLLLFKSIFDDTVAVNPT
FT                   DAYIFFDVRMPRTILAIIMGAGLAVTGTSLQGMFKNPLATPGIIGITAGSALFAAVAIV
FT                   LGSTIKSFLPEILHYSLISIAAFIGALLVMILVYSISFKNGKTHVVIMLLAGVAIAALA
FT                   EATTGFLTFISKDDELRDLTFWRLGSLGAANWSKVMILFTINLICLSLLLGNGKALNAM
FT                   MLGEENARHLGINVKQYHAKIIWLSALVVGTSVAFAGTIAFVGLIVPYILRLLLGSDYR
FT                   LILPLSALFGSVLLLTADIISRTTLAPIEIPIGIITAFMGAPVFILILLQFKKAL"
FT   gene            complement(424072..424875)
FT                   /locus_tag="ZPR_0401"
FT   CDS_pept        complement(424072..424875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0401"
FT                   /product="hemin-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50760"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE19"
FT                   /protein_id="ADF50760.1"
FT                   /translation="MKSSQESESEKSQERIISLNGTLSEIISELGYQDQLVAVDVTSIY
FT                   PENLKEKATDLGHVMNLNVEALLQQKPTQIFAVKKELSADIISQLNTLEVPVHYYEPEY
FT                   SVEDAKNLINLVAKDLNTEAPEKITHNIENKLDVLEEFKSKPRVMFVYARGAGTLLVAG
FT                   KETPVAKMIELAGGENAMNTYDDYRPLTTEAVAQANPDVLLFFDSGLQSVNGIEGLKGI
FT                   SGLANSTAVKKGQVVSMDGLLLTGFGPRTGEAAVQLNKELSQYAN"
FT   gene            425127..427244
FT                   /locus_tag="ZPR_0402"
FT   CDS_pept        425127..427244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0402"
FT                   /product="TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50761"
FT                   /db_xref="GOA:D5BE20"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D5BE20"
FT                   /protein_id="ADF50761.1"
FT                   /translation="MRFSVFICFSLIVGSLYSQRDSVRVNTLDEVLLFGNQYTISSIDK
FT                   ELFTVNTISAQQINQVGANNLADILNQQLNISITPNAADGRSTISMFGLSGDYVKILVD
FT                   NVPLVSDNGYGNNIDITQINLEDIARIEIAEGAMGVLYGDNAVAGVINIITKKSTASKW
FT                   NIRVSLQEETVGEEYNFEDEGRHIQNLAIAHNISDHWYASANFSRNDFNGFKNNYFGRD
FT                   YFGLSGNSVVNDGLRGYEWNPKLQHSLNAMLKYGKMNFNFFYKFNYYNETLDIYNHSIN
FT                   PRIQNGEYDIIANDEQFVSNRFRHEAQAFGRINQIDYNLSLSYQTQTRDYENYVYDLRQ
FT                   QGKRSTTKNTTNQESDLWFSKGTFTNLLSKSADFSLTAGYEITYQEGYDAVASGAYSND
FT                   IAQQDLGNYDVFSQLSFTKKNWSFYPGVRLNNNSNYGSKLIWSTSANYKPAKNIKLQAV
FT                   IGSAYKTPTFTNLYYYFVDANHDVRGNPDLTPEDGISYLISAEKTSVFNKQFQLQNNLK
FT                   FFHFDIQDKIDLAVVGDNSQMQYLNISEYKILGVSTENNLSYKNFQTNIGLSYTGISQS
FT                   LKTETSNPDDYLFSLNATAALRYYWPKAETRFSVLLKYNGELQQYFRDNDTNEFVKGTQ
FT                   EDYSLMDASINKYFFKKRFEVTLGARNLFNVVRVNNAAITAMGGHAAPATSLLFGYGRS
FT                   YFLKLLYNLNM"
FT   gene            427262..428458
FT                   /locus_tag="ZPR_0403"
FT   CDS_pept        427262..428458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0403"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50762"
FT                   /db_xref="InterPro:IPR025921"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEN3"
FT                   /protein_id="ADF50762.1"
FT                   /translation="MKKNILLQLFCLSFVVFSCSSDDDNVSVIEIPAVESAVLDIESGG
FT                   SNEPNQVYIDLSTEKTTVVRRDSWELGFISTENRVVLNSSILVSAVKLDGINDIDAVSE
FT                   DTSLVTPMNLKSLNLATFQSVDVSVTTVEELLVGLPIGYSMYGDPENNISFTDSSIGDL
FT                   DDTAIGDIANSETDAEVYVVSLGSEIPNDPAEPGSVNHTGDHRGFYKIKVFMDNNDYVL
FT                   QYAPLGENSHSQVVINKNETYNFTGFSLANGTEVDVEPNKGNWDINYTSVYSYYGSMGG
FT                   MNAGLTYSDYVVHNTLNGVGVYMVLTEEPGEGEDADPVATGAPSYEDFTLDDINENKLV
FT                   FNDRALIASGWRSTSNGAKSDRYYIIKDTDGNFYKLKFTALLNEQGERGYPQIVYDLL"
FT   gene            428582..429454
FT                   /locus_tag="ZPR_0404"
FT   CDS_pept        428582..429454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50763"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEN4"
FT                   /protein_id="ADF50763.1"
FT                   /translation="MKNFFTTVLILFIICNLKAQQLKAYAIYDAEGNEVSFQKMSDSLS
FT                   NYEVVLFGEFHDHPVVHWLQKKLTEKLYAKNANLVLGAEMFEADNQLILDEYLQDKIPQ
FT                   NRFEEEMRLWNNYKTDYKPLIEFAKTNNLQFVATNVPRRYASVVSKYGLDTLKTYAKEA
FT                   QSYFAKLPITVDTITPGYAEMFGMMSAHGMEADAMKFVEAQAIKDATMAEKIIDYLPKN
FT                   GIFLHYNGDYHSKSFGGIYWYLKAMQPDLKIAVIRVAQSKNESLEFIEDKTGTGNFILF
FT                   IPEDFTRTY"
FT   gene            429543..429941
FT                   /locus_tag="ZPR_0405"
FT   CDS_pept        429543..429941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50764"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEN5"
FT                   /protein_id="ADF50764.1"
FT                   /translation="MKFFKLLSFLAFFGFSLLASAQETDSLAISSEISNHRAIHKDYLS
FT                   IVYGPYSLKSNMAYVSLNGEDYQKIKLKRSKLFNRYDYNGLLKLLKKYNSQGWELVGKD
FT                   FEFEEESGARVFIMMTRDSEEKKLSKND"
FT   gene            430256..430648
FT                   /locus_tag="ZPR_0406"
FT   CDS_pept        430256..430648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0406"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50765"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEN6"
FT                   /protein_id="ADF50765.1"
FT                   /translation="MLKPKNKIMKTKKKLNFGFLTLLTLFVFSTVHLNAQTEKQKDLID
FT                   DATASKAIFVKEEPEMSALFEKAAGYVIFPNVGEGAYILGGAAGNGVLFENGQVAGFSE
FT                   LKQLDIGLQIGGQAYRQAILFQTASE"
FT   gene            430711..430830
FT                   /locus_tag="ZPR_0407"
FT   CDS_pept        430711..430830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50766"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEN7"
FT                   /protein_id="ADF50766.1"
FT                   /translation="MNIRIGLNNPDKIYSSFLRSVKFITDLFFFRKFKKIKCV"
FT   gene            430921..431607
FT                   /locus_tag="ZPR_0408"
FT   CDS_pept        430921..431607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0408"
FT                   /product="L-2-haloacid dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50767"
FT                   /db_xref="GOA:D5BEN8"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEN8"
FT                   /protein_id="ADF50767.1"
FT                   /translation="MELSWGSFTGMKIKAIIFDVNETLLDMQKLEDEINAGLGNSLGFQ
FT                   IWFSKLLHYSLVENEIGSHHDFSKVAFATLKMAASYFGKEFSEKEIQSLLRLVKELPAY
FT                   PEVGMVLKALKEDYHLIALTNGNQETAEAQLKYAKIDEYFNGIYSVDVVGKFKPHPSTY
FT                   QKVLKDYKLKAHEAIMVAAHGWDIAGAQNAGLKTVFVARKGKSLYPLVNTADGLVKDLK
FT                   GLMETL"
FT   gene            complement(431645..432235)
FT                   /locus_tag="ZPR_0409"
FT   CDS_pept        complement(431645..432235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50768"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEN9"
FT                   /protein_id="ADF50768.1"
FT                   /translation="MNVKKPVFSYIEFYEWMVQLVNNKQTSGEKQTENLIQFTELNLSR
FT                   MKRLNKTTKLIPELENLVTGLKKPQVWYVITEAWCGDSAQNLPVIGEIATAGDKIELRI
FT                   VLRDENPELIEKYHTNGSKSIPKLIAFSEKGVELFTWGPRPKPAHDLVLDWKENPAGRD
FT                   FEALEKELHTWYAKDKTQTLQKEFLHLLSALKN"
FT   gene            complement(432247..435855)
FT                   /locus_tag="ZPR_0410"
FT   CDS_pept        complement(432247..435855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0410"
FT                   /product="metallo-dependent phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50769"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEP0"
FT                   /protein_id="ADF50769.1"
FT                   /translation="MINIFLLQQSAYSFKKIFFAFCFILAISTTHFYGQQSGRKVSQTF
FT                   YFTGNTGVDESDYTKKVLSAINEMSQKDEKATFVAIGNITSKQGFPPKKKDREKAEALL
FT                   RKSLMEPMENFNGRVIYTPGKNEWNKNGHENIDDMESFIQDNSKAEFWPNDGCVREIED
FT                   LDTENIELLMVDSQWFLEDWDNHLYINNKCDLKTRDDFFTKFKDDLKDEQNKTVIVAIH
FT                   HPVLSNTKQGFFEKTGGFKKEDYYSQQRKQLRGTLETLASMFPDVIFVSASDQNLQYLS
FT                   DDGIPQIISGTAGKKTKKARADEEDGQFASSDHGFARLTVYDDNSSEVEFYSVENGTPE
FT                   KLFSTTIKRQQTTLDEVSYHDISNWPATKKASIYTDEETSKSGLYNFFWGTHYRDVYSK
FT                   EIEAPVLDLTKLEGNPVAISEGGGHQSRSIRIKDDKDHEYTLRELRKSAVRFIQSAIKN
FT                   HYVEDYMQNTVAERIVQDFYTTAHPYAPFALNTILDTLNIYNAEPKIYYLPKQKNLNIF
FT                   NEDYGDKLYMLEVHAGDENKDNPKFGNPDDIISSTDLLLDMRDSKEYQVDQSAWVKARL
FT                   TDMLIGDWDRHNDQWRFSEFEQEDGSKLYKPIRRDRDQAFPRYDGLIIKLLRLAITDFR
FT                   KMQDFEGGVKNVKWLNFDGYSLDQAFLKDITWEEWEKQVKFIQNQLTDQVIEDAFKTLP
FT                   KEVQDQSIDDIKKALKERRDNLLEPAKAYYEYVNRFQVITGTEEDDKFLITRKPDGKTS
FT                   LSIETEGEVVYEHTYDKKLTKEIWIYGLDGKDDFKIEGEGDHYIKLKIIGGENNDTYDF
FT                   ENNRNAKLYDYKNKNNTIKGNSSKWLVDDYDINNYNPDKRKYSTNTIFPAIGWDPDAGF
FT                   KVGISDTYTTYGLANNPFQSQHKFGAAYFSATNGFEFTYSGEFAHIFHNWNFGIEAGFT
FT                   SPNYAINFFGFGNETSYDDDAVDRDYNRVGIAQWNFAPSLIYRNGSGINFEIKPMIESH
FT                   EVDYKANEATGEFFNSNDDIFENQIYAGGELAFQYKNKGNELAFPRRGLQFDLATGYKT
FT                   NIDEFNNEFVYLKPSVSIDYPLHESGIAVLATKIGSHMIFGDNYEFYHGATLGGNHSLR
FT                   GYRNERFNGKTSFYQSTDLRVGLAKFRTNFIPVRMGVTLGFDYGRVWEEDDNSDIWHND
FT                   FGGSIFINGFNALSGNLGLYHSEDGNRVMFSLGFNF"
FT   gene            complement(436008..436457)
FT                   /locus_tag="ZPR_0411"
FT   CDS_pept        complement(436008..436457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0411"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50770"
FT                   /db_xref="GOA:D5BEP1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEP1"
FT                   /protein_id="ADF50770.1"
FT                   /translation="MLTPFDDTYFMKKAFEEAQIAFEKGEIPVGVVVVIKNRIIARGHN
FT                   LTETLNDVTAHAEMQSITAAASFLGGKYLKGCTMYVTLEPCQMCAGALYWSQLSRLVFA
FT                   AKDDHRGYQKFGVQLHPKTEVSQGIMANECSQLLKKFFIQKRNLN"
FT   gene            436539..438305
FT                   /locus_tag="ZPR_0412"
FT   CDS_pept        436539..438305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0412"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50771"
FT                   /db_xref="GOA:D5BEP2"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEP2"
FT                   /protein_id="ADF50771.1"
FT                   /translation="MEYQILNNIEGPENLKALSLQELQLLAKELRQYIIAVVAVKEGHL
FT                   GASLGVVELTIALHFVFDTPRDLLVWDVGHQAYGHKILTGRRKKFHTNRQLGGISGFPK
FT                   REESVYDAFGVGHSSTSISAALGMALASRLKGDLDKQHIAVIGDASIASGMAFEGLNHA
FT                   GVTNANLLVILNDNAIGIDPSVGALKEYLTKAKVGYKPKESNIIEALNFRYFGPIDGHD
FT                   LEGLVSILKELNEIKGPKFLHVITKKGKGLKKAEEDQVKYHAPGKFKPETGELLPKSAE
FT                   GLPLKYQDVFGLTLVELAEKNKNIVGITPAMPTGSSLKYMMEAFPERAFDVGIAEQHAV
FT                   TLAAGMATQGAIVFCNIYSTFLQRAYDQVIHDVALQNLHVIFCLDRAGLVGEDGATHHG
FT                   LFDLVYLRAIPNMIVVAPADEIELRQLLYTAQLGLTHPMAIRYPRGRGVNVNWQLPFKA
FT                   LEIGKAVCEKEGENLAVLVVGSIIRNAKLALQEFSEEIGLYNMRFVKPLDKTMLHQVFK
FT                   KYKTILTIEDGVISGGFGSAILEFAAANDYSLKIKCLGIPDAFIEHGEIGELQEIAGID
FT                   VKTIINELKSLL"
FT   gene            438409..439341
FT                   /locus_tag="ZPR_0413"
FT   CDS_pept        438409..439341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0413"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50772"
FT                   /db_xref="InterPro:IPR021428"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEP3"
FT                   /protein_id="ADF50772.1"
FT                   /translation="MCAQNQTAQDTTQTPQDSADVEPVIIYWSEKNAVGVNLSEVAFVN
FT                   WNAGGNNSISALFHGQFERNYKKKLTSWKNYLSLRYGLNSQEGQELRKTDDQIQFKTTF
FT                   GYRKDSVSNWYYSGNIDFRTQFANGYKYPNTDAAISKFMAPGYLLIGVGTQFSHPDENF
FT                   NAYISPVTEKSTFVLDQRLANEGAFGVDPAEYDELGNLIDEGNKVRSEFGFLVTSDFKK
FT                   QVFPNVNMNTQISLYSDYLRDFGNIDVDWQLAFDMKVNDFIKANIGSHLLYDNDVKYKE
FT                   DTNGDGNLETLGARVQWKQLLGVGFTYVF"
FT   gene            complement(439418..440764)
FT                   /locus_tag="ZPR_0414"
FT   CDS_pept        complement(439418..440764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0414"
FT                   /product="dGTP triphosphohydrolase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50773"
FT                   /db_xref="GOA:D5BEP4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR027432"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEP4"
FT                   /protein_id="ADF50773.1"
FT                   /translation="MNWEQLLSLKRSGDTNKRLRKEQDETRLGFEVDYDRIIFSSAFRS
FT                   LQDKTQVIPLSKTDFVHTRLTHSLEVSVVGRSLGRLTGKKILEKHPHLSTIHGYQMNDF
FT                   GAIVAAAALAHDIGNPPFGHSGEKAIGEYFLNGNGKRFQSQLSEKEYQDLVKFEGNANG
FT                   FKILTQDRPGTPGGLRISYATLGAFMKYPKESLPHKPTKNIADKKFGFFQSEKGTMLDV
FT                   AQELGLIKTGNKNDISFSRHPLAFLVEAADDICYTIIDFEDGINLGLIDEDYALEYLIK
FT                   LVKDTISTPKYNSLQSTADRLSYLRSLAINTLIREAAEIFLANEEAILAGEFHQALFDK
FT                   SKYEAQIKDIIKISIEKIYQSEEVINKEIAGYKMLETLLDTYTNAFLPATQDLDSNFND
FT                   LVLKSVPKLKNLNAETSVYQKLIQICSYTASLTDGFTVSSFKRYQGSGF"
FT   gene            complement(440870..441433)
FT                   /locus_tag="ZPR_0415"
FT   CDS_pept        complement(440870..441433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0415"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50774"
FT                   /db_xref="InterPro:IPR021458"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEP5"
FT                   /protein_id="ADF50774.1"
FT                   /translation="MFQLGKTIVSEEILKKEFVCNLSACKGACCVDGDAGAPVEEYEKE
FT                   IMDSIYPKVKPFLRQKGIEAIEAQGRYITNDFGEIETPLIDGADCAYVTFDDKGTALCG
FT                   IEEAYNQGEIDWKKPISCHLYPVRVQDYSEFSAVNYHQWHICDDACSLGEELGVPIYKF
FT                   TKEALIRKFGEDWYAELEKVAKKL"
FT   gene            441914..442468
FT                   /locus_tag="ZPR_0416"
FT   CDS_pept        441914..442468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0416"
FT                   /product="marC family integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50775"
FT                   /db_xref="GOA:D5BEP6"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEP6"
FT                   /protein_id="ADF50775.1"
FT                   /translation="MFTVGMVLFAVIDIIGSIPIVLDLRKKVGHIQSEKASLVAGLLMI
FT                   AFLFLGKEILNLIGIDVNSFAVAGSFILFFLALEMILGISLYKDDAPESASVVPLAFPL
FT                   IAGAGTMTSLLSLRAEYETINIIVAIIINIIFVYVVLKSSGKIEKVLGSQGINVIRKIF
FT                   GVILLAIAVKLFAANIQSLFS"
FT   gene            442465..442665
FT                   /locus_tag="ZPR_0417"
FT   CDS_pept        442465..442665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0417"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50776"
FT                   /db_xref="GOA:D5BEP7"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEP7"
FT                   /protein_id="ADF50776.1"
FT                   /translation="MTKYLIYTIIFLGIVVIGFNVTILDFNRLMEDESGTALIAIVASL
FT                   CVIVLMGILLVSRAIAKKHNQ"
FT   gene            442668..443279
FT                   /locus_tag="ZPR_0418"
FT   CDS_pept        442668..443279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0418"
FT                   /product="HI0933-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50777"
FT                   /db_xref="GOA:D5BEP8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEP8"
FT                   /protein_id="ADF50777.1"
FT                   /translation="MEYDLLIVGGGAAGMSCALVVGSGLEKEFAKDKKVGILMHQKTSD
FT                   LQNALFNNVLGLPPATKGIDILKQGPEQLEELYPKVTQLTGEKLQHISKNENGVFELKT
FT                   NKDNYLAKKVVIAIGYSDNFRIGGVDEYVIPHKKAKASKNRVQLINEDHLVVPNLYVAG
FT                   SLAGWRSQFSIACGSGAAVATDILTDWNDGEHTKVHDKLS"
FT   gene            complement(443271..443570)
FT                   /locus_tag="ZPR_0419"
FT   CDS_pept        complement(443271..443570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0419"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50778"
FT                   /db_xref="GOA:D5BEP9"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEP9"
FT                   /protein_id="ADF50778.1"
FT                   /translation="MVPEDLSDSYCIFLPLLFFVIAVSFRLLDNSALLLLQKEIIVTSS
FT                   YVPKKTIIKHIASHPDKVFTEKLKRALVYRSVHRFFIILMISSVVPAISCFLLG"
FT   gene            complement(443570..445171)
FT                   /locus_tag="ZPR_0420"
FT   CDS_pept        complement(443570..445171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0420"
FT                   /product="S41 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50779"
FT                   /db_xref="GOA:D5BEQ0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEQ0"
FT                   /protein_id="ADF50779.1"
FT                   /translation="MKNKKNIYTPLLLGIACAIGVFMGGKINYSSSDQLFSSNPKKEKL
FT                   NRLIDYIDYEYVDNVNTDSIVDVTVNTILKGLDPHSVYIPEQEYDNVSQNMKGDFVGIG
FT                   VSFYSVEDTIMVIQPLEGGPSEKIGIRGGDRILYANDKALFNLGVSSDSLTHFLKGRQG
FT                   SNVELKVKRPGQDDLLSFNVKRDHVPIKSVEAVYMLNKTVGYIKINRFAESTYEEFDAA
FT                   IKALKLMGAKEIALDLRDNPGGYLAEAINIADEFLKDDKLILFTKNKSGAIEKTFANRK
FT                   GDFEDGHVYVLINENSASASEVVAGALQDNDVGTIIGRRSYGKGLVQREMDLGDGSAVR
FT                   LTIARYYTPTGRSIQKPYENGNDNYFRDYERRYENGELKSVDSIKVDDSLKYVTPGGKV
FT                   VYGGGGIIPDVFIPKDIEIEHEHIRILLNRGFLSRFVFQELERKRSYYNSLSKREFENE
FT                   VEITDEVIDRLIAFGKSEKLNIRLTEYKPLMKQYLKAVMAQQLFGSTYFQQLKNEGDPV
FT                   IEKVLELSKKKHNFKD"
FT   gene            complement(445168..445599)
FT                   /locus_tag="ZPR_0421"
FT   CDS_pept        complement(445168..445599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0421"
FT                   /product="cytidine/deoxycytidylate deaminase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50780"
FT                   /db_xref="GOA:D5BEQ1"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEQ1"
FT                   /protein_id="ADF50780.1"
FT                   /translation="MQKEKQLKYDKAYLRIAREWSKLSHCKRKQVGAVIVKDRMIISDG
FT                   YNGTPSGFENFCEDEEGYTKWYVLHAEANAILKVAASTQSCQGATLYITMSPCKECSKL
FT                   IHQAGITRLVYCVDYKDNSGLDFLKKAGVDLIQITQLDD"
FT   gene            complement(445703..445957)
FT                   /locus_tag="ZPR_0422"
FT   CDS_pept        complement(445703..445957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50781"
FT                   /db_xref="GOA:D5BEQ2"
FT                   /db_xref="InterPro:IPR032809"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEQ2"
FT                   /protein_id="ADF50781.1"
FT                   /translation="MIHGLGFSTYFKMLSSGFSSKIFPLLEFALGIECAQAIIVLSVLI
FT                   LAFITQNFFQVSKRDWVLVVSALVIGIILPILRDNFNAI"
FT   gene            complement(445954..446289)
FT                   /locus_tag="ZPR_0423"
FT   CDS_pept        complement(445954..446289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0423"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50782"
FT                   /db_xref="GOA:D5BEQ3"
FT                   /db_xref="InterPro:IPR032809"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEQ3"
FT                   /protein_id="ADF50782.1"
FT                   /translation="MSQFWLYLKLGLEHVLDWNAYDHILFLIALVASYTFTSWKRVLWL
FT                   VTIFTIGHTFALFLSTYEIVIVDTAWVEFLIPVSIMITAIYNIFTASNKEKSGNPTLLY
FT                   FTTAFLG"
FT   gene            446651..447784
FT                   /locus_tag="ZPR_0424"
FT   CDS_pept        446651..447784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0424"
FT                   /product="putative sulfite reductase flavoprotein
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50783"
FT                   /db_xref="GOA:D5BEQ4"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEQ4"
FT                   /protein_id="ADF50783.1"
FT                   /translation="MKKKKNYSLRAFINDVHLWLGLGSGIILFLVCFSGTILTFEDEIK
FT                   DLFAEDFTVEGGDEKLSIEQLISVLESEGMVSSVTVPAKDGEAYEFSVKESPEQRRGTT
FT                   YYVNPYSAEFSKKRESSLDGFFFSMFKLHRWLLLDSSIGRPIVGVATIIFLILSITGIV
FT                   LWFPKKKINWKTLKPGFKIKFSARWKRINHDLHNTLGFYACIFLAIMSLTGLCWSFQWY
FT                   RDLGSEVMGAQIFGGRGGPRVESEAQIDEDEMISIAAVEKITAQELNYEGKTSISFPSG
FT                   DKGVYSIRKYESAKLSPLIADNLIVDRDGKVLKKEVFNDKPINLRIASLIKPLHTGSIY
FT                   GGFSKLLYFLACLIATSLPITGTFIWIHKMKKKPKKE"
FT   gene            448127..448492
FT                   /locus_tag="ZPR_0425"
FT   CDS_pept        448127..448492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50784"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEQ5"
FT                   /protein_id="ADF50784.1"
FT                   /translation="MKDPNTAPLFYVDNLQKIEGDNQYTVDLHLPQNFSNAGYKVIGNS
FT                   PAIHDILKIEIYLRGDKKITPSDVTIVEKIELDLSNQNFKYLKFKIIWKLAVGLGGGVG
FT                   DPEDEETVGESVLNGMG"
FT   gene            448492..450246
FT                   /locus_tag="ZPR_0426"
FT   CDS_pept        448492..450246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0426"
FT                   /product="two-component system sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50785"
FT                   /db_xref="GOA:D5BEQ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEQ6"
FT                   /protein_id="ADF50785.1"
FT                   /translation="MKSILAFFGFLTFGLVSCFAQQNLLDKAEASKEADNYQLSLNILS
FT                   KIDTNTLSIPQKARFYYLKSANYKFRKEDSDAYPLLLKARKLYTALDSLEKLATINLEL
FT                   FQVVRNIGGDHLNYDEYIKAYLDYHLSQNDPKNLRKAYIRIAGNFARETTVDSSFNYFK
FT                   KALQLIRIDKDTLAEAHMLNNFGVLHNEFTSYKDSALYYFTTSRRLYKKSEYIQASFQN
FT                   TASAYKKLGEYDKAIENYQKADSLLGKEYSKERKRFLYDLMAKTYELAEKPTKALEYYK
FT                   LTQAYQDSLNLQEQEKAIFDIQTKYEVQKKENENLQLKQSRFWLISGVILLVLLLIATY
FT                   LVYRTRIAKKQLEVKQSALEKNELEKQLKDQELAGLDAMIEGQEKERQRIANDLHDNLG
FT                   GLLATLKLHFQNLKTKTDRLRDEQDELFKTTNSLLDETYQQVRNYAHQRNAGLKTSEGL
FT                   VPSIKNFASKVSVGNNLVVQVEAHDMDERLENSVEITIFRIVQELITNVIKHAEASEII
FT                   VHLTSFEDHINIMVEDNGKGFDPSIIKDNDGMGLASIIKRVEHLGGNVDIDSHSGSGTT
FT                   VILNIPKS"
FT   gene            450243..450860
FT                   /locus_tag="ZPR_0427"
FT   CDS_pept        450243..450860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0427"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50786"
FT                   /db_xref="GOA:D5BEQ7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEQ7"
FT                   /protein_id="ADF50786.1"
FT                   /translation="MIRVVVAEDHLAVADGILAYFKYHDSISIIGHAKNGEDLVKLVEK
FT                   NIPDVVLTDVKMPVMDGIEAAKLIKAKFDRIGIIAFSMFDQDEAVDLMLQAGATGYLLK
FT                   NSPLSEMEKAILKVSEGNLYYDPNLSLATENTPNENTGILTKRQIEILKLVGKGKTNQQ
FT                   IADALFIGKTTVETHRKNMIRKLGLHGPGELLRYALQRKYDF"
FT   gene            451657..451741
FT                   /locus_tag="ZPR_0428"
FT   tRNA            451657..451741
FT                   /locus_tag="ZPR_0428"
FT                   /product="tRNA-Leu"
FT   gene            451802..452146
FT                   /locus_tag="ZPR_0429"
FT   CDS_pept        451802..452146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0429"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50787"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEQ8"
FT                   /protein_id="ADF50787.1"
FT                   /translation="MKIEVNITKEPTKEPTKEPISFEIVDMSKRKYSEVKIYIPKKKGR
FT                   KSVAPGDKWYAYFYWRDPETGKMNIKCKYYRGINQKKTVAEREEVAKAYQRSYQMLLEQ
FT                   EWCYYSLCFS"
FT   gene            452256..452393
FT                   /locus_tag="ZPR_0430"
FT   CDS_pept        452256..452393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50788"
FT                   /db_xref="InterPro:IPR024997"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEQ9"
FT                   /protein_id="ADF50788.1"
FT                   /translation="MCGWKIGEEVKVVNGDSGKYLRSNPDKTETNNLEHLIDYDWLRYL
FT                   "
FT   gene            452557..453408
FT                   /locus_tag="ZPR_0431"
FT   CDS_pept        452557..453408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50789"
FT                   /db_xref="UniProtKB/TrEMBL:D5BER0"
FT                   /protein_id="ADF50789.1"
FT                   /translation="MQNNRIITKIDIEGNLNTDSRGIKKLFQFYNKAVGYKNQVIEIDM
FT                   YKMGFFDANLSCVLYAILYKLNKDNGLKFALDFEYLQKEYSVLFRNGLFIEGEAVDERE
FT                   STIQLKSFQPNADNDEEFVSYITNDVLGHRGMPNFSRKVKLGIAQELTEISSNIIQHSR
FT                   TNDPFFVCGQYFPKKNLLNFSIVDIGVGFLPAIREKESKITDHGSAIIWALESGNTTKK
FT                   DVPGGLGLHNLLKYCEANNSYMQIVSGDKFWNSESMPGFTMSLGCEFAGSVINLLFSDK
FT                   IR"
FT   gene            453470..453796
FT                   /locus_tag="ZPR_0432"
FT   CDS_pept        453470..453796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0432"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50790"
FT                   /db_xref="InterPro:IPR025474"
FT                   /db_xref="UniProtKB/TrEMBL:D5BER1"
FT                   /protein_id="ADF50790.1"
FT                   /translation="MKMELKKILGSSLATNPKQGKSFFSSLNEAAQGSNEIEISFEGIE
FT                   LLSSAFLNESIGKFVMMFPDKESNVKFIYPIDQPIFETKVNDVLDNVKMGDKYDEWLEN
FT                   AQTH"
FT   gene            453797..454390
FT                   /locus_tag="ZPR_0433"
FT   CDS_pept        453797..454390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0433"
FT                   /product="PilT-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50791"
FT                   /db_xref="GOA:D5BER2"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5BER2"
FT                   /protein_id="ADF50791.1"
FT                   /translation="MSDYSIARLTDYDLTDPPKKKFLLDANIWINVIRSSNKNRKKANL
FT                   YREFFFDLVDCKGANIILPALVVSEVMNRLLREVYLKKFIERIGAKEPLASRFYKEQFR
FT                   PSKEYRSGCMLIADEFKTYLESVELKNDEFGKNIKYKHVLSKFDFGLDFNDSFLFYLAK
FT                   KNNYIIVTDDGDFFVKGVEVLTLNQELLEKSSKM"
FT   gene            complement(454950..456026)
FT                   /locus_tag="ZPR_0434"
FT   CDS_pept        complement(454950..456026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0434"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50792"
FT                   /db_xref="InterPro:IPR025683"
FT                   /db_xref="UniProtKB/TrEMBL:D5BER3"
FT                   /protein_id="ADF50792.1"
FT                   /translation="MNSHYTPILKAKSGEFKALKKLKIETRENLTPLFEIPPITYDYVN
FT                   EKPSKTIEKHLQTIINGISGTGRRQFPCYIDVELLDEIKIRNKYILLSLLENLREKREF
FT                   GIPVIRLKFDNDYLNELKHEIQNNSKRICVRLTQDDFEDFDLQVEIERIIEVLEINLNQ
FT                   IDIVLDFGFLRNEQESMLSQFSKLMVNSLPFLNDYNKIILSLTAFPENLSGISGDSMEK
FT                   IPRSEFKIWKNIIASKIKRKPEFGDYAIANPELFEMDPRTIRMSVNLRYTIANDWLILK
FT                   GRDAKRFGYDQFYGLCDQLVNHSGEFYGEDFSWGDNEILEKSRQIGGTGNATTWRQIGT
FT                   NHHLELVVDQLSSIPFDS"
FT   gene            complement(456132..456314)
FT                   /locus_tag="ZPR_0435"
FT   CDS_pept        complement(456132..456314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50793"
FT                   /db_xref="GOA:D5BER4"
FT                   /db_xref="UniProtKB/TrEMBL:D5BER4"
FT                   /protein_id="ADF50793.1"
FT                   /translation="MGIEPTLPKKLDFEFYSYPILKPNPLIFRLFFFTFHTKIIFIGSA
FT                   IGLQKIKKTFLHNFF"
FT   gene            complement(456693..457331)
FT                   /locus_tag="ZPR_0436"
FT   CDS_pept        complement(456693..457331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50794"
FT                   /db_xref="UniProtKB/TrEMBL:D5BER5"
FT                   /protein_id="ADF50794.1"
FT                   /translation="MNMSEKNESTSTFKNFKAMYEELSRAGYPDIKKYGNNNDYIKVLK
FT                   NGNYDLETYIEIIKKWLPKIEYKTGGLLLIAKTDIKYDGSIIIPIFNEADTADRWRICS
FT                   AIVKNPPLNINDWVKSIYLSKTYSYSEIGILPLAIIKMFPKDQAREILREGFDHNYRVT
FT                   PEALGKIGELEDIPFLENKLNRHYDATHVHRDINKAISKIKKRGNGSVK"
FT   gene            complement(457727..457918)
FT                   /locus_tag="ZPR_0437"
FT   CDS_pept        complement(457727..457918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50795"
FT                   /db_xref="GOA:D5BER6"
FT                   /db_xref="UniProtKB/TrEMBL:D5BER6"
FT                   /protein_id="ADF50795.1"
FT                   /translation="MGGFLAGGLAGTAFASPVQNLGNHLYFGDPLMTPKQYITGIAIGG
FT                   VTGGIVNGGIAALNGRNF"
FT   gene            complement(457903..458250)
FT                   /locus_tag="ZPR_0438"
FT   CDS_pept        complement(457903..458250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0438"
FT                   /product="Rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50796"
FT                   /db_xref="GOA:D5BER7"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:D5BER7"
FT                   /protein_id="ADF50796.1"
FT                   /translation="MNGRLYDAMLHRFLSPDNYVQDPSNPLNFNRYSYVLNNPLIYIDV
FT                   NGEFWHIVIGAVVGGLVNLAVKAVQGKIHNWKDGFVAFGIGTAAGAIGATTGGGAFTMA
FT                   GGAAGGVWEDF"
FT   gene            complement(458302..458574)
FT                   /locus_tag="ZPR_0439"
FT   CDS_pept        complement(458302..458574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0439"
FT                   /product="Rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50797"
FT                   /db_xref="UniProtKB/TrEMBL:D5BER8"
FT                   /protein_id="ADF50797.1"
FT                   /translation="MEVKFDSQSNKTTFVTYIGGDAYSAPLIFHEEKGSSTVSNYFYLH
FT                   RDYLGSILSITDSNGNFKKKRHFDAWGKIVKLTDGNNNNLTSFNI"
FT   gene            458706..459035
FT                   /locus_tag="ZPR_0440"
FT   CDS_pept        458706..459035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0440"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50798"
FT                   /db_xref="GOA:D5BER9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5BER9"
FT                   /protein_id="ADF50798.1"
FT                   /translation="MKKPYYNPELKEQAVRLSYQRENIKELADELGIEVQRIYKWRKAA
FT                   KTATLPKPEKPITDHTLALERIRNALKEKELELEILKKAVHIFSKSDGKSMDLYPIERL
FT                   CRFLK"
FT   gene            complement(459427..459840)
FT                   /locus_tag="ZPR_0441"
FT   CDS_pept        complement(459427..459840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50799"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D5BES0"
FT                   /protein_id="ADF50799.1"
FT                   /translation="MAQEVIRVFVEKADDGTYWGSTQNLPGGVTAYGNSLEELKESFTS
FT                   AFNDYLEIAEDLDEDWIDEVKSIERVEYVMNIPSLFKLLPELKISSIAKKAGINESLMR
FT                   QYASGKANASEERAKIIENAIHELGQELISVSL"
FT   gene            460866..461909
FT                   /locus_tag="ZPR_0442"
FT   CDS_pept        460866..461909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0442"
FT                   /product="transcriptional repressor of the ribose operon"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50800"
FT                   /db_xref="GOA:D5BES1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5BES1"
FT                   /protein_id="ADF50800.1"
FT                   /translation="MKKKQRVSIKDISKELGISITTISFIINKKAKNRISDEVIKKVED
FT                   YIEKVGYEPNTSAQTLRTGKTKTIVFMAEDISDPFFSAVAKEMEEIAYKNGYKIIYCST
FT                   ENNKDRAAELISLFQNRQVDAFIITPPENFEKEIQELITQKNEVIMLFDRRYTSTEHNY
FT                   VILDNFNGAKMAVNKLISSGCKNIAYVGLKSDFSCMSERLEGYKDAIKDHQSQPISLLL
FT                   PFKDVKTKAGRIQFEKFINKHTAVDGILFATNGLAINGLKGLKELHKNIPDELAVITFD
FT                   DRDLFELHTPSISVLSQPVPAMATELIKGTLELLRAKNDKNEIFQKILPGNLITRDSCK
FT                   LTIYDKK"
FT   gene            462232..465270
FT                   /locus_tag="ZPR_0443"
FT   CDS_pept        462232..465270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0443"
FT                   /product="tonB-dependent Receptor Plug domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50801"
FT                   /db_xref="GOA:D5BES2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5BES2"
FT                   /protein_id="ADF50801.1"
FT                   /translation="MITQKSVSCLLFVWAICAGSIAYSQTITGTVKDARGPLPGVSISE
FT                   KGTENGTVSDFDGKYEIDVSSQDVTLVFSYLGYVTREIPWNGENNVEVVLQESTEQLDE
FT                   LVIVGYQSQKESTITGAVSSVNVKQLESRRVPGVTQALQGQVAGVNITQSTGAPGEEVE
FT                   VRIRGNGTIGNNNPLYIIDGVPSREISFLNPSDIKSMSVLKDAAAASIYGSRAAGGVIV
FT                   IETKSGSDRSGFQIDYFGGLQKVTNLPNMLNADQYLNTVTTAWNNAGYSGTNPYLADAG
FT                   RSDFADVDYLDELFELGKTNSVQLSTSGGNEKTNFFLSAGYYGQDGIVVYDNDKFNRLN
FT                   LRSNINSNVTNRIKVGANVQISYEQQDKISSKGDAPGIIRHAFLRPPIIPVYKNPSDPT
FT                   YSEEDPFTDLPFYVDPDNFESNKYEYSQNPIALAYFTDNTTRTFKTFGNLFAEYQILSD
FT                   NSLKFKTNFGADINFGHQKAFNPNYGDDDGQGAEIDSGLGRQNRPTNLSESRYEDMTFT
FT                   WNNSFMYNKEIGDHDINALAGIEFIKNNSSGINASRQRFDYTEPNFRYLDFGGTDRDIW
FT                   NGGLAEEWALFSYFGSATYSYQDKYLITANLRADASSRFSKDNRWGYFPSISAGWTISK
FT                   ENFMDNLDWLNQLKLRASWGQLGNQEIPNYAYLTLYRRDADRYLISRYGNPDLKWETTA
FT                   QVNIGIDFGLYSNKLSGSIDYFEKTTSDILLPISLPKFVGDVSATYLNSGEVQNSGLEF
FT                   GLSYRNYENPLKFQISGNLSTLKNVVNSLHPNLPYLTGNVTRTQEGHPLNAYYGFVQEG
FT                   IYQNQTEVSEHLYGTNNPPQQPGDIKFKDLDGNGVINDNDRDFIGNPNPKLSYGLNVSM
FT                   NYMSFDFNFLFQGVEGVDRYNDLKKIIDYDTRPFNYTDRVLGAWDGEGSTNTIPRVSFT
FT                   DNGSSRVSDIFVEDASYLRLKNVELGYTFDVEKVGNFRIYTSGQNLLTFTDYSGLDPES
FT                   TDLIDFGTYPQSLTILFGVHANF"
FT   gene            465290..466780
FT                   /locus_tag="ZPR_0444"
FT   CDS_pept        465290..466780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0444"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50802"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5BES3"
FT                   /protein_id="ADF50802.1"
FT                   /translation="MKKSILKFLTVVCFIAFSGCDSYLDEDPIGLITKDRIDTEPTAAS
FT                   IISSVNSTYQLLSRTLNVIGQWNWDQGTITRNDFLLQDIASGDMQKKWNPDGDQAWMDE
FT                   VAAFNFTSMNPGFNGIWSYDYEGISRANQAITTLNNSEVMSSVDMDGATKDRLLGEVYF
FT                   LRAFYYFDLVNNFGGVPLLTEPLQDFSDAYQVAKRSTQQEIWAQITADLQESVSLLAEQ
FT                   KYSSNAEPWRVSIGAAIAMQAKVNLFQQNWNEVINKVNQLQGYNFYSLDNNYFDPFDVN
FT                   KEYQENEVIFSYDHVSGLTPSKGNGLSALMGWGFLAPTQNFLDAFEENDPRLEYTVQVA
FT                   QQQQHKLLGTTDGRYKGNEDSPGNKVYIRYADVLLWKAEAFIENGEIEKGLAIIDQIRT
FT                   RARNTPKIDGSATPSNALPNYAGTGVSKAEALQILRHERRVELGFESQRFNDLKRWGIA
FT                   EDVLTNLGKNYQSYNSLYPIPQGEIDRSGGQIEQNPGY"
FT   gene            466802..467956
FT                   /locus_tag="ZPR_0445"
FT   CDS_pept        466802..467956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0445"
FT                   /product="glycosidase, PH1107-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50803"
FT                   /db_xref="GOA:D5BES4"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D5BES4"
FT                   /protein_id="ADF50803.1"
FT                   /translation="MINFKLKYMALCLIGIATACHTDTKKGESVKERNKVSTAEASWMI
FT                   GPFERPQNAQPIIQRDTMATFNDPMSGQEVVWQSMATFNPAAIVKDGKINVLYRAEQDR
FT                   HTDTIGGHTSRIGLATSEDGSIYKRADEPIFYPDNDDQKEFEWTGGTEDPRIVESEDGT
FT                   YVLTYTQWNRKTPRLALATSKDLKNWTKHGPVFQDFKNGKYHDKETKSGAIVTQLKGGK
FT                   LVAAKIKGKYYMYYGVPHIWLATSTDLINWEPVEDYAGNLAPVLNPRPGYFDSWLVEAG
FT                   PPPVLTENGIVVLYNAGNSKNIGVEELGNRVYTSGQALFDANEPWKLIDRSDEPYLKPE
FT                   LPFEKSGQYKDGTTFVEGLTFFKGKWYLYYGTADSMVGMATAEP"
FT   gene            467970..469280
FT                   /locus_tag="ZPR_0446"
FT   CDS_pept        467970..469280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0446"
FT                   /product="xylose permease"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50804"
FT                   /db_xref="GOA:D5BES5"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5BES5"
FT                   /protein_id="ADF50804.1"
FT                   /translation="MQLKRKLLIGAVVSSLGGLLFGFDTAVISGAEQGLKAFYLLDNFA
FT                   HGFTNSIALIGTIIGAIFAFSPAQHLGRKKSLSIIGLFFGLSALGCGLTDNWYLFLFWR
FT                   FLGGLGVGASSVIAPMYISEISPSDYRGRLVGLFQFSIVFGILLAFISNYFLKINMSSD
FT                   SWRWMLGVEAIPAFIFFGLVFLIPKSPRWLVFRKRYEESFVILKALGEANPEERLQTIK
FT                   GSFEQKKEQEKLFQRKYLKPLILVFLMATFNQFSGINAIMYYAPRIFEAAGITKDSAFL
FT                   QAASVGFVNMLFTIGAMVLIDKVGRRKLMIIGSVGMILSLLATTYLLNNRELGVSFLIV
FT                   PVLFFIASFAFSQGAVIWVFISEVFPNKVRAAGQSFGTFIHWCWAAALTWLFPVVAGLA
FT                   NGITYAFGFFALTMILQLIFAIKFFPETKGKSLEEDI"
FT   gene            469625..470296
FT                   /locus_tag="ZPR_0447"
FT   CDS_pept        469625..470296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0447"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50805"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:D5BES6"
FT                   /protein_id="ADF50805.1"
FT                   /translation="MKRILFILIFINTSFLCAQESKFGVTVGVNYPWQSKNGELVAAPN
FT                   LSLFPNPVIGGQAGVFYERDFNKFLIRPQVLFYRSRGKYDFPNTNPIYTLDKVNLELLF
FT                   GYEIIDKFSILAGPAYQFIVRNDFDTREEDLRDNMNAINIPFGIKYEISDRLEASLMYN
FT                   YTLESDEYQRPLLPYDGGFQSFILDDAKIDVISLNISFSVFTSKNSRNRRAKSGSRGCY
FT                   F"
FT   gene            470432..471373
FT                   /locus_tag="ZPR_0448"
FT   CDS_pept        470432..471373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0448"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50806"
FT                   /db_xref="GOA:D5BES7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D5BES7"
FT                   /protein_id="ADF50806.1"
FT                   /translation="MSTSLTEAKIFSCTQSRDLAEKIAASYGIKLGNVITSTYSDGEYQ
FT                   PSFEESVRGARLFIIGSTNPGADNLMEMLLMLDAAKRASARHITAVMPYFGWARQDRKD
FT                   KPRVPIAAKMIASILETAGATRIITMDLHADQIQGFFEKPVDHLFASTVFLPYLRSLKL
FT                   EDLTIASPDMGGSKRAYAYSKELESDVVICYKQREKANVISHMELIGDVTGKNVVLVDD
FT                   MVDTAGTLTKAADLMIERGAKSVRAICTHPVLSGGAYERVENSKLSELIVTDSIPLRQK
FT                   CDKIRVVSCAELFADVMQRVHGNRSISSKFLM"
FT   gene            471459..472100
FT                   /locus_tag="ZPR_0449"
FT   CDS_pept        471459..472100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0449"
FT                   /product="50S ribosomal protein L25/general stress protein
FT                   Ctc"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50807"
FT                   /db_xref="GOA:D5BES8"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D5BES8"
FT                   /protein_id="ADF50807.1"
FT                   /translation="MKSITIKGSKRESVGKKATKALRNAGQVPCVLYGGDAEPLHFTTE
FT                   EISFQHLVYTPDVHTVVIELKSGEKYNAILQDIQFHPVTDNILHVDFYEIFDNKPITME
FT                   IPIHTVGVARGVKNGGVLRYNLRRLKVRGLPGVLPDYIEADVTKLKIGQKLYVTAVESE
FT                   DYKIQHPDNTVICQVRTSRNIVALDDDDEDEDDPQDVPSTETDDVAAVKE"
FT   gene            472233..472862
FT                   /locus_tag="ZPR_0450"
FT   CDS_pept        472233..472862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0450"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50808"
FT                   /db_xref="GOA:D5BES9"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D5BES9"
FT                   /protein_id="ADF50808.1"
FT                   /translation="MLSFFGRILKTKKTAEEVTDPMKKFLIAGLGNIGPKYENTRHNIG
FT                   FKILDELAAKQEAVFTTQKLGDIAQFRYKGRTFVLLKPSTYMNLSGKAVNYWLQKEKIA
FT                   VENLLVVTDDLNLPFGTLRLKTKGSDGGHNGLKDIQAQLNTTKYNRFRFGISAEFSKGQ
FT                   QIDYVLGEWSEEELKELPGRLKISAELIESFATAGVSNTMNSFNGK"
FT   gene            472869..473807
FT                   /locus_tag="ZPR_0451"
FT   CDS_pept        472869..473807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0451"
FT                   /product="riboflavin kinase / FAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50809"
FT                   /db_xref="GOA:D5BET0"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:D5BET0"
FT                   /protein_id="ADF50809.1"
FT                   /translation="MEIHKGASAFKSDKPTVVTIGTFDGVHAGHQKIIKRLVDSARANN
FT                   LESVILTFFPHPRMVLQKESGIKLINTIEERTDILEQSGIDHLVIHPFTMQFSRLTARE
FT                   FVKEILVEKLRAKKVIIGYDHRFGRNRTANINDLKKFGEEFDFEVEEITRQDIEEVAVS
FT                   STKIRTALEEGRVEKANNYLRHPFSLKGEVVKGRGLGKEFNYPTANINIAEDYKLIPKN
FT                   GVYVVRSVIEGETYFGMMSIGTNPTVGGTSRTIESFFFKLDKDLYGKRLKIDLLIRIRD
FT                   EKKFNSVEELKLAMKQDEAFSKQYIKDNYVE"
FT   gene            473797..475119
FT                   /locus_tag="ZPR_0452"
FT   CDS_pept        473797..475119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0452"
FT                   /product="vitamin K-dependent gamma-carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50810"
FT                   /db_xref="GOA:D5BET1"
FT                   /db_xref="InterPro:IPR007782"
FT                   /db_xref="InterPro:IPR011020"
FT                   /db_xref="UniProtKB/TrEMBL:D5BET1"
FT                   /protein_id="ADF50810.1"
FT                   /translation="MWNRWLFKRVDNSALIFFRIAFGLLIALEAIGGIFTGWVRRTLVE
FT                   PDFTFNFIGFEFLQPLPGDLMYYYYAVMGIFGILVMIGFKYRFSMFCYTLMWAAVYLMQ
FT                   KSSYNNHYYLLMLLCFIMIFLPAHKALSYDAWKNKAIRAIAMPRWVWLFIVIQLWIVYS
FT                   YASIAKLYPDWLDGTVPELLMRGKRNYWLVGEFLQQPWIKWVIAYFGLIFDLLIVPMLL
FT                   WRRTRVPFFILAIFFHLFNSFVFHIGIFPYLSLAFCVFFFPTQKVNKYLLRNKKPYYDG
FT                   EEVVVPDHDRILKFAIIVWFIIQVSLPLRHWVIKDNVLWTEEGHRLSWRMMLRTKSGRS
FT                   TFKVVEKGTTDTIMVQKNKYLSNKQRRIISTKPDVIWQFAQRLKQEYAREGKDIQVFVE
FT                   AKVSVNGRPYERLIDPQVDIANEQWNYFAHHDWILPSNLEE"
FT   gene            475187..476458
FT                   /locus_tag="ZPR_0453"
FT   CDS_pept        475187..476458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0453"
FT                   /product="seryl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50811"
FT                   /db_xref="GOA:D5BET2"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D5BET2"
FT                   /protein_id="ADF50811.1"
FT                   /translation="MLQVNNIREHKDAYIEALKKRNFDAESIFDEVLSLDETRRSTQSR
FT                   LDDTLAESNKLSKQIGLMFKNGEHQKANLLKEKTGKLKEDSRNYSEVLATTIADLEKLL
FT                   YTIPNVPNEVVPAGTSEDDNEEIYKEGDVPVLAEGSLPHWELAKKYDIIDFELGNKVTG
FT                   AGFPIYKGKGARLQRALVSYFLDKAVEAGYSEYQLPLMVNEASGYGTGQLPDKEGQMYH
FT                   ITADDLYMIPTAEVPITNMYRDNLLTDKDFPIACTGYTPCFRREAGSYGAHVRGLNRLH
FT                   QFDKVELVRIEKPEDSYAALEGMVDHVKVLLKELKLPYRILRLCGGDLGFTSALTYDFE
FT                   VFSTAQDRWLEISSVSNFETFQANRLKLRYKNKEGKKELVHTLNGSALALPRVLAGILE
FT                   NYQTENGIKIPDVLVPYTGFDMID"
FT   gene            476554..478290
FT                   /locus_tag="ZPR_0454"
FT   CDS_pept        476554..478290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0454"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50812"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5BET3"
FT                   /protein_id="ADF50812.1"
FT                   /translation="MDAQSLQLAENFFAKGEYEKALSYYQKTLEQQNNNPRAFQGVISS
FT                   LQQLERFDKAEEMLLRQLESSPKNSTILIDIGHNFALQRNEAKAEQYYQKALALLEEDP
FT                   RQAFGIGLKFENYILLDYAANAYKKANQLMPNAGLELKLARLYGEQGELQQMFESYLDL
FT                   VIKDEKYFPYANREFGEFITKDASAEPNTLLRNTLLKRLQTNPDPFYNEMLSWLYIQQK
FT                   EYNKALIQEKAIYRRSEVPNLNRIMNLAYAAKRSGDLEAAKAVTDFIIEEAPASLKLRA
FT                   KQLKISLQVATAIPSAYPEIEENFRSVIKEYGDSPETIPLQIDFGQFLAFKSGKVTEAE
FT                   NLLKNLLVKAINDYEKARIKMALADVLVLQEKFNEALITYTQVQKMVKNDQIAQDAQFK
FT                   VAKTSYYKGDFEWAQTQLDVLKKSTSQLIANDAMELSLMIKDNTLEDSTQIALKKYAHA
FT                   DLLAYQGKNKQAITELTQLLQDHIGEKIEDEALYKQAQLYELEEQYPLAEKNYLAILDN
FT                   YGQDLLADNAAWNLAQMYTNKLNLPEKARQYYEKILFNFEDSIYFIESRKKYRSLRGDA
FT                   IE"
FT   gene            478347..478718
FT                   /locus_tag="ZPR_0455"
FT   CDS_pept        478347..478718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50813"
FT                   /db_xref="GOA:D5BET4"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D5BET4"
FT                   /protein_id="ADF50813.1"
FT                   /translation="MYGLFHKEYFASVNIGATFYVFSDLTFSVVIVILFAVFGLGYWLM
FT                   DIFQKQLITWMIAYHVYISVFGMLILLVFYGYFQQLEIDYAFSQTIMMLMFIIAAITIA
FT                   AQLLFPLNFIVSFLRKKKR"
FT   gene            478857..479138
FT                   /locus_tag="ZPR_0456"
FT   CDS_pept        478857..479138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50814"
FT                   /db_xref="InterPro:IPR025563"
FT                   /db_xref="UniProtKB/TrEMBL:D5BET5"
FT                   /protein_id="ADF50814.1"
FT                   /translation="MQEEAHADWLKWMKEEYIPAMLDTGKFTKALMTKVLSKEPMGGIT
FT                   YSVQYTAESMAYLKTFYVEDHANMVAKTTIFKGKIVEFSTELQVMDEQ"
FT   gene            479160..479999
FT                   /locus_tag="ZPR_0457"
FT   CDS_pept        479160..479999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0457"
FT                   /product="dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50815"
FT                   /db_xref="GOA:D5BET6"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BET6"
FT                   /protein_id="ADF50815.1"
FT                   /translation="MSKKKFKKDYKPPRREDQNGQVRAKKHLGQHFLKDENIAKKIGDT
FT                   LSLSGYDYVLEIGPGMGVLTKFLLQKDTEVHVVEIDAESVDYLNANYLQLHGRIHEQDF
FT                   LKYDLTQVFGHKPFAVTGNFPYNISSQIVFKVLEMRDQIPEFSGMFQKEVAQRICEKEG
FT                   SKTYGILSVLTQAYYDAEYLFTVPPSVFNPPPKVDSGVLKLTRKKDYHLKCNEALFFRI
FT                   VKMGFQQRRKTLRNSLKSLNLPDTLREDAIFGKRPEQLSTQDFISLTLNIEPYAVSN"
FT   gene            479983..481338
FT                   /locus_tag="ZPR_0458"
FT   CDS_pept        479983..481338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0458"
FT                   /product="MgtE family divalent cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50816"
FT                   /db_xref="GOA:D5BET7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D5BET7"
FT                   /protein_id="ADF50816.1"
FT                   /translation="MQFQISTELIEKIQFLIEQRNDEELLLHLEDVHHADIAEIITELS
FT                   LDDATYLVRLLDSGKTSEAIMELEEGVRERILETLSAKEIADELVEMDTDDAADIMNEL
FT                   SPELQKQVISEIQDEQHAEDIVELLRYPEDSAGGLMAKELVKVNENWSVTGCMTEMRAQ
FT                   AENVTRVHSIYVVDDKNRLKGRLSLKDLLTAASNENIRDVYIPNVDYVNVHTEGEEVAR
FT                   IMQKYDLEAIPVIDEMGRLVGRITIDDIVDFIKEEAERDYQMAAGISEGVEADDNIFKQ
FT                   TRARLPWLLIGMFGGLGAAGIISGFQGAMAVFPKLLLFVPLIQATAGNVGVQSSAIVVQ
FT                   GLANGSLKGNIIAKRLLKETSLALVNGISIAMIVFIISSVWFDTSYMESLSIGVALISV
FT                   ILLAAMIGTVIPIVLDKNNIDPAVATGPFITTSNDVFGILTYFLIAKVILGF"
FT   gene            481650..482591
FT                   /locus_tag="ZPR_0459"
FT   CDS_pept        481650..482591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0459"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50817"
FT                   /db_xref="GOA:D5BET8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BET8"
FT                   /protein_id="ADF50817.1"
FT                   /translation="MIELLADAGHHNIEGFTQSREETLQNQHLYDGIVIRSRYTIDKDF
FT                   LDAAPNLKFIARVGAGLENIDVAYAKESGVQLFSAPEGNRNAVGEHTLGMLLSLFNKLN
FT                   KADREVREGLWNREDNRGIELDGKTVGIIGYGNMGKAFAKKLRGFDVEVLCYDIKDDVD
FT                   DSNATQVNWEEFTEKCDVVSLHTPWTKETDKMVNTAFIESFAKPFWFINTARGKNVVTE
FT                   DLVYALRSGQVLGAGLDVLEYEKSSFESLFANKKNVAVSAAEPLPEAMRELMFMPNTIL
FT                   SPHIAGWTVESHEKLATVIANKIIKQFGKGEE"
FT   gene            482784..482954
FT                   /locus_tag="ZPR_0460"
FT   CDS_pept        482784..482954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50818"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:D5BET9"
FT                   /protein_id="ADF50818.1"
FT                   /translation="MKNRVTGIGGIFFKSEDPNEAKAWYKKHLGLNTDDYGCTFWWKIK
FT                   IATTVLHNGAL"
FT   gene            482996..483112
FT                   /locus_tag="ZPR_0461"
FT   CDS_pept        482996..483112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50819"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEU0"
FT                   /protein_id="ADF50819.1"
FT                   /translation="MINFGVENLDELLKTLTAEVVSVLGEPKNYDMGNLDGF"
FT   gene            483259..483705
FT                   /locus_tag="ZPR_0462"
FT   CDS_pept        483259..483705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0462"
FT                   /product="arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50820"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEU1"
FT                   /protein_id="ADF50820.1"
FT                   /translation="MLKVYRENKLMKNILVLCRGNSCRSQIAHGYLNYFAFKKAKVYSA
FT                   GIETHGVNPRAIAAMQEDGIDIKTHTSNLIAEYKHIDFDYIISVCDHVKSHCSIRFSSS
FT                   AVRIHQHFRDPSAVKGNNRKIHEAFEVTRLGIKHFCRAFVKQYL"
FT   gene            complement(483756..484406)
FT                   /locus_tag="ZPR_0463"
FT   CDS_pept        complement(483756..484406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0463"
FT                   /product="NAD dependent epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50821"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEU2"
FT                   /protein_id="ADF50821.1"
FT                   /translation="MEKILIAGATGQTGKRIIEILNSSQNFNPVAMIRKEEQKQIFDDM
FT                   GVESVLADLEGEVKHAFEGVDKVIFAAGSGGSTGPEKTTAIDEEGAIKMIDAAKANNIK
FT                   KFVMLSSMGTDNPEDGGDLEHYLRAKKKADDHLRESGVPFTIVQPGSLSDELGRARVKV
FT                   AEKLGEYGEIARDDVAFLMVMSLADPLTKNMSFEALEGETPVKQALIELSGIG"
FT   gene            complement(484593..486416)
FT                   /locus_tag="ZPR_0464"
FT   CDS_pept        complement(484593..486416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0464"
FT                   /product="acyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50822"
FT                   /db_xref="GOA:D5BEU3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEU3"
FT                   /protein_id="ADF50822.1"
FT                   /translation="MFKTNQPMGFVSAKEVARVMNLDKMGFLGTTVGWVVLRTTKLSRL
FT                   NKEYQQRKNLKGVAFIDSILEGFEIQFDIPEKDLKRIPKSGPFITISNHPLGGIDGMIL
FT                   MKLLLEQREDYKIIANFLLHRLDPLRPYIMPVNPFETHKDAKSSVGGIKEAIAHLREGH
FT                   GLGMFPAGEVSTYKDEKLIVDKPWEPVAMRLIQKAKVPVVPIYFHAKNSTFFYRLASMS
FT                   DVLRTAKLPSEMLSQKRRKINVRIGNPISVEDQSEFKDLESFTAYLRRKTYMLANVFEK
FT                   KKLFEKIPHTLKLPKAPKKIATEMKSELMEAEVENCRELDKRLLISKNYEVFLAKREII
FT                   PNIVQELGRLREITFREIGEGTNNPVDLDPFDDYYYHLFLWDNETNKVAGAYRMGMGAE
FT                   IFKDHGINGFYLQDLFRFEPELYKMMSKSIEMGRAFIIKEYQQKPMPLFLLWKGIVHCT
FT                   LRFPEHKYLIGGVSISNKFSNFSKSLMIEFMRSNYYDPYVAQYIRPKKEFKVKLEDADK
FT                   DIVFDKSEADLNKFDKIIDEIEPENLRLPVLIKKYIKQNAKVVAFNVDPLFNNAVDGLM
FT                   YIRIADLPESTVKPVMEEFQKELEEKHQNSH"
FT   gene            complement(486445..487701)
FT                   /locus_tag="ZPR_0465"
FT   CDS_pept        complement(486445..487701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0465"
FT                   /product="aspartokinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50823"
FT                   /db_xref="GOA:D5BEU4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEU4"
FT                   /protein_id="ADF50823.1"
FT                   /translation="MKVFKFGGASVKDTAGVKNVLKVLQKHNNPDKLIVISAMGKTTNA
FT                   LEVIIQKYLAEQSPEAEIEHLRLFHVEIMNGLFEHKKAAVFEKINQFFTILRNFLEHNK
FT                   SKQYDFVYDQIIGFGELISTTIVSEFLSRNGIRNTWIDVRDVIKTDSTYRDAKVDWETT
FT                   QKKIIAAINPGTISITQGFIGSDSNNFTTSLGREGSDYTAGIFAYCLNAESVTIWKDVP
FT                   GVLNADPREFKTTTLLQQISYEEAIELAFYGASVIHPKTLQPLQRKEIPLFVKSFFHPE
FT                   NEGTKVCRGNGCAVIPQLPCFIVKKNQALISLSSRDFSFMVEENISEVFQLFHQYQMKV
FT                   DLIQNSAISFSVCVDNKFNQLEKLIQHLKAKFRVEYQTGVSLYTIRHFNESAINSVEKG
FT                   KKVLLKQLTHNTVQMVTAG"
FT   gene            complement(487705..488178)
FT                   /locus_tag="ZPR_0466"
FT   CDS_pept        complement(487705..488178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0466"
FT                   /product="GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50824"
FT                   /db_xref="GOA:D5BEU5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEU5"
FT                   /protein_id="ADF50824.1"
FT                   /translation="MEYQIREAKREDMPKVLELIMELAKHENAEDQVEISVKDLETEGF
FT                   NNGNFKCFVADVDGKLAGMALVYFRFSTWKGRTVHLEDLIVTESMRGTGLGGALYNQVV
FT                   KYGYEHGVKRVEWVVSEGNKNAIEFYENTGADIKKNWYTVHMNENVIKKNIEK"
FT   gene            complement(488362..488844)
FT                   /locus_tag="ZPR_0467"
FT   CDS_pept        complement(488362..488844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0467"
FT                   /product="GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50825"
FT                   /db_xref="GOA:D5BEU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEU6"
FT                   /protein_id="ADF50825.1"
FT                   /translation="MNIEVRKATKQDMPAVLKLINELAKFENEPDAVEITVKDLENDGF
FT                   GDRPLFECFVAEANDTIEGMALFYYRYSTWKGKTVHLEDLVVSEAFRGKGLGKALYTKV
FT                   IQYSKQQGCKRTEWVVLDWNTNAVEFYKNSGATVFDEWRTVQMDEAAMDSFCDKTR"
FT   gene            488952..489962
FT                   /locus_tag="ZPR_0468"
FT   CDS_pept        488952..489962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0468"
FT                   /product="fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50826"
FT                   /db_xref="GOA:D5BEU7"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEU7"
FT                   /protein_id="ADF50826.1"
FT                   /translation="MTKTRPTLGEFIIDNQQDFPYSTGELSRLIRSIRLAAKVVNHEVN
FT                   KAGLVDITGAAGEQNIQGEDQQKLDVFANNIFIQTLTNREIVCGIASEENDDFITIAGS
FT                   RNDHKNKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRVTPLGTPVTSEDFLQPGNLQVAA
FT                   GYIIYGTSTMLVYTTGHGVNGFTLNPALGSWYLSHPDMKFPENGNIYSINEGNYAHFPT
FT                   GVKKYIKYCQEEEGDRPYTSRYIGSMVSDIHRNMIKGGIYIYPKSTKYDKGKLRLLYEC
FT                   NPMAFIVEQAGGKASDGYQRVMDIMPTELHERSAIFCGSKKMVEKAEAFMKEFGD"
FT   gene            complement(489959..490387)
FT                   /locus_tag="ZPR_0469"
FT   CDS_pept        complement(489959..490387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0469"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50827"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEU8"
FT                   /protein_id="ADF50827.1"
FT                   /translation="MSFSDLFGSGEHLRNLSHFAAIVNLAAVDGAINEAEENLLRRFAR
FT                   KLDITESEYNKVLENPKGYPLTPSHDTERRLERLHDLFRIIFADHLIDDEEAELIKRYA
FT                   IGLGFSSQASEKIIKRSVQIFGGQISFEDYQYLLEKEN"
FT   gene            complement(490471..490575)
FT                   /locus_tag="ZPR_0471"
FT   CDS_pept        complement(490471..490575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0471"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50828"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEU9"
FT                   /protein_id="ADF50828.1"
FT                   /translation="MPAREFSFVKLIELAAIVMKLGKIERLQKGLRKD"
FT   gene            490554..491570
FT                   /locus_tag="ZPR_0470"
FT   CDS_pept        490554..491570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0470"
FT                   /product="metallo-beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50829"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEV0"
FT                   /protein_id="ADF50829.1"
FT                   /translation="MKTPLLAFNDKGIYCAQADVYLDPWRPVDKAIISHGHADHSRWGH
FT                   KKYITHHSNIPIINHRLGEINVSGKNWNETFMINNVQFSFHPAGHIIGSAQIRVEYKGE
FT                   VWVFTGDYKTEDDGVATPYEPVKCHTFITECTFGLPAFKWQPQDEVFAEINNWWQQNQS
FT                   DGRTSVIFGYSLGKAQRLLKYLDTSIGKIYTHGAIENMTEVLRPQLKMPKTTRITRDIK
FT                   KEEIKGNIVVAPPSAHGTPWIKKMVPYVTASASGWMTFRGARRRRAIDRGFVLSDHCDW
FT                   QGLLSSIKETGAEKIICTHGYTDIFSRYLREIGYDARTEQTQYEEENAEQTSKPEDE"
FT   gene            491567..493159
FT                   /locus_tag="ZPR_0472"
FT   CDS_pept        491567..493159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0472"
FT                   /product="ATP-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50830"
FT                   /db_xref="GOA:D5BEV1"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEV1"
FT                   /protein_id="ADF50830.1"
FT                   /translation="MRQFAELIKTLDSTNKTTLKVEALTKYFNNAPDRDKVWTIAILSH
FT                   RRPPRPVNTTLMRLWASEIANIPLWLFEESYHIVGDLAETIALVIPPSSASSEKSLSQF
FT                   LQEIIDLKPKSEEEKKEYLKENWLSLNYYERFVFTKLITGSFRIGVSQKLMTRALSKAT
FT                   DIDEDILAYKMMGDWNAAKTTYTKLILEENEEDFLSKPYPFYLAYAIEDQPEDLGDVNQ
FT                   WSAEHKWDGIRSQVIIRNNELFVWSRGEELVTDKYPEFEKFVGVIPNGTVIDGEILPFP
FT                   KGEIGTFKDLQTRIGRKTVSKNLLKKTPVILKAYDVLEWHGEDIRQKAFKDRRAILEKL
FT                   YTEVKSDGLPLHLSYTIQFKSWEEAAEERERSREVKSEGLMLKRLDSPYLVGRKKGDWW
FT                   KWKVDPLTIDAVLTYAMRGHGRRSNLFTDYTFGLWDEKKEELVTFAKAYSGLTDAEFRK
FT                   LDAWIKKNTLERFGPVRSVTPHHVFEVAFEGIAESKRHKSGVATRFPRILRWRTDKKIE
FT                   EANTLEDLKALIP"
FT   gene            493289..493795
FT                   /locus_tag="ZPR_0473"
FT   CDS_pept        493289..493795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50831"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEV2"
FT                   /protein_id="ADF50831.1"
FT                   /translation="MLALAVLGFTGCNAQEKKTDENSNLGLSTKTNNEKPKGNWTVNKE
FT                   FDENGNLKSYDSTYTYSYGSVNGDTITGSKEIRQHFQQLFGDDKMSSAMMQGFFNDSTS
FT                   LRNDFFRDDVMGSDFFSTGNFPKEFQQQIRKMDSIHQQMLKNNYPQLFTKEEEQKLPSN
FT                   KKTNM"
FT   gene            493862..496330
FT                   /locus_tag="ZPR_0474"
FT   CDS_pept        493862..496330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0474"
FT                   /product="DEAD box helicase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50832"
FT                   /db_xref="GOA:D5BEV3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEV3"
FT                   /protein_id="ADF50832.1"
FT                   /translation="MTRQELLKIAQSWFTEQGWKPFKFQKDTWKAYLQKKNGLLNAPTG
FT                   SGKTYALWVPIVLNYIKNNPDYKTRSKKGLKAIWITPLRALSVEIEQAAERFARGLGTN
FT                   LTVGIRTGDTSQKERAAQKKSMPDLLITTPESLQLLLSSKNYDKTFENLEAIVVDEWHE
FT                   LLGSKRGVQVELALSRLKTVSKNLRIWGISATIGNLQQAREVLLGPKSEALQNSELIRA
FT                   NLKKKIKVKSIIPETMEKFPWRGHMGLHLLDEVVPIIKSSKTTLLFTNTRSQCELWFQK
FT                   IISKYPEFAGELAMHHGSINKETRLWVEQAIRNESLKAVVCTSSLDLGVDFAPVETIIQ
FT                   IGGPKGVARFLQRAGRSGHQPGKESVIYFLPTHAIELIEASALQKAVEKKAVEDRIPYL
FT                   LSFDVLVQYLTTLAVSNGFFPKDIYPEIKSTFCFQAMTEDDWCWLLNFITKGSQSLQAY
FT                   DEYKKVEIEEDGRFKVNHRGVAMRHRLQIGTIVSDAMLSVKYMKGGYIGTIEEWFISKL
FT                   TPGDIFTFAGRNLELVRIKNMQVLVKKSKKKTAKVPSWMGGRMTFSAQMSELLREEMYL
FT                   ASEYDATSGKSEELSALTGIFDRQKKESVIPKSDEFLIETFKTREGYHAIFYPFEGRFV
FT                   HEALGSLLAYRVSLLSPISFSIAFNDYGFELLSDQEIDMQQVLDNNLFSAEFLMDDLYK
FT                   SLNATEMARRKFRDIAVIAGLVFTGYPNKLVKSKHLQSSSQLLFSVFRDYEEDNLLYLQ
FT                   SFRETFEHQLEEGRLRQALERINNQKMIWRNCEKPTPFSFPIITDRLREKLSSEKLEDR
FT                   IRKMMKSLDS"
FT   gene            complement(496774..497277)
FT                   /locus_tag="ZPR_0475"
FT   CDS_pept        complement(496774..497277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0475"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50833"
FT                   /db_xref="GOA:D5BEV4"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEV4"
FT                   /protein_id="ADF50833.1"
FT                   /translation="MFLEHLKSNPTINNKTTRSLIAGAIGGLAGGAVKGLVEYFLPVRK
FT                   AENRSAQLKILDHLSTKITGTPISVQNEELAEQLVNFPVGASAGAAYGYGKKDKDELNL
FT                   AQGIIMGTSTWISTHQTSLPILGLKDKPTDVPIKMQANELIAHVLFGITTELVRNKVNQ
FT                   RLKK"
FT   gene            497377..498162
FT                   /locus_tag="ZPR_0476"
FT   CDS_pept        497377..498162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0476"
FT                   /product="carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50834"
FT                   /db_xref="GOA:D5BEV5"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEV5"
FT                   /protein_id="ADF50834.1"
FT                   /translation="MSTPPNLKVAIIQANLKWEDANANRSFFSKEIAALSDAVELIVLP
FT                   EMFTTGFSMNAENLAEKKQGQTLLWMQEQAKLKNAAITGSVIVTENGQFYNRLFFVFPD
FT                   GTVQKYDKRHTFTLAKEDQTYTAGTKRLIVNYRGWKICPLICYDLRFPVWARNTEEYDL
FT                   LIYVANWPKKRVAAWDALLKARAIENMSFCIGVNRVGEDGDGYVYNGHSAVYDCLGENL
FT                   TDQNDETEFSKEITLDKNHLEKTRDQLKFLQDRDKFRLI"
FT   gene            complement(498154..499767)
FT                   /locus_tag="ZPR_0477"
FT   CDS_pept        complement(498154..499767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0477"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50835"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEV6"
FT                   /protein_id="ADF50835.1"
FT                   /translation="MNRKLFNFILFIVVITSVVRCAKKGMPEGGPIDEEPPRFIRANPE
FT                   NYTTNFDAKEISILFNEFIKLENPQQQIIISPPMDPKPNILPLGQARKDVKIEITDTLR
FT                   ENTTYAINFGKSIVDNNEGNPYPYFKYVFSTGDYIDSLEVSGFIEDAYLKETPEFVSIF
FT                   LYEMDSTYTDSVVYNEIPRYVAYTRDSSVNFDLENLKAGKYQMVAILDDNANYKFNPAK
FT                   DKIGFLDHPISIPTDSIYTISIFQEELAFEVKRPKLFKGRQLLIGYQGIPNLNDLELNF
FT                   LYPPMDPPVSRITRDAKTDTLYYWFRDPIETDSVSLEYVTPRQRDTVYIRMAQLARDSL
FT                   NIQAEPSGKIEYNQPLLLKANTPLVEKNDALITILDKDSVEVNFTSELRGLENQLEIYF
FT                   DKEPEGTYYFKALPGSLTDLFGDQNDTISQKLTTKPLSEYGSIIMSLRNVRSYPMIVQL
FT                   TTLKGEIVKQHILKEGNQFTFEHINPGNYFLRIIYDENQNGYWDTGSWLERRKPEKISY
FT                   YPDTLQTRANFDEVYQFYLD"
FT   gene            complement(499852..500469)
FT                   /locus_tag="ZPR_0479"
FT   CDS_pept        complement(499852..500469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0479"
FT                   /product="phosphoribosyltransferases family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50836"
FT                   /db_xref="GOA:D5BEV7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEV7"
FT                   /protein_id="ADF50836.1"
FT                   /translation="MDHEKVICTACLHQLPLTNYLTDNENQADKVFYGRTPINAAYALL
FT                   VFRKKNMVQVLLHNLKYKRQFEISYFLGEWTGEILKNSARFNAVDIIVPVPLHKNRLKQ
FT                   RGYNQVEGFGKEIAKSLNANYRDDLLLKVSSSRKQAFKNRISRWNLMEQSFQLTDTSAI
FT                   SGKHILLVDDILTTGATLEACIGCLRKSEKIKISIATMAITI"
FT   gene            500461..500562
FT                   /locus_tag="ZPR_0478"
FT   CDS_pept        500461..500562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50837"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEV8"
FT                   /protein_id="ADF50837.1"
FT                   /translation="MIHQGPFAAIAGFRIKQIYEIVKHLLSGCWGKP"
FT   gene            500594..501478
FT                   /locus_tag="ZPR_0480"
FT   CDS_pept        500594..501478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50838"
FT                   /db_xref="GOA:D5BEV9"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEV9"
FT                   /protein_id="ADF50838.1"
FT                   /translation="MMTEKKNNTALKILIGVLAVALIALTIYTIRFYNEEKENKAILQK
FT                   EKTAIENELNELIVKYDEAIDENEIMDQNLVDARERINRLLDSVQDYEANLVLITRYRR
FT                   EISNLKAEKERLFRVVDSLSQQNQRMAMTIDSTQTELSEKTRLSDSLQSSNQSLANKVN
FT                   KASQLKITGLRGEGVIVRNSGKIVENDRTRRIDQIQTCFTITANDLSEAGEKNLYVQVY
FT                   NPENELVGDKIAVEHDGGVMVYSAQSTVYYENDELDVCILANTDKEKLLEGNYKVYVYN
FT                   DATLIGTASFSLR"
FT   gene            501541..503082
FT                   /locus_tag="ZPR_0481"
FT   CDS_pept        501541..503082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0481"
FT                   /product="glycyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50839"
FT                   /db_xref="GOA:D5BEW0"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022961"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEW0"
FT                   /protein_id="ADF50839.1"
FT                   /translation="MAKQEDSFKNVISHAKEYGYIFASSEIYDGLSAVYDYGQNGAELK
FT                   KNIKEYWWKSMVQLHQNIVGIDAAILMHPTTWKASGHVDAFNDPLIDNKDSKKRYRADV
FT                   LVEDYAEKINQKAQKEIEKARKRFGEAFDEEQFIATNPRVQRYKAEEKEILERLAKSLT
FT                   EENLADVKALIEELGIACPESGSKNWTDVKQFNLMFGTKLGASADSATDLYLRPETAQG
FT                   IFVNFANVQKTGRMKIPFGIAQIGKAFRNEIVARQFIFRQREFEQMEMQFFVRPGEELS
FT                   WFEKWKETRQKWHASLGLGDEKYRFHDHEKLAHYANAATDIEFDFPFGFKELEGIHSRT
FT                   DFDLKAHEEHSGKKLRFYDPEMGENYVPYVIETSIGLDRMFLAVFSASLQEEDLGDGKS
FT                   RTVLKLPAVLAPTKAAILPLVKKDGLPELAQEIVEELKWDFRVQYDEKDAVGRRYRRQD
FT                   AAGTPLCITVDHDSLEDKTVTVRYRDTMEQKRVPISELASIIDQEVNFKYWLKKA"
FT   gene            complement(503151..503684)
FT                   /locus_tag="ZPR_0482"
FT   CDS_pept        complement(503151..503684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0482"
FT                   /product="ferritin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50840"
FT                   /db_xref="GOA:D5BEW1"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEW1"
FT                   /protein_id="ADF50840.1"
FT                   /translation="MKDLVRQNLLIHVDILDLLNKQIKQEAQSSAAYLAMASWCDHNGL
FT                   VYSAEFFYEQSAEEREHMMKIFHFINDNGGTAYSPEVSNINHDFASLEEIFETALDQEI
FT                   AITKSIHNIIYECRNKRDLTTENFLQWYVKEQMEEEQTMRRALELFDLINTENVGLRFL
FT                   DERIKEIREEANPA"
FT   gene            503943..504050
FT                   /locus_tag="ZPR_0483"
FT   CDS_pept        503943..504050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0483"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50841"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEW2"
FT                   /protein_id="ADF50841.1"
FT                   /translation="MTKSQQLAKRKLYRFMTKIDIESSAIVALAGSEIF"
FT   gene            complement(504110..504580)
FT                   /locus_tag="ZPR_0484"
FT   CDS_pept        complement(504110..504580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0484"
FT                   /product="transcription regulator AsnC"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50842"
FT                   /db_xref="GOA:D5BEW3"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEW3"
FT                   /protein_id="ADF50842.1"
FT                   /translation="MKIIDQNVVIDGIDKTILNFLMEDAKRPILEIAKNIGITGAAVHQ
FT                   RLRKLEKSGLIEGSRLIIDPRLLGYKTMAFVGVYLDKAVSNPLAVNKLKEIPEVIECHY
FT                   TTGNWSIFVKVLCKDNEHLMKVLNKNIQGIEGVSRTETFISLNQQINRQIKI"
FT   gene            complement(504626..505999)
FT                   /locus_tag="ZPR_0485"
FT   CDS_pept        complement(504626..505999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0485"
FT                   /product="saccharopine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50843"
FT                   /db_xref="GOA:D5BEW4"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR032095"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEW4"
FT                   /protein_id="ADF50843.1"
FT                   /translation="MQQILIIGAGKSTAVLIRYLSEKSSEENFTICVADKELSLAKRAI
FT                   KNHENCTAISFDIFNSEHREKHIAAMDIVISMLPARFHIKIAKTCLKLKKNLVTASYIS
FT                   KEMKALATEVKEAGLIFMNEIGVDPGIDHMSAMQVIDRIRNAGGQMLMFESFCGGLVAP
FT                   ESDNNLWNYKFTWNPRNVVVAGQGGVAKFIQEGKYKYIPYHRLFRRTEFLDIEGYGRFE
FT                   AYANRNSLDYREAYGLHDILTLYRGTVRRVGYSRAWNMFVQLGMTDDSFTMEDSENMTY
FT                   REFVNSFLPYSPTDSVELKLRHNLKIDQDDIMWEKLLELDLFNNHKTIGIESATPAQAL
FT                   QKILEEKWLLSSEDKDMIVMYHKFGYQLNGEKKQIDSTMVCIGKDQTETAMAKTVGLPV
FT                   GIAARKILKKEINTPGVHLPISKEVYQPILEELQENGIIFKEKQTNYLGYNAIGGVSN"
FT   gene            506049..506429
FT                   /locus_tag="ZPR_0486"
FT   CDS_pept        506049..506429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0486"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50844"
FT                   /db_xref="GOA:D5BEW5"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEW5"
FT                   /protein_id="ADF50844.1"
FT                   /translation="MTRKFLVAGGIFGLFGVILGAFGAHGLKNVLDADTLTSFETGVRY
FT                   QIYHALLLIGLANFTKLQNNLLFWFFTIGSIFFSGSIYLLSLDELAGLDFSSIALVTPL
FT                   GGALLIVGWTLLIFKSLRLNYE"
FT   gene            506584..508119
FT                   /locus_tag="ZPR_0487"
FT   CDS_pept        506584..508119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0487"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50845"
FT                   /db_xref="GOA:D5BEW6"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEW6"
FT                   /protein_id="ADF50845.1"
FT                   /translation="MYPDELQEETLKHNLGRETREGVLAINTGKFTGRSPQDRFIVKDE
FT                   VTKDRVWWGAINIPFDSSKFDKLYDKVADYLSDKELYVRDAYACAHQDYKLNIRVINEY
FT                   PWSNMFVYNMFLRPTEEELPGFKEDWLVVNAPGFKADPEKDGTRQENFAVLNFSKKIAL
FT                   IGGTGYTGEIKKGIFSALNLILPIYQDTLPMHCSANVGENGDTAIFFGLSGTGKTTLSA
FT                   DPNRKLIGDDEHGWTADNKIFNFEGGCYAKVINLSKENEPDIFNAIKPGAILENIVFKN
FT                   GEVDYDDSSITQNTRVSYPINHIPYIQKPSVAGNPKNIFFLTADAFGVLPPVSKLNPAQ
FT                   AAYHFISGYTAKVAGTEEGIKEPQPSFSACFGAPFMPLHPTLYAEMLSRKMKEANVNVW
FT                   LVNTGWTGGPYGTGQRMKLKYTRAMINAALSGNLNKVSYETHEIFGIKMPTVCPDVPTE
FT                   VLNPKSTWKDKEAYDVKAKELANTFRRNFSQFKDYASQEILEGGPLSLEYNAS"
FT   gene            complement(508209..508955)
FT                   /locus_tag="ZPR_0488"
FT   CDS_pept        complement(508209..508955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0488"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50846"
FT                   /db_xref="GOA:D5BEW7"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEW7"
FT                   /protein_id="ADF50846.1"
FT                   /translation="MKVKTILVSQPEPKVENSPYFELEEKQKVKVDFIPFIHVEGVSSK
FT                   EVRQQKVDLSKHTAIILTSRNAVDHFFRVAEEMRFKVPDSLKYFCLSEAVAYYLQKYVV
FT                   YRKRKIYVGKRTFAELSPLIKKYKNEKFLLPSSDMLKPVIPKTLDKLGVQWKQAVFYKT
FT                   VVSDLSHLSDVTYDILVFFSPSGIKSLFENFPDFKQNDTRIAVFGNTTIKAAKEHGLTV
FT                   NIKAPTSETPSMTMALNKYIAEANKK"
FT   gene            complement(508981..509640)
FT                   /locus_tag="ZPR_0489"
FT   CDS_pept        complement(508981..509640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0489"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50847"
FT                   /db_xref="GOA:D5BEW8"
FT                   /db_xref="InterPro:IPR025367"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEW8"
FT                   /protein_id="ADF50847.1"
FT                   /translation="MQAIELYTEPLDWITIIFLICFILIVLVRNLYPNRFTEFLSILSS
FT                   NKFMLFKGKENNAFHGFNIILFTVNALSVSVLLFWFYKYYTNPSPTNYVFIYIRIFTAY
FT                   VCFILLKFGVEKIISNIFNMDKIVDIYLFQKLSYRNYIAIMVFPFTLLLIYTFTISDLW
FT                   VYGIVSFILFANLTGIFNIFRQYQKLISANWFYFILYLCALEIAPYFILYKLITVY"
FT   gene            509742..510470
FT                   /locus_tag="ZPR_0490"
FT   CDS_pept        509742..510470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0490"
FT                   /product="dolichol-phosphate mannosyltransferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50848"
FT                   /db_xref="GOA:D5BEW9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEW9"
FT                   /protein_id="ADF50848.1"
FT                   /translation="MVHGLIIIPTFNEIENIERLIRNIFSQRRNFHILVVDDNSPDGTA
FT                   TRVRTLQAEFPEQLFLEERKEKTGLGTAYIHGFKWALKREYDYIFEMDADFSHNPNDLS
FT                   RLYNACRREGADLAIGSRYVTGVNVINWPMNRVLMSWLASKYVQAITGMDIHDTTAGYV
FT                   CYKREVLERIKLDKIQFVGYAFQIEMKFKAHLLGFKITEVPVIFTDRTRGTSKMSGSII
FT                   YEAVFGVIKMKVKSLFNRIK"
FT   gene            510470..511816
FT                   /locus_tag="ZPR_0491"
FT   CDS_pept        510470..511816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0491"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50849"
FT                   /db_xref="GOA:D5BEX0"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEX0"
FT                   /protein_id="ADF50849.1"
FT                   /translation="MMKKVLIKNAKIVNEGKITEGDVFIEDGIIKEISESISAKSPDVQ
FT                   IFDAEGTHLLPGIIDDQVHFREPGLTHKEDIEMGSRAAVAGGITSFIEMPNTLPQTTTI
FT                   EELEKKFQLAAEKSYANYSFMFGGTNDNLEEILKVDPKKTAALKLFLGSSTGNMLVDDQ
FT                   KVLEEIFSKSPLLIAVHCEDETTIQNNLKECVERYGEDIPIELHPKIRSEEACYKSSSN
FT                   AVKLAKKTGARLHVFHVSTAKELELFSNKKPLKDKKITAEVCIHHLWFNDHDYKQKGTF
FT                   IKWNPAVKSEKDQEALMKALSDDILDVVATDHAPHTKQEKQNPYTKAPSGGPLVQHALP
FT                   AMLQFYHKEKISLEKIVEKMCHNPAILFDIKDRGYIRVGYKADLVLVDLNAPWQVKSDN
FT                   ILYKCGWSPFEGVTFKSRITHTFVNGRLVYKNFKHQPFAKVAQQLEFDR"
FT   gene            511816..512358
FT                   /locus_tag="ZPR_0492"
FT   CDS_pept        511816..512358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50850"
FT                   /db_xref="InterPro:IPR025381"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEX1"
FT                   /protein_id="ADF50850.1"
FT                   /translation="MRLIKYAVVFIFFIGLSCQDVNYMDKPKNLISEDKMVDILTEMSL
FT                   VNAARNYNKILLEQTGIKPDQYIYDKFGIDSVQFEKSNAYYTEKYDDYERIFDKVKDSL
FT                   QSLKTHFDELVEEEKRVQDSINKVRREKNRPEFKKEIDSVEVDTTKVDTVLTEADRTNN
FT                   RLDSLQNNQGPLSREAN"
FT   gene            complement(512355..513389)
FT                   /locus_tag="ZPR_0493"
FT   CDS_pept        complement(512355..513389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0493"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50851"
FT                   /db_xref="GOA:D5BEX2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEX2"
FT                   /protein_id="ADF50851.1"
FT                   /translation="MILVTGGTGLVGAHLLLKLAEEKHQIRAIYRPKSDLYKTLEVFLY
FT                   YHHKEEAERLFKKIEWVVADLTDIPRLTTAFKGITKVYHCAALVSFKPKDEKALRKINI
FT                   EGTANIVNLCIATKIDKLCYVSSIASLGKPIKSDSTTENTQWNPEANNSDYAISKYGAE
FT                   IEVWRASQEGVKVIIVNPGVIIGPGFWQKGSGQLFTRIQNGLNYHFPKITGFVGVKDVV
FT                   TAMLKLMSSEIYNERYILVAENLSFKKVLEFTALSINRPKPEKPLKKWMISIGWFVQKT
FT                   ASLFGYNRNITKSDISGIFQKSTFDNTKIKKEINFKFTPMHNVIAETGKYFLKDQEKKE
FT                   TIKN"
FT   gene            513471..514766
FT                   /locus_tag="ZPR_0494"
FT   CDS_pept        513471..514766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0494"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50852"
FT                   /db_xref="GOA:D5BEX3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEX3"
FT                   /protein_id="ADF50852.1"
FT                   /translation="MNKNFVEELTWRGMIHDVMPGTEEHLNEQMRAAYVGIDPTADSLH
FT                   IGHLVGVMMLRHFQLAGHKPYALVGGATGMIGDPSGKSAERNLLDEATLRHNQNSIKEQ
FT                   LSRFLDFEGAEENTAVLVNNYDWMKEFSFLDFIRDVGKHITVNYMMAKDSVKKRLSSDA
FT                   SEGMSFTEFTYQLVQGYDFLHLFREHQCTLQMGGSDQWGNITTGTEMIRRIGDGKGYAL
FT                   TCPLITKADGTKFGKTEGGNIWLDANRTSPYKFYQYWLNTSDADAEKYIKIFTFLSKEE
FT                   IEDLTSKHQEAPHLRELQKVLAKEVTVMVHSEEDYNNAVKASEVLFGKSTAEDLKSLNE
FT                   ATFLDVFEGVPQAEVSRAEVEAGLDMIGALAAKTDFLKSNGEARRALKENSVSVNKEKV
FT                   QEDYTISLDDLINDKYVIINKGKKNTYILVVV"
FT   gene            complement(515176..516156)
FT                   /locus_tag="ZPR_0495"
FT   CDS_pept        complement(515176..516156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0495"
FT                   /product="acyl-protein synthetase, LuxE"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50853"
FT                   /db_xref="GOA:D5BEX4"
FT                   /db_xref="InterPro:IPR007534"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEX4"
FT                   /protein_id="ADF50853.1"
FT                   /translation="MIQHSKIFDIQSKADFLKISLEIFQYQYQNNHVYQHFCKLLHKSP
FT                   DNVRSLADIPFLPIQFFKSHQILSDNKPAEITFTSSGTTGSTTSKHIVTNLEIYEDSFN
FT                   KAFQKFYGPAEDLTILALLPSYLEREGSSLIYMVEHLIKKSNQSESGFYLDNLDTLKNK
FT                   LIQLDKDGKKILLIGVSFALLDLVENHQFQLENTIIMETGGMKGRRKEMIREELHSILS
FT                   KGFGVSAIHSEYGMTELLSQAYSKGNGVFDCPPWMKILIRDPEDAFSPVKKGKTGGINV
FT                   IDLANINSCSFIATQDLGKINKNDTIEILGRFDNSDIRGCNLMVL"
FT   gene            complement(516358..516702)
FT                   /locus_tag="ZPR_0496"
FT   CDS_pept        complement(516358..516702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0496"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50854"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEX5"
FT                   /protein_id="ADF50854.1"
FT                   /translation="MKQNYLYSVILGLFLLIAAPATAQQGDSRIAKKTTVETIEGLSLY
FT                   PNPVSGDKIYITSTKNLEKEIEIYNVLGKAIKKTKLRGKELDISSLVAGIYIVKIKEQN
FT                   EIATRKLVVK"
FT   gene            complement(516861..518078)
FT                   /locus_tag="ZPR_0497"
FT   CDS_pept        complement(516861..518078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0497"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50855"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEX6"
FT                   /protein_id="ADF50855.1"
FT                   /translation="MKKSKLFLSMFTIATLLGSCSSDDDTPTPGTDDDGGVVEQKDDVI
FT                   ESQDDPDLDPEDLHGEVRANITISADTEWMLTGALKVMDGATLKIEPGVTIKARSGGTN
FT                   VYIAVSQGGKIDAQGTADSPILVTSAAENPRAGDWGGVMLAGYAQINSGDVAETEVAGI
FT                   SYGGDNDADNSGTIDYMILEYTGARINGDQEFNGFTFYGVGSETSISNIMVRYGDDDGI
FT                   EWFGGTVDVTNALVVNAKDDWFDWTEGWTGTGKNFYGIREFGFNDVTEDPRGIEADSNS
FT                   NNNDASPRSNPTIDGLTLYHQSTISMADMIKIRRGSSATITNAVVAIIAAEDEDAGSAS
FT                   DFIDLTDNSGDGSSETSINVTALGAIDATDIKAQGATITVGAGNTGADTSVFAWTGYTF
FT                   PSLDVE"
FT   gene            complement(518131..520884)
FT                   /locus_tag="ZPR_0498"
FT   CDS_pept        complement(518131..520884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0498"
FT                   /product="TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50856"
FT                   /db_xref="GOA:D5BEX7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEX7"
FT                   /protein_id="ADF50856.1"
FT                   /translation="MNKFLVLIAFLLTSIVNAQETTGSIAGKLTDREMNGEPLPFANVT
FT                   IKGTSKGTTSDYDGLYVLDKIEPGTYTVVFSFVGYETLEIPNVKVVADKVTEINTGLGA
FT                   SAATLDEVVITTVSRRDSEVALLLEQKGAIEMIENISAQELARKGVGDAQGALTKMAGV
FT                   SKQEGVKNVFVRGLGDRYNSTTLNGLPLPSEDPEYKNVALDFFDSNIINSVGINKTFQS
FT                   SLYGDFAGANINIISKELYGKETIKVGFGSGFNNRAVNEDFETVDGTSWFGYGLSSDSP
FT                   ITSLDTYSFENSMGSNNQNSQINTNGNFQLGKKFDIGDNNLKTLLIGSFDSKYSYNEGN
FT                   TKEINAQGLPLRDLDFQKYQYNVSQILMANLDYGFGENNLSFNSLYIHNNTQSVGNYFG
FT                   QSANISEETDDSAYIKRQQVNDNTVFVNQLLSEFALTDRISLQASIGYNMTRANEPDRR
FT                   QNTFVYNQTNDNYRVAVGTPGYNLRFFSDLEENEIVGHLNAAYAFGAADSKEQQKGIIN
FT                   VGYDYRNTDRRFNFLQFNHDFGSPVNVNPNNPDLVFNQENLSNGTFRLVTNSGFGDDFN
FT                   PLDPFFYEGEKDIHAGFTNAFYKFNEAFTLNAGLRVEHIDQYVNWDTNLSSSENNQNTD
FT                   PSTIENTYFLPSFTAKYNFNENSILRLTGSKTYTFPQFKEVAPFLYEDVNFSSFGNPNL
FT                   EASDNYNLDMKYEFYFGGNQIISLTGFYKKIKNPINRVQVNSAANQLSYINSGAEADVA
FT                   GAELEVRKTVFNIESGESKKHELAFGLNTSYLYSRQDLSNRSTNFTNSEDELEGASPWV
FT                   LNTDLTYNYDSNKFNLMSSVVLNYFSDRIYSLGVQQQGNIVETGIPTLDFIATGTISKH
FT                   WGINAKIKNILDPEFKLTQDDINGGTNTINNFKKGTVFSVGLSYSL"
FT   gene            521058..521741
FT                   /locus_tag="ZPR_0499"
FT   CDS_pept        521058..521741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0499"
FT                   /product="two-component system response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50857"
FT                   /db_xref="GOA:D5BEX8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEX8"
FT                   /protein_id="ADF50857.1"
FT                   /translation="MKKKDIRILLVDDEPDILEIVGYNLSAEGYQVITADNGAEAVKVA
FT                   KKKSPHLIILDVMMPGMDGIEACEQMRKIPELEDTIITFLTARGEDYSQMAGFDAGADD
FT                   YITKPIKPKVLVSKVKALLRRFRDEETGSNIVKVGEIVINRDEYKVVKNKEEMILPRKE
FT                   FELLSLLASKPGKVFKREDILDKVWGNEVVVGGRTIDVHIRKLREKIGDDSFKTVKGVG
FT                   YKFVV"
FT   gene            521801..522826
FT                   /locus_tag="ZPR_0500"
FT   CDS_pept        521801..522826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0500"
FT                   /product="two-component system sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50858"
FT                   /db_xref="GOA:D5BEX9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEX9"
FT                   /protein_id="ADF50858.1"
FT                   /translation="MFLSGLWTAFSYFSGNFHWWALMGFALVCYTFSFFITQYRVENFI
FT                   YKRIKKIYDDVSLLDSSTLNPNQVTTDMASLTREVEKFAEHKKLEIETLKVRENYRKEF
FT                   MGNVSHELKTPLFTVQGYILTLLDGAMKDKSVRKKYLQRASKGVERLIYIVKDLDMITK
FT                   LETGDLHLYIEDFDIVELIQNTFDLLEMKAAKKNITLTFDMDYQEAIWVRADEERIQQV
FT                   ITNLVVNSIKYGKEGGTTEISIENLIKNKVIVRVTDNGEGIAKTNIPRLFERFYRVDKS
FT                   GSRKEGGSGLGLSIVKHIIEAHSEKIYVESVFGVGSEFSFTLEKSKEIPKRVLETEIAE
FT                   A"
FT   gene            complement(523321..523452)
FT                   /locus_tag="ZPR_0501"
FT   CDS_pept        complement(523321..523452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50859"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEY0"
FT                   /protein_id="ADF50859.1"
FT                   /translation="MYLSLINFRSFQETPPTSVAKFSKNILKNLTNAGYLTYQAVKI"
FT   gene            524007..524681
FT                   /locus_tag="ZPR_0502"
FT   CDS_pept        524007..524681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0502"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50860"
FT                   /db_xref="GOA:D5BEY1"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEY1"
FT                   /protein_id="ADF50860.1"
FT                   /translation="MGSKNKLKRFKENETFSNVIQPTREMLTEADFQYKGKWNADFFKN
FT                   DQPIILELGCGKGEYSVGLAQAFPEKNFIGIDIKGARFWRGAKTALEEGLDNVGFLRTQ
FT                   IELIDYAFAENEVSEIWITFPDPQIKYKRTKHRLTNTGFLQKYKKILKPDGVVNLKTDS
FT                   EFMHGYTLGLLHGAGHEVMYANHHVYKNEGAPKEVTRIQTFYEKQYLEKGKPITYIKFR
FT                   IK"
FT   gene            524689..525312
FT                   /locus_tag="ZPR_0503"
FT   CDS_pept        524689..525312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0503"
FT                   /product="LysE type amino acid translocator"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50861"
FT                   /db_xref="GOA:D5BEY2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEY2"
FT                   /protein_id="ADF50861.1"
FT                   /translation="MEEAKIFLIVYFAALFGVLPPGLVNMTVAKTCIERGKKNGMLVAI
FT                   GASVVILLQAFIAVLLAKYIFEHEFVRRIMLRAALVIFSILGVYFFVQAKKKKGMPAHS
FT                   KKKENSSLYKGMIIAALNIFPIPYFCAIAGAFNVGVGVSYNWFKIIAFAVAASLGSFTS
FT                   LYLYVLSFIKIEKKAERFAKYSNYFMAGLMAVLVVITIIRIYNS"
FT   gene            525309..525656
FT                   /locus_tag="ZPR_0504"
FT   CDS_pept        525309..525656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0504"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50862"
FT                   /db_xref="GOA:D5BEY3"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEY3"
FT                   /protein_id="ADF50862.1"
FT                   /translation="MSTVDKSGFFEKVYKVAAQIPEGRVTSYGAIAKYLGAAKSARMVG
FT                   WAMNASKNREDVPAHRVVNRNGMLTGKSHFGGSNAMQQLLEAEGVKIREMKVLDFDSVF
FT                   WDPMTQLEEPY"
FT   gene            525850..526992
FT                   /locus_tag="ZPR_0505"
FT   CDS_pept        525850..526992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0505"
FT                   /product="Mrp/Nbp35 family ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50863"
FT                   /db_xref="GOA:D5BEY4"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEY4"
FT                   /protein_id="ADF50863.1"
FT                   /translation="MKLDRKEIIRALESISVAGEGKNMVEGGALQNVMTFGDEVIVDLV
FT                   LSSPALHIKKRAEVDVMKAIHEKVYEKAKIKVNIKVEAPATEKKAPEIKGKPIPGIKNI
FT                   IAVASGKGGVGKSTVTANLAVTLSKMGFKVGVLDADIYGPSVPIMFDVAAERPLSVNVD
FT                   GKSKMKPVENYGVKILSIGFFTKPNQAVIWRGPMAAKALNQMIFDAAWGALDFLLVDLP
FT                   PGTGDIHLSIMQSLPITGAVVVSTPQNVALADAKKGVAMFQQESINVPVLGIVENMAYF
FT                   TPQELPNNKYYIFGEQGAKNLSEDLQVPFLGEIPLVQSLRESGDIGRPAALQEETPLEE
FT                   SFKEITRNMVQETVNRNKSLPPTEAIKITTMAGCSAVKTK"
FT   gene            526993..527235
FT                   /locus_tag="ZPR_0506"
FT   CDS_pept        526993..527235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0506"
FT                   /product="NifU-like/thioredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50864"
FT                   /db_xref="GOA:D5BEY5"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEY5"
FT                   /protein_id="ADF50864.1"
FT                   /translation="MTSEEIKLNVEKALAEIRPFLESDGGDISLVAIEDDRLVKVQLEG
FT                   ACVGCSVNQMTLKSGVEMTIKKYVPQIEEVINIQK"
FT   gene            527349..528410
FT                   /locus_tag="ZPR_0507"
FT   CDS_pept        527349..528410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0507"
FT                   /product="thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50865"
FT                   /db_xref="GOA:D5BEY6"
FT                   /db_xref="InterPro:IPR022890"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEY6"
FT                   /protein_id="ADF50865.1"
FT                   /translation="MIKTDMIIVGAGPTGLFTVFEAGLLKLKCHLIDALPQPGGQCSEI
FT                   YPKKPIYDIPGFPEVLAGDLVSNLMEQIKAFEPGFTLGERAETIDKQEDGSFIVTTNKG
FT                   TKHHAPVVVIAGGLGSFEPRKPPIPNIIDFEDKGVAYMIKEPEVYRDKKVVIAGGGDSA
FT                   LDWAIFLADVASEVSLVHRRQEFRGALDSVEKVEELSKIGKIKLVTNAEIVDLKGEEDL
FT                   EAVVIRHKDTALGEEIKETDYFIPLFGLSPKLGPIGDWGLEIEKNAIKVDNTYDYQTNI
FT                   PGVYAVGDVNTYPGKLKLILCGFHEAAIMCQSAYQRIFPDKKYVMKYTTVSGVNGFDGS
FT                   RKEAKKEVVKSIN"
FT   gene            528444..528779
FT                   /locus_tag="ZPR_0508"
FT   CDS_pept        528444..528779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0508"
FT                   /product="2Fe-2S ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50866"
FT                   /db_xref="GOA:D5BEY7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEY7"
FT                   /protein_id="ADF50866.1"
FT                   /translation="MSDIKITIIDREGEAHTVDAPTDMNMNLMEVIRSYELAPEGTIGI
FT                   CGGMAMCASCQCYVLNLEHMLPEQSFEEEDMLDQAFFVEDNSRLSCQIPITEDLDGLEV
FT                   KLAPEST"
FT   gene            complement(528807..529595)
FT                   /locus_tag="ZPR_0509"
FT   CDS_pept        complement(528807..529595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0509"
FT                   /product="heme oxygenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50867"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR024423"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEY8"
FT                   /protein_id="ADF50867.1"
FT                   /translation="MIKDINKALKPQVETLLNHSLYSKVRSPKELQVFMEHHVFAVWDF
FT                   MSLLKALQQNLTKTTNPWFPVGNPETRYLINEIVLAEETDVNFYGKHQSHYEMYIDAME
FT                   KAGANTTKIHSFLDQVIHGTDIYLIIAASDLPWSIKQFLKFTFETISEGKPHKIASAFT
FT                   FGREGLIPGMFTSIIGNIQKNFPEKDLQLFKYYFDRHIELDDDEHGPMAFEMIEHLCGK
FT                   DTDKWQEVETIAKQALDARIELWDGIEREIELLTNTTANS"
FT   gene            529714..529887
FT                   /locus_tag="ZPR_0510"
FT   CDS_pept        529714..529887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50868"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEY9"
FT                   /protein_id="ADF50868.1"
FT                   /translation="MIGLIHFNIIIFYSEKSKDFLRVEGVVPKKQMKLKTKCCEKYNKG
FT                   KRCKRCPCFDLL"
FT   gene            complement(529948..531123)
FT                   /locus_tag="ZPR_0511"
FT   CDS_pept        complement(529948..531123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0511"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50869"
FT                   /db_xref="GOA:D5BEZ0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEZ0"
FT                   /protein_id="ADF50869.1"
FT                   /translation="MKPDLFTAPDYYNLDDLLSDEHKMVREATRAWVKKELSPIIEDAA
FT                   QKAEFPKTLLKGLADIGAFGPYIPEDYGGAGLDQISYGIIMQEIERGDSGIRSTASVQS
FT                   SLVMYPIYAYGSEEQKKKYLPKLAAGELIGCFGLTEPDFGSNPGGMLTNFKDKGDHYLL
FT                   NGAKLWISNAPFADIAVVWAKNEEGRIHGLIVERGMEGFSTPETHNKWSLRASATGELI
FT                   FNNVKIPKENLLPQKNGLGAPLGCLDSARYGIAWGAIGAAMDCYDTALRYAKERIQFGK
FT                   PIAEKQLQQKKLAEMITEITKAQLLAWRLGTLKNEGKASSAQISMAKRNNVDMALKIAR
FT                   EARQVLGAMGITGEYSIMRHMMNLESVVTYEGTHDIHLLITGMDITGHSAF"
FT   gene            complement(531180..531902)
FT                   /locus_tag="ZPR_0512"
FT   CDS_pept        complement(531180..531902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0512"
FT                   /product="protein containing methyltransferase small
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50870"
FT                   /db_xref="GOA:D5BEZ1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR022882"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEZ1"
FT                   /protein_id="ADF50870.1"
FT                   /translation="MSSKPFKFKQFEIHQDRCAMKIGTDGVLLGAWVDLLEDTDSILDV
FT                   GTGTGVIALMMAQRSSAQLIDAIEIDENAYEQAVENFEHSDWGDRLFCYHAEFGEFVEE
FT                   MQDEEKYDLIISNPPFYNSDYKTASEARDMARFQDALPFQLLLEGATYLLSEKGRLAVI
FT                   IPKSQEQDFLELAGDFNLFPKKITYVKGTHTSEIKRCLILLGLEPIEVLKDELTIEHER
FT                   HQYTPTYQKLVAPFYLKM"
FT   gene            complement(532155..532982)
FT                   /locus_tag="ZPR_0513"
FT   CDS_pept        complement(532155..532982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0513"
FT                   /product="translation elongation factor EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50871"
FT                   /db_xref="GOA:D5BEZ2"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEZ2"
FT                   /protein_id="ADF50871.1"
FT                   /translation="MAKITAAEVNKLRKATGAGMMDCKKALVEVDGDFDKAIEVLRKKG
FT                   QKVAAKRADRESSEGAAIAKVNADATKGAVISLNCETDFVAKNDDFVKLANDFADLALQ
FT                   VSTKEELLAADYNGISVQDKLTEQTGVIGEKIEIGSFKTLEAPFVGSYIHAGNKIAVLT
FT                   GLSKNVAGAEDAAKDVSMQAAAMNPVALNEEGVDQTTIEKEIEIAKDQLRAEGKPEDML
FT                   DNIAKGKIKRYFKDNTLVNQAFIKDNKQTVAEYVKSVDADLTVVAFERVALGE"
FT   gene            complement(533169..534053)
FT                   /locus_tag="ZPR_0514"
FT   CDS_pept        complement(533169..534053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0514"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50872"
FT                   /db_xref="GOA:D5BEZ3"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEZ3"
FT                   /protein_id="ADF50872.1"
FT                   /translation="MANKVEVKELLDAGVHFGHLTRRWNPNMAPYIYMERNGIHIINLY
FT                   KSAAKMQEAGEALKKIAASGRKILFVATKKQAKEIVAEQAEKANMPYITERWPGGMLTN
FT                   FVTIRKAVKKMASIDRMKKDGTFNTLSKKERLQVDRLRAKLDKNLGSIADMTRLPGALF
FT                   VVDITREHIAIKEAQKLNIPIFAMVDTNSDPREVDYVIPANDDASKSINKVVSYVSESI
FT                   VEGLSDRKSNKDSKKEDKESKSEKAPKMPKAEGEVPSKDASDKKAMKEAKKDVKLESKQ
FT                   ETLEKATSSNEEE"
FT   gene            complement(534219..534605)
FT                   /locus_tag="ZPR_0515"
FT   CDS_pept        complement(534219..534605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0515"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50873"
FT                   /db_xref="GOA:D5BEZ4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEZ4"
FT                   /protein_id="ADF50873.1"
FT                   /translation="MEVIHKIGRRKTAVARVYVSEGKGNITVNKKDLNDYFTTSTLQYK
FT                   VNQPFNLTETAGTFDVKINVYGGGITGQAEAIRLALSRAMVELNEENKSTLKPEGLLTR
FT                   DPRMVERKKFGQKKARKKFQFSKR"
FT   gene            complement(534605..535060)
FT                   /locus_tag="ZPR_0516"
FT   CDS_pept        complement(534605..535060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0516"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50874"
FT                   /db_xref="GOA:D5BEZ5"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEZ5"
FT                   /protein_id="ADF50874.1"
FT                   /translation="MDTLSYKTVSANKATVTKEWVLVDAEGQTLGRLSSKVAKILRGKY
FT                   KPDFTPHVDCGDNVIVINAEKINLTGKKWDAKEYIRHTGYPGGQRSLTASELFTKAPER
FT                   LVEKAVKGMLPKNKLGSALFRNLKVYAGSEHGQEAQKPKTINLNDLK"
FT   gene            complement(535502..538327)
FT                   /locus_tag="ZPR_0517"
FT   CDS_pept        complement(535502..538327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0517"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50875"
FT                   /db_xref="GOA:D5BEZ6"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEZ6"
FT                   /protein_id="ADF50875.1"
FT                   /translation="MAAQKRLFLVDAYALIFRGYYAFIKNPRINSKGFDTSAIMGFMNS
FT                   LFDVIRREKPDHLAVCFDKEGSEVRTELFSDYKANRDATPEPIMQGIPYIQSILKAMHI
FT                   PVVELPGCEADDIIGTLAKQAEKENYQVYMVTPDKDFAQLVSENIFMYRPARMGNGIEI
FT                   WGIPEVQKKFEVERPEQVIDFLGMMGDAVDNIPGLPGVGEKTAKKFLKQFGSMEELLAN
FT                   TDQLKGKMREKVETNAEQGILSKKLARIIIDCDVKFHAEDYELSMPDSEKVQELFDELE
FT                   FRRLKDQFIKLFNGEEDNQTQVSNSPSAKKNEQTAGAGQFSLFGGDSSEKIESTNSRKT
FT                   LKDTPHVYQKVDTGLGLRLFIQKLMKQKSVCFDTETTSLNPLEAQLVGIAFSWEGGKGY
FT                   YLPFEDNIEKTQQLIELLRPFFESPEIEKIGQNLKYDIKVLDKYGIKVEGPTFDTMIAH
FT                   YLINPDMRHNMDILAETYLNYTPQPISELIGKKGKNQKSMRDVPLAEQTEYAAEDADIT
FT                   FQLKEFFEKELDEAKTRKLFNEIEMPLVEVLADMEIEGINLDLDFLKKLSEALDRDIKE
FT                   LEAKIYEAAGEEFKISSPKQLGIILFEKLALVKKPKKTKTGQYSTSEDVLSYLAPEHEI
FT                   VQHVLDYRGLVKLQNTYVDALPGQVEKSSGRVHTDYVQTIAATGRLSSNNPNLQNIPIR
FT                   TERGRQVRKAFIPRSDDYVLLAADYSQIELRIIAALSEEETMIKAFKDGEDIHASTASQ
FT                   VFNVPLEEVTREQRSNAKTVNFGIIYGVSAFGLSNQTSLSRSESKELIDTYYKTYPKLS
FT                   NYIADQVAYAREHGYVSTILGRRRYLKDINSQNAVVRGAAERNAVNAPIQGSAADIIKI
FT                   AMINIHKKLGEEKLQTKMLLQVHDELVFDVYKPELDQVKKLIKSEMENAYQLNVPLDVD
FT                   LGVGQDWLEAH"
FT   gene            complement(538442..539764)
FT                   /locus_tag="ZPR_0518"
FT   CDS_pept        complement(538442..539764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0518"
FT                   /product="glucose/galactose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50876"
FT                   /db_xref="GOA:D5BEZ7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEZ7"
FT                   /protein_id="ADF50876.1"
FT                   /translation="MSTAQNTNKSYRTAFLFLTILFFLWGFITVLVDSLIPRLKEVFTL
FT                   SYFQAGMVQFAFFGAFFVLSIPAGYILSKIGYKKGIILGLSTMAAGCLLFWPAASFRVF
FT                   WVFMLGYFVLAGGITILQVAANPYVTILGPERSASSRLNLSQAFNSLGTAIAPAIGALF
FT                   ILRDKVMSTAEIDALSEAKQKAYYIAEAGAVQKPFLGIAIFIAVIALVFAFVNLPKVGN
FT                   TAASNDYRKVLKNKNLMLGAVGLFFYVGAEVALGSYMVNYFLTLELSEIIKSTPYLRNI
FT                   AQWILDTGLENASNMAVVGVFVTFYWTGAMIGRFIGSYLTKIFNPAVVLCAFAAFAILM
FT                   VNISNLSVGVIAMWTIIAVGLFNSIMFPTIFSLALDGLGDDKPQGSGVLCTMIVGGAVL
FT                   PPSFGFLTDRFGFSIAFVLVMVAYAYIFFYGFINRKRQVEI"
FT   gene            complement(539784..540758)
FT                   /locus_tag="ZPR_0519"
FT   CDS_pept        complement(539784..540758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0519"
FT                   /product="glycosylasparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50877"
FT                   /db_xref="GOA:D5BEZ8"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEZ8"
FT                   /protein_id="ADF50877.1"
FT                   /translation="MKRRNFIKKAGITGAVLGTTPSIFAKNISEISNTQKSSLPIAIAT
FT                   WNFHEATKRAGALLDNGTSALDAVEQGVMVEEANLKNTTVGNGGAPDRDGNVTLDACIM
FT                   APNGNAGSVVYLKHIEHPVSVARKVMEDTPHVMLAGEGALQFAIQNGFKKQNLLTEDSE
FT                   KAWKEWLKEKKYKPIINIENHDTIGMLCIDKDGDIAGACTTSGLAYKMNGRVGDSPIIG
FT                   SGLYVDNEVGAAAATGMGEAIMKSVGSFLVVELMRNGKSPQEACKEAIERIVKKNDNYN
FT                   DFQACFIAINKDGKVGGYSIHKGFSYAKYQDGENKNVQCKSYL"
FT   gene            540961..542175
FT                   /locus_tag="ZPR_0520"
FT   CDS_pept        540961..542175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0520"
FT                   /product="metallophosphoesterase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50878"
FT                   /db_xref="GOA:D5BEZ9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5BEZ9"
FT                   /protein_id="ADF50878.1"
FT                   /translation="MRWLLFIAFYLLIDIYAYQALRSLNRSWWVGGIYFVISLVVIGNF
FT                   IYQWQSSGGGFFSAIGFAFGIVLAFLLAKLVIVLFMFGEDIVRFFIGIFHAVSDSGYKA
FT                   PGRRKFVSQIALGLATIPFVSVLYGMFKGKYDFRVLNYTLYFEDLPSAFDGYRIGQISD
FT                   VHSGSFDNHEKVAYGVDLLNKQGTDVVFFTGDLVNNKATEMEDWKSLFSTVKAKDGVYS
FT                   ILGNHDYGDYVNWNSAEEKENNLDRLKATHAEMGWDLLLNEHRYVEKNGEKIAIVGVEN
FT                   WGGGHFKKAGDLDLAGKNVAADDFKILLSHDPSHWQEKVKQNDKFYHLTLSGHTHGMQF
FT                   GIEIPGFLKWSPAKYRYKNWAGIYKENNKYINVNRGFGYLAFPGRVGIWPEISVIELRK
FT                   GSAPA"
FT   gene            542315..542611
FT                   /locus_tag="ZPR_0521"
FT   CDS_pept        542315..542611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0521"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50879"
FT                   /db_xref="GOA:D5BF00"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF00"
FT                   /protein_id="ADF50879.1"
FT                   /translation="MSKFGELVGLNVPVLIDFYTEWNEASVKMHPVLRDVASAVGDKAK
FT                   VIKIDVDKNTQLAEALRVKGLPTLMIYKNGEMLWRKSGEQNAESIIALIEQYA"
FT   gene            complement(542608..543255)
FT                   /locus_tag="ZPR_0522"
FT   CDS_pept        complement(542608..543255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0522"
FT                   /product="polysaccharide deacetylase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50880"
FT                   /db_xref="GOA:D5BF01"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF01"
FT                   /protein_id="ADF50880.1"
FT                   /translation="MNRFILKYPWILKKLYPKRLSRVAAEKTLFLSFDDGPIPEVTPWV
FT                   LEQLDKYSAKATFFCIGDNIRKHPEIFKKIKDKGHAVGNHTFNHLNGWKTSTSDYLENF
FT                   RKTERIIESKLEKTLSSEEKLFRPPYGKIKNKQAAKITKLNYRIVMWDVITGDYDKNYD
FT                   AEKCLKNTLNLIRAGSIIVFHDSLKAEKNLKYILPKLLEEYSQKAWKFKTLT"
FT   gene            complement(543304..546609)
FT                   /locus_tag="ZPR_0523"
FT   CDS_pept        complement(543304..546609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0523"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50881"
FT                   /db_xref="GOA:D5BF02"
FT                   /db_xref="InterPro:IPR021280"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF02"
FT                   /protein_id="ADF50881.1"
FT                   /translation="MTEFSFKKWNIITGWVVFAIALFTYSSTLEPTASFWDAGEYIATS
FT                   ANLEVGHPPGAPLYQMLGAFFSTFAPDSSNIALMVNFMSGLASAFAILFMFWSISILVR
FT                   KISGPAESLSFSGKLAVLGSAAVGSLAFTFTDSFWFSAVEAEVYAAAACLMSIMFYLGL
FT                   LWERDMFESRGNKWLILISLVTGLTFGIHFMGLLTIPAIGFLYFFKNYPKVTIKNFIIA
FT                   NIVVVAVLLFIFKLLLPYTLTFFSASEVFFTNSLGMPFNTGTIVAFLAMIAIFYFGINW
FT                   SIKNKKTEVNTLLHCILFILIGFSCWIMLPIRSNAPTVINENSPDNARELLAYYNREQY
FT                   GETHLFFGPQWSEMYAGLDAENPYSDKKPKYEKNEELGKYIIINDWKNTKQNLDDAHKT
FT                   FLPRMWSTEHAANYMDLTGPLQFTVKEEYQGEERLMQAISQFKQRYSNGELDNSDYHKF
FT                   LQQFSDYINVEKPSASANFSYLLEYQIGYMYWRYFMWNFVGRQDDIQGKYTDLHGNWLS
FT                   GIKPIDEWHLGPQDNLPDDVKNNPARNTYYFLPFILGFIGFFFHLNRDKKNFWVLLVFF
FT                   LFTGIALKIYLNERPFEPRERDYALVGSFYVFAIWIGFGVYAIYDKLKEYLSPKLAAPI
FT                   VIIASLIVPGIMAAENWDDHDRSDKYSALAMAKMYLDSVDENGIIFTIGDNDTFALWYA
FT                   QQIERYRLDVRVINTSLFATDWYIDQMKRKAFDSDPIPSQLKHDFYSGKNDIVVGREIT
FT                   QDTLNIKQWMNYIESDDPRTKLEYSKDETFNTYPSKHVRIPVDKQAVLKNGIVDPSEAD
FT                   QIVDHIDIEIGSNLIYKNRLLMLDIIANNNWERPIYFTGGSYGDDDYLWMKDYLQLEGV
FT                   AYKLVPIKTPVNPRNPFDMGRLNTDKMYDIVTHWDWGNMGDPNIYHDPETRKNSITYRS
FT                   NLARLVENLLNDSDKERAKEILDLGMKNMPVDYYEYYTLLEPFIDGYYKVGEDEKAREL
FT                   WNKVAEKYKQNLDWYSTWDFQRQRRYAEEIFTDVERYRGLIDILVRNQDEEIVKEKAEE
FT                   FNNYLKKFQHFYSEEEGIEPEVSPEEQLRQQQLEQELNQGQAAQDSIAINADQ"
FT   gene            546916..546991
FT                   /locus_tag="ZPR_0524"
FT   tRNA            546916..546991
FT                   /locus_tag="ZPR_0524"
FT                   /product="tRNA-Gln"
FT   gene            547187..548881
FT                   /locus_tag="ZPR_0525"
FT   CDS_pept        547187..548881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0525"
FT                   /product="trkA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50882"
FT                   /db_xref="GOA:D5BF03"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF03"
FT                   /protein_id="ADF50882.1"
FT                   /translation="MLVLILTGVISPQEGVNGFSNKATMTVAFMFVLSAALLKTGALQV
FT                   MAHRLSSIFRHRFNMGIVLMMILIAGISAFINNTPVVAVFIPVVIQIAHSSGQSPSKML
FT                   IPLSFASIFGGSCTLIGTSTNILVSSISEAESGIPISMFDMTPLGLIFMIVGILYMILI
FT                   GVKLLPDRKTNKDLKAKFQMSGYLTEIELLEDSGSIGKKIMDSGLVKELEMDIIEIRRN
FT                   GQKFTLPAGDFILQSGDVLKVRCDVGKIKSLKDRAKIVVGTSIKIGDDDLKGTNSTIVE
FT                   LVLTANSEIDGKTLKSMDFRRRYRAIPLAIRHREEVRHDQLYDVKLKAGDVVLAEVKTH
FT                   YVKELRKKGSAQNAPFIVLSEDVITDFDKKKFYTVISVILGVVLLATFNILDIMVGAIT
FT                   GVTLLVLLKTISMKEMYQAINWKIIFLLAGALSMGTAMNNTGLDLSIANTLINTLGGWG
FT                   PVAIVSGLYLLTSMLTEIMSNNAAAALLTPIAIATAVNLELSPMPFLMAIMFAASASFM
FT                   TPVGYQTNTMVYSAGQYKFFDFVKVGTLLNILFWIIATLLIPLLYKF"
FT   gene            complement(549341..549715)
FT                   /locus_tag="ZPR_0526"
FT   CDS_pept        complement(549341..549715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50883"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF04"
FT                   /protein_id="ADF50883.1"
FT                   /translation="MAKNAHKSKENNSAKYEKRVNPNTMNEALRNLKSRFTTGDVRSMK
FT                   EVSSTYSTGMPFALGISYETMVDRYNDPRKLTLENILNTADITGTDYEIVLKVAMREAL
FT                   RNHTKRDISKLLPTERETTD"
FT   gene            550656..553592
FT                   /locus_tag="ZPR_0527"
FT   CDS_pept        550656..553592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0527"
FT                   /product="TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50884"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF05"
FT                   /protein_id="ADF50884.1"
FT                   /translation="MLIPLLYIYLQLEIGKVYSQKIQNQQTVSGIISNQNELPVPGVNV
FT                   LIKGTATGTITNLDGYYSIRASVGDTLVYSYVGYQTIEKEFTRGYMGDIIMQPAADALS
FT                   EVIVNAGYYNTTGRERTGNISRVTAAEIENQPLVNPLQALQGRMAGVEISPASSHPGGA
FT                   VRIRIRGINSLREEGNLPLYIIDGMPVNSTPIESNSLIGNRGIDPLNNLNISNIESIEI
FT                   LKDADATAIYGSRGANGVVLITTKSAKRSNGTGLEINMYAGVATMPNRLDLLNTQEYLQ
FT                   VRNAALENDGQGITERNAYDLLVWDQDRYTDWQDFLFGGSSETLNTNLNFSGGDDLTSY
FT                   RIGGSFFDQGTIYPTDYEYQKITGNVNLNHHSKDNRFSIAAALNYGVDDNTLAGNIDLN
FT                   ASIFALPPNAPEAFNSDGSLNWEDWNLAGLDNPLEGYYNSNVTTSNNLISNINFTYELF
FT                   KGLQLKANLGYTHYSSEELWKLPARSNNPQDSYISSSYHLSNGRESWIAEPQLIYDNKF
FT                   SKLNLQFILGSTFQENTSDQTSFQGYGYASDNLIGNIAAAETILNARNVNSMYRYSAVF
FT                   SRIGINWNRKYYLNLTGRRDGSSRFGSNNKFANFGAIGVAWIFSEEEFLKKLNFLSFGK
FT                   LRSSYGSTGNDQIGDYGYLDAYEPTVGPGGLIPVGLANPDYSWEVNKKFEAGLELGFFQ
FT                   NCLETEISFYQNRSSNQLVGYPLPYITGFNSVQANLPATVENKGWEFVLHTRNIENSNL
FT                   AWNTSLNFTIPKNKLVAYPDIEESSYANTYRIGEPLNISLLYEYTGVDAETGRYSIRDV
FT                   NEDGRYDYQDQIIVFNANREFYGGINNSIEYKNFSLQFLFEFVKQKGTLNLFNAGPITN
FT                   VLDDVLVNNRYQQFSQSVASQTAYRNMSESNFTITDASFVRLKTLSLNYSFPEEITKSL
FT                   RFKELQLYIHAQNLFTLTPYEGLDPDRPNTGTSFTNLRSITGGLRINI"
FT   gene            553570..555000
FT                   /locus_tag="ZPR_0528"
FT   CDS_pept        553570..555000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0528"
FT                   /product="SusD/RagB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF06"
FT                   /protein_id="ADF50885.1"
FT                   /translation="MVYVLISKNHKMKKYTHKGFIFIVMLAFLILSCEDFLEIETPRNR
FT                   MVSEEVFSSEETALSAIQGIYNELFVSAFSSGGRNSVTFLTGLSSDNLEGLSSSNIPRV
FT                   QLDEHEITADNELILYLWTSAYNTIYMCNAFLDGIANSDELNMELRGQLQGEALFIRGF
FT                   TYFYLVNLYGDVPLITSPNYSENAVSDRTNSEEVWKLIFEDLETSLNLLPESYRNNERT
FT                   NLTKYAALTMLARASLYREDWKGVENYSTQVIESNRYDLLEDHNDVFLANSNEAIWQIS
FT                   PLGNGQQSSQTNEGGLLIIDPVLYFVAVARLNEDFYETFEENDLRRQKWIGYNEAINVY
FT                   FPYKYKVWTSNDLPPLEYSMVLRYAELYLMRAEAQTHLGNYTEALQDLNVIRERSELPS
FT                   ISTEDVVNQTEILNFIMEERRNEFFAEWGHRWFDMRRTNRLEEVFGERQTWQATDALYP
FT                   IPNEERRKNLNLTQNPGY"
FT   gene            555114..557867
FT                   /locus_tag="ZPR_0529"
FT   CDS_pept        555114..557867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0529"
FT                   /product="peptidase M16"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50886"
FT                   /db_xref="GOA:D5BF07"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF07"
FT                   /protein_id="ADF50886.1"
FT                   /translation="MHGELESGMQYFIKPLKDQNKLQLHLIVKTGSYFEHEDEHQFAHL
FT                   IEHLAFKKSINLPEGLKENKVYLDKLNMDSYDLIGNTGTKTTNYYFNAPAGNMEAIKAG
FT                   LLWFHEIAKNVDLSTNSIDQERGVLLQEFSRSEHVLKYNFLASKLDTTLFPCSKLTTDA
FT                   VNHMQSFPTEKVKEFYKKWYRPNRMAILITGNVEDTHQLKKMISEQMRDLPISSSLHFD
FT                   RYCDSLYFFKKNQTEVLRYQPNSEEVVQTSPLQLNLYFKDPKTWHFIGSMRGSFREIKM
FT                   NLLLSILNKRLEQIGAEYNLNVSSQVYHTALANNKQKGKPVSALKIIFYSDPGNEERGI
FT                   RNMFTILNQIRTYGVFSEELRVEKENLLKSFSEEKNHSIRYWDEEMGAYYMGFGALPEN
FT                   KLELLRAYINSVTNKNILELAKEVFNKFPEDIGIIVPESYKGVLDSKNVAAEFIDGQFK
FT                   KKVKSYALENKDYKVLIANNFDSSAMLSIPTRQPGLLQSSELHLRNGLRLILKPQSGDQ
FT                   SNKVKIHGFREFGAAHLDREDYYSALYMPKVITHMGFGHLDKFDLNELYSQTNTLKLGV
FT                   NPYINALESGFKFSVSPEETELGFQLINLFINQPRIDQSAFVDWKDSSMKFTEIGSDAW
FT                   NHFLDSMNEFSGDTLNIPYSVKALNMIPKVNYSKIKLIHEQVFAHANEFTFVITGDFQE
FT                   EKIIKLANKYLGKLKNASHQTNLNCEKRFSNCSGVNVVEIPEFFDTKNAFYGIEFLKDH
FT                   EAFSWKKEIRIQLLGILANELLNQFRMNEGFSLYDFGATGQYNDELSRYEIRFVFSSTP
FT                   EELDRLRLRNKKIITDLQHGSFPSNYLSVAKSKIIKFLNYNQNPSKMLYSYYRFEKPVI
FT                   EMDKKLELLEGINLEDMVETAQEIFNNGQECETVLINTHDLNSVHL"
FT   gene            complement(558371..558754)
FT                   /locus_tag="ZPR_0530"
FT   CDS_pept        complement(558371..558754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0530"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50887"
FT                   /db_xref="GOA:D5BF08"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF08"
FT                   /protein_id="ADF50887.1"
FT                   /translation="MLFAYTGGSKLIDIDPLYTSLRNTPLYFGKSLALIISWGLPAVEI
FT                   ATALSLCFSKFRYTGLICAGILIFVFIMYTGWIVIFPMQQPCSCGGILAEMSWKQHFLF
FT                   NLFSEALALSGIYLLSPPKKLSR"
FT   gene            complement(558926..559858)
FT                   /locus_tag="ZPR_0531"
FT   CDS_pept        complement(558926..559858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0531"
FT                   /product="AraC family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50888"
FT                   /db_xref="GOA:D5BF09"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF09"
FT                   /protein_id="ADF50888.1"
FT                   /translation="MNQPENTKRLEAIKEVLLLMGSGNFTHRIPRSDHNDNIEDIISSI
FT                   NMLSDDLSHAYNPFIFGTRSEIKRCIVQYIFLLNTQYQLITTSFPIPHTIIPGKSSIFD
FT                   LIHQDDLEVLRKEFKSFPNSKRQSCPFRMSFTTNKGLSQELFCTLFHIQYPKLKDHYLI
FT                   MGSQIIESNPLMISKEQRKVLQNKKAKETPLKILKTKEDIETIQKLKFYIDRHLQKKLP
FT                   TIEELASAMFMNQDKLKKGFKELYNDTIYRYHRKERLHHARMILSSTDENIDTIATLFG
FT                   FPHTSTFSALFKKTYGISPSELRKLDDKS"
FT   gene            complement(559880..560251)
FT                   /locus_tag="ZPR_0532"
FT   CDS_pept        complement(559880..560251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50889"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF10"
FT                   /protein_id="ADF50889.1"
FT                   /translation="MQKHYSNIYAEFWIEDHILYVIFKPNTILNLQGAKKIVADRLQFQ
FT                   QSREYAVYCDIRGLLKVDYDARIYLTKEGVWGIIAIAFIVEEHRTDTFARYYKISRKFG
FT                   IPIRIFRDPTEGKAYIHQL"
FT   gene            complement(560638..561207)
FT                   /locus_tag="ZPR_0533"
FT   CDS_pept        complement(560638..561207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0533"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50890"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF11"
FT                   /protein_id="ADF50890.1"
FT                   /translation="MKTIAIFLFTLLTSTILSSQNLEQKTLLISKESQLKISGDTNINS
FT                   FTCVFNPQELPEKLSTRFRRNNQTLFFENTSLKLNAKAFDCGSRPINRDFEALIKSEQY
FT                   PFIFLDLQELKFLTQHSALITLNIEIAGIEKSYQVPVKIDNLKSNYTGIIHLNIDDFKL
FT                   EPPKKVFGLIKVKKEIQIDFDLYFEE"
FT   gene            complement(561308..562588)
FT                   /locus_tag="ZPR_0534"
FT   CDS_pept        complement(561308..562588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50891"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF12"
FT                   /protein_id="ADF50891.1"
FT                   /translation="MRTIFKIFAIASFLFLGIGNIQAQNDRNLDNYREPDKDGINVFEA
FT                   PKDTISTFDGLKVRIGGAFALQFQALDNENANLEGYQIQGIGENFNLPTANFDIDVALY
FT                   EGIRMHLRTYLSSRHHNEPYVKGGYLLVDKLDFVHKNFLEDVMKYTTIKIGHMENNYGD
FT                   AHFRRSDNAQAIYNPFVGNLIMDAFTTEVGAELYYRRNGFIGMVGFTNGKLNQSVSEND
FT                   YGKTGGASFLAKLGYDKQINNDLRVRLTGSMYNTGYIPNTYLYSADRAGARYYNVMQAL
FT                   GSESDDFRASRYDPKLSNEITAIMINPFVKYRGLEFFGTIETATGKGSAEVDDRTANQY
FT                   AGELIYRFGLDENMYIGARYNVVDAEDISGQDVNINRFQAAAGWFMTKNILLKAEYVVQ
FT                   NYDDFSQTSILNDGKFNGATVEAVISF"
FT   gene            complement(562611..563150)
FT                   /locus_tag="ZPR_0535"
FT   CDS_pept        complement(562611..563150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0535"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50892"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF13"
FT                   /protein_id="ADF50892.1"
FT                   /translation="MKTKSLNYYAVFALLAFLFVGASVNSQNLKPIKTEILVEGTSNIH
FT                   DWEMTSEKAVGTVQSSNGTISEISIEIPVKSLESGKGGMDKNAYKALNEDDYPTIKFSS
FT                   TEVSSSKIKGHLIINGKSKTVSIPVSTKKSGESIEISGKYKINMTHYGVEPPTALMGTI
FT                   KTGEEVTINFNFQVNQ"
FT   gene            563449..563943
FT                   /locus_tag="ZPR_0536"
FT   CDS_pept        563449..563943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0536"
FT                   /product="NusG antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50893"
FT                   /db_xref="GOA:D5BF14"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF14"
FT                   /protein_id="ADF50893.1"
FT                   /translation="MPWYVIYTKPKSEIKTAQRLEKIGVEVFCPVKNEIRQWSDRKKKF
FT                   TVPLFTSYLFVRLEEKDRAIVFEVPGVNNYLFWLGQPAIVRDNEIDIIKKWVNDDAVED
FT                   IQLMHLKAGDRLIIKKGAFKDREAVVQKIGKRRCKLVLPTMGILLEAKLNEVCASENYR
FT                   L"
FT   gene            complement(564059..564202)
FT                   /locus_tag="ZPR_0537"
FT   CDS_pept        complement(564059..564202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50894"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF15"
FT                   /protein_id="ADF50894.1"
FT                   /translation="MSPGLSLTASLKNKKDPTLFLPTTQIFLNFNYFFHKIERQIYLFT
FT                   AH"
FT   gene            564270..565271
FT                   /locus_tag="ZPR_0538"
FT   CDS_pept        564270..565271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0538"
FT                   /product="mannose-1-phosphate guanylyltransferase (GDP)"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50895"
FT                   /db_xref="GOA:D5BF16"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF16"
FT                   /protein_id="ADF50895.1"
FT                   /translation="MSATYHVILTGGVGSRLWPLSRKSQPKQYLEIFKNDSLFELAIKR
FT                   NQKFSDGLIVVGNKDNRSLSISSLKKLGVNNYHEIVEATPRNTAPAIAFAAFQVKPDDI
FT                   LVVTPADHIIKADENYDHAVSKAIKLAEEGNIVTFGVKPTRPETGYGYIESDGQNVVSF
FT                   REKPNLETAKDFLHRGNFLWNSGMFCFKAGVFLSELEKYEPKVFEASKEAFQKSEEGRL
FT                   DEALSMDIPSISVDYAVMERSELIKVVNADFEWSDMGSFEAVYDYFVESGYPVDQEGNM
FT                   VIGCDKFTAFVGLKNTIFVNTSDAILILSKEASQDVKGVYQQLVDENSPLIQ"
FT   gene            565330..565920
FT                   /locus_tag="ZPR_0539"
FT   CDS_pept        565330..565920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0539"
FT                   /product="adenylylsulfate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50896"
FT                   /db_xref="GOA:D5BF17"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BF17"
FT                   /protein_id="ADF50896.1"
FT                   /translation="MSNIIPHKYEITANKRALQKKQRPLVVWFSGLSGSGKSTLANLLE
FT                   KELFTAGFHTYVLDGDNIRLGLNKDLGFDQASRNENIRRIAEVCKLFLDSGLIVIAAFI
FT                   TPKEIDRRIIESVLGEHYIEVYVDTPLELCEKRDIKGLYKKARKGEIANFTGVTCEFEK
FT                   PADPDLHIETQREEIEESIRRIFKYIHDRINEN"
FT   gene            565924..566829
FT                   /locus_tag="ZPR_0540"
FT   CDS_pept        565924..566829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0540"
FT                   /product="sulfate adenylyltransferase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50897"
FT                   /db_xref="GOA:D5BFF3"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFF3"
FT                   /protein_id="ADF50897.1"
FT                   /translation="MKKYYLNYLDELESEAIYVLREVWAQFENPVILFSGGKDSILVTH
FT                   LAKKAFYPSKIPFSLLHVDTGHNFPETIAFRDDLVKELGVNLLVGSVQESIDEGRVQEE
FT                   KGKNATRNALQITTLLDAIETNKIDCAIGGGRRDEEKARAKERFFSHRDDFGQWDPKNQ
FT                   RPELWNLLNGKYFEGEHFRAFPISNWTEMDVWNYIKRENIQIPSLYFAHQREVVWRNNS
FT                   WIPVSDFLKLEESEEVVTKKIRFRTLGDITITGGIESEADTLEKIAEEVSTMRKTERGD
FT                   RSDDKRSETAMEDRKKQGYF"
FT   gene            566865..568121
FT                   /locus_tag="ZPR_0541"
FT   CDS_pept        566865..568121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0541"
FT                   /product="Sulfate adenylyltransferase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50898"
FT                   /db_xref="GOA:D5BFF4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFF4"
FT                   /protein_id="ADF50898.1"
FT                   /translation="MEISNNQLLRFTTAGSVDDGKSTLIGRLLYDSKSIFEDQLASVTA
FT                   TSSKKGHEGVDLALFTDGLKDEREQGITIDVAYRYFTTPKRKFIIADTPGHIQYTRNMV
FT                   TGASTANAAVILIDARNGVIEQTKRHSFIASLLNIPHLVVCVNKMDLVDYSEEVFNKIT
FT                   AQFEEFSSKLLMKDVRFIPISALEGDNVVNKSENMDWYVGGTLLNVLETLHISSDINKI
FT                   DARFPVQTVLRPQSEEFRDYRGYAGRIASGIYRKGDEVAVLPSGFTSKIKSINTGEDEI
FT                   EEAFAPMSVAITLEDDIDISRGDMIVKKNNQPEPSQEFDVMLCWLNNDAAKPRAKYVIQ
FT                   HTSNEERAMIKSVVYKVDINSYERQEDDDSLQMNDIARVKIRTTRRLMIDSYRDNRNTG
FT                   SIILIDAGTNETVAAGMIV"
FT   gene            568123..568935
FT                   /locus_tag="ZPR_0542"
FT   CDS_pept        568123..568935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0542"
FT                   /product="inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50899"
FT                   /db_xref="GOA:D5BFF5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFF5"
FT                   /protein_id="ADF50899.1"
FT                   /translation="MEDQYLEIAIKASFKAAKEVMSIYEAGDFDVEMKSDHSPLTIADK
FT                   TAHTIIKKELEKTGIPILSEEGKHLSYEERKHWDKLWIVDPIDGTKEFIKKSGEFTINI
FT                   ALIEQQKPVLGVVYAPALEFLYWGGQSGSYKLTGVRNFKEFEFKLDSRKKLPLTHKNKA
FT                   FVIAASKSHLTNTTKDFINQKRASYADVEIISKGSSLKICMVAEGIVDCYPRFGTTMEW
FT                   DTAAGHAVCANAQAEIEDLNQVPLLYNKKDLRNADFLCNSKNNFKVTN"
FT   gene            568947..570341
FT                   /locus_tag="ZPR_0543"
FT   CDS_pept        568947..570341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0543"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50900"
FT                   /db_xref="GOA:D5BFF6"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028356"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFF6"
FT                   /protein_id="ADF50900.1"
FT                   /translation="MKIKNICCIGAGYVGGPTMSVIAQKCPEINVTVVDLNEKRIAAWN
FT                   DEDVENIPIYEPGLSGVVAEARGRNLFFSTDVDEAIDKADMIFISVNTPTKTYGIGKGM
FT                   AADLKWIELCARQIARVATSDKIVVEKSTLPVRTAAALSDILHNTGNGVKYHILSNPEF
FT                   LAEGTAVEDLHAPDRVLIGGDYTTEEGSKALQALVDVYAHWVPKENILTTNVWSSELSK
FT                   LTANAFLAQRVSSINSLSELCEASGADVAEVARAIGKDSRIGPKFLQSSVGFGGSCFQK
FT                   DILNLVYIAKSFGLNEVADYWEQVIIMNDHQKRRFAANIVKTLYNTVSGKKIAMLGWAF
FT                   KKDTNDTRESAAIYVADYLLNERAEVVVYDPKVTSAQIYADLDYLGSRSEEENRNLVTV
FT                   VNSPYEAIEDAHATAILTEWDEFKKLDWDKVFESMLKPAFLFDGRRLLERNEMEEKGFK
FT                   FYSIGN"
FT   gene            570403..571353
FT                   /locus_tag="ZPR_0544"
FT   CDS_pept        570403..571353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0544"
FT                   /product="GDP-fucose synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50901"
FT                   /db_xref="GOA:D5BFF7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFF7"
FT                   /protein_id="ADF50901.1"
FT                   /translation="MEKDSKIYLAGHRGMVGAAIWRVLKKKGYSNLIGRTSKELDLRNQ
FT                   KAVFDFIKSEKPDVVIDAAARVGGILANNNYPFQFLMENMQIQNNLIDAAHKLDVKKFI
FT                   FLGSSCIYPKLAPQPLKEEYLLTDSLEPTNEWYAIAKITGVKACQAIRKQFGKDFVSLM
FT                   PTNLYGTHDNFDLETSHVLPAMIRKFHEAKENNNSAVTLWGSGTPMREFLFVDDMAASV
FT                   VFALENELPEYLYNVGTGIDITIKELAETIQKKVGHTGEIVWDSSKPDGTPRKLMDITK
FT                   MHDLGWKHQVELEEGIEKTYQWFLTNNDSFKQVKM"
FT   gene            571493..572617
FT                   /locus_tag="ZPR_0545"
FT   CDS_pept        571493..572617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0545"
FT                   /product="GDP-D-mannose dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50902"
FT                   /db_xref="GOA:D5BFF8"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFF8"
FT                   /protein_id="ADF50902.1"
FT                   /translation="MKVALITGITGQDGSYLAELLLEKGYMVHGIKRRASLFNTDRIDH
FT                   LYQDPHDPNQRLKLHYGDLTDSMNLTRIIQETQPDEIYNLGAMSHVKVSFDSPEYVGNV
FT                   DGLGTLRILEAVRLLGLEKKTRIYQASTSELYGGLPENKNANGFYDETCPFYPRSPYGV
FT                   AKIYGFWITKNYREAYNMYACNGILFNHESPRRGETFVTRKITRAVAKIALGLQDKIYL
FT                   GNLDAQRDWGHAKDYVRMMWMILQADKPEDWVIATGVTTTVRDFVRMAFEEVGIELEFK
FT                   GVGVDEKAFVVACNGDYKVEIGKEVLSVDPSYFRPTEVDLLLGDPSKAKEKLGWVPEYD
FT                   LKALVKDMMKGDVKLMKRDVDLLKAGHKILKQVE"
FT   gene            572755..574038
FT                   /locus_tag="ZPR_0546"
FT   CDS_pept        572755..574038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0546"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50903"
FT                   /db_xref="GOA:D5BFF9"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFF9"
FT                   /protein_id="ADF50903.1"
FT                   /translation="MNKLTSGTSKATVLQWGKLLTITGGAQALVQGLGLLVGVLIIRLL
FT                   PKEEYAFYTIANTMLGTMTVLADGGINNGAMAAGGEVWQDRYGLGKVLRTSIHMRKKFA
FT                   VYSLIVTIPILIYLLNKQDAPWTSILLITLALIPSFWAALSDSLLQTVPKLHQAIPPLQ
FT                   KNQLLVSLMRLFFSGVFVFLFPFTFIAVLGNGIPRLIGNFRLHKIAAPFIDEAAPVDKK
FT                   IEARIMRIVRRTLPGSIYYCISGQITVWILSFFGNTGSIASVGALSRLAMVLTLISTVV
FT                   STLVIPRFSRLKPVRSNLLKKYILIFLGLSVVLLIFIAVTYGCSDWILLILGDKYKGLN
FT                   FELVLTIIGSAFSLLSGVAFGLYSNRGWVIHPVVMIMVNLISIILFVNVMDVTSLVGVL
FT                   QFNIAINMISFLMNFIFGFFKILKLRDI"
FT   gene            574082..575050
FT                   /locus_tag="ZPR_0547"
FT   CDS_pept        574082..575050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0547"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50904"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFG0"
FT                   /protein_id="ADF50904.1"
FT                   /translation="MNIKVCTLFEGRYHYGVAVLTNSLYKWGFRGEIHVGYRGNLPNWT
FT                   SSREENKSIDWGGVSTFEVLDGLTLNFLPLETDISLTNYKPNFMMDLLENETTTADGLL
FT                   YFDPDIVNVTPINFFAEWIEYGIAMAADVNSPISRNHPRRMKWVEFYSKCSIDLNYESD
FT                   IYVNGGFIGVAKKDIVFLNLWKKSQDLMANEIGGLHKSIFSEKPKVVYGGDFDAFSKTD
FT                   QDALNVAIGIYDGKTCIVDRDAMGFFPGLVMFPHALGRQKPWDVKPLLFWLKGLKPRRV
FT                   DKLFWEYAEGPIKPYNKFMVYQKQILIKIWSVLSRFYSKPL"
FT   gene            575047..575622
FT                   /locus_tag="ZPR_0548"
FT   CDS_pept        575047..575622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0548"
FT                   /product="galactoside acetyltransferase (lacA)"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50905"
FT                   /db_xref="GOA:D5BFG1"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFG1"
FT                   /protein_id="ADF50905.1"
FT                   /translation="MIIKKILRLGLFKIRLVYIPKYFSFRTSIYRFQGLKTGKGTVVGN
FT                   ARFTWPHQVKIGDSSRFEHDVYFHYDGIYSDSASIIIGNNVFVGYGVEFNIRKAIHVGN
FT                   NCLIASGCKFIDHDHGMAIGSYMNSQIGTEDEIYLEDDVWLGVNVVVLKGVTIGEGAVI
FT                   AANAVVTKSIPKNEVWAGIPAKKVKDRL"
FT   gene            575619..576734
FT                   /locus_tag="ZPR_0549"
FT   CDS_pept        575619..576734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0549"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50906"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFG2"
FT                   /protein_id="ADF50906.1"
FT                   /translation="MKFSKILVICGSLEKGKDGVGDYTRALVSQLKERRIVVVLLALSD
FT                   KHIKEVQDEVLHSIPVKRIPLMLKESERISIAKHFIEEKKPDLVSLQFVPYAFDAKGFP
FT                   HYLLKVLPCIVQGHNVQWHIMFHELWVAMAKESSFKLKIIGTLQRRLIRNLLKILNPCC
FT                   VHTHTSLYQEELRLLGVKANLLPLFSNIGKIESGSKEKKVMHSIVHVGIFGSIHPGAPI
FT                   KQFFNILQTSFESVKIHFIGGNGNELSSWINLLDVSDIPYEVHGRQSEKTISTLLDYCD
FT                   LGISTTPYYVTQKSGSIAAMLLHDMAVVCVARPWTPWVLTKNSNMAANLTNPYVLQWQG
FT                   GKIDKEMFPITESSHFEVSYVATQFINDLHL"
FT   gene            576737..577330
FT                   /locus_tag="ZPR_0550"
FT   CDS_pept        576737..577330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0550"
FT                   /product="acetyltransferase, CysE/LacA/LpxA/NodL family"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50907"
FT                   /db_xref="GOA:D5BFG3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFG3"
FT                   /protein_id="ADF50907.1"
FT                   /translation="MASLKYLWQNRAVFPFFSKDNAKAWAKRIHSYPVLRRRNRERKSL
FT                   IRQGGLIAETAELGNVDINGDKKNLTIGEFSFLGRVEIALHDRVTIQDYVCINDGVILL
FT                   SASHDLMDPLWQHKKAPIVIESYAWVATGAIILPGVTIGRGAVVGAGAVVSKDVPPYGI
FT                   AAGNPAVLLHKKRTEELRYNPCEFLAANRAWLFG"
FT   gene            577343..578593
FT                   /locus_tag="ZPR_0551"
FT   CDS_pept        577343..578593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0551"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50908"
FT                   /db_xref="GOA:D5BFG4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFG4"
FT                   /protein_id="ADF50908.1"
FT                   /translation="MKNRKVILSHPLGNQNVRAVLRGMEQAGVLGGFVTSVATFPDSSL
FT                   DKISRRISFLGEFQKRSFDPSLRNYTNTYFYRELGRIICAKLKLKFLTTHESGQFSIDK
FT                   VCHYIDHKTAQLLSKESGIKGMYAYEDIALESFQVAKSLGISCLYDLPIGYWLAARRLM
FT                   QQEVEARPEWAPTMVGFRDSAAKLARKDKELALADHIFVASSFTKETLQDYPGTLAPIS
FT                   VVPYGFPPVAINRTYNNPHGKLKLLFVGGLSQRKGLANLFEAVDLIGKQHIELTIVGRK
FT                   SGGACVPLEKALQEHTYIPGLPHAQILELMQTQDVFVFPSLFEGFGLVITEAMSQGLPV
FT                   ITTERTIGPDIITHAENGWLTEAGNTDSLVAALEHMLQQRSHIPQLGEAAMQKAQSRPW
FT                   NVYSQETATQVQKLIDN"
FT   gene            578596..579918
FT                   /locus_tag="ZPR_0552"
FT   CDS_pept        578596..579918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0552"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50909"
FT                   /db_xref="GOA:D5BFG5"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFG5"
FT                   /protein_id="ADF50909.1"
FT                   /translation="MAVRNESVALMNQQNEQIAKRIKQMIWLYFFLLIFEGALRKWFLP
FT                   FLATPLLVVREPVAIYAVFLAIKYRLFPVSPSLLLFVLTGIVTTFLALFLGHQNLFVAL
FT                   FGARIFFFHVPFVYLIASFWTYNDFLQLGKIFLWLTLLMTIIIFFQFYSPQSALINRGV
FT                   GGDTSGAGFSGAKGFFRPPGTFSFINGTTSFYALAICFITYFWLSRNKVNKILLIGATL
FT                   GAIIAIPLSISRTYFFNVVLLLLFVGGIQLRNPRQLPKTLIAIVVLVLVGVVLVQVPEV
FT                   STALEAFTSRFDAANENEGGLEGVLLVRFLGGMYEYLFQAGDIPFWGAGLGMGSNVGAM
FT                   LLSGEAVFLLPEVEWGRILGEIGVVFGLLVIILRVQIGFGSLWKAFKKIGKGEYLSWLL
FT                   LSTGFVVIIQGQWGQPTNLGFFVITTGLVLASLEVENSLDE"
FT   gene            579911..581044
FT                   /locus_tag="ZPR_0553"
FT   CDS_pept        579911..581044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0553"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50910"
FT                   /db_xref="GOA:D5BFG6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFG6"
FT                   /protein_id="ADF50910.1"
FT                   /translation="MNKKIVFIGNYPLDHQESMERFAQMLVMGFQGDCTVEIFRPKVWF
FT                   AKPFKNSLSGVGKWLGYMDKWLLFPLLLRLKVKKETTYTYFHVCDHSNAYYMRSLPVNR
FT                   SSITCHDVLAIRGALGYKDAYCPASRFGVLLQKWILRHLTMSDKIACVSQFTLGQLVDL
FT                   HGKQTKPGWTVIHNGFNAPFQQLSNEVKLQRLQSGGLQGLLKNDYILHLGSNLARKNKK
FT                   LLLHMLSYLPDWDGKICFAGKPLTSEFKEMIQELELSDRVVEVIKPEFTLLEALINQAK
FT                   VFIFPSFSEGFGWPVTEAQACGTPVVASFLAPMPEVGGTGALYADPYQPEAFAQQVDLI
FT                   LKDRNLETTLKAAGFENIKRFETTLMIQRYKDFFQYG"
FT   gene            581076..581255
FT                   /locus_tag="ZPR_0554"
FT   CDS_pept        581076..581255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50911"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFG7"
FT                   /protein_id="ADF50911.1"
FT                   /translation="MPLKRWLLQRYYGYCIHPTARIGWSWVFPGYLEMEAHSKIGHFNT
FT                   AVHLDAIHLESTYL"
FT   gene            581333..581704
FT                   /locus_tag="ZPR_0555"
FT   CDS_pept        581333..581704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0555"
FT                   /product="trimeric LpxA-like enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50912"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFG8"
FT                   /protein_id="ADF50912.1"
FT                   /translation="MFAVGAHSAITKNHHIDCTSPIFIGKFVTIAGYQSQLLTHSINVY
FT                   DNRQDSQSIYIGDYTFIGTNVVILGGSKLPAKSVLGAKALLNKSYEEEWMLYGGNPAKP
FT                   IVPIQKDAKYFSRTKGYVI"
FT   gene            581936..582871
FT                   /locus_tag="ZPR_0556"
FT   CDS_pept        581936..582871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0556"
FT                   /product="glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50913"
FT                   /db_xref="GOA:D5BFG9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFG9"
FT                   /protein_id="ADF50913.1"
FT                   /translation="MLRFDVVIIHGLWMYNSYGTYRVWEKLKRKISKVPRLYIMPHGML
FT                   DPYFQKAKERKLKAVRNLFFWHLIESKVVNGVDGVLFTCEQELLLARTTFSHYLPKREI
FT                   NIGYGVIEPPIKKMEMKGALISHIPEWNEKPFWLFMSRIHSKKGVDLLINSYLKLERVK
FT                   GGLPQLIIAGPALDADYGREMEELASPSKNIIFPGMLTKNAKWAAFYEAEAFILPSHQE
FT                   NFGIAVVEALACGTPVLISDKINIYREVIDSGAGLLFSDTQDSCDQILDEWNNFKDIKK
FT                   EQYGLRAFECYKKYYDIYEVAKKFKTKIHD"
FT   gene            582875..584077
FT                   /locus_tag="ZPR_0557"
FT   CDS_pept        582875..584077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0557"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50914"
FT                   /db_xref="GOA:D5BFH0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFH0"
FT                   /protein_id="ADF50914.1"
FT                   /translation="MSGILFIIGTYPSYGGTEQVTTYLANQFVAKGYRVAIASFEQPAP
FT                   ELQKDCHDSIRLVALNYPVMSKDNVLKLSNTATEMNLNLIINQWVLPFQTNRLCRRVRN
FT                   NNSKCKIISVYHNAPNRNARVTDVDIILKNNPNIGLLKKSMLLSKRFIMDSVIRASMHY
FT                   VYKKSDQYVILSESFRDIFKAYARVANDYKLSIISNPLTIPDEVFDISKKEKIFLYVGR
FT                   IDYNQKRVQRIIDVWEIVSNKLPEWRLEIVGDGPDKEKLMSRVKEKGIKRISFEGFQNP
FT                   LDYYKKSSLLLLTSEYEGFGLVIIEGMRYGVVPIVYGSYEAVYDIIQNGETGLITNPPY
FT                   QQSDIEKAMLKLASDDIQRQRMLHNCMQKSEHFTIDEVVKNWQELFNKLINENRTTNPT
FT                   F"
FT   gene            584202..585158
FT                   /locus_tag="ZPR_0558"
FT   CDS_pept        584202..585158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0558"
FT                   /product="WfeP"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50915"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFH1"
FT                   /protein_id="ADF50915.1"
FT                   /translation="MLKWKTMRALSYLPIFRVLPLVSVETFKRKYIKDFTKDIYTDQAL
FT                   KNVIDRERFRGYVVGSDQIWNYTAAPQITDAFLSFVTDKSDIKRVSYAASFGREQWKYP
FT                   ETETKECKNLVQQFDGVSVREKSGVTLCKDFLGVDANHHLDPTMLLSKEDYIDIIESSK
FT                   VAPSNGKLLLYILDATEERQKIVNAVQKELNLEPYGIRQFKKIKILKNALKGIYPSVQQ
FT                   WLKSFYDAEFVVTDSFHGTIFSIIFNKPFISLGNKERGMARFESLLSDLGLLSRLVTVS
FT                   DQVTVEMIRQEIDWDLVDAKIAKAKDVGIDYLNEKLK"
FT   gene            585273..586535
FT                   /locus_tag="ZPR_0559"
FT   CDS_pept        585273..586535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0559"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50916"
FT                   /db_xref="InterPro:IPR007516"
FT                   /db_xref="InterPro:IPR007525"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFH2"
FT                   /protein_id="ADF50916.1"
FT                   /translation="MDWNEFGFLVPHEINDCTDESDCLSVCPFNPFPEETVKTETEIAN
FT                   LFFPDDTTTKKLEKLGKYKNTYVGYSNEFRATSSSGGIASYVTKQLFERNIIEYVVNVQ
FT                   QVGEKFEYSINKKGNPVVKSSKTRYYPVTMDKVFQKIEELDGNVAIVSIPCFLKGVRLA
FT                   QYQRPALKEKINFTIGIICGGVKSKFFTEYLTQKAGAFNDDVEKVEYRVKNLDSTAGDY
FT                   SFGVKVAGKEDLKTVKMRSLGDMWGTGLFKCNACDFCDDVSGELADIALGDAWIRPYVN
FT                   DGGGTNVMITRSNLADTIIKQGMSNGDLHADDLPESEFIRSQKGSFTHRQDCLPYRADK
FT                   LSNIENIPPKRPRKKRLSPEVKLIQKKRRETRKQSLLIWKDNPNVDFFDLKMKPYLKSL
FT                   RSITKFNHYKRGIIDRMKRMF"
FT   gene            586535..587086
FT                   /locus_tag="ZPR_0560"
FT   CDS_pept        586535..587086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0560"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50917"
FT                   /db_xref="GOA:D5BFH3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFH3"
FT                   /protein_id="ADF50917.1"
FT                   /translation="MEEVKLNEYTEKKPKFFLRIIWSVINRTIFRLLIGKRLFFARNFL
FT                   LRLFGAKLHSRVLIYSSCDIFEPWNLEVDKFSCLGPNTEIYNKAKIKIGANAVISQGSY
FT                   LCSASHDISEKLLPLTFKDITIGDQSWIAADVFIGPGVTIGEGAVVGARAAVFKDVDPW
FT                   TVVGGNPAKFLKKRVLSQKD"
FT   gene            587101..587916
FT                   /locus_tag="ZPR_0561"
FT   CDS_pept        587101..587916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0561"
FT                   /product="glycosyl transferase, group 2 family"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50918"
FT                   /db_xref="GOA:D5BFH4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFH4"
FT                   /protein_id="ADF50918.1"
FT                   /translation="MKKIPVTVVIPVKNEAKNMDRCMQLVSDFDQILVIDSQSTDATCS
FT                   IAESYGAEVHQFHWDGQFPKKRNWVLRNLELRNEWILFLDADEYLTPEFRTELQEVIQS
FT                   QEYNGYWIRFINYFMGQQLKHGDPFQKLPLIRKGTGEYERIKEDSWSHLDMEVHEHPVL
FT                   EGKVGVMKAPIIHNDFKGLEHYIAKHNAYSSWEAQRFLTLKKEGFVGLNKRQRFKYQLM
FT                   ERGWLPMVYFLGAYIGKLGFLDGKVGYYFSKYKAHYFLQIQTKIKELQS"
FT   gene            587913..588851
FT                   /locus_tag="ZPR_0562"
FT   CDS_pept        587913..588851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0562"
FT                   /product="putative dNTP-hexose dehydratase-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50919"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFH5"
FT                   /protein_id="ADF50919.1"
FT                   /translation="MKKRILITGGAGFIGSHLCKRMLDEGNEVICLDNYFTGSKKNIVT
FT                   LMENPYFEMVRHDITESYYAEVDEIYNLACPASPVHYQYNPIKTMKTSVMGTINTLGLA
FT                   KRVNAKILQASTSEVYGDPDVHPQPETYWGNVNTIGPRSCYDEGKRCAETLCMDYHLQN
FT                   GVDVKIIRIFNTYGPNMNPEDGRVVSNFIVQALKGEDITIFGDGTQTRSFQYVDDLVEG
FT                   MVRLMGTPNGFWKPVNIGNQNEFTMLELAENVLNITGSKSKLVFKDLPKDDPKQRQPDI
FT                   SRADKYLNGWKPKIQLEEGLKKTIAYFDSVL"
FT   gene            588885..589631
FT                   /locus_tag="ZPR_0563"
FT   CDS_pept        588885..589631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0563"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50920"
FT                   /db_xref="GOA:D5BFH6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFH6"
FT                   /protein_id="ADF50920.1"
FT                   /translation="MKISIITIVFNNVNTIASCIESVQAQNYNNIEHIVIDGESTDGTI
FT                   DVIKGFENNIDVFISEEDNGLYDALNKGIKKATGDVIGILHSDDMFYSPHTISNVVKCM
FT                   QKSGADLLYGNGVYVERNNTSNVKRVYSSKSFKRSYLKYGWIPLHTTIYVRSNIFDKYG
FT                   DYDERYSIASDYDISLRWFLNENIKKIFLDEFLVKMRLGGKSTTLKLQKRKSSQDIRII
FT                   KEHGLPGYLTLACKIGRKIPQYLKRG"
FT   gene            complement(589685..589801)
FT                   /locus_tag="ZPR_0564"
FT   CDS_pept        complement(589685..589801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50921"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFH7"
FT                   /protein_id="ADF50921.1"
FT                   /translation="MDKNLTQMQLTTTIDYKIRWPAMTNTYLPLEKRALHLL"
FT   gene            589960..590979
FT                   /locus_tag="ZPR_0565"
FT   CDS_pept        589960..590979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0565"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50922"
FT                   /db_xref="GOA:D5BFH8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFH8"
FT                   /protein_id="ADF50922.1"
FT                   /translation="MYRWIFYYLRNIYRTEGGNLANVIVIGRDRKLKKIRQVFDMPELG
FT                   YRYLGYFDNESSKSITYLGQIEDCIPYLRNTHVEEIYCMASRLSSEELGSLINYADNNL
FT                   KRIKIIPDNKEIYTRAMNVELFGSVPVLNLRKLPLETDIAKYTKRTFDIIFSFLVCIFL
FT                   LSWLVPIIAILIKSESKGPIFFRQKRHGVGKKEFWCYKFRSMAVNKDSDTRMMTKNDTR
FT                   VTKIGAFMRKTSIDELPQFFNVLKGDMSVVGPRPHMEAHTNQYQKSVDKYLVRHFAKPG
FT                   ITGLAQIKGYRGEIIEASDIINRTRLDIFYVEKWSLYLDIKIILSTVINAVRGEEKAY"
FT   gene            590980..591747
FT                   /locus_tag="ZPR_0566"
FT   CDS_pept        590980..591747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0566"
FT                   /product="polysaccharide export protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50923"
FT                   /db_xref="GOA:D5BFH9"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFH9"
FT                   /protein_id="ADF50923.1"
FT                   /translation="MKIKFYSLIVLVLAIISLSGCVSRKQVQFYQGIDNLTESQIYDND
FT                   KVRIKPDDRLSIKVFSNNQEAASPFNPMIVSRSGAMSGGGDQSSIEYLVSREGKINFPV
FT                   LGEIKVVDYTINELADILQTQIEPYLSEPVIMVRIKNFRINIIGAINGIIEVDDDQINL
FT                   AQALSQVDGISNQGELNNILVIREKDGLRTSHRLDLTDSEVLNSPYYYLEQNDIIYIEP
FT                   TAPARQQRGYLGTVSSYIGIVSSVLSLIVIFTR"
FT   gene            591749..594103
FT                   /locus_tag="ZPR_0567"
FT   CDS_pept        591749..594103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0567"
FT                   /product="tyrosine-protein kinase ptk"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50924"
FT                   /db_xref="GOA:D5BFI0"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFI0"
FT                   /protein_id="ADF50924.1"
FT                   /translation="MMNSNSNLNNGSSNQPIDFREEAAKYLKYWYWFLLSIIICLAIAF
FT                   IYLRYTPSIYSAKSKILIKDSENPSAETAVLSEMGILSNSNETSIQNELAILKSRRIML
FT                   RVVENLNLNVNYFVEGQVVDVEIYNESPIIASPEQKNASPNVYKVQFSNGKFHITCLET
FT                   GKVYRSLPGKKIDLGFDIVSFNLSSNSIPENAILIRFQDPVLVANSYASKFSATLAQDK
FT                   GSIVDLSINDRVLNRARDVLSQIVIEYNQDAIRDNQVIAMNTSEFINERLDSLNVELDS
FT                   VERNIENFKEINGLIDIETESENMVQNINQYQEKSQEIEIELNIARSLQSFLKQKGDQL
FT                   LPSNLGTQESGVNSLIAQYNALIVKRNNLLSGSSSKNPLVKELNNQISNLRENLFESLD
FT                   RLVRNLEMSSKSVGSQLAQLRAQVASVPSKEREFRGVSRPQNIKEQLYLFLLQKREENS
FT                   ISYGVENIKAKIVDEASSNGVVSPKPNIILLASFVLGLFIPFGIIFGTNFLDNKLRSKQ
FT                   DLETFTNEIAILGQIPSVSKEESDLIQKHDRSILAEAFRILTTSMQYVLAGIQDRDKNN
FT                   TTIYVTSTVKGEGKTFTAFNLALTLCEGNNRVLIVGADLRNPQLQRYEEGAKVLKGVSD
FT                   FIVSDDESIKAYINQSKLHPNLSIVTSGSIPPNPSELLRNVKIDSMFKELKGLYDYVIV
FT                   DTAPAMLVADTFLINRFADLTLYVARAGYTEKNLINFAIEAKESGKLSNVSFVLNDVKM
FT                   SNFGYYGNKYGYTYAAEDNDKRKGLMSRFKK"
FT   gene            594187..595467
FT                   /locus_tag="ZPR_0568"
FT   CDS_pept        594187..595467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0568"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50925"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFI1"
FT                   /protein_id="ADF50925.1"
FT                   /translation="MGGAYSNTEELPFYFYKNTKGRLSDQSEFYGTLMLDYSFDISRNF
FT                   NMILGGAASYDNSPIAGNHIWMDELYSKIVYKNQISLTLGRKHQEENLSGLSASNANFA
FT                   WSLNTRAMPGLQLTLDPFYFDRFDTFGVSASFEQYLLEKDRSVSRAQIHHKNFYLLYNR
FT                   KSWAIKAGIEHYAMYGGTSEFYGEAPSGLQNYLKVFFGREGGSEAIGGERQNVIGNHLG
FT                   TYVFDISYTTNVKYNFVYNHFFEDGSSSKFSNFPDGSYALYIEDVDNRNLWKAFIFEIY
FT                   YTKNRSKNYNGPENVEQYFNNFLFYKSGWSYQQRILGVPFFDFDSSAPRGSIVNDEFIA
FT                   YHLGMNAELAKYSRRNTFPLRLLLTHVNYSNSRPSVLSKSNVFYSYLDIGLIQNNPFNL
FT                   NISFGTEFSEGDKPIFAAGLSVSKSFF"
FT   gene            complement(595464..596087)
FT                   /locus_tag="ZPR_0569"
FT   CDS_pept        complement(595464..596087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0569"
FT                   /product="metallophosphoesterase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50926"
FT                   /db_xref="GOA:D5BFI2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFI2"
FT                   /protein_id="ADF50926.1"
FT                   /translation="MRLISISDTHNKHKDLDIPKGDFLIHCGDFTEGGSRSETLDFLEW
FT                   FSKQPHKHKILIGGNHDFFLEKYQHNLEEYIPNNIHYLNDKGITLENIKIWGSPYTPGN
FT                   GHWAFNLERGRAIRKRWNLIPQNIDILVTHTPPYGILDESQTYKNIGCEELLKQIVDIK
FT                   PTLHLFGHVHDDFGKKNIGPTLFVNSAVMDNKMRLINAISTIDL"
FT   gene            complement(596096..596248)
FT                   /locus_tag="ZPR_0570"
FT   CDS_pept        complement(596096..596248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50927"
FT                   /db_xref="GOA:D5BFI3"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFI3"
FT                   /protein_id="ADF50927.1"
FT                   /translation="MSDSLLVKFIFFAFTAVIIAFALTKITNKFLPVDKDYISQEQEDG
FT                   VVDGE"
FT   gene            596708..598114
FT                   /locus_tag="ZPR_0571"
FT   CDS_pept        596708..598114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50928"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFI4"
FT                   /protein_id="ADF50928.1"
FT                   /translation="MPELKFDQLKVQVFKNAAQLSNIRLKRGEVEINSEKLEVSGLNYW
FT                   KFLFEKNIDLNTISISHPEIIYQTAANKSSEKDSVATKGNSKEKGLNKQILVEKLILNR
FT                   GKFVLTDSVSENKIKVKTFDFQLNQLQVDSSSIQNKIPFEFKSFSLDADSIFLKVDERH
FT                   TINVADIRVEENKSMLQGLLLTSIYSKQEFQNHTPIEKDRYNLSVDSIAINHHDFGFKN
FT                   DSLKYVASRFSIHNADFEIYRDKTQPDDNTVKPMYSEMLRKLPFLLKIDTLNVDNARIV
FT                   YEERIKAGRSPGKVIFAKVQGEISNLTNFSDSIEFPTTRIIAEADFMDQAALQLNWAFK
FT                   VNNRSDWFSVSGNMGTLSAQNMNTFLTPGMNVKAKGDITSMIFNFSGNRNVATGGLNIA
FT                   YKDFKIEVLKNDGTEKSGFLTTIANIFVKHNGESGENVNKGLEIERDKTKSFWNYLWSC
FT                   IKKGALKTFT"
FT   gene            complement(598111..598938)
FT                   /locus_tag="ZPR_0572"
FT   CDS_pept        complement(598111..598938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0572"
FT                   /product="universal stress protein family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50929"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFI5"
FT                   /protein_id="ADF50929.1"
FT                   /translation="MQKILVPTDFSKEAENALKTAAIIAKKFDAEIYLLHMLDLPLNLI
FT                   DPVQGNSQNVPEALYFMKLAHMHFSKIKESDYLKDLSVTEAVQFNHAFKGITEFAKNNN
FT                   CDLIIMGSHGSSGFQEMFAGSNTEKVVRQSEIPVLVIKEEAKDFKIEKFILATDTEIDN
FT                   KKTLLKAIEFSKLFEAELHLLFVNTPNNFTTTKQAYADLEEFLQEMNLNSIKKHIYNDI
FT                   SVEKGILNFSEKIKADLIGISTHGRKGLAHFFNGSISEDLVNHARRPVITFKI"
FT   gene            599097..599561
FT                   /locus_tag="ZPR_0573"
FT   CDS_pept        599097..599561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50930"
FT                   /db_xref="GOA:D5BFI6"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFI6"
FT                   /protein_id="ADF50930.1"
FT                   /translation="MKLKENVEKLLQQAFEENNSLFLIDLMITSDNQIRVIIDGDKGVS
FT                   VEDCMYVSRKVEHNLDREEEDFSLEVTSAGVSEPLQIPRQYKKNIGRKLQVKTENEKFE
FT                   GNLIDATESDIKLQWKAREPKPVGKGKVTVEKEAVLAYSAIVEAKVMITF"
FT   gene            599572..600804
FT                   /locus_tag="ZPR_0574"
FT   CDS_pept        599572..600804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0574"
FT                   /product="transcription elongation factor NusA"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50931"
FT                   /db_xref="GOA:D5BFI7"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFI7"
FT                   /protein_id="ADF50931.1"
FT                   /translation="MENLALIDSFSEFKDDKLIDRVTLMAILEDVFRNALKKKYGEDDN
FT                   FDIIVNPDKGDLEIWRNRVVVADGEVEDPNQEISLAEARKIEPDFEVGEDVSEEVKLKD
FT                   LGRRAILALRQNLISKIHEHDNTNIYKQFKDLEGEIYTAEVHHIRHRAIILLDDEGNEI
FT                   VLPKDRQIPSDFFRKGENVRGVIESVELKGNKPSIILSRTAPAFLEKLFEQEIPEVFDG
FT                   LITIKKVVRVPGEKAKVAVDSYDDRIDPVGACVGMKGSRIHSIVRELGNENIDVINYTN
FT                   NDQLFITRALSPAKITSIKIDEENKRAEVMLKPEEVSKAIGRGGHNIRLAGQLTGYEID
FT                   VFREGVEEDVELSEFSDEIEDWVIKEFAKIGLDTAKSILEQDVNDLIKRTDLEEETVRE
FT                   VLKVLREEFEE"
FT   gene            600850..603660
FT                   /locus_tag="ZPR_0575"
FT   CDS_pept        600850..603660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0575"
FT                   /product="translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50932"
FT                   /db_xref="GOA:D5BFI8"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFI8"
FT                   /protein_id="ADF50932.1"
FT                   /translation="MAEAKTMRLNKVLREFNISLDRAVEFLNSKGHDIEARPTAKISQE
FT                   TYQVLFNEFQTDKSKKVASKEVGEERKKEKEELRLAREREQEEKRKEQEKKEQEKLREE
FT                   QERKKQEQETLSTRTKLSGPKTVGKIDLDKPQVEKKKEEPKKEEKPEQAKQEEPAPKPV
FT                   EEKPKPKPDVVKNQDDAPKKEQPKQEPKKDKEQTEVKPEASEQSEESNRIKTNYTKLDG
FT                   PNFTGEKIDLSKFKKPVKKKDDKKTAASNDDKKGNRKKRRRRISKDVKGGPNQGGGNNN
FT                   NNNRKGRNNKQRSRPITKEEPSEEEVQKQVRETLEKLQGKSSKGKGAKYRRDKRDQHRQ
FT                   RSEEDLAKQESDSKVLKVTEFVTVSEVATMMDVPVTKVISACMSLGMMVTMNQRLDAET
FT                   LSIVADEFGYEVDFVTADVEETVEVQEDAPEDLQERAPIVTVMGHVDHGKTSLLDYIRK
FT                   ENVIAGESGGITQHIGAYGVELDGGQKIAFLDTPGHEAFTAMRARGAQVTDIAIIVIAA
FT                   DDDVMPQTKEAISHAQAAGVPIIFAINKSDLPTANPEKIKEKLASMNLLVEDWGGKVQS
FT                   HDISAKTGMGVKELLEKVLLEAEILELKANPNKIANGTVVEAFLDRGRGYVATILVQAG
FT                   TLKIGDYVLAGRHSGKIKAMHDERGHEIKEAGPSTPVSILGLDGAPQAGDKFKVMLDER
FT                   EAKDIAAKRTQLQREQNVRTQRHITLDEIGRRIALGEFKELNIILKGDVDGSVEALTDS
FT                   FQKLSTEEIQVNIIHKGVGAITESDVLLASASDAIIIGFNVRPAGNARQVADKEEIDIR
FT                   TYSIIYDAINDLKDAMEGMLSPEVKEEITGTAEIRETFKISKIGTIAGCMVTSGKIYRT
FT                   AGVRLIRDGVVIYTGELASLKRFKDDVKEVSKGYDCGMQVKNYNDIREGDVIEAFREVE
FT                   VKKTLK"
FT   gene            complement(603834..604223)
FT                   /locus_tag="ZPR_0576"
FT   CDS_pept        complement(603834..604223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50933"
FT                   /db_xref="GOA:D5BFI9"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFI9"
FT                   /protein_id="ADF50933.1"
FT                   /translation="MNILSFKNLLFGTSLCLSCVAFGQEETQKINISQSDMINELSLTK
FT                   TKLQKSHNIGDRYVIQLFSGPNGDASNKIKDYEALYEYPARIKYEAPNYKVWIGNFRNR
FT                   LEADRALLVIKETYPSAFIPKPERK"
FT   gene            604354..605799
FT                   /locus_tag="ZPR_0577"
FT   CDS_pept        604354..605799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0577"
FT                   /product="cytochrome c domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50934"
FT                   /db_xref="GOA:D5BFJ0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR029467"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="InterPro:IPR039118"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFJ0"
FT                   /protein_id="ADF50934.1"
FT                   /translation="MPEFNGAFLKFLRTDFNLKKPYQSLDVNSTYNMKKVKYRHSTSRL
FT                   LLIVALFLSFTVTGFAQDSTAVEAGTPETAADKADASASAELGDPAAGKSLFNSLCAAC
FT                   HKPYSASIGPALNGVTLRHDKEWLYSWIKNNAELRASGDADAEAIYQEYNGTAMPAFPQ
FT                   LSNEDIDNILAYVEQPKPEPTAAATAGAGTDGQGASGGGVSVNIILGILIFVLVMLLVV
FT                   LFLVNKTLKNFATASGVKLPEKPSRKPIWQAFVENQFLVLVFSIVVLLGVGYFAYGFLM
FT                   QVGVDQGYQPIQPIHYSHRIHAGDNGIECKYCHSSARVSKTSGIPSLNVCMNCHKAISE
FT                   VAPETATADHSKEFYDGEIAKLYDAVGWDPSTRTYSGDQKPVKWVRIHNLPDFVYFNHS
FT                   QHVSVAGVQCQHCHGPIQEMEVVHQEAPLTMGWCINCHRETGVQMEGNEYYEKIHEELS
FT                   KKYGVEELTIAEMGGLECGKCHY"
FT   gene            605852..608917
FT                   /locus_tag="ZPR_0578"
FT   CDS_pept        605852..608917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0578"
FT                   /product="iron-sulfur binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50935"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR030948"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFJ1"
FT                   /protein_id="ADF50935.1"
FT                   /translation="MSSNKKYWTSVEELKGSSIVETLKQKEFAEEIPVDEFLGDKESLS
FT                   NSKTSRRDFLKYVGFSTAAASLAACEGPVVKSIPYVVQPDRIIPGVANYYASTIANGFD
FT                   FQSVLVKTREGRPIKIENNDLAKVKAGGGARVHASVLSLYDKKRVKRPMIDGKNVSWEE
FT                   FDRQVGSALNGVSGDIVLLTQTFASPSTTKLIQDFSAKYPNVKHVAYDAVSEDAALSAF
FT                   ESRYGRRALPNYDFTEAETIVSIGADFLGDWQGGGYDNSYAQSRIPKNGKMSRHVQFES
FT                   NLSLAGAKADKRVPVKPSQQKAILASLYGYIVGGGSTSELPSKIDDAVVKAASQLRKAG
FT                   SKGVVVSGIPDADAQSLVLAINEALGSSIMDTDNARMTRQGNSAQVVELVKDMNAGSVG
FT                   ALMVVGVNPAYSLPNASEFIEGLKNVEVSVSFTMKEDETAKLCKYIAATPHYLESWGDV
FT                   QFTDNQFSLMQPTIRPLFDTRQFQDCLLKWSGNSQSYHDYIKETWSGNLTGGWNQALHD
FT                   GVFEGTSPVGTTVLEGFASSANEASSLRKMNASAQEESEFELTLYTKVSMGDGNQANNP
FT                   WLQELPDPITRTTWDNYLMISQADADKLELENEIVSNGALNGSYVNISVGDTTVKNVPV
FT                   IVQPGQAKGSVALALGYGKKEGMQKEMQVGVNAYPLYKNFSAFQNVSIEKAAGVHEFAS
FT                   VQMQSTLAGRDDILKETTLSVLTSNSKHEWNAVPEVDYNHQEIPVSDQKADIWRSFDRS
FT                   IGHHFNLSIDLNACTGCGACVIACHSENNVPVVGKDEVRKFRDMHWLRIDRYYSAGDTF
FT                   VEEQEKLNNLGAFETYDVIENPSYDNPQVAFQPVMCQHCNHAPCETVCPVAATSHGRQG
FT                   QNQMIYNRCVGTRYCANNCPYKVRRFNWFNYAQNEEFDYHMNNDLGRMVLNPDVVVRSR
FT                   GVMEKCSMCIQMTQKTILDAKREGRPVKDGEFRTACSAACDTGAIVFGDINDEESKVSK
FT                   LQEDDRTYRMMESLGTRPNVMYQAKITNTAEA"
FT   gene            608951..610768
FT                   /locus_tag="ZPR_0579"
FT   CDS_pept        608951..610768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0579"
FT                   /product="molybdopterin oxidoredutase membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50936"
FT                   /db_xref="GOA:D5BFJ2"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFJ2"
FT                   /protein_id="ADF50936.1"
FT                   /translation="MSSHYEAPIREPLVTGEKTYHDISVEVGAPVLGRANKSWYIVFTI
FT                   ALIAFLWGLGCIIYTVSTGIGVWGLNKTIGWAWDITNFVWWVGIGHAGTLISAVLLLFR
FT                   QKWRMAVNRSAEAMTIFAVVQAGLFPIIHMGRPWLAYWVLPIPNQFGSLWVNFNSPLLW
FT                   DVFAISTYLSVSLVFWWTGLLPDFAMLRDRTTNEFQKKIYGILSFGWSGRVKDWQRFEE
FT                   VSLVLAGLATPLVLSVHTIVSFDFATSVVPGWHSTIFPPYFVAGAIFSGFAMVQTLLII
FT                   MRKVVNLQDYITLLHIEYMNKVILLTGGIVSVAYITEFFIGWYSGTSYENYTYLSFGAA
FT                   TGPYAWAFWALIVCNFVVPLTLWVKKLRRNILWTFIVALVINIGMWFERFDIIVIDLSK
FT                   GRTPSSWAMFSPTFVDIGVFIGTIGFFFVLFLLYARTFPVIAQAEVKTILKSSGEYYKN
FT                   LRAKHGDDVAHHVDNDPTAKEPSANIDDKKDFFGDTSTEKEPGSGHESTVNADALGVTE
FT                   AQEDRLDAMLARIGTYNPKVESADELQKLNGVGPLLEQHLHQVGIYKYDQVANLTKDDY
FT                   KLLDEVIENFPIIENRGDWNAQATELKNK"
FT   gene            610774..611301
FT                   /locus_tag="ZPR_0580"
FT   CDS_pept        610774..611301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50937"
FT                   /db_xref="GOA:D5BFJ3"
FT                   /db_xref="InterPro:IPR021776"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFJ3"
FT                   /protein_id="ADF50937.1"
FT                   /translation="MASKTIHAIYNDDDLLLHAVKQVREARYHIGEVYTPFPVHGLDKA
FT                   VGEAPTRLAITSFLYGITGLSVAVLMMNFMMVQDWPQDIGGKPSFSFLTNMPSFIPIMF
FT                   ELTVFFAAHLMVITFYMRSRLAPFKKAENPDPRTTDDMFLMEIDATNHNVEDLTKFLYD
FT                   TGAAEIKLIDNK"
FT   gene            611307..611981
FT                   /locus_tag="ZPR_0581"
FT   CDS_pept        611307..611981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50938"
FT                   /db_xref="GOA:D5BFJ4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFJ4"
FT                   /protein_id="ADF50938.1"
FT                   /translation="MRSLFHKSLVFVIIAGFLNSCAGDRDRNYQYFPDMYRPVPYEPYG
FT                   AYDIFANQQEAKLPVDGTIPRGWMPYDYEDTPEGRADAKANLKNPLPYTEENLTKGKAL
FT                   YTVYCAVCHGDKGDGQGTLVEREKILGVPSYDDPGRSITEGSVYHAMYYGLNNMGSYAV
FT                   QTSIKERWQIDHYVMSLKDKLEGNPERSFQTNTVTQENSDNLNPAEPAEDLSEKDQTQS
FT                   EE"
FT   gene            612015..613379
FT                   /locus_tag="ZPR_0582"
FT   CDS_pept        612015..613379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0582"
FT                   /product="putative molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50939"
FT                   /db_xref="GOA:D5BFJ5"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFJ5"
FT                   /protein_id="ADF50939.1"
FT                   /translation="MYTLSSKLKLTAIILVIVGAIGLVYGFISTPSNEEELKELLAADA
FT                   HGEHGAEHDEASVTTEEHGMAIDEGHAKASEGHGESAHAEGEHGDSHMEHLLHQFQTKP
FT                   WSAMFVSAFFFFMIALGALVFYAIQYVAQAGWSPVLFRVIEGVTNYLLPGSIIVVLIVI
FT                   FAGTHFYPWQNHELVEEDVILQGKSGYLNFPFFVIRAIIYLIGWNLYRFVARRNSLAQA
FT                   TATTLTPYKKNFKASVFFLLFFVITETTMAWDWFMSMTPHWYSTLFAWYVFASMFVSAI
FT                   TVIALVTMFLKKIGHLKFVNDSHLHDLAKFMFAFSVFWTYLWFGQFLLIWYANIPEEVT
FT                   YFIIRIEEYNLLFFGMLVLNFIFPILMLINSDYKRIPWFVIMAGVVILVGHYIDIFLLI
FT                   MPSTVGPHWSFGITEIAGILFFLGLFIFCVGTGLAKESLYPKGNPFLKESENYHY"
FT   gene            613414..614448
FT                   /locus_tag="ZPR_0583"
FT   CDS_pept        613414..614448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0583"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50940"
FT                   /db_xref="GOA:D5BFJ6"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFJ6"
FT                   /protein_id="ADF50940.1"
FT                   /translation="MTVFLVIIVLALLAVTGWQISKIFELSKSPDADTSQVANNKDNEN
FT                   QGKLMMGFAVFLYLLMFYCFWTFTNVTLPDAASEHGGKYDNLMLISMLLIMFVQIVTQA
FT                   LLHYFAYKYRGAKGKRALFYADNDKLEFIWTIIPVIVLAGLIIYGLFTWNDIMSVNEDE
FT                   DPLVIELYAQQFSWTARYAGEDNTLGKANVRFIEGINALGVDKEDSYGQDDKIVRELHL
FT                   PVNRPVLFKLRSQDVLHSAYFPHFRAQMNVVPGMITQFGFTPTVTTEEMRNSDDMVDKV
FT                   ERINDIRKDNGDDSYEFDYFLLCNKICGQAHYNMQMKVIVESEADYEAWLAEQSTFGES
FT                   MSEE"
FT   gene            614484..616304
FT                   /locus_tag="ZPR_0584"
FT   CDS_pept        614484..616304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0584"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50941"
FT                   /db_xref="GOA:D5BFJ7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFJ7"
FT                   /protein_id="ADF50941.1"
FT                   /translation="MSAVVNAPAHDHHEDHGHHHKQTFISKYIFSFDHKMVAKQFLITG
FT                   LLMGIVGIGMSILFRIQLAWPEQSFAIFEALLGKWAPDGVMTPNIYLALVTIHGTIMVF
FT                   FVLTAGLSGTFSNLLIPLQIGARDMASGFMNMLSYWLFFIACVIMLCSLFVEAGPASSG
FT                   WTIYPPLSALPQAIGGSGMGMTLWLVSMALFIASQLLGGINYIVTVINLRTKGMSMTRL
FT                   PLTIWAFFVTAILGLVSFPVLLSAALLLIMDRSFGTSFFLSDIFLDGEVLSHHGGSPVL
FT                   FEHLFWFLGHPEVYIVILPALGITSEVVATNSRKPIFGYRAMIASILAIGFLSTIVWGH
FT                   HMFVSGMNPFLGSVFTFTTLLIAIPSAVKAFNYITTLWKGNLQMNPGMLFSIGLVSTFI
FT                   TGGLTGIILGDSTLDINVHDTYFVVAHFHLVMGISALYGLFAGVYHWFPKMFGRMMNKN
FT                   LGYIHFWVTAVGAYGVFFPMHFLGMAGLPRRYYTNTYFPYFDDLADINVIVTVCAIVTA
FT                   LVQIVFIYNFFSSMFYGKKATMNPWKSNTLEWTTPVEHIHGNWPGELPVVYRWAYDYSK
FT                   TNADGEYVIKGQDYVPQTVPMQENEEDLHH"
FT   gene            616408..617430
FT                   /locus_tag="ZPR_0585"
FT   CDS_pept        616408..617430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0585"
FT                   /product="Holliday junction DNA helicase B"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50942"
FT                   /db_xref="GOA:D5BFJ8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFJ8"
FT                   /protein_id="ADF50942.1"
FT                   /translation="MNENLDATGENFSPEEFDIERALRPLSFDDFAGQEQVLDNLKVFV
FT                   AAANLRSEALDHTLLHGPPGLGKTTLAHILANELGVGLKITSGPVLDKPGDLAGLLTNL
FT                   DERDILFIDEIHRLSPIVEEYLYSAMEDYRIDIMIESGPNARSVQLNLSPFTLIGATTR
FT                   SGLLTAPMRARFGISSRLQYYSTELLSDIVQRSAQILKVPITMEAAIEIAGRSRGTPRI
FT                   ANALLRRVRDFAQIKGDGKIDIGIAKYGLKALNVDAHGLDEMDNRILETIIDKFKGGPV
FT                   GITTLATAVSESAETIEEVYEPFLIQQGFIYRTPRGREVTEAAYKHLGKSRGPSQGGLF
FT                   "
FT   gene            617459..618793
FT                   /locus_tag="ZPR_0586"
FT   CDS_pept        617459..618793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0586"
FT                   /product="cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50943"
FT                   /db_xref="GOA:D5BFJ9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFJ9"
FT                   /protein_id="ADF50943.1"
FT                   /translation="MILIMKREIPEVSTLTFLKNAARIVKNPLPFHHENFQKHGDIFRL
FT                   NIGPKKSVIFCRDAEFAQYVLQKNQKNYIKSEIQTKDLVKYVGNGLLTSNGEHWQKQRK
FT                   LIQPAFHKKHIANLLDTVLEAIRVEYVKIRAGKTIDIFPVFNDLAFQTVVKSLFSSAAS
FT                   QEEINRLQYVTEENQKMLVKELRQPYKRLWFSLSGKLKYHLKLSEESRLILRNIVHKRK
FT                   QNPKRYDDLLDMLLDARYEDGQPMREEQLIDEILILFVAGHETTSNSLSFTTQLLAQNP
FT                   QIQDKIYSEVKVASEATTSLMEFVQGCPYTQNVILESMRLYPPAYFMDRVNLEEDEFNG
FT                   IKLDKGSDLLFSFYEIHRSEKHWEQPLEFNPDRFTSEKNPMAYFPFGAGPRKCIGSNFA
FT                   MYEMILAVSELILNFKILSVKEDIEILPLITLKPKNAYVEFEKRA"
FT   gene            618793..619722
FT                   /locus_tag="ZPR_0587"
FT   CDS_pept        618793..619722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0587"
FT                   /product="4Fe-4S binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50944"
FT                   /db_xref="GOA:D5BFK0"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFK0"
FT                   /protein_id="ADF50944.1"
FT                   /translation="MIVGNKSKYTNLIKKEAIRLGFMSCGISKAGFLEEEAPRLEEWLN
FT                   KNRNGKMSYMENHFDKRLDPTKLVDGSKSVISLLLNYYPDKVQNPESYKISKYAYGKDY
FT                   HFVIKDKLKSLLQFIQSEIGEVAGRAFVDSAPVLDKAWAAKSGLGWIGKNSNLLSKKAG
FT                   SFFFIAELIVDLELEEDTPVTDHCGTCTACIDACPTNAIVEPYKVDGSKCISYFTIELK
FT                   DELPNSFKNTFEDWMFGCDICQDVCPWNRFSKPHNEPLFDPHPDLLKFDKKDWQEITRE
FT                   TFNEIFRKSAVKRTKFEGLKRNIKFLDS"
FT   gene            619874..622165
FT                   /locus_tag="ZPR_0588"
FT   CDS_pept        619874..622165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0588"
FT                   /product="malic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50945"
FT                   /db_xref="GOA:D5BFK1"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFK1"
FT                   /protein_id="ADF50945.1"
FT                   /translation="MSNNSRKRREALVYHAKPKPGKIQIVPTKKYASQRDLSLAYSPGV
FT                   AEPCLEIEKDKENAYKYTTKGNLVAVISNGTAVLGLGDIGPEASKPVMEGKGLLFKIFA
FT                   DIDVFDIEVDTKNVDAFVETVKNIAPTFGGINLEDIKAPEAFEIERRLKEELDIPVMHD
FT                   DQHGTAIISAAALLNAVELAKKKMSKVKIVVSGAGAAAVSCTKLYKAFGAKAENIVMLD
FT                   SKGVIRKDRPNLSEEKLEFATDRDLNTLDDAMKDADVFIGLSIADIVSPAMLKSMAKRP
FT                   IVFAMANPNPEIDYQLAMDTRKDVIMATGRSDHPNQVNNVLGFPFIFRGALDVRATKIN
FT                   EDMKMAAVKALAELAKEPVPEQVNIAYGETRLNFGSDYIIPKPFDPRLIAKVPPAVAKA
FT                   AMESGVARTEITDWQKYEDELLERMGSDNKITRLLMQRAKNNPKRVIFAEADHLDVLKA
FT                   AQIVYDEGIGTPILLGRREVIKELMGEIDFDADVEIIDPKSDEERGKLQKYAEAYFDSR
FT                   NRKGVTLYDAERLMRERNYFAAMMVNEGDADALLSGYSRAYPTVVKPMLQLIGMAKGIS
FT                   RVAATNVMNTSRGPIFISDTSINIDPSAKDLAKIAQLTAGVVRLFGLEPVMAMLSYANF
FT                   GSSDHPQARKVKDAVSYLHRYHPNLLVDGELQSDFALNKEMLQKKFPFSKLAGKKVNTL
FT                   IYPNLDSANSAYKLIKELNDTDSIGPIMMGMNKPVHILQLGASVEEMVNMAAVAVVDAQ
FT                   EKEKAKKAKK"
FT   gene            622257..622838
FT                   /locus_tag="ZPR_0589"
FT   CDS_pept        622257..622838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0589"
FT                   /product="Holliday junction ATP-dependent DNA helicase
FT                   RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50946"
FT                   /db_xref="GOA:D5BFK2"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFK2"
FT                   /protein_id="ADF50946.1"
FT                   /translation="MIHHLKGKLVEKNPTYVVVDCNGVGYFVHISLNTFSKIKDEEQIA
FT                   IFTHLQVKEDSHTLFGFQEKSEREIFRLLISVSGIGASTARTMLSSLDPTQIRDAIASG
FT                   DVATIQSIKGIGAKTAQRVILDLKDKIVKIFGIDEVFVEQSNTIKEEALSALETLGYAR
FT                   KQADKVLNKLIKEIEDPTVETLIKLALKNL"
FT   gene            622877..630034
FT                   /locus_tag="ZPR_0590"
FT   CDS_pept        622877..630034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50947"
FT                   /db_xref="InterPro:IPR025684"
FT                   /db_xref="InterPro:IPR026377"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFK3"
FT                   /protein_id="ADF50947.1"
FT                   /translation="MRFPSSLVLLLLISFNLSAQEEEEEETQQEQDTTQTFSFGRISMP
FT                   DPGSIQSKYEYDPVLDLYFYKKSLGETNIGLPLVLSPKEYEELVVKEEMQRYFLLKNQA
FT                   LTGRSDDADALQQDLLPDFYVNSDFFQSIFGGTNIDIAPQGSVAMDLGILYTKQDNPAY
FT                   SPRNRSNFTFDFDQRIQLSLLGQVGTRLGITANYDTESTFDFQNQLKLEYTPSEDDIIQ
FT                   KIEVGNVNMPLNNTLIQGAQSLFGFKTQLQFGKTRITGVFSEQNSERRTVNVEGGAAVE
FT                   DYEKFALDYDQDRHFFLAHYFRDNYNEFIADYPFVRSGIQIKRIQVWITNRTNNVQNLT
FT                   DTRNIVAIQDIGESPVEGNIGLDNVPPGFFNQPAGAYPDNENNDFNPVGITGNEQSILT
FT                   PAIRDISTVESGFGNVRVSEGIDYVKLENARQLSPNEYRLNQDLGYITLNQRLSNDEVL
FT                   AVAFQYTVNGQVYQVGEFANDGVNATGDEFQQQQGQTDARVSQNLVVKMLKSTVTNVNE
FT                   PVWDLMMKNIYSLGAYDLDPNDFRLNILYTDPQPLNYIRPAENSSLPLPADVAETPLLR
FT                   VFNLDNLNNNNDPINGGDGFFDFVPGFTIDVQNGLVIFTSVEPFGEYLFEKLDNTPNNN
FT                   QEIYSEPSTWNDNQEKYVFRSLYRTTKTQAEQEDADKNKFQLKGRYKSSNFEGIPIGFN
FT                   VPQGSVTVTAGGRTLQEGVDYVVNYDLGRVQILDEALLASDTPIQVNTESNALFGQQSK
FT                   RFTGINVEHQFNEDLIVAGTFLNLRERPLTQKANYSYEPINNTILGFNFNYTKEVPFLT
FT                   RLVNKLPNVDTDVKSNVSVRGEFAYLIPGAPAVNDFDGKATSYIDDFESAQTSIDISTP
FT                   LSWELSSVPIGFGGELANGDLSVGDRRAKLAWYTIDPVFYSNSRPDGITDSDLSSYAAR
FT                   RVTVDEIFPNVDVIQGQAQVIYTMDVAYYPGERGPYNYNSAAAGGNTLPNPAGNFGGMM
FT                   RGINTTNFEQSNVEYIQFWVMDPFIYQDDPNNVNNDGKIVFNLGNISEDVLKDGRKQYE
FT                   NGLPEDGSDLNTTETAFGKVPTDQSLVYAFSSEGQARLNQDVGYDGLNDAEEAQKFPQF
FT                   GNLPDPSADNYEYFLNAEGGIKERYRNYNGVEGNSPDNSGNNNRGNTTLPTTEDVNRDN
FT                   TMNTINSYFQYEVPFFEGMNSENNEYVSDTKELNVTLKNGQTQRVRWVQFKVPIFEPTD
FT                   AIGGIADYRSIRFMRMFLTDFQNPTLLRFGTMELVRGDYRRYNGNLDEESNLPESSDVL
FT                   FEVTAVNIEENENREPIPYVLPPGVIREELYQNNTNIRQNEQSLAMRVCGLEPQDARAV
FT                   YKNFQVDMRQYKNLEMFLHAEGFQGQADPDDGDMVAFIRIGTDFTDNFYQIEIPLSITA
FT                   AGSVNPSDIWPELNRLNLPLELLQRVKTTVLGDPSYNTTRLNFFDENLEPRNPQDAYEP
FT                   GRLRIGVKGNPSFGNVRLIMLGVKNGTPRAGLQEVCGEVWFNELRLSDLDNEGGWAGVL
FT                   NIDTNLADFATFSATGRKSTVGFGTLDQGPNQRSREDAEQYDFVTNINMGQLLPQKWGL
FT                   KIPVNYSRGEEVITPKYDQEFLDIELDTRLAGITDPQERDRVKKQSQTYTKRESINLIG
FT                   LRKERTGEAKPQPYDIENFAFSGSYNQVDYRDFEIEESLDQNVRTGATYEFNFAPKKLE
FT                   PFKNTAALDSSQYFSIIKDFNLNLLPSNINASANYFRQFTQQQFRSLELSDNDIGIPTL
FT                   YQRNFLFDWEYGINYNLTSALNFSFNASNNRIVRNYIDEDGNANNAIGVFDDYFNVGEP
FT                   NNHYQSIQVNYELPLNKLPVFEFLKASYSYTGDFQWQRGSRIYQNLEGIPNIGNSVQNS
FT                   NTHQITANMDLQKLYTYVGIRKKDNQRATSIAERSMGVPTLQPSGEETQAKPVRNRNTA
FT                   SGNKAVNTLIDVVTAVKRLQVNYRNTQGTFLPGYTRSIGFMGTLKPSAGFTFGMQDEIR
FT                   YEAARRGWLTLYQNFNQQFTTNKNEELNAQASVDLLPDLTIDIIGRKLYSETYSENFKV
FT                   DPQNLQYQALTPYTFGNYNISTVLIKTAFSQSNEQSSATFEQFRANRIEIARRLAVERG
FT                   LDPDNVDESGYPVGLGRTNQAVLLPAFLAAYTGTSVDNVKLGAFRSIPLPNWNIKYTGL
FT                   MRLAFFKRNFRRVSLSHGYQSNYTINQFQTNLDYDAEKPFETNQAGDYKNPTLFSNIVL
FT                   SELFTPLLQVDLETTNNIQFLGRLEKDRQLSLSFDNNILTEISGNQYTLGMGYRLKDMK
FT                   IITALGGRRRVLSSDLNFKADVSYRKNKTIVRYLDLSNNQVIAGQDIWSINFVTDYAIT
FT                   KNLTALFYYEHTFSEYAVSTAFPQTTIRSGITLRYNFGN"
FT   gene            630096..630476
FT                   /locus_tag="ZPR_0591"
FT   CDS_pept        630096..630476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0591"
FT                   /product="glycine cleavage system protein H"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50948"
FT                   /db_xref="GOA:D5BFK4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFK4"
FT                   /protein_id="ADF50948.1"
FT                   /translation="MNIPEDLKYTRDHEWVKIDGDIATVGITDFAQGELGDIVYVEVES
FT                   VDESLNREDVFGTVEAVKTVSDLYLPLTGEIVEFNDSLEDEPEKVNNAPYTDGWMIKIK
FT                   YAEIAELEDLLTAQEYKEIIGG"
FT   gene            630556..630855
FT                   /locus_tag="ZPR_0592"
FT   CDS_pept        630556..630855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0592"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50949"
FT                   /db_xref="GOA:D5BFK5"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFK5"
FT                   /protein_id="ADF50949.1"
FT                   /translation="MGDLSVGDKLLHASAYFVLFLVWKFSFFLKAKNNYTYKATILKIS
FT                   VLCIAFGMLIEVLQGTLTSYRQPDWLDVIANSTGVLIASILFLTLERPLKKVKN"
FT   gene            630918..631640
FT                   /locus_tag="ZPR_0593"
FT   CDS_pept        630918..631640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0593"
FT                   /product="TonB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50950"
FT                   /db_xref="GOA:D5BFK6"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFK6"
FT                   /protein_id="ADF50950.1"
FT                   /translation="MEPKKNPKADLSKRSVLFLQLGLILVLFVTWQAIEWKTYEKSDID
FT                   TGMVQMDQLEDEEIPITEMQNTPPPPPPPPPAPEVIEVVEDEEEVEEDEIESTETSLED
FT                   IVEVEEVVEAPVEEEVADVPFAVIEDVPIFPGCENLKDNEERKACMSEKVMKFVQKEFD
FT                   TDLGSELGLSGITRVIVQFKIDKQGKITDVRARAPHPRLEQEAARVVNKLPKMQPGKQR
FT                   GKPVGVVYSLPITFQIQD"
FT   gene            631753..633870
FT                   /locus_tag="ZPR_0594"
FT   CDS_pept        631753..633870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0594"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50951"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFK7"
FT                   /protein_id="ADF50951.1"
FT                   /translation="MKFFLLPVILLASFLVQAQNAEVYPVFPDCESVKYNSLEDCFKNA
FT                   LVTFITDHFETPPKVISNNYTGEITVVFEVSKEGVFRLMYINAAYDELKGEISRIFSLL
FT                   PVIEPAKYNAQPTSMQFRLPIKIPLKRNDIQELESLPEDIDEAPKEKKSDNFQTNELVR
FT                   ANNEYDAVRSDLFTNPRYESNINIPLSHEYYSRFDAALNQIGTNNHTASKPFLFKDVSK
FT                   YYDLKSDAEKLYQDRKTLVGRKIWNEHMFRFQNEDYWFTFDFALDLQLGKDFNDNSADY
FT                   TYNNTRAAIFQGGLGKHLNFYTVVYENQGRFAGYFNNWAASIRPDGGDPAIIPGRGIAK
FT                   PFGDDAYDYPVAEGYLSYSPSKYFNVQFGHGKNFIGDGYRSLLVSDVTSPYPYFKLNTT
FT                   FWKLKYTNTWMSMRDVRPAVTQDGSYRTKYMANHYLSLNVTKRLNIGLFESVIWENDNN
FT                   RGFDINYLNPVIFYRAIEFSTGARGGNALIGLSGKYKLSNYLNAYTQVIIDEFSSSDIF
FT                   GGEKSWKNKLGYQLGLKYFDAFKVPNLFLQLEYNQVRPYTYSHNTEVLNYGHNNQSLAH
FT                   LWGANFRELIAIARYKKDRWYGMAKVIYGKRGFDYDNDFYSYGGDIYRNYEDRPFDNGV
FT                   KIGQGNTGISFFGQLETGYIINPETNLKLYGSFIYRNMNTDINTRNNFDISTSWLNFGI
FT                   RTDIFNWYYDY"
FT   gene            634025..634861
FT                   /locus_tag="ZPR_0595"
FT   CDS_pept        634025..634861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0595"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50952"
FT                   /db_xref="GOA:D5BFK8"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFK8"
FT                   /protein_id="ADF50952.1"
FT                   /translation="MRLAISVVFSSVAGYFLGAETVDFVVVLLLAIGGYFMVGASNAYN
FT                   QIIEKDLDALMDRTKNRPVPSGRMSVTTAFIIASVFTILGLVVLYIINPKTAMFGAISI
FT                   FLYVSIYTPLKTKTPLSVFVGAFPGAIPFMLGWVAASGEFSIEPGTLFMIQFFWQFPHF
FT                   WAIGWWLYDDYKKGGFFMLPTGKRDKGTAIQIVLYVVWTILVSLIPVFGVTGRLFLTPV
FT                   SGIIILLLGLGMLYYAIRLFKLKTADAAKKLMLASVSYITLLQIVYVLDKFIREWI"
FT   gene            634852..635433
FT                   /locus_tag="ZPR_0596"
FT   CDS_pept        634852..635433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0596"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50953"
FT                   /db_xref="GOA:D5BFK9"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFK9"
FT                   /protein_id="ADF50953.1"
FT                   /translation="MDLTKGSEQERRNRAKKMMLWFAIISMGMMFAGLTSAYVVSKTRP
FT                   DWLTEFELPQSFMWSTIVIFCSSITMFFAKKNIISGNRKNGTAFLLGTLILALLFVLFQ
FT                   FQGFAAIVNEGYYFTGSESTITTSFIYVLVLTHLAHLAAGLIVLLVLIYNHFKQRYYKG
FT                   QTLGLELGATFWHFLDVLWVYLFFFLYFFR"
FT   gene            635470..636462
FT                   /locus_tag="ZPR_0597"
FT   CDS_pept        635470..636462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0597"
FT                   /product="cytochrome o ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50954"
FT                   /db_xref="GOA:D5BFL0"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFL0"
FT                   /protein_id="ADF50954.1"
FT                   /translation="MTSSMDATVVRTGTEGKTWGGGNQPLGASYGKLMMWFFILSDALT
FT                   FTGFLSAYGFSRFKFMDSWPIADEVFNHFPFLHGVDAPMYYVALMTFILIFSSVTMVLA
FT                   VDAGHQMKQGKVTTYMFLTIIGGLIFLGSQAWEWSNFISGEYGALKTKGGNILQFVDGE
FT                   GHRVALKDIAITEGTERTTHTENTGIWFESGSTVSEYTLEGIKQGFAANDDLFIRTLDF
FT                   DEVGAKKILSREESQKWLDNNAIGVVEGANLTENEYGPPLFADFFFFITGFHGFHVFSG
FT                   ILINIIIFFNVILGTYERRGSYEMVEKVGLYWHFVDLVWVFVFTFFYLV"
FT   gene            636482..636847
FT                   /locus_tag="ZPR_0598"
FT   CDS_pept        636482..636847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0598"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50955"
FT                   /db_xref="GOA:D5BFL1"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFL1"
FT                   /protein_id="ADF50955.1"
FT                   /translation="MAHDSTAHHHESNTKRIWQVFAILSVVTIVEVVLGIIRPTFLTNT
FT                   SLVGMHLLNWIFIILTLYKAYYIAWAFMHMEQETKGLRRAVVWSGVFLAIYLIFILLTE
FT                   GDYIYEVYKNGYIAWDF"
FT   gene            636932..637576
FT                   /locus_tag="ZPR_0599"
FT   CDS_pept        636932..637576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0599"
FT                   /product="membrane or secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50956"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFL2"
FT                   /protein_id="ADF50956.1"
FT                   /translation="MKKFFVLTVLFALPIVAYLFFASGKNNFARLPILTEDVSEISGLT
FT                   TYKDEPVFLEDHISVVAFFGEKIEDLKGNTFNLDKKILEKYYAFDDFQFVIILPENAKA
FT                   SAADFIKEFEGITNAQEWKFVFGSPEQIQEVFNSFSSPYQLSEDSYSPYVFIVDKSRNL
FT                   RGRDDDDEGSLYGYDSRDIAELTNKMNDDVKVILAEYRLALKKNNAERKNN"
FT   gene            637595..638335
FT                   /locus_tag="ZPR_0600"
FT   CDS_pept        637595..638335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0600"
FT                   /product="electron transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50957"
FT                   /db_xref="GOA:D5BFL3"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFL3"
FT                   /protein_id="ADF50957.1"
FT                   /translation="MKKKYSYIGLAIIILIFGIIVIPKIVDKMNNGEIVEGDRLNKEGT
FT                   KRPTKESPEVGYLEFNGEKRKAPSFEFIDQHGDTISNEDYLGKVYVVEFFFTTCPTICP
FT                   VMSENLVEVQDELKDYENEFGVASFSIDPEHDTPQVLSEYADQYGITNPNWHLLTGEKE
FT                   KIYQLANAGFQTYAGEDPDVKGGFVHSGMFALIDKEGYIRSRKDNFGNPLIYYRGFVKR
FT                   NASIAEGEEEPQIDMLIEDIKTLL"
FT   gene            638344..638871
FT                   /locus_tag="ZPR_0601"
FT   CDS_pept        638344..638871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0601"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50958"
FT                   /db_xref="GOA:D5BFL4"
FT                   /db_xref="InterPro:IPR007352"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFL4"
FT                   /protein_id="ADF50958.1"
FT                   /translation="MTKTDKIAIPVIIALSVLVPIVVLILMNLPERYNLLGAEAGTFPL
FT                   FHAVLNGSTAVLLLMGFFFMRIKEYKLHRNVMITAFVLSSIFLVSYVISKISNEPVHYE
FT                   GIGLLKYVYFFILISHIALSAIIIPLVLFTMYRGLTGEYAKHAKVARWTFPIWLYVAIT
FT                   GVLVYIFMYPYY"
FT   gene            638967..639122
FT                   /locus_tag="ZPR_0602"
FT   CDS_pept        638967..639122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0602"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50959"
FT                   /db_xref="GOA:D5BFL5"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFL5"
FT                   /protein_id="ADF50959.1"
FT                   /translation="MCRAVLESESSQNAAEGINDGILYLMIFPYLLVGGLGYYIYRSYR
FT                   KKKYEA"
FT   gene            639224..639925
FT                   /locus_tag="ZPR_0603"
FT   CDS_pept        639224..639925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0603"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50960"
FT                   /db_xref="GOA:D5BFL6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFL6"
FT                   /protein_id="ADF50960.1"
FT                   /translation="MITIKDLHKSYKTGNNSLHVLKGINFNVAEGELVSIMGSSGSGKS
FT                   TLLNILGMLDEADTGSYTLDGVAIKNLNEKIAARYRNKFLGFIFQSFNLINYKTALDNV
FT                   ALPLYYQGMKRSERMDRAQAYLEKVGLAQWMDHLPNQLSGGQKQRVAIARALASDPKVL
FT                   LADEPTGALDTKTSYEVMDLIQQINDEGRTILIVTHEHDIAQMTKRIVNLKDGLIIDDT
FT                   QVNQVRALQHV"
FT   gene            639918..641165
FT                   /locus_tag="ZPR_0604"
FT   CDS_pept        639918..641165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0604"
FT                   /product="FtsX family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50961"
FT                   /db_xref="GOA:D5BFL7"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFL7"
FT                   /protein_id="ADF50961.1"
FT                   /translation="MFDLERWQEIFETISKNKLRTFLTGLSVASGIFILVILLGIGEGM
FT                   KHGIEREFQGDAANIIYVFPGVTSKEYKGLNPGRMIQMKNEDYQFTTLENKEDLEYKSS
FT                   VYRIWGGMVSFGKESGSYRVEGVYPDYQFLENSSMLLGRFINYNDVEASGKVVIIGNRV
FT                   KNDLFKDQENILGEYVEISGIKFKVVGVYTDPGGEREETRVFVPITTAQKVFGGGNDIN
FT                   YMSYTLQPEDTYEEALASANAFTNKVETYLKGKHTIAPDDNSAIRVNNMLENTKRFYDL
FT                   MAMIKMFFWGVGICTIIAGVVGVSNIMLIIVKERTREIGVRKALGAEPLSIIGMVLHES
FT                   IFVTSFAGFTGLISGLILLDVVAPMIQTDFIYNPTVNFNVALSTVFILIIAGAVAGFFP
FT                   AYRAAKIKPIVALRDE"
FT   gene            641178..642443
FT                   /locus_tag="ZPR_0605"
FT   CDS_pept        641178..642443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0605"
FT                   /product="FtsX family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50962"
FT                   /db_xref="GOA:D5BFL8"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFL8"
FT                   /protein_id="ADF50962.1"
FT                   /translation="MFSRDRWDEIIEALTANWFRTLLTAFGVLWGIFILVILLAAGKGL
FT                   ENGVKQGFSGMATNSMFMWSQTVSKPYKGLPKGRNYNFKLGDVQAIKQTVTGLEIVSPR
FT                   NQLGGFGGANNVVRGLNSGAYNVYGDYPEIIRQQPMDITSGRFINYSDIKDNRKVAVIG
FT                   EGVRAGLYDINEEALGTYIKINGVSFMVIGTYKKKGSGGGNVEEMQKEIFVPFTAFSQA
FT                   FNMGNVVGWMAITADDDHSITNLKNSVFDVIKSRHSIAPDDDRAVGNFDLYEEYSRING
FT                   LFIALRLVAYFVGTLVLLSGIIGISNIMLIVVKERTNEIGIRRALGASPWNIRGQILLE
FT                   SIFLTIISGMAGIILSTFVIFIINMILDGMDTSEMMFINPSVNIGVVLIALAILVISGL
FT                   LAGLIPAQNAIKIKPVDALRTE"
FT   gene            642477..643595
FT                   /locus_tag="ZPR_0606"
FT   CDS_pept        642477..643595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0606"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50963"
FT                   /db_xref="GOA:D5BFL9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFL9"
FT                   /protein_id="ADF50963.1"
FT                   /translation="MKRTVTIVILAVIFIGFLGSLYYYFQKGQQDPVVYQTEQASVQTI
FT                   TKNTVATGNIVPLEEILIKPNISGIIDEIYVEAGESVAAGDLIARIRVIPNVNSLQSAK
FT                   DAVATAKINLDNQKKIFERQKSLFDKGVISANDYDNAEVAYQRAEQNYKSAEQNFEIVK
FT                   TGTTRGIGSAANTLIRSTVTGMVLDVPVKTGNQVIESNNFNDGTTLATLADVNKMIFEG
FT                   KVDESEVGKIKEGLPLEVTVGAIENKTFDAVLDYIAPKGVEENGAIQFEIKGTLDKADT
FT                   TFIRAGLSANASIILAKAEDVLAIKEALVQFDNDTQQPFVEIETGNQQFERKDVELGVS
FT                   DGINVEIKSGVGKDDKIKVWNQLKPAQNFAAN"
FT   gene            643657..645099
FT                   /locus_tag="ZPR_0607"
FT   CDS_pept        643657..645099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0607"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50964"
FT                   /db_xref="GOA:D5BFM0"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFM0"
FT                   /protein_id="ADF50964.1"
FT                   /translation="MKKFRLFTILLFIGFIANAQEKKWTLQECVEYALEHNISVKQSEL
FT                   DVEAAEIDKLDAIGNLLPGLNGNASNSWNTGLTQNVTTGVLQNQTTRNFSAGVTASITL
FT                   FDGLRNYKQLQRAKMSKLAAQYSLDKMEDDITLSVANSYLQVLFAKQDLEVLKSQNEVT
FT                   LEQLDRTKQLVDAGSLPRGDLLEIQATNADEKQRIIIAQNNIRISLISLAQTLLIKDYE
FT                   NFDIVEDDYDIFGTEILDNSVYDIIERAKEERSEIRIAEANKEIAEQNVEIARGAYLPT
FT                   LGAFVNYNTRETGANRIDYINPPGTTITEIGYVESTGETVVTESQNPAVPISLPPRPFI
FT                   DQLWLNDGISYGFQLSVPIFNGFATRNQVKRSKVNVRRAEYQLEQAELDLEANVYQAYV
FT                   DATGAFEAYEAALVAEESQQQAYEYATERFDVGLTNAFDFSQSKVRYENAQREVIRTKY
FT                   DYIFKLKVLELYFGVPVANLRF"
FT   gene            645179..646459
FT                   /locus_tag="ZPR_0608"
FT   CDS_pept        645179..646459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0608"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50965"
FT                   /db_xref="GOA:D5BFM1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFM1"
FT                   /protein_id="ADF50965.1"
FT                   /translation="MKKKTLFIILGIVVVLAILLVVGKKSGMFGKSGNFKQVEITEIKP
FT                   LDIVETVSATGKIQPEVEVKLSSEVSGEIIELPIIEGQQVEKGDLLVRINPDIYQSSVQ
FT                   RSKASMENARANYTQSQASLKQAKANYERNKTLFEKGVISKAEWDGIVSNYEVAEANKE
FT                   SAYYSMQSAAATVTEAQDNLGRTNIYAPMSGTISKLDAELGERVVGTQQMAGTEILRVA
FT                   NLSNMEVEVDVNENDIVKVEVGDSTVVEVDAYLRKEFKGVVTEISNSADSELTTDQVTN
FT                   FKVKVRILEDSYKDLLEGKPENYSPFRPGMTATVDIITNKKTAVIGVPISAIVVKSDTT
FT                   TVAMGTAPAVNVETDPSKLFECVFVKNGEEAKLRVVKTGIQDDSNIQITEGLKEGETVI
FT                   IGPYNVVTKTLKSGDKVEVAGSTNSEG"
FT   gene            646496..647140
FT                   /locus_tag="ZPR_0609"
FT   CDS_pept        646496..647140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0609"
FT                   /product="M22 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50966"
FT                   /db_xref="GOA:D5BFM2"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFM2"
FT                   /protein_id="ADF50966.1"
FT                   /translation="METATTNCSVALSKDGDVIALKEDNSKGYSHAEKLHVFIDEILKE
FT                   NNFEIDDLDAIAISKGPGSYTGLRIGVSAAKGLCFAKDIPLISVPTLTALAKQVTPNKG
FT                   DQIIPMLDARRMEVYSAVFDSAFNQIRETKAQVLSEDSFQEELAKGKVYFIGNGVAKFR
FT                   EICSQQNAEFIEERLPSAKEMGQIAYDKYKISDIEDVAYFEPYYLKDFVAG"
FT   gene            complement(647154..648044)
FT                   /locus_tag="ZPR_0610"
FT   CDS_pept        complement(647154..648044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0610"
FT                   /product="small-conductance mechanosensitive ion channel
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50967"
FT                   /db_xref="GOA:D5BFM3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFM3"
FT                   /protein_id="ADF50967.1"
FT                   /translation="MDKFNDFSELAQEYAKKLIDFLPDLIAAILILIIGFWIAKRAVKF
FT                   MQKALDKRDYDVALKGFLTTLVSWALKILVIIVAISQVGIETTSLVAILGAAGLAIGLA
FT                   LQGSLANFAGGVLIIVLKPFKVGDWIEAQGVSGSVKSVSLFYTKLDTFGNQEAVIPNGS
FT                   LANDNIINYTVNGVRRENMTFGISYDDDIKKAKEVLMNLIKEQEGIEAEPAPQVLVGEL
FT                   GDNSVNFYVRYFAKNPVFWDIHWFMLEEGKIRLEEAGMTIPYPQRDVYLYDQTKMSGTV
FT                   LKESKKEKDSTDKTE"
FT   gene            complement(648116..650152)
FT                   /locus_tag="ZPR_0611"
FT   CDS_pept        complement(648116..650152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0611"
FT                   /product="six-hairpin glycosidase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50968"
FT                   /db_xref="GOA:D5BFM4"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFM4"
FT                   /protein_id="ADF50968.1"
FT                   /translation="MKSATNDLIYETSPYLLQHAHNPVDWKAWHKTVLEDAKKTNKLLL
FT                   ISVGYSACHWCHVMEHESFEDPEVADIMNAHYISIKVDREERPDIDQVYMQAVQLMTGS
FT                   GGWPMNIVALPDGRPVWGGTYFRKEQWKSALLQIQQIYKKESTQLTNYANKLKEGLQQL
FT                   NLIDIGNNSYEFSQKRLGEFIEIWKPYLDMKLGGTKNAPKFMMPTNLDFLLRYAYQFKD
FT                   KKLQEYVLHSLDKISFGGTFDHIGGGFARYSVDDRWHVPHFEKMLYDNAQLLSLYSKAY
FT                   KLTQDHWYKEVIKKTARFIETELTDSTGAFYSALDADSENAKGNQEEGAFYTWKKEELE
FT                   ELLASEFDLFSAYFNINARGYWENGNYILYKTEKDDDFTKKHNISLEELYQKKSNWTKI
FT                   LSEARKKRKKPGLDDKTLTSWNALSLNGFAEAYTATGKNHYLNIALKNAEFIIQNQLNP
FT                   DYSLFHSYKNKQSKINAYLEDYAFTIEAFLKLYEVTFDKKWIDISSHLTKYCFENFYNQ
FT                   ENTLFNFTSKKDDALISTPIELTDNVIPASNSVMANNLFRLGRLTGTSRYLEVSEKMLQ
FT                   VISGKIGSYPMGHSNWLHLYLNISNPFYELAILGEQIDREQKEIQKKYLPNLIISGSNT
FT                   ESELSILKGRFVKGKTRYYLCEQGKCQLPKEELTHVLNNIALV"
FT   gene            650500..652788
FT                   /locus_tag="ZPR_0612"
FT   CDS_pept        650500..652788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0612"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50969"
FT                   /db_xref="GOA:D5BFM5"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFM5"
FT                   /protein_id="ADF50969.1"
FT                   /translation="MLVENIGFMEDVYIVMLVALLALAITDLVVGVSNDAINFLNSAIG
FT                   SKAVSMRTILIVASIGVAIGAIFSSGLMEVARKGIFLPQQFYFEEIMIIFMAVMITDVL
FT                   LLDFFNSIGLPTSTTVSIVFELLGAAVSIAVIKIYKDGNDLSLLASYINTSKATEIIIG
FT                   ILMAVVIAFIVGLVVQYISRLIFSFQFERKMKYVGSIFGGASLTAILYFILIKGLKSVP
FT                   YLSEDTLTYINENTLIIILIGFVFFSIISQLLMSMFKLNILRVIIVIGTFALALAFAGN
FT                   DLVNFIGVPIAAWQSYNLWETAYQSSGTLPSEMLMSGLSGSVPTPEFLLIIAGGVMVVT
FT                   LWFSSKAKAVVETGVNLARQGDGVERFEPNWLSRSIVRYSVMFSGAVSTVMPKAIKNKI
FT                   DKKFEKPEHHTRSKRLDAPAFDMVRASVNLVVASILISIGTNLKLPLSTTYVTFMVAMG
FT                   SSLADRAWDRESAVYRVAGVLNVIGGWFVTALVAFTAAAIFACIIYYGGTIALAILIIL
FT                   AVVLVVRSGIIHSRKSKEEKKNKRYNRTDIITINEITTETSENISSVIHGINRMYTKTV
FT                   DNLGYHDLGKLKKNNKAIGKLEEEVDELKGNIFYFIKSLDDDSVEASKFYILILDYLQD
FT                   MTQSIAFITRNSYNHVHNNHKNLKFNQIRDLKKVDERMQVLFDDIEYAFNNHEFAKIDQ
FT                   ILKDKQELLDYVSDLIQKQINRIRTSETSPRNTKLYFGLLLETRDLITSTMSLLQLFQE
FT                   FYREAKSTF"
FT   gene            complement(652859..653788)
FT                   /locus_tag="ZPR_0613"
FT   CDS_pept        complement(652859..653788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0613"
FT                   /product="nifU related protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50970"
FT                   /db_xref="GOA:D5BFM6"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFM6"
FT                   /protein_id="ADF50970.1"
FT                   /translation="MENYTINIQHTTQPEIVKFEANKFLTKHENFEFKNIDEAAKSPIA
FT                   QQLFYLPFVKTVYISQNFIAIEKYDIVAWPEVENEVAEQIQNYLNKGGIVIKTDEQQKN
FT                   IPVTVYAESTPNPKVMKFVANRKLVLHAAEFKNIDDAAESPLAQKLFHFPFVKEVFIDE
FT                   NYVSINKYDVASWDEITMELREFIRNFIQEGNSVLNNDAITGAPEGKNGSETSKTAPKP
FT                   QINIDELDDTSQQVVAILEEYIKPAVASDGGNILFDSYNEESRTVKVILQGACSGCPSS
FT                   TMTLKSGIETMLRDMLKGKVDYVEAVNG"
FT   gene            654045..654920
FT                   /locus_tag="ZPR_0614"
FT   CDS_pept        654045..654920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0614"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50971"
FT                   /db_xref="InterPro:IPR019861"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFM7"
FT                   /protein_id="ADF50971.1"
FT                   /translation="MAGASNYNQIRLTARQQWFDVDDAPNLQTLSVNGRLGDKIGVGTI
FT                   FFRDENGYFSKLGAYGTFAYHLMFSRDNVNLNQLSFGLSGGIIQHRLDQSEFNVYDPII
FT                   GNNDTTADFFANMDVGMSYYYMDFYAHVAVKNIISIERDLFYSDAVPNNQRKYLASAGY
FT                   VFDFVPNDWGLEPSFLFQLRELNSQASIDVNIKAYKDFDFGQGWIGVSYRQAFDGVEYN
FT                   RTGEEIQRQNLRYITPFLGLEYKRFMFGYTFSYQMNTIVLSNNGFHQLTLGYNFGESRK
FT                   RYDCRCPAIN"
FT   gene            complement(654917..655708)
FT                   /locus_tag="ZPR_0615"
FT   CDS_pept        complement(654917..655708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0615"
FT                   /product="glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50972"
FT                   /db_xref="GOA:D5BFM8"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFM8"
FT                   /protein_id="ADF50972.1"
FT                   /translation="MNKNSIGIFDSGIGGTSIWREIHELLPFEDTVYLADSFNAPYGIK
FT                   TREEIIELSRKNTIKLLELGAKIIVVACNTATTNAINELRNEFDVSFIGIEPAIKPAAL
FT                   QSRTKNIGILATKGTLSSSLFTKTSDLYTQGLKVIEVEGNGLVELIEAGKIYSTEMDLL
FT                   LDQLLAPLISQPIDYLVLGCSHYPYLIPRLKEKFHPALSIIDSGEAVARQTKAILEKEN
FT                   LLNTDFQQKGTCTFYTNYDPYILKNIIKRDNEDFQVKRLDF"
FT   gene            complement(655778..656290)
FT                   /locus_tag="ZPR_0616"
FT   CDS_pept        complement(655778..656290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0616"
FT                   /product="OmpH family outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50973"
FT                   /db_xref="GOA:D5BFM9"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFM9"
FT                   /protein_id="ADF50973.1"
FT                   /translation="MKQFRTFFIALALTLGATTFVNAQNSKVAHIATQELIESMPAYKD
FT                   AMTQLDKLRNTYDAEIKDMMSEAQKTLQRYEAEAETVTEEENQKRSMELQSAEQRIRER
FT                   SQKASQDLQKKQQDLVRPILEKARNAIQEVARAKGFDYVLDSTTGAGVIMADGYDLMPD
FT                   VKTKLGI"
FT   gene            complement(656325..657050)
FT                   /locus_tag="ZPR_0617"
FT   CDS_pept        complement(656325..657050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0617"
FT                   /product="OmpH family outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50974"
FT                   /db_xref="GOA:D5BFN0"
FT                   /db_xref="InterPro:IPR005632"
FT                   /db_xref="InterPro:IPR024930"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFN0"
FT                   /protein_id="ADF50974.1"
FT                   /translation="MDYILQNIPEYQEASSQLDNRVQEWKNEIDAKRREISEIQTQLEN
FT                   ERALLTKELLEEREEDIKYLQDQLTEYQQKRFGPGGDFILQKKQLIKPIQDQVFTAVQE
FT                   IADRRNFDFIFDRTSEIGMIYAKSNYDMSDQVLRIITRAANREQIETRQDRRELRQAEN
FT                   RTVAQDSVVQARAQASENAKTERELYIEQRRRERDSLRAAKKAEFEARRERILKERKAA
FT                   QDSIQAAREAAKQTKDTIN"
FT   gene            complement(657168..659801)
FT                   /locus_tag="ZPR_0618"
FT   CDS_pept        complement(657168..659801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0618"
FT                   /product="surface antigen D15 family outer membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50975"
FT                   /db_xref="GOA:D5BFN1"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFN1"
FT                   /protein_id="ADF50975.1"
FT                   /translation="MTKRILAFVLVCFTFSIAANAQDLPIGNGKKYTLGEIKVTGSTRY
FT                   NESTVVSFTRLKKGEEIYIPGQRLSNVIKKLWDLDMFSDIEFYITNVKDGVADLELVIT
FT                   DIPKLSEVRIQGIKKKKDKEELIEENKLRTGVNVTENLITNTKNYIENKYKKDGYFNAK
FT                   VAINTVEVKDTTNNNMVNMVVNIDTGDKVKISNIDIIGNKQISDAKLKRAMKNTKQKRF
FT                   YRFWKRSKFNREDYQKDKQNLVNKLKENGFRDARIISDSLITVDENNIALDIKVEEGNK
FT                   YYIGNIDFVGNTVYTDDFLHRALGIKKGDTYNGVLMNERIEDPEDPNATNISTIYRNNG
FT                   YLFSSFNLVETNVYNDTIDFELRITEGKEAYFDEIRVVGNNRTKDHVIYRNLLTKPGQK
FT                   YNQQDVVSTVRELGSLGFFDAEQLSPEFIDPDPQTGTLSLEYNVVEAGASQIELQGGYG
FT                   GGGFIGTLGLSFNNFSIAGIFDKDAYKPVPMGDGQSLSLRAQASTFYQTYSLSFIEPWL
FT                   GGRKPVQLSTSFSYTRQFLYDYRSRKPDRTKSFDILGVSVGFGKRLTEPDPYLQISHAV
FT                   GFQRYDLNNYNTGLFTYGDGFSNNLTYTLGITRDNTRYNPIFPIGGSVFSITAKFTPPY
FT                   SLWNGVDYNDLQNQSEFQLKDDDGNFIDNSGNRVLPENAVGDQSKIDQEKYKWLEFYKV
FT                   KFKGDWYTTLANFGENKNLVLRTNVEYGFLGAYNQDRGIPPFERFYLGGDGLGSYSLDG
FT                   RETIRLRGYPNQSLIPLDRTSLSQASNEDGATIYNKYSLELRFPITLKPSASIYALTFL
FT                   EGGASYDNFRDFNPFQLNRSAGAGLRIFMPAFGLLGIDFGYGFDPIPGQSGANGWETHF
FT                   IIGQQF"
FT   gene            complement(659809..660549)
FT                   /locus_tag="ZPR_0619"
FT   CDS_pept        complement(659809..660549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0619"
FT                   /product="undecaprenyl-pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50976"
FT                   /db_xref="GOA:D5BFN2"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFN2"
FT                   /protein_id="ADF50976.1"
FT                   /translation="MNFKENLNLTKLPSHIAVIMDGNGRWAKKQGFLRAVGHNEGVKSV
FT                   RDIVEGGAQIGIKFLTLYAFSTENWNRPKLEVDTLMKILVSSLKKEIKTLQDNNIKLTA
FT                   IGNIDNLPKKAKRELLDVIEKTKHNAKMTLILALSYGSREEITSAVKALANKVKEGTLE
FT                   PDKINDSLISESLYTKDIPDVDLMIRTSGEQRISNFLLWQMAYAELYFTSILWPDFRKD
FT                   NLYEAIYNYQNRERRFGKTSEQLS"
FT   gene            complement(660553..661227)
FT                   /locus_tag="ZPR_0620"
FT   CDS_pept        complement(660553..661227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50977"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFN3"
FT                   /protein_id="ADF50977.1"
FT                   /translation="MLITSVNLQSQTYEVGAFLGGANYIGDVGNTFYVNPSGLAAGGIL
FT                   KWNRSPRHSFRFSLIMGNIEADDAESNDTRRQQRGYSFSNTITEASLGLEFNFWDFDLH
FT                   KGTSQSAPYLYTGLTYFSADHVILDGSRGAPLVNESTNWEFAIPMVVGYKTTLSQHLVG
FT                   AIEIGARYTFTDNLDGSNPEELLGEPDPILTFGNQNTNDWYVFTGITFTVTFGRKPCYS
FT                   SF"
FT   gene            complement(661352..662236)
FT                   /locus_tag="ZPR_0621"
FT   CDS_pept        complement(661352..662236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0621"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50978"
FT                   /db_xref="GOA:D5BFN4"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFN4"
FT                   /protein_id="ADF50978.1"
FT                   /translation="MKIGIYGQFYHENAGTYINQLLELLQEEKVEVIIERNFLDLINKN
FT                   KSVTGEYSDYKTFDILDASYDLFFTIGGDGTILKSINYIKNLDIPIVGINTGRLGFLST
FT                   IQKEQIGETIHTILKKDFSISPRAVLQIETNPKSDDEVFNNVALNEIAVSRKNTTSMIT
FT                   VDTWLNNQYLTSYWADGLIIATPTGSTGYSLSCGGPVITPDADSIVITPIAPHNLNARP
FT                   LIIKDDTKITLKVSGREDSHLLSMDSRLASLENDTEIIIQKAPYAINLVELNDDSFLQT
FT                   LRKKLLWGEDKRN"
FT   gene            complement(662504..663160)
FT                   /locus_tag="ZPR_0622"
FT   CDS_pept        complement(662504..663160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0622"
FT                   /product="CBS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50979"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFN5"
FT                   /protein_id="ADF50979.1"
FT                   /translation="MDIEEYILNDVAIRHFSDKIGDLQNDFNQLTYSHLPVENNGIYMG
FT                   CISENDIRCFEAEKSIEDYQYALEGFFVRSTDYWLDILESFAQNNSNILPVLDSDNEYL
FT                   GYVELNEIMGIFNETPFLNEAGNIIVVEKGFKDYSLSEISQIIESSNVHLLGLFVSKIE
FT                   NDLAQITIKINPSGINEVIQSLRRYGYNIISQHQEDAFDKNLRDRSKYLDKYLNI"
FT   gene            663321..664070
FT                   /locus_tag="ZPR_0623"
FT   CDS_pept        663321..664070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0623"
FT                   /product="pyridoxal phosphate biosynthetic protein PdxJ"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50980"
FT                   /db_xref="GOA:D5BFN6"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFN6"
FT                   /protein_id="ADF50980.1"
FT                   /translation="MKPDSKGKARNMTKLSVNINKIATLRNARGGNIPNVVQCALDIEK
FT                   FGAEGITVHPRPDERHIRYQDTRDLKPVLKTEFNIEGNPVTKFINLVLEVKPAQVTLVP
FT                   DAEDAITSNAGWNTVKNKEYLIEVISEFKKHGIRTSIFVDADEKMIEGAAATGTDRIEL
FT                   YTESFAEKFADGDKKEAVKPYAKCAELAHQLGLGVNAGHDLSLDNIEFFKNEVPFVDEV
FT                   SIGHALIAEALYLGLEETISRYLKKLQ"
FT   gene            664113..664877
FT                   /locus_tag="ZPR_0624"
FT   CDS_pept        664113..664877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0624"
FT                   /product="alpha/beta superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50981"
FT                   /db_xref="GOA:D5BFN7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFN7"
FT                   /protein_id="ADF50981.1"
FT                   /translation="MKLHTNIIGEGKPFIILHGFLGMGDNWKTLGKMFSEKGYEVHLVD
FT                   QRNHGKSPHSDDFSYEILAEDLKEYIEEHHLEEIVLMGHSMGGKTAMFFAATYPDLLEK
FT                   LIIVDIAPKYYKPHHQDILAGLTLLDKSDVSSRQEAAKIISEYVPDKPTQLFLLKNLDR
FT                   EGKDKYVLKVNLKTLKAKIENIGAALEEGKIYEGKTLFIKGEKSRYIKLPEDEDLLHNH
FT                   FPNAEIEVISDAGHWVHAENQEDFYSTVIRFL"
FT   gene            664999..666249
FT                   /locus_tag="ZPR_0625"
FT   CDS_pept        664999..666249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0625"
FT                   /product="OMPP1/FadL/TodX family outer membrane protein
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50982"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFN8"
FT                   /protein_id="ADF50982.1"
FT                   /translation="MKKLLFLTLFGLATAMTYAGGYRVGLQGQRRLAMGHTGVAVVDNA
FT                   ELAFFNPAGLVYLEDRINVAVGASAVFSDVVWQNDEYGQMARTDSPVGTPFYAYVSYRA
FT                   SDWLTLGLAAYTPYGSSVEWPTDWSGSHLVNNIDLQAIYIQALASVKISDRLSVGGGPI
FT                   YVNGSVNFNRNLNRTLSDIDGNRANVTVDASGVHAWGWSLGAMYNPTDKLRIGANYRSE
FT                   IIVEAENGDADFNNIPNSPLTPFKDTRFDASLPLPAELSIGASYEISEKWLIAFDYNRA
FT                   FWDVYKSLDIDFQDPAIPDSKNPRNYKDANTYRFGAQYIANEMFTLRAGYYFDESPVQS
FT                   GYFAPETPRNDAHGFTAGLSVNITDNLSIDASFLYNRFKEVEESYDYYMENGQNVPFEG
FT                   SYKTVAFVPGLGVTFKI"
FT   gene            666264..667841
FT                   /locus_tag="ZPR_0626"
FT   CDS_pept        666264..667841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0626"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50983"
FT                   /db_xref="GOA:D5BFN9"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFN9"
FT                   /protein_id="ADF50983.1"
FT                   /translation="MKNYRFLAVGLLALGIVSCEPDLDNPIDEEGNVYSNGDANFTHYV
FT                   ALGNSLTAGYADNALYITGQTNSYPNILAGQFALTQETDEFTIPYMNDNAGGLLLSGQQ
FT                   LPGFNNRLVLASDGEGNNSPSVYTGMAATTDITNVLEGPFSNMGVPGAKSYHLGVEGYG
FT                   NVAGVQAGLSNPYFVRFASSPQTSVIADALAQNPTFFSLWIGNNDVLGYATSGGTGVNQ
FT                   TGNLNPATYGSNDITDPQVFAQVYSGLVESLTASGAGGVLINIPDVTSIAFFNTVPNNA
FT                   LQLDAQTAASLTSYFGAVSQVFAGGLMAQGVPQEQAMALAAQYAITFNEGPNRFIIDVP
FT                   VTQANPLGFRQMTADELIQLQVDQSALASGYGSVNLTAEVQQVLGLLMSGGTPTAAQAN
FT                   ILFGGVNGLDDADVLDSTEISEIQTATTAFNQTIAAVANAKGLAMVDANALLNDVANGG
FT                   VAYDAGTVTATYATGGAFSLDGVHLTPRGYAIVANEIIEQINATYGATVPKVNIGQYGT
FT                   ITLSNDVQ"
FT   gene            667972..668274
FT                   /locus_tag="ZPR_0627"
FT   CDS_pept        667972..668274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0627"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50984"
FT                   /db_xref="GOA:D5BFP0"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFP0"
FT                   /protein_id="ADF50984.1"
FT                   /translation="MVGLAKVLPGVTVNSYFTAFIVAIVLALLNIIVKPVLVILTLPVT
FT                   ILTLGLFLLIINAIIIFLADGFVPGFSVDGWFMAIIFSLLFSLFQSILYSLLDKD"
FT   gene            668362..669684
FT                   /locus_tag="ZPR_0628"
FT   CDS_pept        668362..669684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0628"
FT                   /product="trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50985"
FT                   /db_xref="GOA:D5BFP1"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFP1"
FT                   /protein_id="ADF50985.1"
FT                   /translation="MNITRENIDELNAVVKVDIAKDDYAPKVEKILKDYRKNANVPGFR
FT                   KGHVPMGMVKKQYGQAVLVDEVNKLLQENLNKYLTEEKLDVLGNPIPKEQENFDWNKDN
FT                   YTFEFEVGLAPEFEVSLDLEKPVTKYNIVADDTMIDKQIENIQKQYGKLVSKDEVEEGD
FT                   IVAGTFKNEEEGIENETSIELEKIKGKRNLNKFVGAKVGDTIALKTKSLFEDDHDLIQH
FT                   LKIEHDKAHDLDIEVEFTISEINKRELADLDQELFDKLFGEGKVTTVTELKEKIKEDAE
FT                   KQFVQQSDQQLMNDVTEALIEKTEFDLPKEFLQKWIRTVGEKPLTEEEAKEEYQNSEKG
FT                   LRYQLIEGKIVKENDIQVDFEALKAFAKDKIKEQMAQFGQMDPSDKELDDIAARILSNQ
FT                   DEVKRLSEQLVNEKLLNFYKDNMKFDEKEVTYDEFVKEIYE"
FT   gene            669863..670537
FT                   /locus_tag="ZPR_0629"
FT   CDS_pept        669863..670537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0629"
FT                   /product="ATP-dependent Clp protease proteolytic subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50986"
FT                   /db_xref="GOA:D5BFP2"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFP2"
FT                   /protein_id="ADF50986.1"
FT                   /translation="MDYGKEFEKYATKHHGINSNYYDKIVSSMTPVGMTPNIIEERQMN
FT                   AVAMDVFSRLMMDRIIFMGTGINDQVANIIQAQLLFLESTDSSKDIQIYINSPGGSVYA
FT                   GLGIYDTMQFIKPDVATICTGMAASMGAVLLCAGAEGKRSGLPHSRVMIHQPLGGAQGQ
FT                   ASDIEITAREIITLKEELYKIISKHSGQSYEKVYEDSDRDYWMKADRAKEYGMIDEILT
FT                   RD"
FT   gene            670610..671842
FT                   /locus_tag="ZPR_0630"
FT   CDS_pept        670610..671842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0630"
FT                   /product="ATP-dependent protease ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50987"
FT                   /db_xref="GOA:D5BFP3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFP3"
FT                   /protein_id="ADF50987.1"
FT                   /translation="MAKEELECSFCGRKKPETNLLIAGLDAHICDRCIEQAHGIVLEES
FT                   KQGEANELSSELMLSKPKSIKAFLDEYIIGQEATKKVMSVAVYNHYKRLLQPDSDDDIE
FT                   IQKSNIVMVGETGTGKTLMAKTIAKMLNVPLAIVDATVLTEAGYVGEDVEGILTRLLQA
FT                   ADYNVDKAQRGIVFIDEIDKIARKSDNPSITRDVSGEGVQQALLKLLEGTTVNVPPKGG
FT                   RKHPDQKFIEVDTENILFIAGGAFDGIEKNISKRLNMQAVGFSASKSDDNIERTNLLKY
FT                   IIPKDLKDFGLIPEIIGRLPALTYMNPLDQETLRSILTEPKNAIIKQYTKLFEMDEIEF
FT                   TATDEALDFIVEKAVEYKLGARGLRSLCEAILTDAMFDLPESDVTEFTLTREYAEEKLN
FT                   KSTMNALKAAS"
FT   gene            672090..674753
FT                   /locus_tag="ZPR_0631"
FT   CDS_pept        672090..674753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0631"
FT                   /product="pyruvate dehydrogenase subunit E1"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50988"
FT                   /db_xref="GOA:D5BFP4"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFP4"
FT                   /protein_id="ADF50988.1"
FT                   /translation="MAEEKEAAAEIENQEWLDSLRWVLQNESKERVEEILKLLRAEAQK
FT                   HGVKSDLPLTTPYINTISPEDEEQYPGDIEIEEKILAYIRWNAMAMVVRANNKSKGIGG
FT                   HISTYSSIAHLWEVGFNHFFKMDRSAGSDLVYFQGHASPGVYSRGFLEGRFTEEHLENF
FT                   RREVKSDKGLTSYPHPHLMPDFWNFPTVSMGLGPISAIYQARFNKYLEKRGIIEKNDQQ
FT                   IWAYLGDGEMDEPEARGAISVAARDKLDNLTFVVDCNLQRLDGPVRGSGKIIQELEGLF
FT                   QGAGWNVIKLIWGKDWDPIFEKDTDGKLVNLLNEIPDGQLQKYAFSEGAFIREDLFGKD
FT                   KNLAKIVKNLSDDELKRLKRGGHDYQKIYNAYKQATEHKGQPTIILAQTIKGYGQGKAG
FT                   EASNVSHKTKSFKEEELKAFRDFFSLPISDKELKDIPFLKPEEDSEELKYLHEKREKLG
FT                   GFLPQRKDNSEALKEPDKKVFKSFLEGSGDDEAATTMVMIQTLSRLFKDKELGKYIVPI
FT                   IPDESRTFGMESLFRQVGIYAPGGQLYEPVDKESLLFYKESENGAIMEEGITESGCMAE
FT                   FIAAGTAYLNQAKPMIPFYFFYSMFGFQRTGDLMWAAADAGAKGFLIGGISGRTSLPGE
FT                   GLQHQDGNSHLYALAFPTLKAYDPAFAYELATIVEAGIKEMYIDKKHYFYYITLGNATY
FT                   KMPKMPKDSEEGILKGLYKFQKSRKRKTDKKAHLFGSGSIMAEVLEAANILEKEYDVAV
FT                   DIWSITSYKALYDDAIDTERNNRLKTQLNKDKNYIQECLEDEKGIFVAASDYVKALPES
FT                   IAKWFPTNLAVLGTDGFGRSDARPELREFFEVNAAHIVFAALYELANEGKIKAKQLKEA
FT                   AKKFDIDAKKPNPRTS"
FT   gene            674772..676208
FT                   /locus_tag="ZPR_0632"
FT   CDS_pept        674772..676208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0632"
FT                   /product="dihydrolipoyllysine-residue acetyltransferase
FT                   component of pyruvate dehydrogenase complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50989"
FT                   /db_xref="GOA:D5BFP5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFP5"
FT                   /protein_id="ADF50989.1"
FT                   /translation="MAKEIKVPQIGDGVESATVSEVLVAEGDKIEKDQSVIAVESDKAS
FT                   VEVPSSAAGTIKEIKISEGDEVEVGQVIILLEESDDDDDDETEEDNGEASEEEKEKENT
FT                   SEEENENEDEDSGEKQSGKKKKKIKEENPEDNDEEPEEDDADENKDEKKSSKKDESEAD
FT                   KTSEEKENKKSGESSGESSTGAGIQASPGTRRLARELGVDLTELAEEISGRVSEKDVKE
FT                   FAKKDSQKSTRSASISLPDFEKWGSVERKPLNNIRKATAKNVTASWQSVPHVFQFDEAD
FT                   ITDIQQYLEVNQDKAEKAGGKLTITALLTKIVASALVRFPKFNASIDMENEEMILKNYV
FT                   NIGIAVATEKGLLVPVIKDADKKSIIEIATELTNIAEKARDGKLSKEDMEGANFSISNL
FT                   GGIGGTNFTPIVPAFQVAILGISRSAKKPVYIDDEFKPREILPLSLSYDHRLIDGADGA
FT                   AFINWITQALEDPYKALLGA"
FT   gene            676311..677726
FT                   /locus_tag="ZPR_0633"
FT   CDS_pept        676311..677726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0633"
FT                   /product="E3 component of pyruvate dehydrogenase complex"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50990"
FT                   /db_xref="GOA:D5BFP6"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFP6"
FT                   /protein_id="ADF50990.1"
FT                   /translation="MANSKKEKKELVIIGAGPGGYAAAFRAADLGIKTTLIDPEANPGG
FT                   VCLYRGCIPSKALLHVAKVKKEALELANFGVRFGEPEIDVKKIGEWKDEVVKKLTSGLG
FT                   QLSKARKVEFIQGKAFFKDEQTLEIKENSGDSYELEFENVIIATGSTPTELPNIEVDHQ
FT                   LIWNSKDALDIKEIPKKLLVIGGGYIGLELGSVYANLGSEVSVAEMTSGFLPGADRDLV
FT                   KVFEKEHPFKNLYFDTKVEKVNAKKKKVEVVLKSGDKEQKKKFDKVLVAIGRKPNVKAS
FT                   KPQNAGVEIGQDGFIKVFSNRKTSANNIYAIGDITGQPMLAHKASHEGRVAAEVIKGEK
FT                   GSAYDAKVIPAIVFTDPEIAWCGLTEEELKSSNIDAKVVKFPWSASGRAKALGTDNGLT
FT                   KLIVDKESEIILGGGVAGKNAGSLIPEIALAIEMGTTARDLSLTIHPHPTLSETIMESA
FT                   ELFYGSPTHIVDK"
FT   gene            677877..679079
FT                   /locus_tag="ZPR_0634"
FT   CDS_pept        677877..679079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0634"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50991"
FT                   /db_xref="GOA:D5BFP7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR022880"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFP7"
FT                   /protein_id="ADF50991.1"
FT                   /translation="MLHLDLDSFFVSVERKHHSELKNKPVIVGGMGDRGVVASCSYETR
FT                   KFGVRSGMPMKIARRLCPHAVYIKGNASIYTKESHLVTEIIKNQVPLFEKASVDEFYAD
FT                   LTGMDRFFGIERFAKELREGIIKESGLPISVGLSQNKVVSKIATGEVKPDAMSVIRLGE
FT                   EKQFLAPLDVNKIPMIGDKTFQLLMGLGVYKVKTLQEMPVEVLEGVLGKNGRTIWKRAQ
FT                   GIDHTPIIPFHDRKSISNERTFHRDTTDVTRLHATLVAMTESLAFQLRRGNKLTSNISV
FT                   KIRYSDFQTSTLQVKIPYTSADHILIPKAEELFKKLYNRRVLIRLIGVKLSGLVGGHYQ
FT                   INLFDDSEKMLSLYHSLDRIKDKYGERSVVRAVSMGAKTIGRMRNPFDGEPPIVLAHRN
FT                   Q"
FT   gene            679315..682284
FT                   /locus_tag="ZPR_0635"
FT   CDS_pept        679315..682284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0635"
FT                   /product="DNA polymerase III subunit alpha-2"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50992"
FT                   /db_xref="GOA:D5BFP8"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFP8"
FT                   /protein_id="ADF50992.1"
FT                   /translation="MYLNCHSYFSLRYGTFSENELLKLAESNKATYVALTDINNTSACL
FT                   SFLKQAKNFSIKPLVGIDFRNGVEQQYVVIAKNRNGFREMNQHLSSHLHAKMNFDKNAP
FT                   ILEGCYIIYPFIKVLETNKTEFMENEFIGVSVRDLNKLKFSGYKNYTSKLVVLQSVSFR
FT                   SKRDFNAHRLLRAIDNNTLLSKLAVEEQGNPEDKMLSKEEVNEVFKEFPEILSNTKALA
FT                   EGCEVEFTFSKKQNNNLSSIDEAKADELKLRKMCYDNIENRYPEADEEVYARLNKELTA
FT                   IIKLGFVSYFLINHEIVQYARSKDYPVIGRGSGANSIVAYIIGITNVDPIELDLYFERF
FT                   INENRSSPPDFDIDFSWRDREDVTRFIFNRFDHVALMGTYVTFKRRAVIRELGKVFGLP
FT                   KAEIDKLSLGRFERSSLDKMELLVLNYGNLIAGFPNYLSVHSGGILILNDDIFNYGATF
FT                   LPPKNFQTIQIDMNIAEEVGIHKFDILAQRGLSKITDTLELIRQNQPDAFIEDIDNISK
FT                   FKKDPAINNLLKMGDCMGVFYVESPAMRGLLTKLQTDNYMNLVAASSIIRPGISSGGMK
FT                   EEYIKRHRDPKRRDQGHPVMLEIMGDTYGIMVYQEDVMKVAHHFAGLSFDDADVLRRGM
FT                   SGKKTSKGQMEKIEAQFRSNCKERRYTQQITDEVWEQISSFAGYAFPKGHSASYAVESY
FT                   QSLYLKKYFPLEFMVAVLNNGGGFYSVETYIQEIKKCGGNVLAPCINHSDHPNTILGKN
FT                   IYLGFGYIKELEAKTIQQILENRQFFGYYKSLDDFIDRVEISIEQLRILLKVGAFRFTG
FT                   KDKHQLLWEAYFRKIKSKKNSNQPGLFKIQHKEYVLPEFQYSALIDAYDQIELLGFPLC
FT                   NYFELLQDPVYDYTRVDELKNFVGKKVSIYGKLICTKKTTTSGGKEMCFATFYDIDYNI
FT                   FDTVQFPDKVAKYPLYNKGIYRCVGKVINEFNYISIEAEAIEFQKIKVDPRFITTPFKV
FT                   "
FT   gene            complement(682376..682451)
FT                   /locus_tag="ZPR_0637"
FT   tRNA            complement(682376..682451)
FT                   /locus_tag="ZPR_0637"
FT                   /product="tRNA-Phe"
FT   gene            682557..683291
FT                   /locus_tag="ZPR_0638"
FT   CDS_pept        682557..683291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0638"
FT                   /product="pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50993"
FT                   /db_xref="GOA:D5BFP9"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFP9"
FT                   /protein_id="ADF50993.1"
FT                   /translation="MNLVIDLGNTFAKIAVFQNHRVLESFKFLKSEKNKKIEKIFQKYP
FT                   QIEFSILSSVLKDDDSLKKILQKHSVLYYLDHQIKLPFENKYSSPETLGKDRIALAAAA
FT                   VYAYPKQNCLVIDAGTCVTYDVVNSESEYLGGGISPGLQMRFQAVHKFTEKLPLIQSDS
FT                   NHLKLIGNSTKESLRSGIYFGFAAEIDGMISRYYSEFKDLTVILTGGDLLFLSKRLKNS
FT                   IFANSNFLLEGLNYILEYNKTQ"
FT   gene            683288..684529
FT                   /locus_tag="ZPR_0639"
FT   CDS_pept        683288..684529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0639"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50994"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFQ0"
FT                   /protein_id="ADF50994.1"
FT                   /translation="MIKRFIVIVALFSAFWAKAQENTSSPYSYYGVGITNFKGTVENRA
FT                   MGGLSTFSDSIHMNLTNPAGYGKLARTTYVVGASVESTKQETQGAEDRTKNVSLDYLGL
FT                   GVPVGRFGFGVGLIPYSSVGYRIYDIEENGASRLRGRGGMNKVFLSAAYAISRDLSIGV
FT                   NADYNFGNIQHRRTVVREGIQYGTRDIDRSDISGFNFNFGLDYQTKLKNGLKLHASAVY
FT                   TPEADITSESYREIGNVLFTANGENIFNVKTFDMESQDITLPSKATFGLGIGRPNKWFL
FT                   GGEYSAFGSIPEISVFNTPVNDVEYNDGNAYRLGGYIVPEYSSLTSYFKRVVYRFGGRF
FT                   EETGLQLNGESIDEFGISFGLGLPIGGDFSNLNLGLEYGQRGTTNSGLIQENFFKLSIG
FT                   LSLNDQWFVKRKFN"
FT   gene            684547..685908
FT                   /locus_tag="ZPR_0640"
FT   CDS_pept        684547..685908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0640"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50995"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFQ1"
FT                   /protein_id="ADF50995.1"
FT                   /translation="MKARFIVLLSAVMLGSGAFAQDCTTTAALAYDDAKAKNYDAAYEP
FT                   LMKVKEECPDYSLATFQYLAMVLNYKIDKATGDEKAKYIDELIDVYMGRLEHYPEKTKK
FT                   GDIYSDIALLKFDNKVGTTEDRFNAFDKAYTEDKDNFTSPKGLYAYFDLMVNMQDAGDR
FT                   ELQDVFDIYDRVMAKIEEEEINEADRLQPLIEKQDAGEDLTSKEAKTAKIAEQRLTNFN
FT                   AVKNALNAKLGARADCDNLVPLYEKDFEAKKGDVSWLRNANARLSAKDCEDPLFFKISE
FT                   ALHQLEPSAASAYSLGQLAEADGDRSKALEYYNEAAELEEDPADKAKIYYRIAQNYKSS
FT                   GSFSQARSFYKKAIQAKPSYGRAYLNIADMYADSANNCGETAFDKRAVYWLAAEYVAKA
FT                   GRVDPSLSNHANATVAAYNGRAPQKADVFQEGKKAGDAIQIGCWIGETVRIPQL"
FT   gene            685967..686476
FT                   /locus_tag="ZPR_0641"
FT   CDS_pept        685967..686476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50996"
FT                   /db_xref="GOA:D5BFQ2"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFQ2"
FT                   /protein_id="ADF50996.1"
FT                   /translation="MLFSCEGNLNEVRALQNPADAPAGIANGILLKYTDSGRVVATLQS
FT                   EKMFDFTNKDFPFREFPEGVYIEFFDEDDQKSTVTADYGIVYDGTGLVDLRGNVVIFTA
FT                   DSTRLEGDQLYWDQNQSWVFTDRENQIKFPDGSFNEGMGFDSNQNFDKFNFRTNSGIQN
FT                   IEESEK"
FT   gene            686515..686673
FT                   /locus_tag="ZPR_0642"
FT   CDS_pept        686515..686673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0642"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50997"
FT                   /db_xref="GOA:D5BFQ3"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFQ3"
FT                   /protein_id="ADF50997.1"
FT                   /translation="MGGFFIFETFAIWDTERNRAYIFIFLAAMAIFMFFFKRNFRRKLE
FT                   KRQKNKK"
FT   gene            686673..687962
FT                   /locus_tag="ZPR_0643"
FT   CDS_pept        686673..687962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0643"
FT                   /product="cystathionine beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50998"
FT                   /db_xref="GOA:D5BFQ4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFQ4"
FT                   /protein_id="ADF50998.1"
FT                   /translation="MSAEAIIIIFSLLLSAFFSGMEIAYVSSNKIYIEIEKLQNDFLAK
FT                   VLKRLTKKPSKFIAAMLVGNNIALVVYGFYMGDLIMAWLNEIQPLHNAILNYLVTDLSL
FT                   FTQTVLSTLLILVTAEFLPKVFFQIYANTMLKFFAVPAYLFYLLFSFISSFVIWISDMI
FT                   LKRFFKTDGDEVQLAFSKIELGNFISEQMETVEEEDEVDSEIQIFQNALQFSDIKAREV
FT                   MIPRTEIIAVNQDQEPGDLVKTFTETGLSKILIYNDTIDDIIGYVHSFELFKKPASVNS
FT                   ILLPVIFVPETMWVKDVLNVLIKKRKSIAVVIDEYGGTSGMMTIEDIVEELFGEIEDEH
FT                   DSPILVDEKISDEHFKFSARVEVDYINETYRLNIPTGENYETLGGFIVNHTEEIPHQNE
FT                   VVRIDQFEFTILDVSNTKIDLVELKIKSED"
FT   gene            688059..690167
FT                   /locus_tag="ZPR_0644"
FT   CDS_pept        688059..690167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0644"
FT                   /product="PpiC-type secreted peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADF50999"
FT                   /db_xref="GOA:D5BFQ5"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFQ5"
FT                   /protein_id="ADF50999.1"
FT                   /translation="MAVLNKIRQRSVFLILIIALALFSFVLADVIRSGGFSGKDNSIAT
FT                   VNGEEISREEFARQVEAYQQNMRGNISTTQAVNRVWDQELNQIIVEEQVEKLGIRAEQA
FT                   QVRQMMRAQMSQNPQFTNEAGMFDENRVKEYVASLKQTSPQMYQQWLSYEEGLAESAAQ
FT                   NIYANMIRTGVGATLTEGKQAYQLQNNTMDLRYVQIPFSSIPDDEVEVSKSEIKEYVDN
FT                   HKAKFETEAARNIQYVIFNEEPSVEDKEESKNSLSALLEDRVEYNSVSKTNDTIAGFNT
FT                   TSDDQEFVNSNSDLQQPVTFKFKNQLPKEFADDLFNLEKGEVYGPYEENGYWKLSKLVE
FT                   TKEIPDSIKASHILLGFQGAQAGGTRTESAAKQLADSLAGVIKADKSKMAALATEFSDD
FT                   PSAAQNSGDLGYFRPGMMVPTFDDFVLNNNEGTVGVVETDFGYHVIYIEEQTDREKAVK
FT                   IATVAREIDATEGTRNKLFNEVTKFEIAAGEGDFTEEAKAADYRIRTVRDVKALDENIP
FT                   GVGQQRRVVQWAFEDDAKVGDVKRFETPTGYIVAQITAKKNKGLMSPEDASAEVIPILT
FT                   KQKKAEIIKEKISGTTVDQVAENQNKIVQTANAVNLSSPTLAGAGSEPEVVGAVYALGV
FT                   GETSKPIVGDKGVYVVELVSKSEAPELDSYKPFAQQETSSRRQMANSRAFEALKAKAEI
FT                   EDKRAKFY"
FT   gene            complement(690325..691248)
FT                   /locus_tag="ZPR_0645"
FT   CDS_pept        complement(690325..691248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0645"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFQ6"
FT                   /protein_id="ADF51000.1"
FT                   /translation="MRFYSPGKLLITAEYAVLDGAQALCLPTKKGQCLNVEENNLGIIN
FT                   WISKDEHGEVWFQDQFKKDSTGIKSTFHHKNSADDAAISKRCIQILNAAEQLSGQDLFA
FT                   KGFNIQTALEFKRKWGLGTSSTLINNISQWLKINPYILLNKTFGGSGYDIACAQAHSPI
FT                   TYERKNDTQVSLKAGFDPVFSDHIYFVYLNQKQNSREGIAHYRTNAVDDRQILIEKVSN
FT                   ITQQLIKCDQLAEFELLINIHENVISKALNLPKVKTKTFPDYNGSIKSLGAWGGDFIMV
FT                   TGKKDPTPYFKEKGFEVVIPYREMIL"
FT   gene            complement(691245..692561)
FT                   /locus_tag="ZPR_0646"
FT   CDS_pept        complement(691245..692561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0646"
FT                   /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51001"
FT                   /db_xref="GOA:D5BFQ7"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFQ7"
FT                   /protein_id="ADF51001.1"
FT                   /translation="MKEPISGFSKLTKEEKINWLTKTYLNDDPKAVDILKQYWNKNEKL
FT                   QQLHEEFTENTISNYYLPFGIAPNFLINDELFAIPMAIEESSVIAAASKAAKFWRSRGG
FT                   FKTEVIDTVKVGQVHFIYEGSEEKLELFFNHLEPKLRAAAIPITKNMEKRGGGIKSIEL
FT                   RDRTTEIDNYYQLHCSFETVDSMGANFINSCLEKFAEVLEKEVAVWEGFNEKERHIEVV
FT                   MSILSNYVPECVVRAEVCCPLDDLSDEPNLSGEQFAQKFLRAVKIAETEPFRAVTHNKG
FT                   IMNGIDAVVLATGNDFRAIEAGVHAYAAKDGQYSSLTHARVENGIFKFWIEVPLALGTV
FT                   GGLTSLHPLVKLAIEVLGHPNARKLMEIVAVAGLAQNFAAIKSLITTGIQKGHMKMHLM
FT                   NILNQHHATLDEKEKLIEYYKTNIVSHSDVAVQLEKLRQ"
FT   gene            692781..694922
FT                   /locus_tag="ZPR_0647"
FT   CDS_pept        692781..694922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0647"
FT                   /product="dipeptidyl-peptidase IV"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51002"
FT                   /db_xref="GOA:D5BFQ8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFQ8"
FT                   /protein_id="ADF51002.1"
FT                   /translation="MMMAASVATSQKKNITLEEIWSGKFSQQHLQSLQSLNNGVEYVVL
FT                   DHDPDSGNSSVDVYSYKTGKKTRTLVDTKNLEGLKSFQNFSLSQDESKMLLATDPQPIY
FT                   RRSSKSIFYIFDINSKKLTKLSDKKIQEPTFSPDNSKIAYVFNNNIYVYDVVENSEKQI
FT                   TKDGKINSIINGVTDWVYEEELGFVKAFEWNNKGDRIAFLRFDESKVPEFSMDIFGSDL
FT                   YPDQQVFKYPKAGEANSDVSLHMYDVATEATQEIDLGDYSDFYIPRIKWTNKDYILSAQ
FT                   VLNRHQDQLDLIFVNAEDHSTKVVLTEKDEAYVDVTDNLTFLEDNSFIWTSERDGYNHI
FT                   YLYAENGKLKNQVTKGNWEVTNYYGYDKESNRLFYQSTENGSVNRDVYSIKTNGKGKKR
FT                   LTEKTGTNNADFSTDFTYFINAFTNVETPMEYTLHLAKNGKLVREIKNNDELLEVEKPY
FT                   HFSPKELSTLPVNGNELNMWIIKPSDFDESKKYPLLMFQYSGPGSQSVSNSYFNTNDYW
FT                   YQLLANQGYIIACVDGRGTGFKGAEFKKVTQNELGKYELEDQIAAAKKLGELDYIDADR
FT                   IGIWGWSFGGFMASNAILKGNDIFTMAIAVAPVTSWRFYDTIYTERFMTTPQENASGYD
FT                   ENSPINHVDKLKGDFLIVHGGGDDNVHLQNTMRMVEALIQANKQFDWAIYPDKNHGIFG
FT                   GNTRLHLYTKMTNFIKEHL"
FT   gene            694947..696323
FT                   /locus_tag="ZPR_0648"
FT   CDS_pept        694947..696323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0648"
FT                   /product="POT family amino acid/peptide transporter"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51003"
FT                   /db_xref="GOA:D5BFQ9"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFQ9"
FT                   /protein_id="ADF51003.1"
FT                   /translation="MANTAPPVNQKEIFGHPAGLYILFFTELWERFSYYGMRALFTLYL
FT                   VAETTSDNPGFGWTNTEALELYGWYTMLVYVSSIPGGWVADKLLGQKKTVLIGGILLCI
FT                   GHGILSFESETSFYIGCLFIILGVGGLKPNISSMVGGLYKQGDERRDLGFYIFYMGINI
FT                   GGFLAPIACGFLAEYYGWHWGFGLAAIGMLLGQVVYMLGQKHLSHVGNLISRKNETDRA
FT                   ILDKPLTSIEKDRVKVLLISFLLIILFWAAFEQAGGLMNLYASEKVDRNLLGIEIPASV
FT                   FQSVNSFFIITLATLVGSFWYKWKKKGKESSSIFKMAIGLIIMALGFGFMSAASIQYQE
FT                   TGSSGMYWLILAYLFHTIGELCASPVSLSFITKLAPLKYASIIMGMYWAATGLGNKVAG
FT                   LIGQFAQDLGEFEIFTGILVIWTIIGLLVIAMLKPLKRLTHGAEDAKMEEGIPQETTIE
FT                   "
FT   gene            696427..696954
FT                   /locus_tag="ZPR_0649"
FT   CDS_pept        696427..696954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0649"
FT                   /product="thioredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0649"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51004"
FT                   /db_xref="GOA:D5BFR0"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFR0"
FT                   /protein_id="ADF51004.1"
FT                   /translation="MIVGAGVQAQEAESKINWMTMNEALEAQKETPKNIIMDAYTDWCG
FT                   PCKMLDKNTFGHPKVAEFINENYYPVKFNAEGQEEIKYKDEVFANPQYKAELKGKRNSP
FT                   HEFARALQISGYPSIVFFDEKGELIAPLTGYRTPAQIEIFLKIFAKDEYKKLTTEKAWN
FT                   EYNENFEPTFSK"
FT   gene            complement(696987..698996)
FT                   /locus_tag="ZPR_0650"
FT   CDS_pept        complement(696987..698996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0650"
FT                   /product="competence protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51005"
FT                   /db_xref="GOA:D5BFR1"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFR1"
FT                   /protein_id="ADF51005.1"
FT                   /translation="MGFINTKILKFSIAFLCGILAVHFFEIPLVLIFISSGIIFPIFIF
FT                   FFFRAHIQLYQQAYFGISCYLILFLLGSISYELKSPENRSQYFSNLVQSNEDFLQLKLT
FT                   EVLKPNFQKRFIAEVHRVTLSQDSTKSMPTSGKILVGIPLKSNLEVGQKITVPAQITNI
FT                   SPALNPHQFNYAEYMKFQGVFYQIQLSEHQILIHQNPAPPLRTKLRVSLLQALQDTGFK
FT                   KDELAVIKALILGERNDISDELYQSYAAAGAIHILAVSGLHVGIILLLINFLLKPLQQS
FT                   KWLKLTITVIGIWSFAVLTGFSASVVRASLMFSFVAFGLQINRKINLLNTVFSAFFILI
FT                   IINPLYIFQVGFQLSFAAVFSIALFLPRFHKLWYPKQRIVRFFYQIITVSLCAQIGVLP
FT                   LSLFYFHQFPGLFLLTNIVILPVLGVLLVSGISILILGILGIRPEILIDFYSFLVEKLN
FT                   EFIKWVASQENFIINDIHLSAFSVLFLFGVIISLFFLLRQKQKKHVFLVLTAIIVFQIS
FT                   LLTDQYQHTSHEIFILNKSRNSIIAEKKGKRLNLYSNHLKDSSWSYIDDFKIAEKISNI
FT                   RFKELDNFYELKHKRILVIDSAGLFNFPEFKPDIVLLSNSPKINLERAIKILKPGIIIA
FT                   DASNYHNFIKLWKQTCIHKKVPFYQTGKKGAFNY"
FT   gene            complement(699273..699503)
FT                   /locus_tag="ZPR_0651"
FT   CDS_pept        complement(699273..699503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0651"
FT                   /product="NlpC/P60 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51006"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFR2"
FT                   /protein_id="ADF51006.1"
FT                   /translation="MSLQGERLYLKDVTVGDLLFFETDKNRKVINHVGLVVDISQGDIL
FT                   FIHSTTSQGVIISKLSENYWNNTFVMARRII"
FT   gene            699705..699908
FT                   /locus_tag="ZPR_0652"
FT   CDS_pept        699705..699908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0652"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0652"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51007"
FT                   /db_xref="GOA:D5BFR3"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFR3"
FT                   /protein_id="ADF51007.1"
FT                   /translation="MFCFLVVFSVLVVIILGLEAPQELKNIAVKIIMPSLRLCFIIILL
FT                   SIFFISLKIDIVLFLGIYFIEL"
FT   gene            complement(699890..701002)
FT                   /locus_tag="ZPR_0653"
FT   CDS_pept        complement(699890..701002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0653"
FT                   /product="lipid-A-disaccharide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51008"
FT                   /db_xref="GOA:D5BFR4"
FT                   /db_xref="InterPro:IPR003835"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFR4"
FT                   /protein_id="ADF51008.1"
FT                   /translation="MKYYIIAGEASGDLHASNLMRSLKKIDPTAEFRFWGGDLMQAQGG
FT                   TMVKNYRELAFMGFAEVLMNLRTILGNISFCKKDITAYKPDALIFIDYPGFNLRIAKWA
FT                   KAEGYDTHFYISPQIWAWKENRIKAIKRDIDHMYVILPFEKDFYENKHHYPVNFVGHPL
FT                   IDAISNRKNTDIAKFKAENNLDERPIIALLPGSRKQEISKMLEVMLSITQDYKDYQFVI
FT                   AGAPSQEKEFYSPYLKKNNINLVMNKTYDILSCAHAALVTSGTATLETALFKVPEVVCY
FT                   KGSYISYHIAKRIINLDYISLVNLIMDREVVKELIQGEFNSDSLKIELNKILEPKNRER
FT                   IFKDYYELEQKLGGTGASLETAKLIYNSIK"
FT   gene            complement(701172..701459)
FT                   /locus_tag="ZPR_0654"
FT   CDS_pept        complement(701172..701459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0654"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51009"
FT                   /db_xref="GOA:D5BFR5"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFR5"
FT                   /protein_id="ADF51009.1"
FT                   /translation="MSKSNIAIGFLIGISTTIGGVFLFTIFFSDYSFEVSLRDSIHNDY
FT                   FGKLIAIGAILNFLPFFVFMRKKQIYHARGILLACLVVAIAIAVVKIRNF"
FT   gene            complement(701452..702234)
FT                   /locus_tag="ZPR_0655"
FT   CDS_pept        complement(701452..702234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0655"
FT                   /product="stationary phase survival protein SurE"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0655"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51010"
FT                   /db_xref="GOA:D5BFR6"
FT                   /db_xref="InterPro:IPR002828"
FT                   /db_xref="InterPro:IPR030048"
FT                   /db_xref="InterPro:IPR036523"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFR6"
FT                   /protein_id="ADF51010.1"
FT                   /translation="MSKEKPLILVTNDDGITAPGIRSLLQVMKEIGDVVVVAPDSPQSG
FT                   MGHAITISDTLFCDSVTLKENYNHKEYSCSGTPADCVKIATQEILHRKPDLCVSGINHG
FT                   SNSSINVIYSGTMSAAVEAGVEGIPAIGFSLLDYSLNADFEPCKKYVKAITKNVLKNGL
FT                   PKGVVLNVNFPKLPAEKIKGIKVCRQANAHWEEEFDKRTNPQGRDYYWLSGKFVNNDEG
FT                   QDTDEWALQNGYVSLVPVQFDLTAHHFINQLNDWKLDE"
FT   gene            702324..704522
FT                   /locus_tag="ZPR_0656"
FT   CDS_pept        702324..704522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0656"
FT                   /product="tail-specific protease"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0656"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51011"
FT                   /db_xref="GOA:D5BFR7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR020992"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040573"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFR7"
FT                   /protein_id="ADF51011.1"
FT                   /translation="MAQFLMYFVQNLMTKSMRYMKRNLKILILAVLMAATSCSFTTKKF
FT                   DDPNKDKLLIDLITYVLSQGHYDAKEINDDFSEKVYKHYIASLDPSKRFFYKEDIEEFE
FT                   KYKLLIDDEINNKELNFFDLTYSKLEKRNEEAKRLYTEILAEPFDFSKEEDFVADGDDL
FT                   DYVTSKSELKERWRKQLKFSTLINYYDLKEDEKNKKENDPDYTMKSDEELEKKARETTR
FT                   NSLSEYFDLTDDLERKDYFSVFINAVVEEFDPHTYYFAPRDKDRFDIQMSGKIEGIGAR
FT                   LQKKNDDITIMDVISGGPAWKSEELDAGDVILKVKQENENEPVNISGMRLDDAVDLIKG
FT                   PKGSKVTLTVRKKLLGNIEQVTLTRDLVELEETYAKTAMVDKDGKHYGIINLPKFYFDM
FT                   EDYNSRNAASDMRKDIIELKEQGMDGLVVDLRNNGGGSLKTVVDIAGLFIEKGPIVQVK
FT                   SNGERKEVLNDEDSEIVWDGPLVILVNELSASASEILAAAMQDYKRAVIIGSKQTYGKG
FT                   TVQNVVDLNRWLRNNDYGDMGALKITTQKFYRVNGGSTQLEGVKSDVVVPDRYSYVDIG
FT                   EKDQENPLPWDKIDPADYNIWDGYVGYEEAIEKSKQRMAKSEQIKLIEQNAQWIKEQSE
FT                   DDTYSLNFDRYAADAEKNREVAKQYDALKDYKTNLSFTSLPYEKQLFKADSTLQEKRER
FT                   WHKDLSRDVYVEEAINVLSDIKRNNIKHKVADSDKLKD"
FT   gene            complement(705220..706470)
FT                   /locus_tag="ZPR_0657"
FT   CDS_pept        complement(705220..706470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0657"
FT                   /product="rod shape-determining protein MrdB"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0657"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51012"
FT                   /db_xref="GOA:D5BFR8"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFR8"
FT                   /protein_id="ADF51012.1"
FT                   /translation="MARKTAGFDWLTILIYFLLVCFGWANIYSASLGSGPAGSYFDLDE
FT                   VYGKQALWIGLSIFLIVIILAIEVKFYQRFSSVIYITALVLLAGLFVFGKTISGATSWY
FT                   AIGSFRLQPSEFAKIATALALAKYVSDIQTNIKLFSHQFKAFIIIALPALLIVPQPDPG
FT                   SAMVYAAFFFPLYREGISALYLVLALSGVLIFVGTLLIGPIWVTAAVITLASLSFLLKK
FT                   KKRPGIPLLLFIVATCIGLSFSVNYIFNNIFEQRHRDRFNIVLGKEVDSRGIGYNTNQS
FT                   EIAIGSGGWTGKGWTEGTQTKGHFVPEQHTDYIFSTVGEEWGFVGSGLVVLLFIGLLLR
FT                   LIFLAERQKSQFNRIYGYSVVGIIFLHFMVNIGMVIGIFPTVGIPLPFFSYGGSGLWGF
FT                   TILLFIFIRLDSDRLSF"
FT   gene            complement(706445..708340)
FT                   /locus_tag="ZPR_0658"
FT   CDS_pept        complement(706445..708340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0658"
FT                   /product="penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0658"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51013"
FT                   /db_xref="GOA:D5BFR9"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFR9"
FT                   /protein_id="ADF51013.1"
FT                   /translation="MRRILLYIIILTTGFIFLGRLFYLQIVDDSFAVRSNDNAVKVIYD
FT                   YPQRGYIYDRDGELMVSNQPSYDVMVIPRNLKPFDTTELCEIVSIERKELERRLDKAKI
FT                   YSPFLPSVIVPQLTKSEYAFLQEKMRNYEGFYIQKRSLRDYHVDHSANVLGFIAEVSPA
FT                   TIKNNPYYTSGDLIGRKGVESVYEDTLRGIKGVKYIQKDKLNRDIGPYKDGIYDTLPER
FT                   GKDITISVDSDLQAYGEYLMTNKRGGIIAIEPSSGEILSMVTAPTYDPADLVGRKRSPN
FT                   FSKMWLDSTARPLYDRSILAQYPPGSPFKTMNALIALQEGVVDTDDTFSCHNGYSYGRG
FT                   RKMGCHSHASPLAMTQGIAQSCNSYFAQVYRKIIEKYPTPQEGMDAWNKHVSSFGLGDY
FT                   LGNDLSTGRPGKIPTAEYYNKIYDYPTYRWYATATLSNAIGQGEVLLTPIQLANMTATI
FT                   ANRGWYYTPHMIKEIDGKPIKDKRFIKKHHTTIDPENFEPVVEGMHQVYKNGTASSLQI
FT                   EGIEIAGKTGTAENFVRVNGKRMQLTDHSIFVAFAPVDNPKIAIAVFVENGYWGGRYGG
FT                   KIASLMIEKYLKGKITRTDLEDFIMDPKNSLEDEYEKPYSGEPFLINDGKKNGWL"
FT   gene            complement(708337..708843)
FT                   /locus_tag="ZPR_0659"
FT   CDS_pept        complement(708337..708843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0659"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51014"
FT                   /db_xref="GOA:D5BFS0"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFS0"
FT                   /protein_id="ADF51014.1"
FT                   /translation="MNSNLISNILRFIGLILIQVLVLNNINFMGYVNPYLYILFLLLYP
FT                   FNTNQSLFLLLAFLLGLSVDIFEDSGGIHAAACLVAAFVRPNLLRFSFGISYDHQTLRL
FT                   AATPLGARISYVVLMVAIHHLVLFSLEMFSFSHIILVLKKTLFSGIFTVIVILLSIALF
FT                   SKKYR"
FT   gene            complement(708836..709660)
FT                   /locus_tag="ZPR_0660"
FT   CDS_pept        complement(708836..709660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0660"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0660"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51015"
FT                   /db_xref="GOA:D5BFS1"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFS1"
FT                   /protein_id="ADF51015.1"
FT                   /translation="MQQIFNFLIRNKNNILFLALLAFSIFLTIQTHSFHKSKFISSANW
FT                   VTGGIYSWNNNIQDYFYLDEYNQRLVEENKNLRNIIRQLSGKDTIPNYTDTTFTSDYTF
FT                   RSADVINNNFSKRDNYITLDKGENEGIAAENGVVTSKGIIGIIDRTNTNYSRAISILNS
FT                   QSKINAQLKKSNHFGSLTWNGKDPNLMQLTDVPKQAPVAKGDTIITGGKSLIFPKGLLI
FT                   GTIQDFKLDNTESYFTINVKLFNDMTNIGYVYVIENKNKEEILSLEKEEEDE"
FT   gene            complement(709676..710704)
FT                   /locus_tag="ZPR_0661"
FT   CDS_pept        complement(709676..710704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0661"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0661"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51016"
FT                   /db_xref="GOA:D5BFS2"
FT                   /db_xref="InterPro:IPR004000"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFS2"
FT                   /protein_id="ADF51016.1"
FT                   /translation="MGFFDFLIEEIAIDLGTANTLIIHNDKVVVDSPSIVARDRTSGKI
FT                   TAVGKEAAMMQGKTHENIKTIRPLKDGVIADFDASEKMLTMFIKEIPALKRKMFTPALR
FT                   MVICIPSGITEVEMRAVKESAERVNGKEVYLIHEPMAAAIGIGVDIMQPKGNMIVDIGG
FT                   GTTEIAVIALGGIVCDKSIKIAGDVFTNDIVYYMRTQHNLYVGERTAEKIKIQIGAATE
FT                   DLEVPPDEMSVQGRDLLTGKPKQVNISYREIAKALDKSILRIEDAVMETLSQTPPELAA
FT                   DIYNTGIYLAGGGSMLRGLDKRLSTKTDLPVYIAEDPLRAVVRGTGITLKTLNRYKGIL
FT                   IK"
FT   gene            complement(710744..712276)
FT                   /locus_tag="ZPR_0662"
FT   CDS_pept        complement(710744..712276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0662"
FT                   /product="bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0662"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51017"
FT                   /db_xref="GOA:D5BFS3"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFS3"
FT                   /protein_id="ADF51017.1"
FT                   /translation="MSNLKQAKSALISVFSKDGLAPIVKKLNELGITIYSTGGTEQFIK
FT                   DLGIDVVPVEDVTSYPSILGGRVKTLHPKVFGGILNRQDNDSDVQEIAQYEIPQIDIVI
FT                   VDLYPFEKTVASGASEQDIIEKIDIGGISLIRAAAKNFKDVLCVSSVNDYAEFLNILNE
FT                   GNGETSLAQRKNFAAKSFNISSHYDTAIFNYFNTSEEIPAFKQSIQEGKTLRYGENPHQ
FT                   KGTFFGDFDAMFDKLHGKELSYNNLLDVDAAVNLMNEFKGEAPTFAILKHNNACGLAQR
FT                   ETIKQAYVDALAGDPVSAFGGILIANTEIDKATAEEIHSLFCEVVIAPSFSDEALEILK
FT                   GKKNRIILIQKETELPENQVRTCLNGVLVQGKDNKTDVLDDLSYATTNKPTEQEIEDLL
FT                   FASKICKHTKSNTIVLAKNKQLCSSGTGQTSRVDALRQSIEKAGSFKFDLKGAVMASDA
FT                   FFPFPDCVEIAGNAGITAVIQPGGSIKDQLSIDYCNDHDIAMVMTGTRHFKH"
FT   gene            712423..713676
FT                   /locus_tag="ZPR_0663"
FT   CDS_pept        712423..713676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0663"
FT                   /product="ABC transporter efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0663"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51018"
FT                   /db_xref="GOA:D5BFS4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFS4"
FT                   /protein_id="ADF51018.1"
FT                   /translation="MLIFLRVLGESFNFAINALKNNLLRTFLSLLGVTIGIFSIIGVLA
FT                   AVDSLKNEISGSLSSLDNSTTIVMRFNFGPTDIPRWKWQQFPDVTYDEYQFLKRNLPDA
FT                   KAVTFTQNVPAETIKYQDASSLGVSVQAVGSEYYDIEAINIEEGRFFNESEAASGSPVI
FT                   VMGSEIAENLFGSIDPLGKQVRMYGSKFTVIGLLKKEGSSMFGPSKDGQVFIPVNVTRR
FT                   IYGENNRNIFPQILLKPEADVDNAEFLAVLEQRLRSFRGIKPGEVSTFFVNQLKGFTDM
FT                   IDNITGTLNMIGLVISGFSLLVGGFGIANIMFVSVKERTNLIGIQKSLGAKNKFILFQF
FT                   LFEAIILAIIGGAAGLFFVWIATIIASNFTGDFDFILSFGNIILGTTVSALIGLISGII
FT                   PAISASRLDPVEAIRTGM"
FT   gene            complement(713936..714394)
FT                   /locus_tag="ZPR_0664"
FT   CDS_pept        complement(713936..714394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0664"
FT                   /product="GAF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0664"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51019"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFS5"
FT                   /protein_id="ADF51019.1"
FT                   /translation="MPFDKLRPQVEDILNTKELSVDHRLTQVCELLMETIPYYDWVGFY
FT                   FKNGDKEELKLRSFAGEPTDHDIIPFGKGICGQVAISNENFVVPDVKAQNNYIACSIHV
FT                   KAEIVVPLFVNGENIGQIDIDSHTPDPFSKEDERFLEFVNEKVAEILE"
FT   gene            714477..715037
FT                   /locus_tag="ZPR_0665"
FT   CDS_pept        714477..715037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0665"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51020"
FT                   /db_xref="GOA:D5BFS6"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026323"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFS6"
FT                   /protein_id="ADF51020.1"
FT                   /translation="MFQLFKKYSVVIRFVAVFLGSYFLLSVLYNAYLIFSETRTKFYPD
FT                   FFTNIVSRQSAAIMEFLGYSIKLQAHQTQNAVQVFIEDTLLVRVVEGCNSISVIILFTS
FT                   FILSFFAKKRTTFFYILAGSVFIYAMNLIRIALLTIAIYKYPEYTSLMHDIVFPLIIYG
FT                   TVIILWVFWVRVYANLEKNESQV"
FT   gene            715021..715473
FT                   /locus_tag="ZPR_0666"
FT   CDS_pept        715021..715473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0666"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51021"
FT                   /db_xref="GOA:D5BFS7"
FT                   /db_xref="InterPro:IPR026414"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFS7"
FT                   /protein_id="ADF51021.1"
FT                   /translation="MKARYRIVFIGMLVIVLAVIRFYESSLFYDPLINFFKSSDYLNDK
FT                   IPAFKAGLLILNTIFRYILNSIISIGIIAIAFIDRNIVKFSAVLFFILLILAGSVFTYL
FT                   IFTIENEHFLALFYVRRFLIHPIFILVLLPAFYYYRINNQNIKNRN"
FT   gene            715680..716093
FT                   /locus_tag="ZPR_0667"
FT   CDS_pept        715680..716093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0667"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51022"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFS8"
FT                   /protein_id="ADF51022.1"
FT                   /translation="MKKVFCKIVASILAVLVLFSTLSFTVDQHFCGSFLVDSAVFTKAK
FT                   TCGMEMSSADSTEASITKESCCTNKKLEVKGQDELKQNFNTLDFQQQVFITGLVYAYLK
FT                   LFEVSEPDFIPFKDYSPPKLVCNIQLQDQVFLI"
FT   gene            716199..719930
FT                   /locus_tag="ZPR_0668"
FT   CDS_pept        716199..719930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0668"
FT                   /product="putative copper/silver resistance-related
FT                   transport membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0668"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51023"
FT                   /db_xref="GOA:D5BFS9"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFS9"
FT                   /protein_id="ADF51023.1"
FT                   /translation="MLNKSIKFLIENKLVAVILLLVLVGWGVVNAPFNWEKARIARGIP
FT                   RNPVAVDAIPDIGENQQIVFTKWEGRSPQDIEDQITYPLTTSLLGIPGVKTIRSASMFG
FT                   FSSIYIIFEEEVEFYWSRSRILEKLNSLPAGLLPEGVNPSLGPDATALGQIYWYTLEGR
FT                   DKEGNVTGGWDLQELRSIQDFYVKYALSSAGGVSEVASIGGYVQEYQIDVNPEKMRQYK
FT                   VSLQDVVKGVKESNREIGAQTLEINQAEYLVRGLGYVKSIDDIENAVVASKDFSALKVS
FT                   DVANVSIGPAARRGILDKEGAEVVGGVVVARNGANPMEVIQNVKDKIASISGGLPSKEL
FT                   TDGTTSQLTIVPFYDRSELIQETLGTLNEALSLEILITIFVIVIMVFNLRASILISGLL
FT                   PVAVLMVFIAMKIFNVDANIVALSGIAIAIGTMVDVGVILSENIIRHLEENEAELPTNT
FT                   VVYNATTEVSGAIITAVLTTIISFIPVFTMVGAEGKLFRPLAFTKTMALTASIIVALFL
FT                   IPPFAASIFKKRETRKNFNLAIQALLILAGIVMIFYGFWIGLILIGLGIAGILKAQNIT
FT                   SEKQHNWLVVGVIATAIVFMLAVFWRPLGLDTSIFWNVIMVAIICFGLLFVFNLFKNSY
FT                   TRILHWALANKILFLVFPLAIIIAGFTIMRNTGEEFMPSLNEGSFLLMPTSMPHAGVAE
FT                   NKRILQQLDMAVASIPEVKTVVGKAGRTESALDPAPLNMYENIIQYKPEYALNANGEKQ
FT                   RFKVNEDGYFVLKDGSVCANSNLKTEQTSKVSKTCKVSQLIPDENGEYYRNWRPHIKSP
FT                   NDIWNEISAATKLPGITSAPKLQPIETRLVMLQTGMRAPMGIKVRGQDLRQIEAFGMKL
FT                   EEILKEAEGVKDEAVFADRIVGKPYLLMDIKRDRLARYGISVSDVQDVLEVAVGGKMLS
FT                   QTVEGRERYSVRVRYPRELRDSPEDLKDIYVPVENGQPVPLNELVEIRYEKGPQVIKSE
FT                   DTFLIGYVLFDKMEGFAEVDVVENAQKTIQQKIEAGELKVPKGINYEFTGNYENQLRAS
FT                   KTLSIVVPLALLIIFMILYFQFKSVTTSFIVFTGIAVAFGGGFIMIWLYGQDWFLNFSL
FT                   FGENLRNLFQMHTINLSVAVWVGFIALFGIATDDGVVMATYLTQTFSKNEPDTIKSIRA
FT                   SVVEAGEKRIRPCLMTTATTILALLPVLTSTGRGSDIMIPMAIPSFGGMVFALITLFVV
FT                   PVLFCWKKELKLKREVSS"
FT   gene            720206..720325
FT                   /locus_tag="ZPR_0669"
FT   CDS_pept        720206..720325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51024"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFT0"
FT                   /protein_id="ADF51024.1"
FT                   /translation="MKKENKLMAKSWQLKAEKAYKTFLFWLCCCFVWQPKHNN"
FT   gene            720301..721494
FT                   /locus_tag="ZPR_0670"
FT   CDS_pept        720301..721494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0670"
FT                   /product="outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51025"
FT                   /db_xref="GOA:D5BFT1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFT1"
FT                   /protein_id="ADF51025.1"
FT                   /translation="MATQAQQLESYVLEAQDNSPAIDALRAKYDISREQINAVNTLPNT
FT                   EFAAGYFVSEPETRTGPQQAKFSVKQMFPWFGTISARQDYASALAQQDNIEVGIALGKL
FT                   RLSVSKTYFQLYELQEKIKVVKENIELLKVYEELVLKGVEVDKASAVDVLQLKMRQNKL
FT                   EDQQLSLQNQLTSGKVAFNRLLNKENNALVEIADTLELPSEDIQVSAIKVHPELSKFDE
FT                   NLESIDFAEAINKKESAPQFGLGIDYINVGTRTDMAIPNSDSYRNGKDIVMPMLSFSIP
FT                   IFNNKYSSVTAQNELRKKQISANKTQRLNELESSLSNAVSMRNSARNSVEIQLRNIALT
FT                   KDAEDILMRSYESESLDFRDVLDIQEMQLDYQMKLIESLSNYFQQAAMIQYLVISNE"
FT   gene            721709..723400
FT                   /locus_tag="ZPR_0671"
FT   CDS_pept        721709..723400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0671"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0671"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51026"
FT                   /db_xref="GOA:D5BFT2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR021782"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFT2"
FT                   /protein_id="ADF51026.1"
FT                   /translation="MKKTIIYTGLALITGLFVGYLVFSEVENKTEEAHTEHNASEDTMW
FT                   TCSMHPQIMQPEPGDCPICGMELIPADQSDATIAGFTMTENAMKLANIQTTIVGTSNTD
FT                   KSVTLSGTLETNEELNAVQSSYFAGRIEHLFINTTGEQVKIGQILATIYSPDLVAAQQE
FT                   LLTAVKLKGSQPKLYQAVRNKLKNWKLSDSQINAIEEGGRVKENFPVFASNSGTVTEKM
FT                   VNEGDYIDRGQPLYKVANLSEVWAEFDAYEQQLSNLKEGQKLYISVNAFADKTFSGTID
FT                   FIDPILDNSSRTTKVRVVLDNRDGKLKPGMFAEAAINMETTESEQISIPKSAVMWTGER
FT                   SIVYIKTNPNLPQFEMKEVTLGSEVGDFYQILDGLQKGDEVVTNGTFTVDAAAQLQGKK
FT                   SMMNQNSADEDVAIQMNLPKKFQLTFKPMLQDYLNLKDALVASDTTLAKQTAKKASTKI
FT                   NNTDTAELNQMLVSHFKVIQNKFKAISASNDIAAQREEFIILSQNMIALVSNFDEIEEM
FT                   YIQRCPMANNNKGATWLSKNKDIKNPYFGEQMLGCGETIDRLPYKN"
FT   gene            723521..724075
FT                   /locus_tag="ZPR_0672"
FT   CDS_pept        723521..724075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0672"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0672"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51027"
FT                   /db_xref="InterPro:IPR021782"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFT3"
FT                   /protein_id="ADF51027.1"
FT                   /translation="MKRIHRNLFFIAFSAGIISFTSCKENKETSTETSDKEMKVSHDEI
FT                   MDNETPMEMSGAEFNDEKVATNYQSYLDLKNALVASDAEAAQVAAKKLSENGEDDIIEA
FT                   ATKISHTLDIETQRKAFSELTHNMEPVLENAIASAAIYKQFCPMAFEGKGDYWFASSKD
FT                   INNPYFGDKMLHCGRVEKIIQ"
FT   gene            724107..724697
FT                   /locus_tag="ZPR_0673"
FT   CDS_pept        724107..724697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0673"
FT                   /product="AraC family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51028"
FT                   /db_xref="GOA:D5BFT4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFT4"
FT                   /protein_id="ADF51028.1"
FT                   /translation="MRESFKIKVLTENIVHIKNVVCGRCIATVEGILSKLNIPYKNVSL
FT                   GEATLLKDLSTEEYTAFKLELEKVGFALIEAKNKRIVNHIKSILIDEVSNSTDQKKLSE
FT                   ILSAELHYEYSHITNLFTAEEGQSIQSYFNKLKIEKAKELLEYDELSIAEIAYQLGFST
FT                   AAYLSTSFKKQTGITPSEYKKMQIKDRKGLDHV"
FT   gene            724915..725112
FT                   /locus_tag="ZPR_0674"
FT   CDS_pept        724915..725112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0674"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51029"
FT                   /db_xref="InterPro:IPR005560"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFT5"
FT                   /protein_id="ADF51029.1"
FT                   /translation="MCAEVCNALANVAVIEGANITDFVKYCITICQECADECKKHEHKH
FT                   CQDCATACETCVEACNSYLA"
FT   gene            725171..727915
FT                   /locus_tag="ZPR_0675"
FT   CDS_pept        725171..727915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0675"
FT                   /product="copper-translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0675"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51030"
FT                   /db_xref="GOA:D5BFT6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFT6"
FT                   /protein_id="ADF51030.1"
FT                   /translation="MMKHKYNISGMSCQGCKSHVTKALENIPGVEQVEVDLERGSAEVA
FT                   MQKHIEIEEFQQALKNAGGNYQISMPSENTSAAEEKLMTHKYHISGMSCNGCRSHVEKT
FT                   LNEIGGVAKAEVNLEKAEATISMHQHIEIAEFQQALKNNGGGYEIHPAGHQYHHTEKSK
FT                   NKKKSKTKGNGKWYCPMHCEGDKIYDAPGDCPVCGMDLVQEQSLSASSITYTCPMHPEI
FT                   EEDKPGDCPICGMDLVSKNPEPDAQNSTYLKLRKKLWLSLVFTLPVFLIAMSDMLNNNP
FT                   LYKIMDLEYWNWGQFVLSIPVVFYTAWMFFERAWKSVVNWNLNMFTLIGIGAGVAWVFS
FT                   VLGLLFPGVFPDQFKTEAGTVHVYFEAATVILTLVLLGQMLEARAHDRTNSAIKELLKL
FT                   APNKATRIKDGKEEVVKIDEIEEGDILKVKPGEKIPVDGIIKEGKSSIDESMITGEPVP
FT                   VEKSTDDKVTSGTINGNSSFTMVAQQVGDETLLSQIIQMVNDASRSQAPIQRLADKISG
FT                   YFVPIVVLISVITFVVWAIFGPSPSYVYAFVNAIAVLIIACPCALGLATPMSVMVGVGK
FT                   GAQNGVLIKNAQALELMNQIDTLIIDKTGTITEGKPSVEKIVSVGGYSESDIAGFVAAL
FT                   NTHSEHPLATATIKYAKMREIEIEQASNFDSVTGKGVVGELQQKKLALGNKALLDEKGI
FT                   NSSGKIDREIEQFQQQGKTVSYLSVAGKVEGFVVISDPVKKTSKEALTKLIEDGVEVIM
FT                   LTGDNERTAKAVADEMGIAFKAGMLPQDKMREVEKLQQQGRKVAAAGDGINDAPALAKA
FT                   DIGIAMGTGTDVAIESAEITLVKGDLKAVLKARKLSDKVMANIKQNLFFALIYNSIGVP
FT                   IAAGVLYPFFGILLSPMIAALAMSFSSVSVIANALRLRAARLS"
FT   gene            727958..729181
FT                   /locus_tag="ZPR_0676"
FT   CDS_pept        727958..729181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0676"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0676"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51031"
FT                   /db_xref="GOA:D5BFT7"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D5BFT7"
FT                   /protein_id="ADF51031.1"
FT                   /translation="MDDFLNKWGEAANTSLGFFWMALWAFALGYVISSCIQVFVTEKRM
FT                   QKTMGKNESKGVLLGTFFGFISSSCSFAALASTKSLFKKGASFVASIAFLLASTNLVIE
FT                   LGIIISIFLGWQFVVGEYLGGILLILISWLLIRLFHPKGLIKKARERLQDNEDDDVNNQ
FT                   KSWKERIKTEKSWAKVSQQYGMEWKMVWKDVTLGFTIAGIVAAFIPDSFFQTLFINSGQ
FT                   GNTDFSFFTIFEHITVGPLVAFITFIGSMGNIPLAALLFGKGVSFAGVIAFIFSDLVVF
FT                   PVLRINAKYYGWKMSFFILMLLFISLVGASLLLHYGFLSLDLIPDPSSVKVQDQSFFKI
FT                   DYTFFLNIAFLLGSGYLIYLGFFKRTDVMQMKEMAPKSKLMEKGLKYIAFVCYVWLAGG
FT                   MIVKYFMQ"
FT   gene            complement(729246..729686)
FT                   /locus_tag="ZPR_0677"
FT   CDS_pept        complement(729246..729686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0677"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51032"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG73"
FT                   /protein_id="ADF51032.1"
FT                   /translation="MVLIGVSSFAQQKENHKKLMKERAGMNMTAEEKAILKSKQLTLAL
FT                   DLTERQQEEFQKLYVDRAEDKVKRRKEMKEAVEDSKLKAEAFEKMNTRLDKEIAFQQSI
FT                   QKILNKEQYMLWKDSQRAEKRNRMMAFKGHRKDFRSKNKNPK"
FT   gene            complement(729868..732306)
FT                   /locus_tag="ZPR_0678"
FT   CDS_pept        complement(729868..732306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0678"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51033"
FT                   /db_xref="InterPro:IPR032534"
FT                   /db_xref="InterPro:IPR033413"
FT                   /db_xref="InterPro:IPR033428"
FT                   /db_xref="InterPro:IPR034032"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG74"
FT                   /protein_id="ADF51033.1"
FT                   /translation="MASCAVFQKNKKAQPTNAQKEESKDGLKPYAKVITKDAKSDEGLF
FT                   TVHKVKNKYYYEIPDSLFNREMLTVTRIAKTASGIGFGGGKQNTQVHRWQKKGDQVLLR
FT                   VVSYDIYAADSLPVHEAVVNSNFEPILSSFDIETVGKDSINKSTIIEVTDLYKKDVQAL
FT                   GLGDRYRKQYKVSRLDDSRSFIDTIRSYPENIEVRHIKTYNAGDPPSNSTTGSISLEFS
FT                   NSMILLPKEPMERRYFDERVGWFTTSQTDYGLDAQKSKTVEYLDRWRLEVKDEDMEKFK
FT                   NGELVEPKKQIVYYIDRATPKKWVPYIKQGIEDWQVAFEAAGFKNAIIAKEAPTPEEDP
FT                   DWSPEDVRYSTVRYLASPIPNANGPHVSDPRSGEILESDINWYHNVMTLLRNWYFVQTA
FT                   AINEDARGVAFKDEIMGRLIRFVSSHEVGHTLGLPHNMGSSPAYAVEDLRDPEFTAKYG
FT                   TAPSIMDYARFNYVAQPGDGDVALMPNIGPYDKYAIMWGYKPIPGKEGKEEKPVLDEWI
FT                   LEHAGDPLYRFGSQQSGGVIDPSSQTEDLGDDAMLASEYGIKNLKRIVPKLIEWTAEDG
FT                   KNYEDLDDLYGQVLAQLNRYMGHVTANIGGVYENSKTYDQEGAVYTHVDKEKQERAMDF
FT                   LQEQLFETPDWLINQDIFNKIEFDGNIERIRSMQSSALSNILDFGRMQRLLENEEINGK
FT                   EAYTLLDMMDELRKGIWSELNSGQKIDRYRRNLQRAYIDRMAYLMTEDQTAIPSAYRRW
FT                   ISRTNVNVAQSDIRPIVRGELQTLQRQIRNSMYRSGDTLTRYHLQDALERIDQILNPND
FT                   "
FT   gene            complement(732564..734255)
FT                   /locus_tag="ZPR_0679"
FT   CDS_pept        complement(732564..734255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0679"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0679"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51034"
FT                   /db_xref="GOA:D5BG75"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG75"
FT                   /protein_id="ADF51034.1"
FT                   /translation="MQLSEQEVIRREKLATLREKGINPYPADLFPLDHTSADIKTNFEE
FT                   GKKVVIAGRLMSRRIQGKASFAELQDSKGKIQVYFNRDEICTDEDKSKYNDVYKKLLDI
FT                   GDFIGIQGELFKTQVGEMTVMVKDFELLSKSIRPLPLPKTDKEGNTYDGFTDPEHRYRQ
FT                   RYADLAVNPKVKEIFVKRTKLFSAMRNFFNEAGYFEVETPILQSIPGGAAARPFITHHN
FT                   ALDIPLYLRIANELYLKRLIVGGFDGVYEFSKNFRNEGMDRTHNPEFTAMEIYVAYKDY
FT                   NWMMDFTEKLLEHCAMAVNGTTEATFGKHQVDFKAPYKRVTMTDAIIEFTGFDITGKSE
FT                   AELFEAAKSMGIEVDKTMGKGKLIDEIFGEKCEGNYIQPTFITDYPKEMSPLCKTHREN
FT                   PELTERFELMVCGKEIANAYSELNDPIDQRERFEEQLRLAEKGDDEATEFIDQDFLRAL
FT                   EYGMPPTSGLGIGMDRLVMFLTNNQSIQEVLFFPQMKPEKKQVELTEEEKAVYQLLKDD
FT                   QNHDMNLIKEKSGLSNKKWDKALKSLRKHKMIDVFKEGNDMKISVA"
FT   gene            734562..735272
FT                   /locus_tag="ZPR_0680"
FT   CDS_pept        734562..735272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0680"
FT                   /product="lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51035"
FT                   /db_xref="GOA:D5BG76"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG76"
FT                   /protein_id="ADF51035.1"
FT                   /translation="MMLKVQNKKIEVRDLGLKDYKETWDEQERLFKEILDLKVKNRREN
FT                   TKRETPNYLLSVEHPHVYTLGKSGDISNLLINEKQLEEKGASFYKINRGGDITYHGPGQ
FT                   MVIYPILDLDNFFTDIHKYLRLLEEAVILVLQDFGIKAGRSEGETGVWLDVGTPFARKI
FT                   CAMGVRASRWVTMHGLALNVNADLGYFDNIVPCGIKEKAVTSLNVELGKTTVDIEEVKK
FT                   RFLEHFKILFNIDY"
FT   gene            735468..738461
FT                   /locus_tag="ZPR_0681"
FT   CDS_pept        735468..738461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0681"
FT                   /product="putative outer membrane protein, probably
FT                   involved in nutrient binding"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0681"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51036"
FT                   /db_xref="GOA:D5BG77"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG77"
FT                   /protein_id="ADF51036.1"
FT                   /translation="MKKNLQVVLMFFFALATQFAFAQERMINGTIVDDQGMPLPGVNVI
FT                   VQNTNRGVQTDFDGHFSIAASTGEVLEFSYVGFTSQTVTIGPDMQDLSIILGEDAAQLD
FT                   EVVVVGYGTQSKRQLTDNVAKLTSEDIAEVPTPSLQSSLSGKAAGVQVTQTNGKVEGGI
FT                   NIRIRGIASVGAGSEPLYVLDGVPLINNNESNNGAPTNPLLTLSSNEIESIDILKDASA
FT                   AAVYGSRGANGVVIITTKKGGNNKGTFAVNYSYGISETANRRDWLNADQYIELFTEAAI
FT                   NSYGEADGLAEAEGTFDYLAQGTDWRNREIDTDWQDEIFRTGYTQNADFSASGGDERTS
FT                   YFFSGAYNDTEGIIRGNNLDRITARANVSHQFSDKFNAGMNVSFSRTNIDRIANDNAFV
FT                   NPVQGVAQSPLSPAYLENGEPNPNTLYANFLLQDKHAFYNTVIRRVTGRAFAEYKFLPS
FT                   LKFNTDFGYDLFYQTEDSFTGSLAPFQSTNGEAYASSVGTESYVSSNYFTYSQVFDEIH
FT                   DVEVVAGMEYNNTHRRFQSVTGIQFPTDDFQTINSAAEISAGNGITNGNRFLSYFARGT
FT                   YALDGKYLFKASVRRDGSSRFGRDTQFGTFSAISGGWILSEENFLSEADWLSFLKLRAS
FT                   WGQTGNAQIGDYAALGLYGGTSYNQRPGIYPDQPANFLLSWESVNQTDIGVEYGFLNNR
FT                   ISGEIDYYSKVSKDLLFDNPLPGTSGFSSIQRNIGEMENSGVEFVLNTKIIQKADFTLS
FT                   TSFNIAKNKNEVKRLPNDGADIISGQNIQREGESLNSFYLVEYAGVDPENGDALYYLNG
FT                   KGSETTTNFNEANRVVAGAPYAEWIGGLTSNLYFHGIDFSFTFQGEWGASLYNGGGVYQ
FT                   SANGDYFDNQTADQMNRWQQPGDITDVPQARLYAGNGVANSTRYLEDADFIRLRNLTLG
FT                   YTFPESIADKLSMNNLRVYFSGLNLLTVTDYEGYDPESRSDAGQGPGTTFYSAPAARTF
FT                   SLGVNLKF"
FT   gene            738573..739823
FT                   /locus_tag="ZPR_0682"
FT   CDS_pept        738573..739823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0682"
FT                   /product="putative outer membrane protein, probably
FT                   involved in nutrient binding"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51037"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG78"
FT                   /protein_id="ADF51037.1"
FT                   /translation="MALSTGENVENLLIGAYAEAGQSASYGGNIQMLSDLYGATNQVSW
FT                   NGTFQPIRQVYTKNILVDNSYVRDTWLNGYDVINQTNLVLDNIDLVDEENQSNIEGQAR
FT                   FLRGLTYFDLTRLFGQQYMSGQSNNQLGVPLELEGIEDYSGNLEIARSTVEENYTQVIT
FT                   DLQAAYDLLPEDNEEFAERYAAQALLARVYLQQGDYSSALASANDVIENSSYSLAGTYA
FT                   DIFNNDTDGSETIFAFQVTTQDGSNNLITHYADQANGGRGNDISINDGYVAMFDSEDDV
FT                   RSEFFYASAQSEDRLTAKYTNQFGNVMLLRLAEMYLIRAEANLRLGSAVGATPVEDINR
FT                   IRERSNADVLTSVSLDDIMLERQLELAFEGFLIHDLKRTMEDVGDIPYDDNSLLFPIPQ
FT                   REMDVNSLLTQNPGYGS"
FT   gene            complement(739859..740080)
FT                   /locus_tag="ZPR_0683"
FT   CDS_pept        complement(739859..740080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0683"
FT                   /product="ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0683"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51038"
FT                   /db_xref="GOA:D5BG79"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG79"
FT                   /protein_id="ADF51038.1"
FT                   /translation="MSIATASILAKTYRDEYMEIIHEEYPIYNWKKNKGYPTKEHREAI
FT                   RKYGITKYHRKSFKLLPEQLELELIKRR"
FT   gene            740462..743545
FT                   /locus_tag="ZPR_0684"
FT   CDS_pept        740462..743545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0684"
FT                   /product="putative outer membrane protein probably involved
FT                   in nutrient binding"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0684"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51039"
FT                   /db_xref="GOA:D5BG80"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG80"
FT                   /protein_id="ADF51039.1"
FT                   /translation="MQIIYAQKKTVAGKILDENGLPLPGVNVIEEGTSNGTQTDFDGDY
FT                   TITVEPGATLVFSYVGFVTQKTVVGAEDVYNLTLKTDSAALDEVLVVAYGTTTKESFTG
FT                   SASTIQAEQLEQRSLTSPLSAIEGNSTGVQFLSASGQPGSSPSIVIRGVGTLNGDTDPL
FT                   IIVDGVQFEGALNAINQNDIKSMTVLKDAASTSLYGSRAANGVVLITTKSGKGKQDLRV
FT                   NIDSQVGVINRAIPLYDNVNPQEYYELMWQSYKNSLDVDNAAAEASATIFNRLGYNPFN
FT                   VPNDQIVQENGQINPNAEVIFKGLDWYGALERTGQRLFNSADVSVGGANHNVFFSVSNL
FT                   KEEGYVVTSDFERTTARLKGDFVPTDWLTLGGNINMALSSSNGPSSRGSSIANPFGFAK
FT                   NMGSIYPVYIVDPETGDYIRDAAGNLQYDRGEGYPDFGIQSRPTNVGRHAIEEVLLNND
FT                   KTETNNYGIRLNAGFQIVDGLKLNLLYGQDVNDYINKRYENNLVGDGQPAGRYRETRFR
FT                   RIVENFNQILNYNKSVGDHSFDLTLGHESFDRTFSQVFGFKNTQTAEGIYEFDNFSTIA
FT                   SLDGYTSDKTLEGYFSRLNYNFKEKYYLSGSVRRDGSSVFDKDVRWGNFYSIGGAWRVN
FT                   QENFMSNVHFVNNLKLRASYGEVGNDDLNDYYISQPRYSLLPNAGNPGIFWSDLGNSAL
FT                   TWETVESWDIAIEFDLFDYRLSGSLEYYKRNSSDLLYNVPLPISMGLNEGPANIGDMYN
FT                   EGLELGLNGIIVDGNNFKWNLGLQFSTNNNKITFLPDPFVTGSKRWIEGRSIYDYFLYD
FT                   YAGVDSENGDALYYAYEEDTETGENVPVINEEGEHVTLTDPTEANRTYVGATAVPDLVG
FT                   SIRNQFSYKVFSLSFLFTYQLGGEILDYGYAAMMHEGSYGESLHPDALNAWKKPGDQTN
FT                   VPRLENGNPNLAPSLSSRWLTDASFFSLRNVNLSYNFNNDMINDMGMSSLRLFVSAENL
FT                   FLISERKGLNPQYNLQGTPGGNDYNPSRIVSAGVNISF"
FT   gene            743614..745185
FT                   /locus_tag="ZPR_0685"
FT   CDS_pept        743614..745185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0685"
FT                   /product="putative outer membrane protein probably involved
FT                   in nutrient binding"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0685"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51040"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG81"
FT                   /protein_id="ADF51040.1"
FT                   /translation="MISFSCSEDFLDNVPTDAISAEAALSSPENMMLILNGLHRQVYSQ
FT                   AQLPGSSSSRSGESHFIPALDAMGGSIIHSSPGNGWMTSDLQWLTHTNPTYTTVYNFWY
FT                   QRYHFIASSNSIINAISDGDFAVSPQLNNILGQAHAYRAWAYHKLVTTFAKGYTIGNPS
FT                   TDLGVPIVFSTEAPYESAPRSTVEEVYDQMENDIDEAISYLENAGSPVNKSHISLNAAY
FT                   GIKARIALSKGDWQTAAESAALAREGFPLLNESQWLSGFNTYDLPEVIWGGRVIDSETN
FT                   YYQSYFYYISPTFNGSQNRSNPKIISSELYDMIPETDFRNEAWLPLAPNTNPSASNGEG
FT                   GSYESDPNYDSEDEFWDAWSEVISKYGMTSGHNTHPYMTVKFLQKNPGTIDPDDVIYMR
FT                   SSEMYLIEIESLAMMNAISEAQELLQEFGESRDSAFDASQFATQEELIEQIKFQRRVEL
FT                   WGEGFSFHDHIRWDEPLDQSNSGAAKVLYQNGFFQERPSQNDAWIWKIPQAEIDANPYI
FT                   TSSDQN"
FT   gene            complement(745195..745296)
FT                   /locus_tag="ZPR_0686"
FT   CDS_pept        complement(745195..745296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51041"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG82"
FT                   /protein_id="ADF51041.1"
FT                   /translation="MNILLRKQSTSTRIKKSSEVMFAGFVIIFAILK"
FT   gene            complement(745706..746305)
FT                   /locus_tag="ZPR_0687"
FT   CDS_pept        complement(745706..746305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0687"
FT                   /product="ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51042"
FT                   /db_xref="GOA:D5BG83"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG83"
FT                   /protein_id="ADF51042.1"
FT                   /translation="MLLRNLKDCDHECGTDEAGRGCIAGPVTAAAVILPKHFENEFLRD
FT                   SKKLTHQKRLLLKKIIENDCASYGITHIFMETIDEINILNSSILAMHKSIEKLSPEPEH
FT                   IIVDGNRFKPFKNIAYECIVKGDDKYLSIAAASILAKTYRDEYMESIHEEYPMYNWKKN
FT                   KGYPTKEHREAIRKYGITKYHRKSFKLLPEQLELEL"
FT   gene            746605..749571
FT                   /locus_tag="ZPR_0688"
FT   CDS_pept        746605..749571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0688"
FT                   /product="ragA protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51043"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG84"
FT                   /protein_id="ADF51043.1"
FT                   /translation="MKKTLHGLLTLFMVLVVQLSFAQEKTITGTVVDEDGLPLPGVNVI
FT                   EKGTRNGVQTDFDGEYSISVPQSATLVFSYVGFATQEIKVGSSSTLNATMVVDAAALDE
FT                   VVVVGYGTRDKTDVVGSVAQVSGEVLQDRPAANVIDALQGQIPGIQIFTSSGEPNAIPS
FT                   IRLRGVGSLGAGSTPLILLDGFQVDSGIFTRLSPNDIEDITVLKDASETAIYGARAANG
FT                   VVVITTKTGRNEQDPSINVGVQHGFSELANTDFFESFMNTEQFSNFRVDIGQISRENMD
FT                   AILAQNNADTEWYKWYYKDNAPTTQFNVSATGGSKKTKYFISAGYFEQEGLAFRSDFNR
FT                   YTLRSNITTDINDWMKAGLNIGFAYTTDQDNPYGSNSTNRGLSLLAAPYFSPINPETGQ
FT                   RYEGVIPGWNRYDPVYLAENNPYDRNRFQVNPSGYIELNPIKGLTLRTAVGLNAFDQRE
FT                   TFIRLPSYLASLNNGRRQERFRRDKQITVSNTVSYSVTLDDVHNFSLLGGHEFQDYDYG
FT                   LFGATSTGQTDDRLVMLGQGPSNRDVEQEMEEWSLESYFGRLEYNFDSKYYANFTVRRD
FT                   GSSRFGRDNREATFWAVGARWTAKKEAFLTDVEWLDDLVVRANVGTSGNSDIGNYNSYA
FT                   LVGTNQYQGQTGWYLDTPGNPALQWESQRSASVGVEVSLIDRLRLTVEYYDRLTEDMLI
FT                   DVPYPFTSGFSEVTENTGSLKNYGFDVGLSYDVIKGNSDLNITPYVNFNYNQNKVTELF
FT                   QGRDYWIIPNTGVSWVVGQPVSFFYPVFAGVNSENGDAEWYLPNEDPDQVVYNREDPNA
FT                   VTNQFNTARLQQNTGIDRYPPLNGGFGLNADYKGFYLQTHFAFSVGKYLINNDRYFYEN
FT                   PTQFSGFNQSERVLDYWQEPGDQTLFPRSNVQFTQFDSRLIEDASFLRMKTLTVGYNIP
FT                   SSILDSTGFMKGAKVYVTGRNLLTWTDYLGPDPEVDQNLTLGVNPNTKQFTFGIDLQF"
FT   gene            749587..751080
FT                   /locus_tag="ZPR_0689"
FT   CDS_pept        749587..751080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0689"
FT                   /product="putative outer membrane protein, probably
FT                   involved in nutrient binding"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51044"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG85"
FT                   /protein_id="ADF51044.1"
FT                   /translation="MKKRNIKKVILGLFLSISFIGCDDLKRFPYDAIEQSQSFQTVNDA
FT                   ATWNNGLYASFRGVLYGQYMFSTDVQADQLNATLDYGNRNGNPHRWEGFLADDYTVRDV
FT                   WFGYYARISDLNAAIEGMSTIVTDSPEEEAELERYIADAYFARAFYYHNLVVRYASDYD
FT                   PASASSDLGVPLMLQYDISARPSRSTVEQVYQQILADIDAARPALSQVSGEQGAQRFNA
FT                   DVLTAFEARVKFYMEDWAGAKAAADELINSGDYPLINNQADFRDMWVNDYDQEVIMQVY
FT                   VEAPNELANTNSIYLGFSGGTGLFTPDFLPTQWMVDLYEDDDIRKDVYFLNDTIVMSSI
FT                   TYTDLFMVNKYPGNPDLWTGANTNYQQAPKVFRIAEMYLISAEAALSISESQALAPLNE
FT                   LRQARGLSAVDASGSALVDAVREERTRELAFEGFRLDDLRRWDLGFTRRDPQNTDPLQP
FT                   GANYYTKSVEASNPKFIWGVPTNDILINPGLAGEQNPGW"
FT   gene            752024..755008
FT                   /locus_tag="ZPR_0690"
FT   CDS_pept        752024..755008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0690"
FT                   /product="tonB-dependent Receptor Plug domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51045"
FT                   /db_xref="GOA:D5BG86"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG86"
FT                   /protein_id="ADF51045.1"
FT                   /translation="MQFSFAQEKTITGTVVDEDGLPLPGVNVIEKGTRNGVQTNFDGKY
FT                   SIKVDEGKVLVFSYVGFTSKEQMVGTSNILNVTLVVDAAALDEVVVTGYSTQKKSDITG
FT                   SVVKVDDEVLKSFASPTVDQALQGNVAGLTVSSSSGTPGSVANIRIRGISSITAGNEPL
FT                   YVIDGVPINNGNVSASGATSSISALAAIDNNNIASITVLKDASATAQYGARGANGVILI
FT                   TTKSGKYGETVFTINTQIGFMNDAVDGPTPLTSAQRLELAAEAYYNDGYYDTTQQATDY
FT                   LLENNALFKAWDQNGRKESDWGSAVANKDAIYREYSISASGGGNGHNFFASLGYLEQEA
FT                   TVIGSSFERISGSINFSKDLTPSLKLSSNNSAAYTFQKAFLERSAYFASPRTAKYFMNS
FT                   LRYPYNDDGTFAEIGGALPNPLIGARDDFNDNRFTRIISGNALTWDIGSGFTLGAKFSV
FT                   DLQLYNYRTYSNRNYGYGVPTSGDASQYDRTNAFYVFQNYLDYNLALNQHNLKFKLLQE
FT                   YQSNRQYFLGGAAENFADDGLYFLDSAGTPSSVSSSFSDWYMGAYLGLLEYSVFDSRYV
FT                   LNLSYRIEGNSRFQEDNRWGNFYSVGAAWNIHKEDFLTSIDNIEYLKLRFSYGKTGNAS
FT                   IGLNRYQSLFTYGVDYNGDGAQAVSTFGNNDLSWEINKTIDIGLEFGLFNDVLSGSIGY
FT                   FNRKSEDLLLNVPLSQTTGFSSQTQNIGALKNTGVEIQLNASLIDTQDVSLSIGGNIAT
FT                   VNNEITELPLDPNGIERTITTTTTRIETGHPVREWYMPTWAGVNPETGMEEFYLNGVGG
FT                   ETTTTFNDAEAVFQGANAVPTLTAGVNLNFEVKGFFLNAQAYYAGGHKIYEGWHLYLNQ
FT                   PNGFPIFSYNGYQSLLDRWQETGDITRNGKFTSDGQSWQRHSKYLYDGDFIRLRNLTFG
FT                   YNIPSSVMNSIGMKTARVFVRGNNLATWVKDDNLLFDPEQDLGGETGLETPPTKSFLFG
FT                   VNLTF"
FT   gene            755054..756385
FT                   /locus_tag="ZPR_0691"
FT   CDS_pept        755054..756385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51046"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG87"
FT                   /protein_id="ADF51046.1"
FT                   /translation="MISVTVSCSTEDLEPTLAQEKSVEDSVNKVENLSSILKGIHSSMT
FT                   SSGYYGRDIIITNEVRTDNTFSNGNSGRFTTQSQYLYNENSGFIWNTAYYVIANANIII
FT                   NTDLESLEGDLDLGMHIQGQATVLRALAHFDLLRVYGQQFAGAGNLGVPIVTTFKGDDL
FT                   FPARNTIEEVKAAIYNDLETGFAMMNSDYDNSKVLVSKFVAKALEARVAVYFGDWNRAV
FT                   SASEAVIQSGLYSIIPAESYVSSWAGDGGANVIFELAANLADNPGINGLAYIYRANDDG
FT                   SGYGDIQVKNEVLDIYEDSDVRKGILGYQGDILRNLGKYPDNVNNADNIVLFRYEELIL
FT                   NYAEALLETGGDALTQLNKIPANRGAQPYNNATKENILLERRKELIFEGFRFDDMLRSG
FT                   MNMEAMNTQGNVMKTFSVPNYLFAWPIPVSELNSNSNMVQNEGY"
FT   gene            756499..758409
FT                   /locus_tag="ZPR_0692"
FT   CDS_pept        756499..758409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0692"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51047"
FT                   /db_xref="InterPro:IPR025631"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG88"
FT                   /protein_id="ADF51047.1"
FT                   /translation="MKKALFLISFVIIGYHCNAQEQRSPGRVGEEKSKDSVAEPTIDLF
FT                   KIISIENDTTHVDTSLTIQKDYKFNYLRKDLFGLLPFANTGQTYNKLTEFRDFSTIMPK
FT                   FGARARHYNFMEAEDINYYYVPTPLTELYFKTVPEQGQQLDAFFTVNTSERLNFSIAYK
FT                   GVRALGRYRHILTSTGNFRTTLNYQTKNRKYRAKAHFVSQDLLNEENGGLTDEALASYI
FT                   SKEPEFDDRSVLDVNFENAESTLYGKGFFLDHQYYLSGAQDTIQNKFYLSHRLDYSYKK
FT                   FQYLQSAAATAILGEAFQSTNLNDETRYRNLDNTVAVNFDNPVLGKISAKAGYSFFDYW
FT                   YDSVFIGENGVVGDRLDGRLINVGGSYDNYLAGFNLHADVSFNFGDDFSGNHILASAGY
FT                   SLDDNNFLNFGIKQTSRAPNLNFLLYQSDYINYNWQNNFDNENAQSLFFELSAKMIANF
FT                   SGEITQIQNYTYFSLNNDGVVKPFQFGGDVRYYKLKAQREFTFGKFALDNTILYQNISD
FT                   GKDVLNLPELVTRNTFYYKDFWFDKALYLQTGLSLRYFSSYQMDAYDPVLAEFYVQNET
FT                   EFGNYPVVDFFFNGKVDQARIFFKLENLNFLIDGNNNFSAPRYPHNDFMVRFGLVWNFF
FT                   L"
FT   gene            759240..760762
FT                   /locus_tag="ZPR_0693"
FT   rRNA            759240..760762
FT                   /locus_tag="ZPR_0693"
FT                   /product="16S ribosomal RNA"
FT   gene            760943..761019
FT                   /locus_tag="ZPR_0694"
FT   tRNA            760943..761019
FT                   /locus_tag="ZPR_0694"
FT                   /product="tRNA-Ile"
FT   gene            761175..761251
FT                   /locus_tag="ZPR_0695"
FT   tRNA            761175..761251
FT                   /locus_tag="ZPR_0695"
FT                   /product="tRNA-Ala"
FT   gene            761491..764312
FT                   /locus_tag="ZPR_0696"
FT   rRNA            761491..764312
FT                   /locus_tag="ZPR_0696"
FT                   /product="23S ribosomal RNA"
FT   gene            764467..764572
FT                   /locus_tag="ZPR_0697"
FT   rRNA            764467..764572
FT                   /locus_tag="ZPR_0697"
FT                   /product="5S ribosomal RNA"
FT   gene            765100..765480
FT                   /locus_tag="ZPR_0698"
FT   CDS_pept        765100..765480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0698"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51048"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG89"
FT                   /protein_id="ADF51048.1"
FT                   /translation="MVGKPYYRISLMGTEYIENADQLSYANEHLEDNLILIKKYMYSKD
FT                   VMLIGFGGGGSRTDDYFSYGLTNSNKDILIEPEYQFISSKVNSDNEVIIYGLPYIVKGN
FT                   EKMVFYKIENGKLKEIPEKDSW"
FT   gene            765880..766386
FT                   /locus_tag="ZPR_0699"
FT   CDS_pept        765880..766386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0699"
FT                   /product="ECF subfamily RNA polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51049"
FT                   /db_xref="GOA:D5BG90"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG90"
FT                   /protein_id="ADF51049.1"
FT                   /translation="MNLLSDFKKGKKAALKQIYLQYHQNVYALALNFTNDVQRAEDFVH
FT                   DVFLRFWEQRRKLSEDHNIESQLIRTAKFYIINQLKSNKWEVACNAQKSENISQEIDIE
FT                   NNENQLHSLNKAIKKLPQHCREIFIMHKLEGLTQKEVADYLNISVKTVENQIAKAISEL
FT                   KRHLI"
FT   gene            766586..767455
FT                   /locus_tag="ZPR_0700"
FT   CDS_pept        766586..767455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0700"
FT                   /product="putative anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51050"
FT                   /db_xref="GOA:D5BG91"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="InterPro:IPR032508"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG91"
FT                   /protein_id="ADF51050.1"
FT                   /translation="MKNKTEKFFSEGNFDKLINNAWDKPVNPNSIKLWQRIDKSTTNSN
FT                   YTIWKSIAAIFVIAFLTAISLTLFNINTTSKLVVVNNDGMTPKEILLEDGSKVFLNRNS
FT                   GVTYSPENSRMLNLTGEAYFEIKKDKNHPFTVNTRELTLSVLGTYFNVNAYKNTNETII
FT                   SLVSGKLKVSSVQNGEKILSPGEELIYNNRSKKVSVNSFNVNTVLAWRSSLIKCENTGL
FT                   DFLLDRLENYYAIEINNKTDYANCKISGEFRSDLSLDEIMEIISFSHNIEFLSLKENEY
FT                   KIKGEICE"
FT   gene            767682..771158
FT                   /locus_tag="ZPR_0701"
FT   CDS_pept        767682..771158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0701"
FT                   /product="putative outer membrane protein, probably
FT                   involved in nutrient binding"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51051"
FT                   /db_xref="GOA:D5BG92"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG92"
FT                   /protein_id="ADF51051.1"
FT                   /translation="MNTIKRRCRFLTTTIFMLTIYAIGTQQLKAHSNKSSNLDEVIQLL
FT                   ARNYGSINFVYNTKAFKEVVVSDFSPTNNGIENELHQLQQLVPLSYIKKRFTIALKLNK
FT                   EIEQERIITGTVTDSDNLPIPGASVFVQDTNIGTAADFEGNFTLEVPEDARSLSVTYMG
FT                   YKKQIVNIENRTEIDIILQTDAASLEEVVLVGYGQTSRETLVDAVSKVDAEQIQQRPIA
FT                   DVSAGLQGLSPGLNVTQSSGDPAAKPRINIRGFTSINGGEPLVIIDGVEGDINNLNPND
FT                   IESISVLKDAGASAIYGARGAFGVVLISTKNPKTGNLTVSVDATTAWNSPTVNTDFLTD
FT                   PYKAVMLVDESFRTAVGRSYTGYNEEDYQNIYEVSQDPSLARVETDIRNGREQYIYYGH
FT                   TDWWNYFFRDSYPTQIYNVSVSGGSDKIKGFFSYRNYNSEGILKVQDDHYKIYNLRGKL
FT                   EMKINDWISFTNNMQYNSSNDLKHGGSQYGWGDQFNGNIYVHGLPSYMPQNPDGTATWR
FT                   TELNNYTIGDGAYASLLYGKAKQETEEGEFSNIATLKLNPVKGLDVTASYAYRRTNYNR
FT                   YRRSVNIPYSIYPGEVNTMGTDQLTEYNTRFKYDAFNIYGDYHHQIGDHSLKATLGFNQ
FT                   ESFYNKSTTASKQNSISDDLNSLGLATSNPEALGSAAEWALQGVFYRLSYDYKDKYLLE
FT                   VNGRYDGTSRFPEEERWGFFPSVSGGWLINKENFFSSLTDTFNLVKLRASYGSLGNQEV
FT                   ANYAYIPTLRKNIDGNFALNGRTLDYIAAPGLNPREISWEEVKTFDVGTDIALFNNDVN
FT                   ITFDWFQRSTKGMLTQGATLPSVLGTGSPQENAADLRTRGFELSIGYHHSFEVAKSPLN
FT                   FGIEGNLSNSVTEITKFDNPNNSLLDYYEGMTIGELWGYHVDGLFQTQDEITGHADQTR
FT                   VSNRIIANGGLQLGDVRYVDLNGDGVIDEGENTLQDSGDRRKIGNTAPQYLYSFRVNAA
FT                   WKGFDVSVFFQGVGKQDWYPNGDSRIFWAMYNRPYDTFIRKDLVNNIWSPDNREAYFPR
FT                   LFGYIALSDSDALGAVNDRYLQSVAYLRLKNLSLGYTIPKRITEKFNISKFRIYFSGEN
FT                   LFTFTSLTDYIDPEAASNSVNLNQPSTSANRSTAQTVPFNETYSVGLSLQF"
FT   gene            771164..772906
FT                   /locus_tag="ZPR_0702"
FT   CDS_pept        771164..772906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0702"
FT                   /product="putative outer membrane protein, probably
FT                   involved in nutrient binding"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51052"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG93"
FT                   /protein_id="ADF51052.1"
FT                   /translation="MTMKNIKIIFILLLAVLTGCSDDLLNKEPLSDVTEDNFFTKASDL
FT                   QLYTNGFYRLLPSTSIYNGDTRAGNILETTLSEEMRSARTIPTTGGGWDWGYLRDINYF
FT                   LENYQRGDNASAIAHYGGVARFFRAYFYFDKLKRFGEVPYYDYTIDPDDEESLQKPRDS
FT                   RQFIVEKILEDLDVAIENLNQDQQLYTVTKYTALALKSRVGLYEGTYEKYRNISGYETY
FT                   LEASIEASEELMNNSPYKVFSSGNPSSDYLNLFNSHDAVGTEVIFAREFNTALDVDHNV
FT                   NYYTTTSSYGRPGMPKDLVNTYLNADGSRFTDRPDYNQVFFTEEVANRDPRLSQTIRTP
FT                   GYTRKGQTQELPPNLGATVTGYQIIKYVTEPQYDTNDQSITDLPIFRFGEIILNFAEAK
FT                   AELGTVSQTDIDNSINVLRNRVAMPHITINAANNDPDPYMQNQYPQVKGNNAGLLLEIR
FT                   RERRIELYMENFFWDDMVRWKAGQFITRPLRGLYVPGPGEYDFDGDGDTDVVFYKDDAP
FT                   GNQIEGIQYLKLDSDVFLSENNLIDPQPNFNNRSFNENKDYLYPIPRIELQLNPNLEQN
FT                   PGWE"
FT   gene            complement(773300..774418)
FT                   /locus_tag="ZPR_0703"
FT   CDS_pept        complement(773300..774418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0703"
FT                   /product="protein containing BNR/Asp-box repeat"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51053"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG94"
FT                   /protein_id="ADF51053.1"
FT                   /translation="MKTRPSLGILVALLFSLPGIAQQTYQPMSALNVEIDTIPVSFPEQ
FT                   EQFKNEVTGNTVKVLHAVENTGFQFYNSVSFRNDKEGIIAGGTRLRLRSTQDGGKHWKG
FT                   FSFSGFANAFYSTAIYENQFYVVGASRYIFRNDDLNTEWEAFDVNTLGESKYALRHPKF
FT                   YKIKFSLSGFGIIVGDNNGKPLVLKTTDKGVHWKKVKLNGLQTDEVSLSDVFIFPDDTI
FT                   RLLSFTGNVYESSNEGKDWSLLRRGKEGESLNSIAFATKKEGYISGLQGLLLKTTDGGK
FT                   TWEQIDTTVLGSGANISNLEYTKDHRLLLTTAESFQDEKNNAPIFSIDKEGKISPFLSA
FT                   KGQTFVFDTYGLFLLNDNVFLLDRDKLYKIKV"
FT   gene            774707..774952
FT                   /locus_tag="ZPR_0704"
FT   CDS_pept        774707..774952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0704"
FT                   /product="transcriptional regulator/antitoxin, MazE"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0704"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51054"
FT                   /db_xref="GOA:D5BG95"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG95"
FT                   /protein_id="ADF51054.1"
FT                   /translation="MEASIIKIGNSKGLRLSKTILEKYHIKDKVELILEKGQIILRPID
FT                   SPRKNWEEKFKKMAENEDDQLLMNDVFDDENFEEWI"
FT   gene            775081..775266
FT                   /locus_tag="ZPR_0705"
FT   CDS_pept        775081..775266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0705"
FT                   /product="PemK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0705"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51055"
FT                   /db_xref="GOA:D5BG96"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG96"
FT                   /protein_id="ADF51055.1"
FT                   /translation="MTTNTKKYPTRILVKSNGKNGMIAIDQVRTIDKQRIVKVFESLSN
FT                   SDIKKCKKVLKETLLD"
FT   gene            775410..776426
FT                   /locus_tag="ZPR_0706"
FT   CDS_pept        775410..776426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0706"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51056"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG97"
FT                   /protein_id="ADF51056.1"
FT                   /translation="MKKVFGILFTICLWLFSCSKKADDTDHKSDLSNYHFNGKIKSVKS
FT                   ELFNLIIEKDTFKIGEKINSLAFDRNSLLEFNELGNLTSVKEFLYNGKVIKEDIYTYDK
FT                   NDLLIKRKEIDNYGKGSFLYFEFKYDSRDSLTSVLISSDGFKRTLKIERDSNNRPIERK
FT                   TIQNDTVQLTYIVKYDKNDNLISESQFRHKSAPVKLIERSFNSQNLKEKEKIIEYRTWD
FT                   TIRVEKEYLYNNKNQLVIEKFNIENDSSFEIKNKYHKNGELKESITVMGENEFVIIERN
FT                   NENGDLTKKAVKTNDGKTNDVWSYDFKYDSENNWIEKIEFKNNKPLRIVKRKIEYYK"
FT   gene            776675..778198
FT                   /locus_tag="ZPR_0707"
FT   CDS_pept        776675..778198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0707"
FT                   /product="glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0707"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51057"
FT                   /db_xref="GOA:D5BG98"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG98"
FT                   /protein_id="ADF51057.1"
FT                   /translation="MKNKLWILIGFILLKFILQYILISPEYELQRDEYLYLDQAHYLAW
FT                   GYLSVPPVSSWISSIIYFLGNSVFWVKFFPALFGSLTIVVVWKTIEELKGNLFALTLGA
FT                   TGVLFSALLRLNTLYQPNSLDVLCWAAVYFFLIKYLNTQRSKWLYTLAMVFAIGFLNKY
FT                   NIVFLLIGLIPAILMTNQRKLLLKKEVYLAMLLALGIILPNLVWQYTNNFPVIHHMEEL
FT                   SETQLVNVDRMEFLQSQILFFIGALPVIISGLWALLFYRPFQKYQSFFWAFFFTLLVFM
FT                   YFRAKDYYAIGLYPIYIAFGAVFLADFLKAGWKQYLNPVVIAIPIVLFIPMYQIAFPNK
FT                   SPEWIVNHSDTYKEYGLLRWEDGTDHSIPQDYADMLGWKELARKVDAIYISLPNPSQTL
FT                   VLCDNYGQAGAINYYTRKHIKAVSFNADYVNWFDLEPQYVNLIRIKNYKEKDDELIETS
FT                   PYFDKAVVADSITNPYAREFRTLIFAFTGAQVDVNERIKDEIREAKNDR"
FT   gene            complement(778338..778820)
FT                   /locus_tag="ZPR_0708"
FT   CDS_pept        complement(778338..778820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0708"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51058"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5BG99"
FT                   /protein_id="ADF51058.1"
FT                   /translation="MNGITSILLDCSFCIRLLKRDDEFHQNCVDYFKHFIENNIEMYLS
FT                   TIVVSEYAVGDNPENLLSLNSFRLLEFDFKDAKFSGKFLSYLKALGKFGDFGERKVVIN
FT                   DIKLFAQIHNRKIDAYITKDRKSFKKMIAPLKEEFNLKLEVIDLTTPLNSKLGRLF"
FT   gene            complement(778817..779584)
FT                   /locus_tag="ZPR_0709"
FT   CDS_pept        complement(778817..779584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0709"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0709"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51059"
FT                   /db_xref="UniProtKB/TrEMBL:D5BGA0"
FT                   /protein_id="ADF51059.1"
FT                   /translation="MEEQGYIELRVTNRDNSLSPKDIDINEIKDFISDIETFLYPNRKE
FT                   KRNRPHISYDIEKGSAKHKFFLPITAVILFNGLTSEIKNRRNLDFLDYKRQSIIDKFQK
FT                   KALKEGYKIEFNNSMQNHPTLVIDETTDYEMIAPTFFESEFYLYGEIYQEGGKNPNLHI
FT                   STSKYGNITVSATKEQIMNGEKKTYKPYGVKVRGKKNLEDDSLSDLVLLEFIQYKPLFN
FT                   QSLLDKVIDKASENLNKITDVDTWLDDIKAEGV"
FT   gene            779913..780284
FT                   /locus_tag="ZPR_0710"
FT   CDS_pept        779913..780284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ZPR_0710"
FT                   /product="mepB protein"
FT                   /db_xref="EnsemblGenomes-Gn:ZPR_0710"
FT                   /db_xref="EnsemblGenomes-Tr:ADF51060"
FT                   /db_xref="InterPro:IPR011235"
FT                   /db_xref="InterPro:IPR038231"
FT                   /db_xref="UniProtKB/TrEMBL: