(data stored in ACNUC7421 zone)

EMBL: CP001654

ID   CP001654; SV 1; circular; genomic DNA; STD; PRO; 4679450 BP.
XX
AC   CP001654;
XX
PR   Project:PRJNA33069;
XX
DT   28-JUN-2009 (Rel. 101, Created)
DT   28-OCT-2017 (Rel. 134, Last updated, Version 7)
XX
DE   Dickeya paradisiaca Ech703 chromosome, complete genome.
XX
KW   .
XX
OS   Dickeya paradisiaca Ech703
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Pectobacteriaceae; Dickeya.
XX
RN   [1]
RP   1-4679450
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Balakrishnan V., Glasner J., Perna N.T.;
RT   "Complete sequence of Dickeya dadantii Ech703";
RL   Unpublished.
XX
RN   [2]
RP   1-4679450
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Balakrishnan V., Glasner J., Perna N.T.;
RT   ;
RL   Submitted (24-JUN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; c37aa553010deb1c3ca9683377fc8d82.
DR   BioSample; SAMN02598494.
DR   EnsemblGenomes-Gn; Dd703_R0001.
DR   EnsemblGenomes-Gn; Dd703_R0002.
DR   EnsemblGenomes-Gn; Dd703_R0003.
DR   EnsemblGenomes-Gn; Dd703_R0004.
DR   EnsemblGenomes-Gn; Dd703_R0005.
DR   EnsemblGenomes-Gn; Dd703_R0006.
DR   EnsemblGenomes-Gn; Dd703_R0007.
DR   EnsemblGenomes-Gn; Dd703_R0008.
DR   EnsemblGenomes-Gn; Dd703_R0009.
DR   EnsemblGenomes-Gn; Dd703_R0010.
DR   EnsemblGenomes-Gn; Dd703_R0011.
DR   EnsemblGenomes-Gn; Dd703_R0012.
DR   EnsemblGenomes-Gn; Dd703_R0013.
DR   EnsemblGenomes-Gn; Dd703_R0014.
DR   EnsemblGenomes-Gn; Dd703_R0015.
DR   EnsemblGenomes-Gn; Dd703_R0016.
DR   EnsemblGenomes-Gn; Dd703_R0017.
DR   EnsemblGenomes-Gn; Dd703_R0018.
DR   EnsemblGenomes-Gn; Dd703_R0019.
DR   EnsemblGenomes-Gn; Dd703_R0020.
DR   EnsemblGenomes-Gn; Dd703_R0021.
DR   EnsemblGenomes-Gn; Dd703_R0022.
DR   EnsemblGenomes-Gn; Dd703_R0023.
DR   EnsemblGenomes-Gn; Dd703_R0024.
DR   EnsemblGenomes-Gn; Dd703_R0025.
DR   EnsemblGenomes-Gn; Dd703_R0026.
DR   EnsemblGenomes-Gn; Dd703_R0027.
DR   EnsemblGenomes-Gn; Dd703_R0028.
DR   EnsemblGenomes-Gn; Dd703_R0029.
DR   EnsemblGenomes-Gn; Dd703_R0030.
DR   EnsemblGenomes-Gn; Dd703_R0031.
DR   EnsemblGenomes-Gn; Dd703_R0032.
DR   EnsemblGenomes-Gn; Dd703_R0033.
DR   EnsemblGenomes-Gn; Dd703_R0034.
DR   EnsemblGenomes-Gn; Dd703_R0035.
DR   EnsemblGenomes-Gn; Dd703_R0036.
DR   EnsemblGenomes-Gn; Dd703_R0037.
DR   EnsemblGenomes-Gn; Dd703_R0038.
DR   EnsemblGenomes-Gn; Dd703_R0039.
DR   EnsemblGenomes-Gn; Dd703_R0040.
DR   EnsemblGenomes-Gn; Dd703_R0041.
DR   EnsemblGenomes-Gn; Dd703_R0042.
DR   EnsemblGenomes-Gn; Dd703_R0043.
DR   EnsemblGenomes-Gn; Dd703_R0044.
DR   EnsemblGenomes-Gn; Dd703_R0045.
DR   EnsemblGenomes-Gn; Dd703_R0046.
DR   EnsemblGenomes-Gn; Dd703_R0047.
DR   EnsemblGenomes-Gn; Dd703_R0048.
DR   EnsemblGenomes-Gn; Dd703_R0049.
DR   EnsemblGenomes-Gn; Dd703_R0050.
DR   EnsemblGenomes-Gn; Dd703_R0051.
DR   EnsemblGenomes-Gn; Dd703_R0052.
DR   EnsemblGenomes-Gn; Dd703_R0053.
DR   EnsemblGenomes-Gn; Dd703_R0054.
DR   EnsemblGenomes-Gn; Dd703_R0055.
DR   EnsemblGenomes-Gn; Dd703_R0056.
DR   EnsemblGenomes-Gn; Dd703_R0057.
DR   EnsemblGenomes-Gn; Dd703_R0058.
DR   EnsemblGenomes-Gn; Dd703_R0059.
DR   EnsemblGenomes-Gn; Dd703_R0060.
DR   EnsemblGenomes-Gn; Dd703_R0061.
DR   EnsemblGenomes-Gn; Dd703_R0062.
DR   EnsemblGenomes-Gn; Dd703_R0063.
DR   EnsemblGenomes-Gn; Dd703_R0064.
DR   EnsemblGenomes-Gn; Dd703_R0065.
DR   EnsemblGenomes-Gn; Dd703_R0066.
DR   EnsemblGenomes-Gn; Dd703_R0067.
DR   EnsemblGenomes-Gn; Dd703_R0068.
DR   EnsemblGenomes-Gn; Dd703_R0069.
DR   EnsemblGenomes-Gn; Dd703_R0070.
DR   EnsemblGenomes-Gn; Dd703_R0071.
DR   EnsemblGenomes-Gn; Dd703_R0072.
DR   EnsemblGenomes-Gn; Dd703_R0073.
DR   EnsemblGenomes-Gn; Dd703_R0074.
DR   EnsemblGenomes-Gn; Dd703_R0075.
DR   EnsemblGenomes-Gn; Dd703_R0076.
DR   EnsemblGenomes-Gn; Dd703_R0077.
DR   EnsemblGenomes-Gn; Dd703_R0078.
DR   EnsemblGenomes-Gn; Dd703_R0079.
DR   EnsemblGenomes-Gn; Dd703_R0080.
DR   EnsemblGenomes-Gn; Dd703_R0081.
DR   EnsemblGenomes-Gn; Dd703_R0082.
DR   EnsemblGenomes-Gn; Dd703_R0083.
DR   EnsemblGenomes-Gn; Dd703_R0084.
DR   EnsemblGenomes-Gn; Dd703_R0085.
DR   EnsemblGenomes-Gn; Dd703_R0086.
DR   EnsemblGenomes-Gn; Dd703_R0087.
DR   EnsemblGenomes-Gn; Dd703_R0088.
DR   EnsemblGenomes-Gn; Dd703_R0089.
DR   EnsemblGenomes-Gn; Dd703_R0090.
DR   EnsemblGenomes-Gn; Dd703_R0091.
DR   EnsemblGenomes-Gn; Dd703_R0092.
DR   EnsemblGenomes-Gn; Dd703_R0093.
DR   EnsemblGenomes-Gn; Dd703_R0094.
DR   EnsemblGenomes-Gn; Dd703_R0095.
DR   EnsemblGenomes-Gn; Dd703_R0096.
DR   EnsemblGenomes-Gn; Dd703_R0097.
DR   EnsemblGenomes-Gn; Dd703_R0098.
DR   EnsemblGenomes-Gn; Dd703_R0099.
DR   EnsemblGenomes-Gn; Dd703_R0100.
DR   EnsemblGenomes-Gn; EBG00001027111.
DR   EnsemblGenomes-Gn; EBG00001027114.
DR   EnsemblGenomes-Gn; EBG00001027117.
DR   EnsemblGenomes-Gn; EBG00001027122.
DR   EnsemblGenomes-Gn; EBG00001027126.
DR   EnsemblGenomes-Gn; EBG00001027129.
DR   EnsemblGenomes-Gn; EBG00001027132.
DR   EnsemblGenomes-Gn; EBG00001027135.
DR   EnsemblGenomes-Gn; EBG00001027137.
DR   EnsemblGenomes-Gn; EBG00001027140.
DR   EnsemblGenomes-Gn; EBG00001027143.
DR   EnsemblGenomes-Gn; EBG00001027146.
DR   EnsemblGenomes-Gn; EBG00001027149.
DR   EnsemblGenomes-Gn; EBG00001027152.
DR   EnsemblGenomes-Gn; EBG00001027155.
DR   EnsemblGenomes-Gn; EBG00001027158.
DR   EnsemblGenomes-Gn; EBG00001027161.
DR   EnsemblGenomes-Gn; EBG00001027164.
DR   EnsemblGenomes-Gn; EBG00001027167.
DR   EnsemblGenomes-Gn; EBG00001027170.
DR   EnsemblGenomes-Gn; EBG00001027172.
DR   EnsemblGenomes-Gn; EBG00001027175.
DR   EnsemblGenomes-Gn; EBG00001027178.
DR   EnsemblGenomes-Gn; EBG00001027181.
DR   EnsemblGenomes-Gn; EBG00001027184.
DR   EnsemblGenomes-Gn; EBG00001027187.
DR   EnsemblGenomes-Gn; EBG00001027190.
DR   EnsemblGenomes-Gn; EBG00001027193.
DR   EnsemblGenomes-Gn; EBG00001027196.
DR   EnsemblGenomes-Gn; EBG00001027199.
DR   EnsemblGenomes-Gn; EBG00001027202.
DR   EnsemblGenomes-Gn; EBG00001027205.
DR   EnsemblGenomes-Gn; EBG00001027208.
DR   EnsemblGenomes-Gn; EBG00001027211.
DR   EnsemblGenomes-Gn; EBG00001027214.
DR   EnsemblGenomes-Gn; EBG00001027217.
DR   EnsemblGenomes-Gn; EBG00001027220.
DR   EnsemblGenomes-Gn; EBG00001027223.
DR   EnsemblGenomes-Gn; EBG00001027226.
DR   EnsemblGenomes-Gn; EBG00001027229.
DR   EnsemblGenomes-Gn; EBG00001027232.
DR   EnsemblGenomes-Gn; EBG00001027235.
DR   EnsemblGenomes-Gn; EBG00001027238.
DR   EnsemblGenomes-Gn; EBG00001027241.
DR   EnsemblGenomes-Gn; EBG00001027245.
DR   EnsemblGenomes-Gn; EBG00001027248.
DR   EnsemblGenomes-Gn; EBG00001027251.
DR   EnsemblGenomes-Gn; EBG00001027254.
DR   EnsemblGenomes-Gn; EBG00001027257.
DR   EnsemblGenomes-Gn; EBG00001027260.
DR   EnsemblGenomes-Gn; EBG00001027262.
DR   EnsemblGenomes-Gn; EBG00001027266.
DR   EnsemblGenomes-Gn; EBG00001027269.
DR   EnsemblGenomes-Gn; EBG00001027270.
DR   EnsemblGenomes-Gn; EBG00001027273.
DR   EnsemblGenomes-Gn; EBG00001027276.
DR   EnsemblGenomes-Gn; EBG00001027279.
DR   EnsemblGenomes-Gn; EBG00001027281.
DR   EnsemblGenomes-Gn; EBG00001027284.
DR   EnsemblGenomes-Gn; EBG00001027287.
DR   EnsemblGenomes-Gn; EBG00001027289.
DR   EnsemblGenomes-Gn; EBG00001027293.
DR   EnsemblGenomes-Gn; EBG00001027296.
DR   EnsemblGenomes-Gn; EBG00001027300.
DR   EnsemblGenomes-Gn; EBG00001027303.
DR   EnsemblGenomes-Gn; EBG00001027306.
DR   EnsemblGenomes-Gn; EBG00001027307.
DR   EnsemblGenomes-Gn; EBG00001027310.
DR   EnsemblGenomes-Gn; EBG00001027313.
DR   EnsemblGenomes-Gn; EBG00001027316.
DR   EnsemblGenomes-Gn; EBG00001027319.
DR   EnsemblGenomes-Gn; EBG00001027322.
DR   EnsemblGenomes-Gn; EBG00001027325.
DR   EnsemblGenomes-Gn; EBG00001027327.
DR   EnsemblGenomes-Gn; EBG00001027330.
DR   EnsemblGenomes-Gn; EBG00001027332.
DR   EnsemblGenomes-Gn; EBG00001027335.
DR   EnsemblGenomes-Gn; EBG00001027337.
DR   EnsemblGenomes-Gn; EBG00001027340.
DR   EnsemblGenomes-Gn; EBG00001027344.
DR   EnsemblGenomes-Gn; EBG00001027347.
DR   EnsemblGenomes-Gn; EBG00001027349.
DR   EnsemblGenomes-Gn; EBG00001027352.
DR   EnsemblGenomes-Gn; EBG00001027355.
DR   EnsemblGenomes-Gn; EBG00001027358.
DR   EnsemblGenomes-Gn; EBG00001027362.
DR   EnsemblGenomes-Gn; EBG00001027365.
DR   EnsemblGenomes-Gn; EBG00001027368.
DR   EnsemblGenomes-Gn; EBG00001027371.
DR   EnsemblGenomes-Gn; EBG00001027374.
DR   EnsemblGenomes-Gn; EBG00001027377.
DR   EnsemblGenomes-Gn; EBG00001027380.
DR   EnsemblGenomes-Gn; EBG00001027382.
DR   EnsemblGenomes-Gn; EBG00001027384.
DR   EnsemblGenomes-Gn; EBG00001027387.
DR   EnsemblGenomes-Gn; EBG00001027389.
DR   EnsemblGenomes-Gn; EBG00001027392.
DR   EnsemblGenomes-Gn; EBG00001027394.
DR   EnsemblGenomes-Gn; EBG00001027396.
DR   EnsemblGenomes-Gn; EBG00001027398.
DR   EnsemblGenomes-Gn; EBG00001027401.
DR   EnsemblGenomes-Gn; EBG00001027403.
DR   EnsemblGenomes-Gn; EBG00001027405.
DR   EnsemblGenomes-Gn; EBG00001027407.
DR   EnsemblGenomes-Gn; EBG00001027409.
DR   EnsemblGenomes-Gn; EBG00001027414.
DR   EnsemblGenomes-Gn; EBG00001027418.
DR   EnsemblGenomes-Gn; EBG00001027422.
DR   EnsemblGenomes-Gn; EBG00001027424.
DR   EnsemblGenomes-Gn; EBG00001027425.
DR   EnsemblGenomes-Gn; EBG00001027427.
DR   EnsemblGenomes-Gn; EBG00001027429.
DR   EnsemblGenomes-Gn; EBG00001027430.
DR   EnsemblGenomes-Gn; EBG00001027431.
DR   EnsemblGenomes-Gn; EBG00001027433.
DR   EnsemblGenomes-Gn; EBG00001027434.
DR   EnsemblGenomes-Gn; EBG00001027436.
DR   EnsemblGenomes-Gn; EBG00001027437.
DR   EnsemblGenomes-Gn; EBG00001027438.
DR   EnsemblGenomes-Gn; EBG00001027440.
DR   EnsemblGenomes-Gn; EBG00001027442.
DR   EnsemblGenomes-Gn; EBG00001027444.
DR   EnsemblGenomes-Gn; EBG00001027446.
DR   EnsemblGenomes-Gn; EBG00001027448.
DR   EnsemblGenomes-Gn; EBG00001027451.
DR   EnsemblGenomes-Gn; EBG00001027454.
DR   EnsemblGenomes-Gn; EBG00001027456.
DR   EnsemblGenomes-Gn; EBG00001027457.
DR   EnsemblGenomes-Gn; EBG00001027458.
DR   EnsemblGenomes-Gn; EBG00001027459.
DR   EnsemblGenomes-Gn; EBG00001027460.
DR   EnsemblGenomes-Gn; EBG00001027461.
DR   EnsemblGenomes-Gn; EBG00001027462.
DR   EnsemblGenomes-Gn; EBG00001027463.
DR   EnsemblGenomes-Gn; EBG00001027464.
DR   EnsemblGenomes-Gn; EBG00001027465.
DR   EnsemblGenomes-Gn; EBG00001027466.
DR   EnsemblGenomes-Gn; EBG00001027467.
DR   EnsemblGenomes-Gn; EBG00001027468.
DR   EnsemblGenomes-Gn; EBG00001027469.
DR   EnsemblGenomes-Gn; EBG00001027470.
DR   EnsemblGenomes-Gn; EBG00001027471.
DR   EnsemblGenomes-Gn; EBG00001027472.
DR   EnsemblGenomes-Gn; EBG00001027473.
DR   EnsemblGenomes-Gn; EBG00001027474.
DR   EnsemblGenomes-Gn; EBG00001027475.
DR   EnsemblGenomes-Gn; EBG00001027476.
DR   EnsemblGenomes-Gn; EBG00001027477.
DR   EnsemblGenomes-Gn; EBG00001027478.
DR   EnsemblGenomes-Gn; EBG00001027479.
DR   EnsemblGenomes-Gn; EBG00001027480.
DR   EnsemblGenomes-Gn; EBG00001027481.
DR   EnsemblGenomes-Gn; EBG00001027482.
DR   EnsemblGenomes-Gn; EBG00001027483.
DR   EnsemblGenomes-Gn; EBG00001027484.
DR   EnsemblGenomes-Gn; EBG00001027485.
DR   EnsemblGenomes-Gn; EBG00001027486.
DR   EnsemblGenomes-Gn; EBG00001027487.
DR   EnsemblGenomes-Gn; EBG00001027488.
DR   EnsemblGenomes-Gn; EBG00001027489.
DR   EnsemblGenomes-Gn; EBG00001027490.
DR   EnsemblGenomes-Gn; EBG00001027491.
DR   EnsemblGenomes-Gn; EBG00001027492.
DR   EnsemblGenomes-Gn; EBG00001027493.
DR   EnsemblGenomes-Gn; EBG00001027494.
DR   EnsemblGenomes-Gn; EBG00001027495.
DR   EnsemblGenomes-Gn; EBG00001027496.
DR   EnsemblGenomes-Gn; EBG00001027497.
DR   EnsemblGenomes-Gn; EBG00001027498.
DR   EnsemblGenomes-Gn; EBG00001027499.
DR   EnsemblGenomes-Gn; EBG00001027500.
DR   EnsemblGenomes-Gn; EBG00001027501.
DR   EnsemblGenomes-Gn; EBG00001027502.
DR   EnsemblGenomes-Gn; EBG00001027503.
DR   EnsemblGenomes-Gn; EBG00001027504.
DR   EnsemblGenomes-Gn; EBG00001027505.
DR   EnsemblGenomes-Gn; EBG00001027506.
DR   EnsemblGenomes-Gn; EBG00001027507.
DR   EnsemblGenomes-Gn; EBG00001027508.
DR   EnsemblGenomes-Gn; EBG00001027509.
DR   EnsemblGenomes-Gn; EBG00001027510.
DR   EnsemblGenomes-Gn; EBG00001027511.
DR   EnsemblGenomes-Gn; EBG00001027512.
DR   EnsemblGenomes-Gn; EBG00001027513.
DR   EnsemblGenomes-Gn; EBG00001027514.
DR   EnsemblGenomes-Gn; EBG00001027515.
DR   EnsemblGenomes-Gn; EBG00001027516.
DR   EnsemblGenomes-Gn; EBG00001027517.
DR   EnsemblGenomes-Gn; EBG00001027518.
DR   EnsemblGenomes-Gn; EBG00001027519.
DR   EnsemblGenomes-Gn; EBG00001027520.
DR   EnsemblGenomes-Gn; EBG00001027521.
DR   EnsemblGenomes-Gn; EBG00001027522.
DR   EnsemblGenomes-Gn; EBG00001027523.
DR   EnsemblGenomes-Gn; EBG00001027524.
DR   EnsemblGenomes-Gn; EBG00001027525.
DR   EnsemblGenomes-Gn; EBG00001027526.
DR   EnsemblGenomes-Gn; EBG00001027527.
DR   EnsemblGenomes-Gn; EBG00001027528.
DR   EnsemblGenomes-Gn; EBG00001027529.
DR   EnsemblGenomes-Gn; EBG00001027530.
DR   EnsemblGenomes-Gn; EBG00001027531.
DR   EnsemblGenomes-Gn; EBG00001027532.
DR   EnsemblGenomes-Gn; EBG00001027533.
DR   EnsemblGenomes-Gn; EBG00001027534.
DR   EnsemblGenomes-Gn; EBG00001027535.
DR   EnsemblGenomes-Gn; EBG00001027536.
DR   EnsemblGenomes-Gn; EBG00001027537.
DR   EnsemblGenomes-Gn; EBG00001027538.
DR   EnsemblGenomes-Gn; EBG00001027539.
DR   EnsemblGenomes-Gn; EBG00001027540.
DR   EnsemblGenomes-Gn; EBG00001027541.
DR   EnsemblGenomes-Gn; EBG00001027542.
DR   EnsemblGenomes-Gn; EBG00001027543.
DR   EnsemblGenomes-Gn; EBG00001027544.
DR   EnsemblGenomes-Gn; EBG00001027545.
DR   EnsemblGenomes-Gn; EBG00001027546.
DR   EnsemblGenomes-Gn; EBG00001027547.
DR   EnsemblGenomes-Gn; EBG00001027548.
DR   EnsemblGenomes-Gn; EBG00001027549.
DR   EnsemblGenomes-Gn; EBG00001027550.
DR   EnsemblGenomes-Gn; EBG00001027551.
DR   EnsemblGenomes-Gn; EBG00001027552.
DR   EnsemblGenomes-Gn; EBG00001027553.
DR   EnsemblGenomes-Gn; EBG00001027554.
DR   EnsemblGenomes-Gn; EBG00001027555.
DR   EnsemblGenomes-Gn; EBG00001027556.
DR   EnsemblGenomes-Gn; EBG00001027557.
DR   EnsemblGenomes-Gn; EBG00001027558.
DR   EnsemblGenomes-Gn; EBG00001027559.
DR   EnsemblGenomes-Gn; EBG00001027560.
DR   EnsemblGenomes-Gn; EBG00001027561.
DR   EnsemblGenomes-Gn; EBG00001027562.
DR   EnsemblGenomes-Gn; EBG00001027563.
DR   EnsemblGenomes-Gn; EBG00001027564.
DR   EnsemblGenomes-Gn; EBG00001027565.
DR   EnsemblGenomes-Gn; EBG00001027566.
DR   EnsemblGenomes-Gn; EBG00001027567.
DR   EnsemblGenomes-Gn; EBG00001027568.
DR   EnsemblGenomes-Gn; EBG00001027569.
DR   EnsemblGenomes-Gn; EBG00001027570.
DR   EnsemblGenomes-Gn; EBG00001027571.
DR   EnsemblGenomes-Gn; EBG00001027572.
DR   EnsemblGenomes-Gn; EBG00001027573.
DR   EnsemblGenomes-Tr; Dd703_R0001-1.
DR   EnsemblGenomes-Tr; Dd703_R0002-1.
DR   EnsemblGenomes-Tr; Dd703_R0003-1.
DR   EnsemblGenomes-Tr; Dd703_R0004-1.
DR   EnsemblGenomes-Tr; Dd703_R0005-1.
DR   EnsemblGenomes-Tr; Dd703_R0006-1.
DR   EnsemblGenomes-Tr; Dd703_R0007-1.
DR   EnsemblGenomes-Tr; Dd703_R0008-1.
DR   EnsemblGenomes-Tr; Dd703_R0009-1.
DR   EnsemblGenomes-Tr; Dd703_R0010-1.
DR   EnsemblGenomes-Tr; Dd703_R0011-1.
DR   EnsemblGenomes-Tr; Dd703_R0012-1.
DR   EnsemblGenomes-Tr; Dd703_R0013-1.
DR   EnsemblGenomes-Tr; Dd703_R0014-1.
DR   EnsemblGenomes-Tr; Dd703_R0015-1.
DR   EnsemblGenomes-Tr; Dd703_R0016-1.
DR   EnsemblGenomes-Tr; Dd703_R0017-1.
DR   EnsemblGenomes-Tr; Dd703_R0018-1.
DR   EnsemblGenomes-Tr; Dd703_R0019-1.
DR   EnsemblGenomes-Tr; Dd703_R0020-1.
DR   EnsemblGenomes-Tr; Dd703_R0021-1.
DR   EnsemblGenomes-Tr; Dd703_R0022-1.
DR   EnsemblGenomes-Tr; Dd703_R0023-1.
DR   EnsemblGenomes-Tr; Dd703_R0024-1.
DR   EnsemblGenomes-Tr; Dd703_R0025-1.
DR   EnsemblGenomes-Tr; Dd703_R0026-1.
DR   EnsemblGenomes-Tr; Dd703_R0027-1.
DR   EnsemblGenomes-Tr; Dd703_R0028-1.
DR   EnsemblGenomes-Tr; Dd703_R0029-1.
DR   EnsemblGenomes-Tr; Dd703_R0030-1.
DR   EnsemblGenomes-Tr; Dd703_R0031-1.
DR   EnsemblGenomes-Tr; Dd703_R0032-1.
DR   EnsemblGenomes-Tr; Dd703_R0033-1.
DR   EnsemblGenomes-Tr; Dd703_R0034-1.
DR   EnsemblGenomes-Tr; Dd703_R0035-1.
DR   EnsemblGenomes-Tr; Dd703_R0036-1.
DR   EnsemblGenomes-Tr; Dd703_R0037-1.
DR   EnsemblGenomes-Tr; Dd703_R0038-1.
DR   EnsemblGenomes-Tr; Dd703_R0039-1.
DR   EnsemblGenomes-Tr; Dd703_R0040-1.
DR   EnsemblGenomes-Tr; Dd703_R0041-1.
DR   EnsemblGenomes-Tr; Dd703_R0042-1.
DR   EnsemblGenomes-Tr; Dd703_R0043-1.
DR   EnsemblGenomes-Tr; Dd703_R0044-1.
DR   EnsemblGenomes-Tr; Dd703_R0045-1.
DR   EnsemblGenomes-Tr; Dd703_R0046-1.
DR   EnsemblGenomes-Tr; Dd703_R0047-1.
DR   EnsemblGenomes-Tr; Dd703_R0048-1.
DR   EnsemblGenomes-Tr; Dd703_R0049-1.
DR   EnsemblGenomes-Tr; Dd703_R0050-1.
DR   EnsemblGenomes-Tr; Dd703_R0051-1.
DR   EnsemblGenomes-Tr; Dd703_R0052-1.
DR   EnsemblGenomes-Tr; Dd703_R0053-1.
DR   EnsemblGenomes-Tr; Dd703_R0054-1.
DR   EnsemblGenomes-Tr; Dd703_R0055-1.
DR   EnsemblGenomes-Tr; Dd703_R0056-1.
DR   EnsemblGenomes-Tr; Dd703_R0057-1.
DR   EnsemblGenomes-Tr; Dd703_R0058-1.
DR   EnsemblGenomes-Tr; Dd703_R0059-1.
DR   EnsemblGenomes-Tr; Dd703_R0060-1.
DR   EnsemblGenomes-Tr; Dd703_R0061-1.
DR   EnsemblGenomes-Tr; Dd703_R0062-1.
DR   EnsemblGenomes-Tr; Dd703_R0063-1.
DR   EnsemblGenomes-Tr; Dd703_R0064-1.
DR   EnsemblGenomes-Tr; Dd703_R0065-1.
DR   EnsemblGenomes-Tr; Dd703_R0066-1.
DR   EnsemblGenomes-Tr; Dd703_R0067-1.
DR   EnsemblGenomes-Tr; Dd703_R0068-1.
DR   EnsemblGenomes-Tr; Dd703_R0069-1.
DR   EnsemblGenomes-Tr; Dd703_R0070-1.
DR   EnsemblGenomes-Tr; Dd703_R0071-1.
DR   EnsemblGenomes-Tr; Dd703_R0072-1.
DR   EnsemblGenomes-Tr; Dd703_R0073-1.
DR   EnsemblGenomes-Tr; Dd703_R0074-1.
DR   EnsemblGenomes-Tr; Dd703_R0075-1.
DR   EnsemblGenomes-Tr; Dd703_R0076-1.
DR   EnsemblGenomes-Tr; Dd703_R0077-1.
DR   EnsemblGenomes-Tr; Dd703_R0078-1.
DR   EnsemblGenomes-Tr; Dd703_R0079-1.
DR   EnsemblGenomes-Tr; Dd703_R0080-1.
DR   EnsemblGenomes-Tr; Dd703_R0081-1.
DR   EnsemblGenomes-Tr; Dd703_R0082-1.
DR   EnsemblGenomes-Tr; Dd703_R0083-1.
DR   EnsemblGenomes-Tr; Dd703_R0084-1.
DR   EnsemblGenomes-Tr; Dd703_R0085-1.
DR   EnsemblGenomes-Tr; Dd703_R0086-1.
DR   EnsemblGenomes-Tr; Dd703_R0087-1.
DR   EnsemblGenomes-Tr; Dd703_R0088-1.
DR   EnsemblGenomes-Tr; Dd703_R0089-1.
DR   EnsemblGenomes-Tr; Dd703_R0090-1.
DR   EnsemblGenomes-Tr; Dd703_R0091-1.
DR   EnsemblGenomes-Tr; Dd703_R0092-1.
DR   EnsemblGenomes-Tr; Dd703_R0093-1.
DR   EnsemblGenomes-Tr; Dd703_R0094-1.
DR   EnsemblGenomes-Tr; Dd703_R0095-1.
DR   EnsemblGenomes-Tr; Dd703_R0096-1.
DR   EnsemblGenomes-Tr; Dd703_R0097-1.
DR   EnsemblGenomes-Tr; Dd703_R0098-1.
DR   EnsemblGenomes-Tr; Dd703_R0099-1.
DR   EnsemblGenomes-Tr; Dd703_R0100-1.
DR   EnsemblGenomes-Tr; EBT00001630044.
DR   EnsemblGenomes-Tr; EBT00001630045.
DR   EnsemblGenomes-Tr; EBT00001630046.
DR   EnsemblGenomes-Tr; EBT00001630047.
DR   EnsemblGenomes-Tr; EBT00001630048.
DR   EnsemblGenomes-Tr; EBT00001630049.
DR   EnsemblGenomes-Tr; EBT00001630050.
DR   EnsemblGenomes-Tr; EBT00001630051.
DR   EnsemblGenomes-Tr; EBT00001630052.
DR   EnsemblGenomes-Tr; EBT00001630053.
DR   EnsemblGenomes-Tr; EBT00001630054.
DR   EnsemblGenomes-Tr; EBT00001630055.
DR   EnsemblGenomes-Tr; EBT00001630056.
DR   EnsemblGenomes-Tr; EBT00001630057.
DR   EnsemblGenomes-Tr; EBT00001630058.
DR   EnsemblGenomes-Tr; EBT00001630059.
DR   EnsemblGenomes-Tr; EBT00001630060.
DR   EnsemblGenomes-Tr; EBT00001630061.
DR   EnsemblGenomes-Tr; EBT00001630062.
DR   EnsemblGenomes-Tr; EBT00001630063.
DR   EnsemblGenomes-Tr; EBT00001630064.
DR   EnsemblGenomes-Tr; EBT00001630065.
DR   EnsemblGenomes-Tr; EBT00001630066.
DR   EnsemblGenomes-Tr; EBT00001630067.
DR   EnsemblGenomes-Tr; EBT00001630068.
DR   EnsemblGenomes-Tr; EBT00001630069.
DR   EnsemblGenomes-Tr; EBT00001630070.
DR   EnsemblGenomes-Tr; EBT00001630071.
DR   EnsemblGenomes-Tr; EBT00001630072.
DR   EnsemblGenomes-Tr; EBT00001630073.
DR   EnsemblGenomes-Tr; EBT00001630074.
DR   EnsemblGenomes-Tr; EBT00001630075.
DR   EnsemblGenomes-Tr; EBT00001630076.
DR   EnsemblGenomes-Tr; EBT00001630077.
DR   EnsemblGenomes-Tr; EBT00001630078.
DR   EnsemblGenomes-Tr; EBT00001630079.
DR   EnsemblGenomes-Tr; EBT00001630080.
DR   EnsemblGenomes-Tr; EBT00001630081.
DR   EnsemblGenomes-Tr; EBT00001630082.
DR   EnsemblGenomes-Tr; EBT00001630083.
DR   EnsemblGenomes-Tr; EBT00001630084.
DR   EnsemblGenomes-Tr; EBT00001630085.
DR   EnsemblGenomes-Tr; EBT00001630086.
DR   EnsemblGenomes-Tr; EBT00001630087.
DR   EnsemblGenomes-Tr; EBT00001630088.
DR   EnsemblGenomes-Tr; EBT00001630089.
DR   EnsemblGenomes-Tr; EBT00001630090.
DR   EnsemblGenomes-Tr; EBT00001630091.
DR   EnsemblGenomes-Tr; EBT00001630092.
DR   EnsemblGenomes-Tr; EBT00001630093.
DR   EnsemblGenomes-Tr; EBT00001630094.
DR   EnsemblGenomes-Tr; EBT00001630095.
DR   EnsemblGenomes-Tr; EBT00001630096.
DR   EnsemblGenomes-Tr; EBT00001630097.
DR   EnsemblGenomes-Tr; EBT00001630098.
DR   EnsemblGenomes-Tr; EBT00001630099.
DR   EnsemblGenomes-Tr; EBT00001630100.
DR   EnsemblGenomes-Tr; EBT00001630101.
DR   EnsemblGenomes-Tr; EBT00001630102.
DR   EnsemblGenomes-Tr; EBT00001630103.
DR   EnsemblGenomes-Tr; EBT00001630104.
DR   EnsemblGenomes-Tr; EBT00001630105.
DR   EnsemblGenomes-Tr; EBT00001630106.
DR   EnsemblGenomes-Tr; EBT00001630107.
DR   EnsemblGenomes-Tr; EBT00001630108.
DR   EnsemblGenomes-Tr; EBT00001630109.
DR   EnsemblGenomes-Tr; EBT00001630110.
DR   EnsemblGenomes-Tr; EBT00001630111.
DR   EnsemblGenomes-Tr; EBT00001630112.
DR   EnsemblGenomes-Tr; EBT00001630113.
DR   EnsemblGenomes-Tr; EBT00001630114.
DR   EnsemblGenomes-Tr; EBT00001630115.
DR   EnsemblGenomes-Tr; EBT00001630116.
DR   EnsemblGenomes-Tr; EBT00001630117.
DR   EnsemblGenomes-Tr; EBT00001630118.
DR   EnsemblGenomes-Tr; EBT00001630119.
DR   EnsemblGenomes-Tr; EBT00001630120.
DR   EnsemblGenomes-Tr; EBT00001630121.
DR   EnsemblGenomes-Tr; EBT00001630122.
DR   EnsemblGenomes-Tr; EBT00001630123.
DR   EnsemblGenomes-Tr; EBT00001630124.
DR   EnsemblGenomes-Tr; EBT00001630125.
DR   EnsemblGenomes-Tr; EBT00001630126.
DR   EnsemblGenomes-Tr; EBT00001630127.
DR   EnsemblGenomes-Tr; EBT00001630128.
DR   EnsemblGenomes-Tr; EBT00001630129.
DR   EnsemblGenomes-Tr; EBT00001630130.
DR   EnsemblGenomes-Tr; EBT00001630131.
DR   EnsemblGenomes-Tr; EBT00001630132.
DR   EnsemblGenomes-Tr; EBT00001630133.
DR   EnsemblGenomes-Tr; EBT00001630134.
DR   EnsemblGenomes-Tr; EBT00001630135.
DR   EnsemblGenomes-Tr; EBT00001630136.
DR   EnsemblGenomes-Tr; EBT00001630137.
DR   EnsemblGenomes-Tr; EBT00001630138.
DR   EnsemblGenomes-Tr; EBT00001630139.
DR   EnsemblGenomes-Tr; EBT00001630140.
DR   EnsemblGenomes-Tr; EBT00001630141.
DR   EnsemblGenomes-Tr; EBT00001630142.
DR   EnsemblGenomes-Tr; EBT00001630143.
DR   EnsemblGenomes-Tr; EBT00001630144.
DR   EnsemblGenomes-Tr; EBT00001630145.
DR   EnsemblGenomes-Tr; EBT00001630146.
DR   EnsemblGenomes-Tr; EBT00001630147.
DR   EnsemblGenomes-Tr; EBT00001630148.
DR   EnsemblGenomes-Tr; EBT00001630149.
DR   EnsemblGenomes-Tr; EBT00001630150.
DR   EnsemblGenomes-Tr; EBT00001630151.
DR   EnsemblGenomes-Tr; EBT00001630152.
DR   EnsemblGenomes-Tr; EBT00001630153.
DR   EnsemblGenomes-Tr; EBT00001630154.
DR   EnsemblGenomes-Tr; EBT00001630155.
DR   EnsemblGenomes-Tr; EBT00001630156.
DR   EnsemblGenomes-Tr; EBT00001630157.
DR   EnsemblGenomes-Tr; EBT00001630158.
DR   EnsemblGenomes-Tr; EBT00001630159.
DR   EnsemblGenomes-Tr; EBT00001630160.
DR   EnsemblGenomes-Tr; EBT00001630161.
DR   EnsemblGenomes-Tr; EBT00001630162.
DR   EnsemblGenomes-Tr; EBT00001630163.
DR   EnsemblGenomes-Tr; EBT00001630164.
DR   EnsemblGenomes-Tr; EBT00001630165.
DR   EnsemblGenomes-Tr; EBT00001630166.
DR   EnsemblGenomes-Tr; EBT00001630167.
DR   EnsemblGenomes-Tr; EBT00001630168.
DR   EnsemblGenomes-Tr; EBT00001630169.
DR   EnsemblGenomes-Tr; EBT00001630170.
DR   EnsemblGenomes-Tr; EBT00001630171.
DR   EnsemblGenomes-Tr; EBT00001630172.
DR   EnsemblGenomes-Tr; EBT00001630173.
DR   EnsemblGenomes-Tr; EBT00001630174.
DR   EnsemblGenomes-Tr; EBT00001630175.
DR   EnsemblGenomes-Tr; EBT00001630176.
DR   EnsemblGenomes-Tr; EBT00001630177.
DR   EnsemblGenomes-Tr; EBT00001630178.
DR   EnsemblGenomes-Tr; EBT00001630179.
DR   EnsemblGenomes-Tr; EBT00001630180.
DR   EnsemblGenomes-Tr; EBT00001630181.
DR   EnsemblGenomes-Tr; EBT00001630182.
DR   EnsemblGenomes-Tr; EBT00001630183.
DR   EnsemblGenomes-Tr; EBT00001630184.
DR   EnsemblGenomes-Tr; EBT00001630185.
DR   EnsemblGenomes-Tr; EBT00001630186.
DR   EnsemblGenomes-Tr; EBT00001630187.
DR   EnsemblGenomes-Tr; EBT00001630188.
DR   EnsemblGenomes-Tr; EBT00001630189.
DR   EnsemblGenomes-Tr; EBT00001630190.
DR   EnsemblGenomes-Tr; EBT00001630191.
DR   EnsemblGenomes-Tr; EBT00001630192.
DR   EnsemblGenomes-Tr; EBT00001630193.
DR   EnsemblGenomes-Tr; EBT00001630194.
DR   EnsemblGenomes-Tr; EBT00001630195.
DR   EnsemblGenomes-Tr; EBT00001630196.
DR   EnsemblGenomes-Tr; EBT00001630197.
DR   EnsemblGenomes-Tr; EBT00001630198.
DR   EnsemblGenomes-Tr; EBT00001630199.
DR   EnsemblGenomes-Tr; EBT00001630200.
DR   EnsemblGenomes-Tr; EBT00001630201.
DR   EnsemblGenomes-Tr; EBT00001630202.
DR   EnsemblGenomes-Tr; EBT00001630203.
DR   EnsemblGenomes-Tr; EBT00001630204.
DR   EnsemblGenomes-Tr; EBT00001630205.
DR   EnsemblGenomes-Tr; EBT00001630206.
DR   EnsemblGenomes-Tr; EBT00001630207.
DR   EnsemblGenomes-Tr; EBT00001630208.
DR   EnsemblGenomes-Tr; EBT00001630209.
DR   EnsemblGenomes-Tr; EBT00001630210.
DR   EnsemblGenomes-Tr; EBT00001630211.
DR   EnsemblGenomes-Tr; EBT00001630212.
DR   EnsemblGenomes-Tr; EBT00001630213.
DR   EnsemblGenomes-Tr; EBT00001630214.
DR   EnsemblGenomes-Tr; EBT00001630215.
DR   EnsemblGenomes-Tr; EBT00001630216.
DR   EnsemblGenomes-Tr; EBT00001630217.
DR   EnsemblGenomes-Tr; EBT00001630218.
DR   EnsemblGenomes-Tr; EBT00001630219.
DR   EnsemblGenomes-Tr; EBT00001630220.
DR   EnsemblGenomes-Tr; EBT00001630221.
DR   EnsemblGenomes-Tr; EBT00001630222.
DR   EnsemblGenomes-Tr; EBT00001630223.
DR   EnsemblGenomes-Tr; EBT00001630224.
DR   EnsemblGenomes-Tr; EBT00001630225.
DR   EnsemblGenomes-Tr; EBT00001630226.
DR   EnsemblGenomes-Tr; EBT00001630227.
DR   EnsemblGenomes-Tr; EBT00001630228.
DR   EnsemblGenomes-Tr; EBT00001630229.
DR   EnsemblGenomes-Tr; EBT00001630230.
DR   EnsemblGenomes-Tr; EBT00001630231.
DR   EnsemblGenomes-Tr; EBT00001630232.
DR   EnsemblGenomes-Tr; EBT00001630233.
DR   EnsemblGenomes-Tr; EBT00001630234.
DR   EnsemblGenomes-Tr; EBT00001630235.
DR   EnsemblGenomes-Tr; EBT00001630236.
DR   EnsemblGenomes-Tr; EBT00001630237.
DR   EnsemblGenomes-Tr; EBT00001630238.
DR   EnsemblGenomes-Tr; EBT00001630239.
DR   EnsemblGenomes-Tr; EBT00001630240.
DR   EnsemblGenomes-Tr; EBT00001630241.
DR   EnsemblGenomes-Tr; EBT00001630242.
DR   EnsemblGenomes-Tr; EBT00001630243.
DR   EnsemblGenomes-Tr; EBT00001630244.
DR   EnsemblGenomes-Tr; EBT00001630245.
DR   EnsemblGenomes-Tr; EBT00001630246.
DR   EnsemblGenomes-Tr; EBT00001630247.
DR   EnsemblGenomes-Tr; EBT00001630248.
DR   EnsemblGenomes-Tr; EBT00001630249.
DR   EnsemblGenomes-Tr; EBT00001630250.
DR   EnsemblGenomes-Tr; EBT00001630251.
DR   EnsemblGenomes-Tr; EBT00001630252.
DR   EnsemblGenomes-Tr; EBT00001630253.
DR   EnsemblGenomes-Tr; EBT00001630254.
DR   EnsemblGenomes-Tr; EBT00001630255.
DR   EnsemblGenomes-Tr; EBT00001630256.
DR   EnsemblGenomes-Tr; EBT00001630257.
DR   EnsemblGenomes-Tr; EBT00001630258.
DR   EnsemblGenomes-Tr; EBT00001630259.
DR   EnsemblGenomes-Tr; EBT00001630260.
DR   EnsemblGenomes-Tr; EBT00001630261.
DR   EnsemblGenomes-Tr; EBT00001630262.
DR   EnsemblGenomes-Tr; EBT00001630263.
DR   EnsemblGenomes-Tr; EBT00001630264.
DR   EnsemblGenomes-Tr; EBT00001630265.
DR   EnsemblGenomes-Tr; EBT00001630266.
DR   EnsemblGenomes-Tr; EBT00001630267.
DR   EnsemblGenomes-Tr; EBT00001630268.
DR   EnsemblGenomes-Tr; EBT00001630269.
DR   EnsemblGenomes-Tr; EBT00001630270.
DR   EnsemblGenomes-Tr; EBT00001630271.
DR   EnsemblGenomes-Tr; EBT00001630272.
DR   EnsemblGenomes-Tr; EBT00001630273.
DR   EnsemblGenomes-Tr; EBT00001630274.
DR   EnsemblGenomes-Tr; EBT00001630275.
DR   EnsemblGenomes-Tr; EBT00001630276.
DR   EnsemblGenomes-Tr; EBT00001630277.
DR   EnsemblGenomes-Tr; EBT00001630278.
DR   EnsemblGenomes-Tr; EBT00001630279.
DR   EnsemblGenomes-Tr; EBT00001630280.
DR   EnsemblGenomes-Tr; EBT00001630281.
DR   EnsemblGenomes-Tr; EBT00001630282.
DR   EnsemblGenomes-Tr; EBT00001630283.
DR   EnsemblGenomes-Tr; EBT00001630284.
DR   EnsemblGenomes-Tr; EBT00001630285.
DR   EnsemblGenomes-Tr; EBT00001630286.
DR   EnsemblGenomes-Tr; EBT00001630287.
DR   EuropePMC; PMC3343043; 22570692.
DR   EuropePMC; PMC4028081; 24735398.
DR   EuropePMC; PMC4522980; 26239726.
DR   EuropePMC; PMC4888284; 27257541.
DR   EuropePMC; PMC6025938; 29954894.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01056; Mg_sensor.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   SILVA-LSU; CP001654.
DR   SILVA-SSU; CP001654.
XX
CC   CP001654 was submitted as Dickeya dadantii Ech703, but it is
CC   99.9988% identical to the genome from Dickeya paradisiaca NCPPB
CC   2511 (WGS entry AONV00000000.1), the type strain of Dickeya
CC   paradisiaca
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085705
CC   Source DNA and bacteria available from Nicole T. Perna
CC   (ntperna@wisc.edu)
CC   Contacts: Nicole T. Perna (ntperna@wisc.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Dickeya dadantii Ech703
CC   GOLD Stamp ID         :: Gi03887
CC   Oxygen Requirement    :: Facultative
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: Soft rot
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4679450
FT                   /organism="Dickeya paradisiaca Ech703"
FT                   /strain="Ech703"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:579405"
FT   gene            188..1576
FT                   /locus_tag="Dd703_0001"
FT   CDS_pept        188..1576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: ypk:y4113 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83820"
FT                   /db_xref="GOA:C6C5K7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5K7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACS83820.1"
FT                   /translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNR
FT                   FVLDWVRDKYLNNINGLLNDFCGMDAPLLRFEVGSKPVSAVPVSSVGNSIAAPVPQVRA
FT                   ASLMRPSWDTQSAPTEHTYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPL
FT                   FLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYR
FT                   SVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRF
FT                   GWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIA
FT                   NANFTGRAITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVA
FT                   RPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIR
FT                   TLSS"
FT   gene            1581..2681
FT                   /locus_tag="Dd703_0002"
FT   CDS_pept        1581..2681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: eca:ECA4440 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83821"
FT                   /db_xref="GOA:C6C5K8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5K8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACS83821.1"
FT                   /translation="MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVSEGRLSLT
FT                   GTDLEMEMVAHVTLTQPHEPGATTVPARKLFDICRGLPDGAEITVTLEGDRMLVRSGRS
FT                   RFSLSTLPASDFPNLDDWQSEVAFELPQATLKRLIEATQFSMAHQDVRYYLNGMLFETS
FT                   GDGLRTVATDGHRLAVCSMPVGQPLPSHSVIVPRKGVMELVRLLDGGETPLQLQIGSNN
FT                   IRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEASCDLLRQAFARAAILSNEKFRGV
FT                   RLYLNQNQLRITANNPEQEEAEEILDVEYGGTEMEIGFNVSYVLDVLNALKCEDVRMLL
FT                   ADPASSVQLEDCASQAAAYVVMPMRL"
FT   gene            2800..3885
FT                   /locus_tag="Dd703_0003"
FT   CDS_pept        2800..3885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: eca:ECA4439 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83822"
FT                   /db_xref="GOA:C6C5K9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5K9"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACS83822.1"
FT                   /translation="MALTRLLIRDFRNIESADLALIPGFNFLVGANGSGKTSVLEAIYT
FT                   LGHGRAFRSIQAARVIRHDQAEFILHGRIAGAERERSVGLSKNRDGDSTVRIDGSDGHK
FT                   VAELAQLLPIQLITPEGFTLLNGGPKYRRAFLDWGCFHNEAGFFMAWSNLKRLLRQRNA
FT                   ALRQVNHYGQLRAWDQELVPLAERISQWRAEYSAAIATDIASTCAQFLPEFSLSFSFQR
FT                   GWDKESDYAELLERHFERDRQLGYTALGPHKADFRIRAGGVAVEDMLSRGQLKLLMCAL
FT                   RLAQGEFLTRQNGLKCLYLIDDFASELDSTRRRLLAERLKATQAQVFVSAITAEQISDM
FT                   VGENGKMFRVEQGKITVQSQD"
FT   gene            3903..6314
FT                   /locus_tag="Dd703_0004"
FT   CDS_pept        3903..6314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: eca:ECA4438 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83823"
FT                   /db_xref="GOA:C6C5L0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5L0"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACS83823.1"
FT                   /translation="MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGYCKDIVVTIHADNSVSVQDDGRGIPTGIHEEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELVIRREGKLHRQEYKHGEPQAPLAVVGDASTT
FT                   GTTVRFWPSLETFTNVVEFEYDILAKRLRELSFLNSGVSIRLRDEREENKADHFHYEGG
FT                   IKAFVDYLNRNKTPIHPQVFYFSAEKDGIGVEVAMQWNDGFQENIYCFTNNIPQRDGGT
FT                   HLAGFRAAMTRTLNNYMEKEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFSSQTKDK
FT                   LVSSEVKSAVESLMNDRLVDYLMENPSDAKIVVGKIIDAARAREAARKAREMTRRKGAL
FT                   DLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYR
FT                   QMPEIVERGHVFIAQPPLYKVKKGKQEQYIKDDEAMDQYQIMLALDGATLHTNAHAPAL
FT                   AGEPLEKLVAEHSGVQKLIDRLERRYPKALLNALVYQPALTEALLKDRAQVQQWIETLV
FT                   NHLHEQEQHGSAYSFVIRDLPERHEPVLRVRTHGVDSDYALDLAFVQGNEYRRINQLGE
FT                   KLRGLIEDGAFIERGERKQPVASFEQALEWLTKESRRGLAIQRYKGLGEMNPEQLWETT
FT                   MDPESRRMLRVTVKDAMAADELFTTLMGDAVEPRRAFIEENALKAANIDI"
FT   gene            complement(6528..7712)
FT                   /locus_tag="Dd703_0005"
FT   CDS_pept        complement(6528..7712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0005"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA4437 MFS efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83824"
FT                   /db_xref="GOA:C6C5L1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5L1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS83824.1"
FT                   /translation="MKMKKLPLLAQVSSAHWVSHFHMMVLPALMPLISAQRGISYVEIG
FT                   VALGVFNVVSALVQTPIGFAVDRIGPRRTLIAGLTLGSLCFLSLSLFTSYAWMIIAMAL
FT                   AGLANAVYHPSDYALLSRGIAENRMGRAFSIHTFSGFLGTAVAPAILLSVASIAHIAFA
FT                   FALAGVVGLLTVPLLLSEREAPVAAASRKNAAASRAGVFTLPVLVLLILFMLLNLSTNS
FT                   IQNFSVTALVNGYGMPLTQANMALTAFLFTSAFGVLAGGSLADKTRHHGLVATGSLLIT
FT                   AVLIAVVAVYPLPSPATILILGVAGFLSGIIAPSRDMLVRAVSPAGAEGRVFGIVTTGF
FT                   NIGGAAGPVAFGWLLDQGHPSAIFWAAVMFMVITAAMALDQELRSAKRRALATE"
FT   gene            complement(7960..8823)
FT                   /locus_tag="Dd703_0006"
FT   CDS_pept        complement(7960..8823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0006"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: hso:HS_0453 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83825"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5L2"
FT                   /inference="protein motif:SMART:SM00507"
FT                   /protein_id="ACS83825.1"
FT                   /translation="MNKFRVAELPDFLKVKKLNELRHSMQAEIIPPISDIKIKTLDIDE
FT                   LLATTGIDTSIEDIKVNQDNTFDYNNKKVILHIRDVNTYGKEITLPKYHLANCRTLQGM
FT                   WRRNRSGRYVVATRSDGLFIIKHLDASGTEWETKETRLNVCKSCLETLNWKGYSSKSYQ
FT                   ERMTIFNQFSLKEFFEKYPNSKTTYRAEHTDISAPTNTYSNDFNTISKQYRESIHWHCE
FT                   QCGINLKEKNLNKYLHVHHRDGQKNNNQRSNLQALCIECHSKQDNHGHMNSHHDLAIFL
FT                   TLKEAL"
FT   gene            complement(8816..9562)
FT                   /locus_tag="Dd703_0007"
FT   CDS_pept        complement(8816..9562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vsp:VS_1368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83826"
FT                   /db_xref="GOA:C6C5L3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5L3"
FT                   /inference="similar to AA sequence:KEGG:VS_1368"
FT                   /protein_id="ACS83826.1"
FT                   /translation="MANRLLASAKSSKSKEDYWISLSDLMTSLMMIFLLISLIYMIKVQ
FT                   DMVKIPTVYKNTLQGLGQALQHEFKDDLKRWHATIDEDLTVRFQEPNILFNNNSADLKP
FT                   EFKAILDEFIPRYLNIITNPKYIDNIEEIRIEGHTSTVWRAGVSEKEAYIHNMELSQSR
FT                   TRSTLEYIMNMSVVSEPESMFSWFKGHVRAIGFSSARPVDSEGKVIISADKIEDRARSQ
FT                   RVEFRVRTNVERQVANIVEKGKNTHE"
FT   gene            complement(9566..11128)
FT                   /locus_tag="Dd703_0008"
FT   CDS_pept        complement(9566..11128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0008"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ecm:EcSMS35_4824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83827"
FT                   /db_xref="GOA:C6C5L4"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5L4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83827.1"
FT                   /translation="MINIHPYDTYIAIGLIICFWFYFNKNFTEKNAQEGPGLLITIGIG
FT                   ATFFGITIGLLSFDMNDVEKSLPELINGIKTAFVASFAGVFAALIIKIRHIFIKVNKTD
FT                   DTSEEGATIDDIVRQLKKSDTSLDKLHYSLVGNEEASLLTQLKLIRTDQNDQLGNLHKA
FT                   FIEFAQKQAENNSKALIDALREVIRDFNEKISDQFGENFKQLNDAVGKINDWQEQYRQQ
FT                   MQEMIEQQKQTTINMQQASEGFTQIVQQSQSFGQVAEDIHNTIGMISILEQTLRENLTL
FT                   LASVIDATKNGLPEIEQKVIAMVSDISNGAQASTSLITQHIQDVSHTLQSSANDFSLQL
FT                   NSSAENMASAVVKQNSEINQTIHEISIDLKQQVSDIAKDLVHHQDDITQTLKLSTSQFT
FT                   QQLNSSAENMAHAVTKQSNEMHQAVQKTSSELNQLITGLEQELTKYIQRHNESITGHLS
FT                   EMTKNTAQQVTVLDKELSEALKKSLDTLGQQLGSLSTKFAQDYTPLTEKLKEVVRLAET
FT                   LKA"
FT   gene            complement(11561..12307)
FT                   /locus_tag="Dd703_0009"
FT   CDS_pept        complement(11561..12307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0009"
FT                   /product="protein of unknown function DUF548"
FT                   /note="PFAM: protein of unknown function DUF548; KEGG:
FT                   eca:ECA0054 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83828"
FT                   /db_xref="GOA:C6C5L5"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5L5"
FT                   /inference="protein motif:PFAM:PF04445"
FT                   /protein_id="ACS83828.1"
FT                   /translation="MGLLTEAGADPEALATLARRWGLEDDPTSTLALVLTPERLELRKR
FT                   DEPKLGAISVDFASGAMAHRRRFGGGRGEAVAKAVGIKKDYLPDVVDATAGLGRDAFVL
FT                   ASLGCRVRMVERHPVVAALLDDGLQRGYQDAEIGGWLRERLTLLHASSIDALADITPPP
FT                   DVVYLDPMFPHRQKSALVKKEMRVFQTLVGADDDADALLAPARRLARKRVVVKRPDYAP
FT                   PLAGLPAQSALETKSHRFDFYLPLTA"
FT   gene            complement(12310..14352)
FT                   /locus_tag="Dd703_0010"
FT   CDS_pept        complement(12310..14352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0010"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: eca:ECA0055 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83829"
FT                   /db_xref="GOA:C6C5L6"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5L6"
FT                   /inference="protein motif:PRIAM:3.4.24.70"
FT                   /protein_id="ACS83829.1"
FT                   /translation="MTNPLLSSFTLPPFSHIKTEDIVPAVQAALDDCRSAVERVVAQSG
FT                   PFTWDNLCQPLAESDDRLGRIFSPIAHLNAVKNSPELRETYEQCLPLLSEYSTWVGQHA
FT                   GLYRAYRELRDGAHYASLSVAQKKAVDNALRDFELSGIGLPPEKQKRYGEIAARLSELA
FT                   SQFSNNVLDATMGWSKLITDVAELEGLPESALAAAKAQAEAREQQGWLLTLDIPSYLPV
FT                   MTYCANQALREELYRAYVTRASEQGPNAGKWDNSAIMTETLALRHELAQLLGFDSFAHK
FT                   SLATKMAENPQQVLDFLTDLAKRARPQGEKELAQLRAFAKEHYGVDELNPWDITYYSEQ
FT                   QKQHLYAISDEQLRPYFPEARALAGLFEVVNRIYGITAKERIGVDVWHPEARFFDLFAE
FT                   NGELLGSFYLDLYARENKRGGAWMDDCVGRLRKADGDVQKPVAYLTCNFNRPVNGKPAL
FT                   FTHDEVITLFHEFGHGLHHMLTRIDTAGVAGISGVPWDAVELPSQFMENWCWEPDALAF
FT                   ISGHYETGEPLPKEMLDKMLAAKNYQAALFILRQLEFGLFDFRLHAEYNPAQGAQVLAT
FT                   LADVKAQVSVVKSPEWNRFPHSFSHIFAGGYAAGYYSYLWADVLAADAFSRFEEEGIFN
FT                   RDTGQSFLENILSRGGSEEPMALFKRFRGREPKLDAMLEHYGIQA"
FT   gene            complement(14477..14761)
FT                   /locus_tag="Dd703_0011"
FT   CDS_pept        complement(14477..14761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0011"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83830"
FT                   /db_xref="InterPro:IPR022574"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5L7"
FT                   /inference="similar to AA sequence:KEGG:ECA0060"
FT                   /protein_id="ACS83830.1"
FT                   /translation="MKNHFGDGILAGLNASGPLSDHDIRRYCDDFRRGYVCGYAHQRAG
FT                   LCGRLRAAFEAGQLSRRYGLRRDIVAEFFTDVQQPTLVQSFYDGYDQYA"
FT   gene            14928..15770
FT                   /locus_tag="Dd703_0012"
FT   CDS_pept        14928..15770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0012"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   plu:plu0374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83831"
FT                   /db_xref="GOA:C6C5L8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5L8"
FT                   /inference="protein motif:PFAM:PF04378"
FT                   /protein_id="ACS83831.1"
FT                   /translation="MLSYRHSFHAGNHADVLKHTVQSLIITALKEKEKPFLYLDTHSGA
FT                   GRYQLHGEHAERTGEYREGIGRIWQRDDIPAEMEAYLQVVRSYNSGGQLRYYPGSPLIA
FT                   RQLLREQDTLNLTELHPTDFSLLRQEFARDDRARVVREDGYLQLKSRLPPAARRGVILI
FT                   DPPYELKTDYQAVVDGIQEGYRRFATGVYALWYPVVLRQQIKRLLKALEETGIRRILQI
FT                   ELAVLPDSDRHGMTASGMIVINPPWKLEAQMKSLLPWLHQVLVPEGTGHTRVEWVVPE"
FT   gene            15968..17320
FT                   /locus_tag="Dd703_0013"
FT   CDS_pept        15968..17320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0013"
FT                   /product="glutathione-disulfide reductase"
FT                   /note="TIGRFAM: glutathione-disulfide reductase; PFAM:
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: eca:ECA0062 glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83832"
FT                   /db_xref="GOA:C6C5L9"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5L9"
FT                   /inference="protein motif:TFAM:TIGR01421"
FT                   /protein_id="ACS83832.1"
FT                   /translation="MTKHYDYLAIGGGSGGIASINRAALYGKKCALIEAKHLGGTCVNV
FT                   GCVPKKVMWHAAQIAEAIHQYGPDYGFDVTVNRFDWSTLLKNRSAYIDRIHQSYHNVLG
FT                   KNQVEVIHGFARFVDAHTVEVNGERITADHILIATGGRPTRPEIPGAEYGIDSDGFFAL
FT                   QAQPTRVAVVGAGYIAVEIAGVLKALGSEVHLFVRKHAPLRQFDPLIVETLVEVMNTEG
FT                   PTLHTESIPKAVVKNADGSLTLQLQNGHEQTVDCLIWAIGREPATDNLNLDAAGVARNA
FT                   QGYIPVDQFQNTNVPGIYAVGDNTGAVELTPVAVAAGRRLSERLFNNKPGEHLDYSNIP
FT                   TVVFSHPPIGTVGLTEPQAREQYGDDQVKVYKSAFTAMYTAVTQHRQPCRMKLVCVGPE
FT                   ERIVGVHGIGFGMDEILQGFAVAVKMGATKQDFDNTVAIHPTAAEEFVTMR"
FT   gene            complement(17493..20270)
FT                   /locus_tag="Dd703_0014"
FT   CDS_pept        complement(17493..20270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0014"
FT                   /product="putative DNA helicase"
FT                   /note="KEGG: abu:Abu_1172 putative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83833"
FT                   /db_xref="GOA:C6C5M0"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5M0"
FT                   /inference="similar to AA sequence:KEGG:Abu_1172"
FT                   /protein_id="ACS83833.1"
FT                   /translation="MDEKKFLVLTRSKHSEFKNTTGNVVTITPSDDKTLVTFLGGKTFP
FT                   YNRENVRFFDNPAVINIEDSIILLANGRSKKFDEAFVFGNKYIVLFSEGNSEFHPVADV
FT                   TITPNIAKHKETRHLIDYYRYIATFLKEETPHVQYYYENKLNQIRGDSVLNNFVNSTPS
FT                   RNPSPSSIIFPFGMNPSQREAVINALTSQISIIQGPPGTGKTQTILNIIANLICQNKTV
FT                   AVVAGNNEATHNIYEKLEKEGFDFIAASLGKADLQKIFFAKEHAIPEIAHWAIAETDLH
FT                   QIRQVMTSSDNLVSRLLELQNEQARIKELISRLEVESQYFDRHFSVDPINPSTWSFGNK
FT                   WSTPNLIKFMAEVEYFSENDKPSWSLKFKWLFKYRIYKFKDISYLSSDLFKGLVSEYYQ
FT                   RRKTELLANKLSIEQELKKHDFKGLLRQYTDSSMTILKNYIFSTHHKIENIPFNNQSYK
FT                   KSFDNFVKRFPVVLSTTDSIINNKSDDELFDYLIVDEASQVNLLTGVLAMACAKNMVVV
FT                   GDLKQIPHIPSQSLISTHPDINEKFDIKMKYNYLTESLLSSINKVFAESVPSTLLKEHY
FT                   RCHPRIIDFCNQKYYNNQLVIMTHSNTEPFKIVKTAPGHHTCKAPGGKSQINFRELEVI
FT                   KEELLDTILANTAPEKIGIVTPYRAQVLNANHLIDKKDLKIDTAHKFQGREKDIIIYSP
FT                   TASWSDKFNDSPNLINVAVSRAKAQFIMVMSANLFKQQGTNIGDLIRHIEYQSMSPAIF
FT                   ESKTISIFDCLYSEYSPALQDFKMRTGNTSKYLSENLMITLLNDIFADNIFTSFTYKHN
FT                   YPLSLLISNFESLTEREKKFGQHLSSHIDFLIFNKLDKLPVLAIEVDGYQTHALNPQQR
FT                   ERDELKNSILFKLGVPLLRFPTKRSGEERIIRQALQDIIALIPESDTEQHESVR"
FT   gene            complement(20675..21709)
FT                   /locus_tag="Dd703_0015"
FT   CDS_pept        complement(20675..21709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0015"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: kpe:KPK_0472 peptidase, S15 family"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83834"
FT                   /db_xref="GOA:C6C5M1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5M1"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACS83834.1"
FT                   /translation="MLLKKIILAGGIMMGMTTTTLHAATHDLPGYADGAQVIQVKKANE
FT                   QIDAMSGIIYSQVKSTRAIRQLQMALLIPRTQDLKPAIIYFPGGGFTSADHEKFIEMRM
FT                   ALAEAGFVVAAAEYRVVPNTFPAPVLDGKSAVRFLREHAAEYGIDPNRIGVLGDSAGGY
FT                   LAQMLGTTNGDKQFEQGQFLNRSSDVQAVATLYGLSNLLNIGEGFPENIQKVHQSPAVT
FT                   EALLVNGAAFRDFAGATISSDPKKALNASPMGHVNGKKPPFLIMHGSADTLVSPGQSAQ
FT                   LYKALKTENNNVEYVLVEGAAHGDITWFQKPVIERVVHWFKQTLGAPIKPAVSNGKTSA
FT                   NANL"
FT   sig_peptide     complement(21638..21709)
FT                   /locus_tag="Dd703_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 24"
FT   gene            22163..22687
FT                   /locus_tag="Dd703_0016"
FT   CDS_pept        22163..22687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: avi:Avi_0040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83835"
FT                   /db_xref="InterPro:IPR020915"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5M2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83835.1"
FT                   /translation="MKAISKVFAVFSILGLVSSSVLADEKISVEKETPPKTELVMEITA
FT                   DIAPSIPMGKGPLGERAMVPILSGTFTGNNIRGTLVPGGADRQQIRQDGYKFLQATYEL
FT                   KTDDGVVISVANHVLTPMTRKPGEKAFSQIELIAPEGKYDWINKNVYIGTLTSLKPQRT
FT                   AVLVRVYKLIP"
FT   sig_peptide     22163..22234
FT                   /locus_tag="Dd703_0016"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(22767..23414)
FT                   /locus_tag="Dd703_0017"
FT   CDS_pept        complement(22767..23414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0017"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   ppu:PP_0642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83836"
FT                   /db_xref="GOA:C6C5M3"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5M3"
FT                   /inference="protein motif:PFAM:PF02588"
FT                   /protein_id="ACS83836.1"
FT                   /translation="MLRKESIPGNIPGIGARAGIAHTLKDDIYGLALGVMFIAFGLNML
FT                   KLSGMVTGGIAGIALLLSYYVPLSIGVLFILTNIPFMLFCYFSMGRGFTLKTLIVNIAL
FT                   GCTTQAVPGLITISYIHPLFSALVGGTFLGMGILSLARHNASVGGTGVVTLWLYQRFNI
FT                   NAGKTQMLLDVLVFALSLIKLPAALLLWSALSALAMNAMLMNWHKPGRYQGG"
FT   gene            23614..24084
FT                   /locus_tag="Dd703_0018"
FT   CDS_pept        23614..24084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0018"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: reu:Reut_C6217
FT                   AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83837"
FT                   /db_xref="GOA:C6C5M4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5M4"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACS83837.1"
FT                   /translation="MKMDRIDAQILNELQQDARLKITELAERVCLSATPCTRRLKHLEE
FT                   SGIIEQYVTLLDQEKAGFPVNAYISLTLEPKSEATFRKFEQQIATFDEVMECHLMSGSH
FT                   DFMLRVVAASLSDFERFLQKKLIKIEGLRDVQTSFSLRRLIHKTALPVRSML"
FT   gene            complement(24074..25156)
FT                   /locus_tag="Dd703_0019"
FT   CDS_pept        complement(24074..25156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0019"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: pap:PSPA7_1546 putative
FT                   methylated-DNA--protein-cysteine methyltransferase;
FT                   TIGRFAM: methylated-DNA/protein-cysteine methyltransferase;
FT                   PFAM: Methylated-DNA-[protein]-cysteine S-methyltransferase
FT                   DNA binding; Ada metal-binding domain protein;
FT                   methylguanine DNA methyltransferase ribonuclease domain
FT                   protein; SMART: helix-turn-helix- domain containing protein
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83838"
FT                   /db_xref="GOA:C6C5M5"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5M5"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACS83838.1"
FT                   /translation="MFDLPDDDELYRALIARDPTWEGFAYVGVKSTGIFCRLSCAARKP
FT                   KRENVQFFSSVATALEAGFRPCKRCRPLMAKGDEEGSIVATLTAALEKQPEKLWSESDL
FT                   IAMQMDPSTVRRTFKRQFGITFLEMARLRRLAKGITTLSFGEDVISAQLDASYESGSGF
FT                   RSAVIRHLGISPSQARRHRLLKAAWIDTPIGTMLAVADEHALHLLEFVDRKGLPGELEK
FT                   LKQHTASNIIMGTLPVIEHLREELRDYFAGRRFRFETPLAQHGTLFTRRVWDALSAIPY
FT                   GTVESYRTLATRVGNTAACRAVARANGANPLAIVVPCHRVIGADGSLTGYAGGLWRKKW
FT                   LLEHERRTRPDDAPSGDVTA"
FT   gene            25301..25756
FT                   /locus_tag="Dd703_0020"
FT   CDS_pept        25301..25756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0020"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   spe:Spro_2129 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83839"
FT                   /db_xref="GOA:C6C5M6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5M6"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS83839.1"
FT                   /translation="MLMQWTKGEYLVSTDRQRLDCDAIYAYLTTSTWANGIDRETVTLS
FT                   IDNSLCFGLFHREQQIGFARMVTDFATFGYLCDVFVLPERQGAGLGRFLVECTLAHPRL
FT                   QRLRRQLLLTSTAPWLYQKVGYEPINRDDYTWTYVRHGIYDRHDAVH"
FT   gene            26097..26825
FT                   /locus_tag="Dd703_0021"
FT   CDS_pept        26097..26825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0021"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_0626 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83840"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR032793"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5M7"
FT                   /inference="similar to AA sequence:KEGG:Veis_0626"
FT                   /protein_id="ACS83840.1"
FT                   /translation="MERNIALDEFIEAGIQDYHNKILERLKLLKLGDILKRKNPYLFRV
FT                   KNLNTSHDLVKSILDAHLSSQEEGIFGGFLEELAIYICHETYRGIKSSAEGIDLEFIND
FT                   GVRYIISIKSGPNWGNSSQIAKMKDHFRKAKRILGTNAGKPIPVEAINGCCYGKDNNPI
FT                   KDEYQKLCGEKFWTLISGDENLYKKIIEPLGFKAEERNDKFNYEYASVLNKFTMEFTQN
FT                   YCTEKGAIDWEKLLRFNSGY"
FT   gene            complement(26896..28293)
FT                   /locus_tag="Dd703_0022"
FT   CDS_pept        complement(26896..28293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0022"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: swp:swp_0839
FT                   site-specific DNA-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83841"
FT                   /db_xref="GOA:C6C5M8"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5M8"
FT                   /inference="protein motif:TFAM:TIGR00675"
FT                   /protein_id="ACS83841.1"
FT                   /translation="MSTLISVKDVSRELLISEQHVRNLCRNGILQSEKIGQTWVVYESS
FT                   LKQYKSKLIPLTVKDHEHTSNSVCFEKSKPIALSFFSGAMGLDLGIEKAGFDIRLACEI
FT                   DKYCRQTISLNKPDIALLSDINDYSAMDIIKAAKISPDTDIDLVMGGPPCQAFSTAGKR
FT                   KSFKDERGNVFLKYIDLVLELKPKYFIIENVRGILSAALNHRPLAERGDNFPVLENDEI
FT                   KGGALNFILSKLKISGYAYSFNLYNAANFGTPQIRERVIIICSRNGKTPPYLTPTHSDD
FT                   PYFELPHWNTLESSISDLKNHDHLNFPEKRLKYYRMLKPGQNWKNLPEYLQKEAMGKSF
FT                   YSGGGKTGFLRRLAWDKPSPTLVTHPAMPATDLAHPEENRPLSIQEYKRIQEFPDNWKI
FT                   SGPLLQQYKQVGNAVPVSLGFAVGNTIINLLNGKEAEPGIPNFRYSRYKNTSDKEWEAE
FT                   FFKIKKQ"
FT   gene            28702..28872
FT                   /locus_tag="Dd703_0023"
FT   CDS_pept        28702..28872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83842"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5M9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83842.1"
FT                   /translation="MPVGWRRLNKGDDYYGYQMLFHRDVFYQLLTAVFLSICKLNLNEG
FT                   NNGAGDSSLLF"
FT   gene            29573..30541
FT                   /locus_tag="Dd703_0024"
FT   CDS_pept        29573..30541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0024"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="KEGG: ssn:SSON_2480 glucokinase; TIGRFAM:
FT                   glucokinase; PFAM: Glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83843"
FT                   /db_xref="GOA:C6C5N0"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5N0"
FT                   /inference="protein motif:TFAM:TIGR00749"
FT                   /protein_id="ACS83843.1"
FT                   /translation="MYQYALVGDVGGTNARLALCDLTNGNLSHGKQYSVLEHDSLESVI
FT                   RLFLGEHAALAVGSGCIAIACPITGDWVEMTNHNWAFSIAAVKQSLGFSHLEVINDFTA
FT                   VSMAIPALAPDDVIQLGGAAPLAGKPIAVYGAGTGLGVGHLLPVGDQWVSLPGEGGHVD
FT                   FASNSEEEDLLLQVLRQELGHVSAERVLSGPGLVNIYRAIVKSDDRVPEALTPQTISER
FT                   ALAHSDVDCLRALSLFCVLMGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFRNSGFRAA
FT                   FEDKGRFRDYLADIPAYLITHPQPGLLGAGAYLRQALGQTL"
FT   gene            complement(30639..32123)
FT                   /locus_tag="Dd703_0025"
FT   CDS_pept        complement(30639..32123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0025"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   kpe:KPK_4014 transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83844"
FT                   /db_xref="GOA:C6C5N1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5N1"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACS83844.1"
FT                   /translation="MIEHCLHIDFVAHRSLQEQLRETLITSILSGVFPVDEALPSCRKL
FT                   SCQLNISRNTVALVYEGLQSDGYLVSRPRSGYYLHPDYHQPEAAAASWPQQAANDSAQQ
FT                   APDWGKRLNVSPSNFLAIMKPAQWMAYPYPFIYGQPNTQLFPIEQWRETTRRVTGTHRD
FT                   HHWLYDNIDQDVPLLIEQVRQRILPKRGIIARADEILITLGSQNALSLLSQLLFSHTTQ
FT                   VAVENPVFREAINAFALQGAQIIPHTLDNEGLRLADASRQCDYFYITPSHQAPTGVRMS
FT                   DARRRALLEHANLHDQIIIEDDYDSETNFDPYPRAALKASDTGGRVIYVSSLSKSLSPG
FT                   LRLGYLVAPSELIDELRALRRLSYRHPPTHIQHQMAHFLAQGYYEAYLHRYREDSARRW
FT                   DTLNNALDRWLPECRRMTGSEHANAFWLQAPEGCNTRQLAWRAAHNGVLIEPGQAHFLD
FT                   AAAPENYFRLGFHAILPDQIEAGITRLAEAFHHRIR"
FT   gene            complement(32524..33639)
FT                   /locus_tag="Dd703_0026"
FT   CDS_pept        complement(32524..33639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0026"
FT                   /product="uncharacterized peroxidase-related enzyme"
FT                   /note="TIGRFAM: uncharacterized peroxidase-related enzyme;
FT                   alkylhydroperoxidase like protein, AhpD family; PFAM:
FT                   Carboxymuconolactone decarboxylase; KEGG: eca:ECA0070
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83845"
FT                   /db_xref="GOA:C6C5N2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR023923"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5N2"
FT                   /inference="protein motif:TFAM:TIGR01926"
FT                   /protein_id="ACS83845.1"
FT                   /translation="MSFSTQDILQQLAEIAPNTDLAQARTVRDAATRHTQGSHEALFSA
FT                   SASGNLTPALRFLLAEKISGWHQDSVLQRFYAERLADFPVPADSDALQLALAHAERLTF
FT                   RPATATHEHLHALLQAGWITDDIVTLSQLTAFVSFQSRLLRGFRLLAGQPVAETDTVAV
FT                   AAGAWHTQALTHNGKPAPLAFTQEELAWEPWIPAKPLAEFSAAEQAVLAKFGHTHSDYF
FT                   RLLGRNQPVLEQRTLTDKGIFYTSGGLPRAERELAAAVASKVNGCIYCASVHARKASQL
FT                   AKRHDAVQRLLAVAPGGDLSVEQEPRWQAIIDVAARLSVTPAQLNPQDIERLRQQGLST
FT                   LEILDLIQSAAFFAWANRLMLTLGEPFQPQG"
FT   gene            complement(33636..34673)
FT                   /locus_tag="Dd703_0027"
FT   CDS_pept        complement(33636..34673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0027"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   eca:ECA0071 putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83846"
FT                   /db_xref="GOA:C6C5N3"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR024003"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5N3"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACS83846.1"
FT                   /translation="MRKRLGFFTRLLDDVPAGQRYRLATEQIIRAEQLGFDSAWVAQHH
FT                   FHADEGGLPSPLVFLAQVAARTRRIRLGTGVITLPMEQPLRVAEDTAVLDLLSDGRLEV
FT                   GIGSGGTPSSFAAFGHNSEQRGDILARYLAQVRAAWAGVPLSGDGNQLYPTAPHLNQRV
FT                   WQATFSVEGAIRAGKAGDGLMLSRTQPRAENHADATLADLQNPMIDAYLDALPDGVEPR
FT                   IMGSRSVFVADDRALALQLAQTGLQRSAARLARLGRPSRDGSVEELIASFDSHVGAPDD
FT                   VIASLLADSALARTTDLSFQVHSIDPPHASILRSLELIATQVAPALGWQTKKAQQNSPV
FT                   GQEIA"
FT   gene            complement(34700..36340)
FT                   /locus_tag="Dd703_0028"
FT   CDS_pept        complement(34700..36340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0028"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA0072 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83847"
FT                   /db_xref="GOA:C6C5N4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5N4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS83847.1"
FT                   /translation="MSLLAGLQTQAPQPVLALDDVTIAYRGDDGERIVVEGVSFSIWPG
FT                   EVVALVGESGSGKTTTAQSVIGLLADNGRLARGAIRLNGIDISRWPQKRLDSIRGSVVS
FT                   LVPQDPGSSLNPVKTIGEQVDEILRLHQNRGDRKAIRQQTLALLARVGLTQPELRAAQY
FT                   PHELSGGMKQRVLIAIAIALKPALIIADEPTSALDVTVQKRILDLLDDLRREQGTAVLF
FT                   VTHDLGVAAERADRLLVFRQGYIQEQGPVREVLSAPQSPYTRTLLDNIPSLAATKRPSR
FT                   RQDGAPIVTVEHLVQEFPLAGKTTPFRAVDDISFSVAPGTTHAIVGESGSGKTTTARLL
FT                   LGFQRPTAGRIVIDGTDIAPLRGEALRQFRQHIQLVYQNPFSSLDPAQRLADIVEEPLR
FT                   NFGRYRRLERQQKVAEMFERVALPASLLQRYPAELSGGQRQRVAIARALVLEPKVLVLD
FT                   EAVSALDVTVQAQILRLLEELQTALGLTYLFISHDLAVVRQIADTVSVLCHGKLVESGP
FT                   VEQIFSQPEQPYTQALIDAIPGRRALIHA"
FT   gene            complement(36343..37197)
FT                   /locus_tag="Dd703_0029"
FT   CDS_pept        complement(36343..37197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0029"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA0073 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83848"
FT                   /db_xref="GOA:C6C5N5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5N5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS83848.1"
FT                   /translation="MATIQLEKMTFPLRRKTLRLRRYIAQPGLLLAWLVLLTVMLWALF
FT                   PALFTHANPVEGIAGAQRLAPGQHALLGTDQLGRDVYTRMVYGASHSLSGAAIAVGLGL
FT                   GLGSLLGLLAGALGGRSDTLVMRAVDVLLAIPSLLLALTVIILLGFGNVNASIAVGTIL
FT                   VAKFARLVRAEVLRVRNSDYVEAAFGSGGTFWSVLWRHILPNALPNVLAYAALQFGYAI
FT                   LELATLSFLGYGAPPPTPEWGLLIAEGRNYLATAWWLTTFPGLLVVAVVLAANRVSQSL
FT                   RRA"
FT   sig_peptide     complement(37039..37197)
FT                   /locus_tag="Dd703_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.980 at
FT                   residue 53"
FT   gene            complement(37200..38135)
FT                   /locus_tag="Dd703_0030"
FT   CDS_pept        complement(37200..38135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0030"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA0074 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83849"
FT                   /db_xref="GOA:C6C5N6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5N6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS83849.1"
FT                   /translation="MKYLAIRIGQALGVLWAAFTLSFILLQALPGDAVLIKFMNPELGL
FT                   SADQIAQLRQSYGTDVPMLTQYFASLARILHGDFGLSLHAGLPVGELLATNLPPTLLLA
FT                   VLGFSVSVLLAFALAFLSALSPFYWLRQAFQSVPSLFISIPTFWLGIVLIQVFSFRLGW
FT                   VSVINPGEWEGLVLPILTLAVPISAPIAQVLMRSIDQVLTQPFVAVARAKGISRSGVLW
FT                   RHVARNAALPALTLAGMLLGELIAGALITETVFGRSGLGQLTQEAVNTQDASVLQAIVL
FT                   VSATAFVTVSLLVDLLYPLLDPRLKKRAEV"
FT   sig_peptide     complement(38049..38135)
FT                   /locus_tag="Dd703_0030"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.664) with cleavage site probability 0.441 at
FT                   residue 29"
FT   gene            complement(38315..39958)
FT                   /locus_tag="Dd703_0031"
FT   CDS_pept        complement(38315..39958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0031"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: eca:ECA0075 ABC-type transporter, substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83850"
FT                   /db_xref="GOA:C6C5N7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023920"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5N7"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACS83850.1"
FT                   /translation="MFGLFDAPHNRQMGLFISLALLGNGATAQADEKAPKTGGTLVYLE
FT                   QQSHTNLYPPAGGFYPNGGILNQITDKLTYQNPETLEIEPWIAESWTINADSTEYTFKL
FT                   RPGVTFSDGTPLDANAVAKNFDTYGLGNKELNQPVSEVINNYLRSEVIDPLTVKFYFKK
FT                   PSPGFLQGTSAIGSGLVSLSTLARNFNQLGDAPRIIGSGPFVVSSEKPGRELKLTARKD
FT                   YNWAPVKFTHQGRPYLDGITYLVTPEDSVRIGALVSGQADVIRQIQAYDEKRVQSEGIH
FT                   VYAAATRGVNNSINFRPDNPLVADIRVRQALLHGTNAGEIVQTLYSGNYPQATSVLAKT
FT                   AAGYVDLSSKLSFDPAQASRLLDEAGWKTGAQGLREKDGQTLTLTAYESLPQPQNKEML
FT                   QLVAQQWARLGVKLNVLAGDAGSKTVDSLDPQKTGVAPGMVGRADPDVLKSQYYPTLRN
FT                   VLLQKGGVSDKVKTFEDARLNALLDGIASTTDRPRRLALVGDVQNYLIDQAYVIPIFEE
FT                   PQVFAGRAATKGIGFEAVGRPSFYNTWLDK"
FT   sig_peptide     complement(39866..39958)
FT                   /locus_tag="Dd703_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.852 at
FT                   residue 31"
FT   gene            40345..41370
FT                   /locus_tag="Dd703_0032"
FT   CDS_pept        40345..41370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0032"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: spc:Sputcn32_3988 putative cytoplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83851"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5N8"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_3988"
FT                   /protein_id="ACS83851.1"
FT                   /translation="MTDNIPQPPQGELVLFTSADGKTRVECRFESDTLWLSQAMIGELY
FT                   GKAKATISEHIKNIFAEGELDENSVVRLYRTTAGDGKSYNVQYFSLKLVLAVGYRVRSI
FT                   RGTQFRQWATQTLQEYLIKGFVMDDERLKNPPVGHSAVPDYFDEMLERIRDIRASERRV
FT                   YLRVKEIFTMAADYEPSNQETNRFFQTIQNKLHYACTHMTAAELIANRVDASKPDMGLT
FT                   SYKGDEVRRTDVTVAKNYLHEDEIKELNRIVNMWLDFAEDQALRRKQVFLQDWADKLDQ
FT                   FLSFNDRDVLSGAGKISKQAADDKAKREFDRFAQQRRRLKEAEGAQANIAALKAILKKD
FT                   R"
FT   gene            complement(41602..42366)
FT                   /locus_tag="Dd703_0033"
FT   CDS_pept        complement(41602..42366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0033"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   psa:PST_4121 probable short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83852"
FT                   /db_xref="GOA:C6C5N9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5N9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS83852.1"
FT                   /translation="MSNIVFITGATSGFGRATAYHFARAGWSLILTGRRAERLQALADE
FT                   LSSTVPVHIATLDVRDAAAVQAVVDNLPDGFRAVKTLVNNAGLALSPQPAQSVQLDDWH
FT                   TMIDTNTKGLVNVTHALLPTLISTGTGASIINIGSIAGQWPYPGSHVYGATKAFVKQFS
FT                   YNLRCDLQGTGVRVTDLAPGIAETEFTLVRTKGDQDASDRLYRGTTPLTAEDIAGQIYY
FT                   IATLPDHMNINRVEVMPVRQAWSPFAIDRDPA"
FT   gene            42667..43992
FT                   /locus_tag="Dd703_0034"
FT   CDS_pept        42667..43992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0034"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   kpn:KPN_00577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83853"
FT                   /db_xref="GOA:C6C5P0"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5P0"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACS83853.1"
FT                   /translation="MTLKQVQSNEEVRQLDRQYVFHSWSSQGALNPMVIAGGEGCRLWD
FT                   YEGRSYLDFSSQLVNTNIGHQHPKVVAAIREQAGLLTTIAPATANLARGEAAKRIVSHA
FT                   PQGLNKVFFTNAGADANENAIRMARLFTGKEKVLSGYRSYHGNTGAAIGATGDWRRLPN
FT                   EYSRGHVHFFTPYLYRSEFHATTEQQECAAALHHLRRIIECEGPNTIAAILLETIPGTA
FT                   GILVPPAGYLQGVEALAREFNIILIMDEVMAGFGRTGSWFTCQHYGVTPDLITFAKGVN
FT                   SGYVPAGGVIISERIAHFFDDRLFPGGLTYSGHPLAMAAIVATIDAMEEEKVVENAATI
FT                   GDGILAEGLKSIGEKYAIVGDVRGKGVFHALELVSDPAARTPLPAARMAELKKALLDRG
FT                   MIGFIAENRLHVVPPCIITADEARQGLAIIDEALAELSNTLA"
FT   gene            44318..45154
FT                   /locus_tag="Dd703_0035"
FT   CDS_pept        44318..45154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0035"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rlt:Rleg2_3040 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83854"
FT                   /db_xref="GOA:C6C5P1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5P1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS83854.1"
FT                   /translation="MSQMVYVDEPSVVALKPASAPRPAIVVRDANVIYPAADQPVHALK
FT                   DINLTIRQGEFVSFIGPSGCGKTTLLRAIADLEPITTGEVLVNDMTPSEARQAGAYGYV
FT                   FQSPVLLPWRTVLANVMLPLQIQGVPPGRCDEIAREQLARVGLKGFEKKYPWQLSGGMQ
FT                   QRVSIARALGFEPKILMMDEPFGALDELTRDNLNQQLQQLWFSEKRTMAFVTHSISEAV
FT                   YLSTRIVIMTPRPGRIVKIIESPLPDERDLSLRDTPEFIRLAQEVREALVEGHHEH"
FT   gene            45144..46022
FT                   /locus_tag="Dd703_0036"
FT   CDS_pept        45144..46022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0036"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: smd:Smed_2371
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83855"
FT                   /db_xref="GOA:C6C5P2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5P2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS83855.1"
FT                   /translation="MNTELIRRHALPVGVVLLAALLGWYLLAVGLNAAGAIERTLAPKG
FT                   NWGWRELVATTLSMPRPVLPAPHQILLDIWNSLTQWPVTSPRNLLLHTWVTASAALTGF
FT                   FMGLALGLGLAVCIVHSRTLDKALLPWIVASQTVPVLAIAPIVLVILGSLGITGMLPKA
FT                   TIAMYLCFFPVTIATVQGLRAPQKLEMELVHTYAASRIDTFWLVRLPSSLPYLFPAFRV
FT                   AIASGLVGTMVAELPTGAQAGLGSRLLTGSYYGNTVQIWSALVMASLLGLGLTALVSLT
FT                   ERLVMRQRKGA"
FT   sig_peptide     45144..45245
FT                   /locus_tag="Dd703_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.678 at
FT                   residue 34"
FT   gene            46023..47111
FT                   /locus_tag="Dd703_0037"
FT   CDS_pept        46023..47111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0037"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rru:Rru_A3455
FT                   binding-protein dependent transport system inner membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83856"
FT                   /db_xref="GOA:C6C5P3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5P3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS83856.1"
FT                   /translation="MIKTRPIPGVVLLIAALLSLVLAGIQAFSHDAPSWAALAADAVLL
FT                   AACFTAMSPTMAVWRWLTLMALLAIGAVVLASLTDEGLDGATLTALALLAGVSVQGLAR
FT                   LAGRHLPEGAVALLFGVWVLYFWQLLVTWFAIPQVLLPTPLDILQALFGSASLLAGDVV
FT                   QTVLKSVLAGYLLGSGLGIAVAMLIDRLPFLQRGLLPLANLTSTIPLVGVAPIAVMWFG
FT                   FDWPSKAAVIVLVTFFPALVSTLAGLRASGKLERELMYCYAASPRRTLWALRLPAALPF
FT                   IFSALKVNATLALISAIVAEFFGSPTAGLGFRISTEAARMHMSIVWAAIVVASAIGSLV
FT                   YALLVRLERKVNFWHPSVRGVS"
FT   sig_peptide     46023..46112
FT                   /locus_tag="Dd703_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.769 at
FT                   residue 30"
FT   gene            47251..48261
FT                   /locus_tag="Dd703_0038"
FT   CDS_pept        47251..48261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0038"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   avi:Avi_3461 ABC transporter substrate binding protein
FT                   (nitrate/sulfonate/taurine/bicarbonate)"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83857"
FT                   /db_xref="GOA:C6C5P4"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5P4"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACS83857.1"
FT                   /translation="MTKRSVFRQGALLAALSLTFALQAQAAEKVTLQLKWVPQAQFAGY
FT                   YVAQEKGFYKQEGLDVTIKPGGTDISPVQVIAGKSADVIVNWMPDALAAREAGVPLVNI
FT                   AQVFDRSGMMLTCKKSSGVAAPADLKGKTLGVWFGGNEYPFFNWMNKLGYKPDVDIKVL
FT                   KQGFNVDPLLQNQAACISTMNYNEYWQLIDAGVKKDDLITFAYEDQGVSTLEDGLYVLG
FT                   PNLKDPAFVAKMAKFLKASFKGWNYAVNHPDEAAKIVVAEDASGAATQDVQQRQMENVA
FT                   KLITHANTPKVGYLDPAAYRRTIDVLLKSGGSNPVIKKDPGDAAMSHVVWDAAMK"
FT   sig_peptide     47251..47331
FT                   /locus_tag="Dd703_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 27"
FT   gene            48304..48990
FT                   /locus_tag="Dd703_0039"
FT   CDS_pept        48304..48990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0039"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Tetracycline transcriptional regulator YcdC
FT                   domain protein; regulatory protein TetR; KEGG:
FT                   pna:Pnap_4037 TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83858"
FT                   /db_xref="GOA:C6C5P5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013573"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5P5"
FT                   /inference="protein motif:PFAM:PF08362"
FT                   /protein_id="ACS83858.1"
FT                   /translation="MRVRDMQDEGIVAAQSGRLLPESADEGEKGRIRQDNEAIILLAAE
FT                   RVFARFGFRGATMALIAEEAGLPKANLHYYFGNKQTLYLTVLDSILHDWLSPLDDLHPQ
FT                   ADPKTAIEAYVRQKIHFSFARPDASRLFANEILQGAPMVHHLLQTELRRLVVEKAAVLD
FT                   GWIAADRLQPLDTTHFFFSVWSMTQTYADFDIQIAAVLGDDSHSDAAEARATRHVLNSV
FT                   FRMCGL"
FT   gene            49032..49838
FT                   /locus_tag="Dd703_0040"
FT   CDS_pept        49032..49838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0040"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AraC protein arabinose-binding/dimerisation;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: dac:Daci_3066 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83859"
FT                   /db_xref="GOA:C6C5P6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5P6"
FT                   /inference="protein motif:PFAM:PF02311"
FT                   /protein_id="ACS83859.1"
FT                   /translation="MKARSVRLLACRQPGIEAVEADTDFSFGRHTHDQFGIGLMVRGAQ
FT                   KSLSGRGRVESVAGDIITVNPGEIHDGMPIDGARAWRMLYIQPEVVERCFAEISDGRSR
FT                   SGEFSHPVFTDRRLAVCFRRLYLSATQQETQDGALAVQERLLMLASALAAIPRRQQVFP
FT                   HRGILLARDMIDDDPSSPKTLAELAGEAGLNQFQFLRGFSRLTGLTPHAYRVQRRVLMA
FT                   RALIGRGTPLAEAALCSGFADQSHMTRLFVRSFGYTPGQLALASSH"
FT   gene            50045..50656
FT                   /locus_tag="Dd703_0041"
FT   CDS_pept        50045..50656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0041"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   rpc:RPC_2485 lysine exporter protein LysE/YggA"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83860"
FT                   /db_xref="GOA:C6C5P7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5P7"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACS83860.1"
FT                   /translation="MVSLDFLAISLLVVISPGTGTLITLTAGLQYGMRGAWVAAAGCTL
FT                   GVLPHMLAVVTGLAALYQASALVFDGVKFAGVGYLLFMSWQALRDKTPLTLDADSEFSG
FT                   KMLVYHAVTANLLNPKLTVFFLAFLPQFVSEHDRQPVRTMLLLSAIFAGITFWVFVGYG
FT                   AMAVRFRRHVVMNPRVFTAIRWLVAAAFTGLAVKLAVMTR"
FT   gene            complement(50676..51950)
FT                   /locus_tag="Dd703_0042"
FT   CDS_pept        complement(50676..51950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0042"
FT                   /product="Ferric reductase domain protein protein
FT                   transmembrane component domain protein"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein;
FT                   FAD-binding 8 domain protein; KEGG: dar:Daro_2745
FT                   oxidoreductase FAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83861"
FT                   /db_xref="GOA:C6C5P8"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5P8"
FT                   /inference="protein motif:PFAM:PF01794"
FT                   /protein_id="ACS83861.1"
FT                   /translation="MKLITVSFLVCLTIWALSLPEVTTLAAFFYWRDMLLQLTGFIAVL
FT                   CIAGLLLMALHPSFLEKRLGGMDKMYLQHKYLGIGAGVATLLHWLFAKLPKIAAALEWV
FT                   TSGRHQPHPFDPWRKVMDEFGEIAFYGMTIFIAVSLIKWISYKHFRIIHKIGAIIALLG
FT                   MIHSFYMINNDMRWTAFGIAIMVLCVISAAIALYSLAGQIGKRNNFPGKITATNKLNDS
FT                   TLELTINIPASFSRHYQPGKFIFLTTDPKEGKHPFTISRYDANHQTLTITIKALGDYTA
FT                   SLVDAHDLIGKNVVVEGPYGDFILPAHPDKPTYWVAGGIGITPFLSWLYHLHDSRAKQA
FT                   NTTLFYCVNSETDLIHRETLEHLAGETGVNLNIIVRDRDGLLDPQRIPTDDCAGVWFCG
FT                   PAGMRRYLQRRLGRSALHFEQFDFR"
FT   gene            52958..53062
FT                   /locus_tag="Dd703_0043"
FT   CDS_pept        52958..53062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83862"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5P9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83862.1"
FT                   /translation="MSIRQQRSIGDIPRQMACAGRRYPDVSFRVEVVR"
FT   gene            53059..54477
FT                   /locus_tag="Dd703_0044"
FT   CDS_pept        53059..54477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0044"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: aav:Aave_0966 glutamate synthase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83863"
FT                   /db_xref="GOA:C6C5Q0"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Q0"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACS83863.1"
FT                   /translation="MTTPLSAGIDAPGILSARLDPADYAGNFSDSCPPLTAMQAVIEAE
FT                   RCYYCFDAPCTRACPADIDVPSFIHRIAQDNARGAAEVILQANVLGGMCSRVCPTETLC
FT                   EQACVRNAQDGNPVKIGLLQRHATDRYLANPGNPLFVRAPDSGKTVAVVGAGPAGLTVA
FT                   HRLAVCGHQVVVFDARPKPGGLNEYGLAAYKTTEDFAQKEIAWLLSIGGIALRLGQQLG
FT                   RDFTLDALREAYDAVFLGMGLAGVNALGIDEPPLAGVREAVDFIAALRQAEDLSQVAVG
FT                   RQVVVIGGGMTAVDAAVQAKKLGAREVTMVYRRGETAMKASAHEQQWAKQNGVVIRHWA
FT                   APQALHGADGKVTGVTFQVMQPQDGALTASGETFTLAADMVLKAIGQCYEPQPAGAALA
FT                   LKSGRIAVDEQGRTSLPGVWAGGDCCADGLDLTVDAVRQGKLAAKSIELALKVTGLVAA
FT                   NDTSSLTRQERSHG"
FT   gene            54470..55783
FT                   /locus_tag="Dd703_0045"
FT   CDS_pept        54470..55783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0045"
FT                   /product="dihydroorotate dehydrogenase family protein"
FT                   /EC_number="1.3.1.2"
FT                   /note="KEGG: aav:Aave_0967 dihydropyrimidine dehydrogenase;
FT                   TIGRFAM: dihydroorotate dehydrogenase family protein; PFAM:
FT                   dihydroorotate dehydrogenase; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83864"
FT                   /db_xref="GOA:C6C5Q1"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Q1"
FT                   /inference="protein motif:TFAM:TIGR01037"
FT                   /protein_id="ACS83864.1"
FT                   /translation="MADLSTEFLGIKSPNPFWLASAPPTDKEYNVVRAFEAGWGGVVWK
FT                   TLGLDPHVVNVSGPRYSTLLGADRRVLGLNNIELITDRPLHVNLEEIARVKRNWPDRAM
FT                   IVSIMVPCEEEAWKAILPLVEETGADGIELNFGCPHGMSERGMGAAVGQVPEYIERVTR
FT                   WCKQYCSLPVIVKLTPNITDIRYPARAAKRGGADAVSLINTINSVMGVDLDQMLMTPHT
FT                   GGKGSHGGYCGPAVKPIALNMVSEIARDPDTFGLPISGIGGISTWRDAAEFIALGCGTV
FT                   QVCTAVMVQGFPIVRDMISGLSNFMDERGYRSIEAFRGRAVSSVTDWRYLNLNHIDKAV
FT                   IDQSLCIKCGRCHLACEDTSHQAITRQKNGERHFEVKEEDCVGCNLCVSICPVENCISM
FT                   RSLQPGEVDLRTGKTVSADYANWTTHPNNPMATTAGVA"
FT   gene            55825..57270
FT                   /locus_tag="Dd703_0046"
FT   CDS_pept        55825..57270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0046"
FT                   /product="dihydropyrimidinase"
FT                   /note="TIGRFAM: dihydropyrimidinase; PFAM: amidohydrolase;
FT                   Amidohydrolase 3; KEGG: dac:Daci_2864 dihydropyrimidinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83865"
FT                   /db_xref="GOA:C6C5Q2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011778"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Q2"
FT                   /inference="protein motif:TFAM:TIGR02033"
FT                   /protein_id="ACS83865.1"
FT                   /translation="MSKLLIKGGTVVNADRQFRADVLCVDGVIAAVGDIPASDIAGAEV
FT                   VDAGGLYVMPGGIDPHTHMNFPFMGTTTVDDFYSGTAAALAGGTTTIIDFVIPNPQQPL
FT                   MEAYHTWRGWAEKAASDYSFHVAITWWDDSVRRDMGTLVQEEGVNSFKHFMAYKNAIMC
FT                   DDETLMNSFRRSLELGAMPTVHAENGEMVYLLQQELLKQGITGPEGHPLSRPPEVEGEA
FT                   ANRAITIASIMGVPIYVVHVSCIESAEAIARARARGQRVYGEVLAGHLVLDDSVYRDAD
FT                   AARAAAYVMSPPFRPKAHQDALWRGLQSGQLHTTATDHCTFCASQKAAGLDNFTKIPNG
FT                   CGGVEERMAVIWDAGVNSGRLTPSEFVAITSANTARLFNIYPRKGSVSVGADADLALWD
FT                   PAGSKTLSAKTHHSRNDFNAFEGRTVKGIPAFTVSQGVVVYANGDLRAREGAGRYIKRP
FT                   AFGPDFSAAAQWERQRAPQAVTR"
FT   gene            57352..58638
FT                   /locus_tag="Dd703_0047"
FT   CDS_pept        57352..58638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0047"
FT                   /product="amidase, hydantoinase/carbamoylase family"
FT                   /EC_number="3.5.1.87"
FT                   /note="KEGG: pna:Pnap_4022 amidase; TIGRFAM: amidase,
FT                   hydantoinase/carbamoylase family; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83866"
FT                   /db_xref="GOA:C6C5Q3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Q3"
FT                   /inference="protein motif:TFAM:TIGR01879"
FT                   /protein_id="ACS83866.1"
FT                   /translation="MTSDVLTAAQCGIDTTDLRVDGDRLWQSLMDLAVIGATPKGGVCR
FT                   LTLTDLDRQGRDLVVGWGNAAGLSVDVDQIGNVFMRRAGRNNALPPIVAGSHIDTQPTG
FT                   GKFDGNFGVLAALEVIRTLNDSGIETEAPVEMVFWTNEEGSRFVPVMMGSGVFAGVFSL
FT                   EHAYAAVDIDGKTVKDELTKIGYAGPQTPGDRPIGAYFEAHIEQGPILEDEDVTIGVVQ
FT                   AVLGIRWYDCVVTGQESHAGPTPMALRKDALQVSTRIMQEVVAIAGRFAPHGRGTVGMV
FT                   QVHPNSRNVVPGSVKFSVDFRNINDALVDEMDAALKAFISQLAQETGLGIELTQVSHYP
FT                   AAPFHPECKDAVRNAAQRLGYSHRDIVSGAGHDAVYMSMLAPTGMIFIPCKDGISHNEI
FT                   EYAAPEHVTAGANVLLHAMLEKAGVVGRR"
FT   gene            complement(58821..59138)
FT                   /locus_tag="Dd703_0048"
FT   CDS_pept        complement(58821..59138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0048"
FT                   /product="NIPSNAP family containing protein"
FT                   /note="PFAM: NIPSNAP family containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83867"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Q4"
FT                   /inference="protein motif:PFAM:PF07978"
FT                   /protein_id="ACS83867.1"
FT                   /translation="MRVFQLRTYTLKTPEAAAQYAEIWYAHITSLKAFHIQTHGVFQPL
FT                   AHERQVIALVSYPENADVPALGAAYMSSDAFRADMAGFDIAMIEKVEETLLGALPASPL
FT                   Q"
FT   gene            59473..60525
FT                   /locus_tag="Dd703_0049"
FT   CDS_pept        59473..60525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0049"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bsu:BSU06240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83868"
FT                   /db_xref="GOA:C6C5Q5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Q5"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACS83868.1"
FT                   /translation="MKALRWHGQKDIRIDDVAEAQAGPGRVKIKVKWCGICGTDLHEYL
FT                   AGPIFIPVEHPHPLTGEKAPVTLGHEFCGEIVEVGAGVSDYHVGDRVTVEPILFDPNSK
FT                   ASRQGLYNLCDKMGFYGLAGMGGGFSEYASVPASIIHRLPDSVSYEQGALTEPAAVAVH
FT                   AVRESRFQMGDKAAVFGAGPIGLLVVEALKAAGAQEIYVVELSPQRREKAASLGAIVID
FT                   PSATDAVQEIVARTDGGVDVAYEVTGVAPVLQQSIDCVRIQGETMIVSVWEKAAPIYPN
FT                   QILFKERHVTGIIGYRNVFPATLALMEKGYFKPKDFVTRQIALDDVIEQGFNTLIADKS
FT                   QVKILVSPEK"
FT   gene            complement(60637..61890)
FT                   /locus_tag="Dd703_0050"
FT   CDS_pept        complement(60637..61890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0050"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   eca:ECA4386 valine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83869"
FT                   /db_xref="GOA:C6C5Q6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Q6"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACS83869.1"
FT                   /translation="MNFSRFGNKFTRHSGITQLMADLNDGLRTPGAIMLGGGNPAHIPE
FT                   MDMYFQQLCGDLLAEGKLTEALCNYDGPQGKDALLSALAEMLHQQQGWDIGPQNIALTN
FT                   GSQSAFFYLCNLFAGRTDDGKLRRVLFPLAPEYIGYADSGVDEDMFVSLRPQIELLPEG
FT                   QFKYHVDFEQLNITDDIGMICVSRPTNPTGNVLTDDEVQHLDALARQHQIPLVIDNAYG
FT                   VPFPGIIFSDATPLWNPNIILCMSLSKLGLPGSRCGIVIAAEPVIAALGNMNGIISLAP
FT                   GSIGPAIALEMIRRGDLLRLSEQVVRPFYRQRVAQTIAIIRRYLSPERCLIHKPEGAIF
FT                   LWLWLRDLPITTEELYQRLKKRGVLMVPGHYFFPGLAQEWDHAHQCLRMNYVPEPEKIE
FT                   RGVGILAEEIERAWQEKR"
FT   gene            61991..62152
FT                   /locus_tag="Dd703_0051"
FT   CDS_pept        61991..62152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83870"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Q7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83870.1"
FT                   /translation="MPNGTLAQHKLKGVQLTLRVNTTAVALRLKFVSFIPIDCPFLLIK
FT                   RQYFLCFL"
FT   gene            62286..63494
FT                   /locus_tag="Dd703_0052"
FT   CDS_pept        62286..63494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83871"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Q8"
FT                   /inference="similar to AA sequence:KEGG:ECA4385"
FT                   /protein_id="ACS83871.1"
FT                   /translation="MKKALAMGISLALVSWQLSAQTFVLTDVESSTEKGNWQVTSDALK
FT                   IKDQHFSIEQKVLHGGRQEGSKVITITSPNGLQIALSPSRGMDLLHVTGKNIRLGWDSP
FT                   VDEVVNPNTIRLESRNGLGWLEGFNEMMVRCGYEWTGHPVTSDGMIYTLHGRAGNTPAS
FT                   KVIVDVSDKAPHTITVRGLLKENSFKKSHLETWTELRYVPGSESFTIHDVLTNKADYPR
FT                   DYQIIYHSNFGTPVLEAGARFIAPVKEISPFNDYAKAGLKDWQTYQGPTKGFDEMVFNL
FT                   TPYADKDGKTLAALFNRAGDKGVSIAFDTHQLPLLTLWKNTDTQKQGYVTGIEPGTSYA
FT                   YPVTIERQQGRVKTLQPGQSTTFELTYSLLSSPAAVQQAEQKVKAIQGDRAVTLTEKPI
FT                   AVE"
FT   sig_peptide     62286..62348
FT                   /locus_tag="Dd703_0052"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.928 at
FT                   residue 21"
FT   gene            complement(63722..64246)
FT                   /locus_tag="Dd703_0053"
FT   CDS_pept        complement(63722..64246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0053"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pcr:Pcryo_1617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83872"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6F3"
FT                   /inference="similar to AA sequence:KEGG:Pcryo_1617"
FT                   /protein_id="ACS83872.1"
FT                   /translation="MAKKKSTLRSINKTLLLVGEGHAEKAFLSHMKSLFSNGKFKITVV
FT                   TAGGKVPEHVITHAISCKKCDGYDFVIVLLDTDLVWPKSHVQRAMSAGINLIGSDPCLE
FT                   GLLLEVIGREKAESNRACKEIFHPLLNGSSTDRDSYSELFTIEVLGNCENAKIKFIIDA
FT                   LRGKESKSIKL"
FT   gene            complement(64258..65481)
FT                   /locus_tag="Dd703_0054"
FT   CDS_pept        complement(64258..65481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0054"
FT                   /product="abortive infection protein"
FT                   /note="KEGG: mmw:Mmwyl1_3852 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83873"
FT                   /db_xref="GOA:C6C6F4"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6F4"
FT                   /inference="similar to AA sequence:KEGG:Mmwyl1_3852"
FT                   /protein_id="ACS83873.1"
FT                   /translation="MIKWYRFKNLYSFKDEQLIDLTLKANSSESSFDRQWIDCRITKVL
FT                   AVMGANGSGKSNLIKPLAFLSWFCSESFKSMDNSDSLPIYSHICNESEPSEIEICFVES
FT                   KEDKNSVDFFEFKYFLKFNRKRVLHEELKYKSSRLFSSVFYRKYDTDTNTYKVKSAGNG
FT                   FSVNELKAVPQNASAISYFRRKGDNVIAKAMHSIFYSIENNLNVFGKSSFNYGNVLEAT
FT                   EFYNEKPEFFEKAKKYLTRMDFGLNDIRIRTEDIIDKKTGEAERRFLPYGIHAHGGNEF
FT                   EIPFIMESTGTQACYYFIYKLISALNYGGVAVIDELDSDLHSYMVRELLDMFANEGVNK
FT                   LSSQLIFSCHTAEVLKTLNKHNVYLVEKSDSVSEAWRLDEIQGLRSQDNLYAKYITGAL
FT                   GGVPNINI"
FT   gene            complement(65850..66815)
FT                   /locus_tag="Dd703_0055"
FT   CDS_pept        complement(65850..66815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0055"
FT                   /product="Gluconate 2-dehydrogenase"
FT                   /EC_number="1.1.1.215"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: eca:ECA0078 2-hydroxyacid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83874"
FT                   /db_xref="GOA:C6C6F5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR023756"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6F5"
FT                   /inference="protein motif:PRIAM:1.1.1.215"
FT                   /protein_id="ACS83874.1"
FT                   /translation="MKPEIILYKSIPDDLRRTLEQHFTVAVFDGLPPVDHPVLANAEGL
FT                   IGAGHTVSREYIAHMPKLRAVSTVSVGYDNIDVAALNEKNALLMHTPTVLTETVADTVL
FT                   TLMLMSARRALESAERVKAGEWTRSVGADWFGVDVHHKTIGILGMGRIGLAVAQRTHCG
FT                   FGMNVLYNARRHHDEAETRFNARYCDLDTLLAESDFLCITLPLTPETRHLIGQAQLAKM
FT                   KPGAILINIGRGPVVDEQALIEALTNGTLYAAGLDVFEQEPLPVDSPLLKLPNVVALPH
FT                   IGSATVETRYNMAACAVDNLIAALSGNVKENCVNPDVLTQ"
FT   gene            67055..67303
FT                   /locus_tag="Dd703_0056"
FT   CDS_pept        67055..67303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0056"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   plu:plu4502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83875"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6F6"
FT                   /inference="protein motif:PFAM:PF07338"
FT                   /protein_id="ACS83875.1"
FT                   /translation="MNAIKNIAAIFALATLSFGTMAATEVHQAQGTEIGTVSASASSLG
FT                   ELNAELAAKADAAGAKSFRIISASGSDSLRGVAELYN"
FT   sig_peptide     67055..67123
FT                   /locus_tag="Dd703_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 23"
FT   gene            complement(67363..67812)
FT                   /locus_tag="Dd703_0057"
FT   CDS_pept        complement(67363..67812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0057"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   eca:ECA0081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83876"
FT                   /db_xref="GOA:C6C6F7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6F7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS83876.1"
FT                   /translation="MIRDFHPQDVEQLIPLWLESTTRAHPFIHPRYWQESEELVRYRYL
FT                   PHSQTWIYEDEQGIGGFISVMRQRFVGALFVHHRLYGTGVAATLMRYVQDRFDALSLEV
FT                   YQQNHRACAFYRKLGYSVVQESYQGETQAQLLIMHWKRLDPTLSG"
FT   gene            complement(67809..68447)
FT                   /locus_tag="Dd703_0058"
FT   CDS_pept        complement(67809..68447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0058"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: eca:ECA0082 DNA-3-methyladenine glycosylase I;
FT                   TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83877"
FT                   /db_xref="GOA:C6C6F8"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6F8"
FT                   /inference="protein motif:TFAM:TIGR00624"
FT                   /protein_id="ACS83877.1"
FT                   /translation="MRHTSAIINTNITDKSQRVNSLSGDAMKRCGWVTQDALYLDYHDN
FT                   EWGKPCTNSQKLFELLCLEGQQAGLSWITVLKKREHYRRCFHDFDPHRVAVMTDDDVAR
FT                   LVQDSSIIRHRGKIEAIITNARAWIVMQAQGENFSDFIWAFVDHTPIVNHPVSLSDVPA
FT                   KTAVSDAMSKALKKRGFKFIGSTICYAFMQAAGLVNDHVVDCFCRQESS"
FT   gene            68575..69381
FT                   /locus_tag="Dd703_0059"
FT   CDS_pept        68575..69381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0059"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   eca:ECA0083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83878"
FT                   /db_xref="GOA:C6C6F9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6F9"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACS83878.1"
FT                   /translation="MGVEWILAYLALGAVVGFMAGLLGIGGGGIMVPVLTGLFAAQGVA
FT                   PSHLVHLALGTSMAAIVMTAVSSLRTHHQHQAVLWPVVWRIAPAILIGTFAATWLATKV
FT                   PTRVLAIFFSCFMAYVAVQMVLNIKPKPNRQLPGTPGLSLAGLVIGGISALVAIGGGSL
FT                   TVPFLTWCNVRIQQAIGTSAAVGLPIALAGALGYMVNGWSTTGLPAFSMGYVSLPAVVL
FT                   ISMVSFFTAPVGARLAHRLPVVTLKKCFAGLLLLLSLKMLQTVFTG"
FT   gene            69529..70443
FT                   /locus_tag="Dd703_0060"
FT   CDS_pept        69529..70443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0060"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: esa:ESA_04168 glycyl-tRNA synthetase subunit
FT                   alpha; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83879"
FT                   /db_xref="GOA:C6C6G0"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6G0"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ACS83879.1"
FT                   /translation="MQKFDTKTFQGLILTLQDYWSRQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRALGPEPIAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKE
FT                   LGMDPTIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGTTTYGDVFHQNEVEQSTYNFEYADVDFLFTC
FT                   FEQYEKEAQQLLALEKPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTK
FT                   AVAEAYYASREALGFPMCNRKKS"
FT   gene            70453..72522
FT                   /locus_tag="Dd703_0061"
FT   CDS_pept        70453..72522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0061"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: eca:ECA0085 glycyl-tRNA synthetase subunit
FT                   beta; TIGRFAM: glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83880"
FT                   /db_xref="GOA:C6C6G1"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6G1"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ACS83880.1"
FT                   /translation="MTDKTFLVEIGTEELPPKALRNLAESFAANFTAELDTAGLGYQSV
FT                   NWFAAPRRLALKVAGLSASQPDREVEKRGPAIAQAFDAAGHPTKAAEGWARGCGITVSQ
FT                   AERLTTDKGEWLLFRAQVKGEAAQALLPGMVSAALAKLPIPKLMRWGDNDTQFVRPVHT
FT                   VTLLLGDELVPGTVLGIDSARTLRGHRFMGEPEFTIDNADQYPQILLERGKVLADYEAR
FT                   KAQIKADAEAAARNIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTM
FT                   KGDQKYFPVYDNAGKLLPNFIFVANIESKDPQQIIAGNEKVVRPRLADAEFFFNTDRKK
FT                   RLEDHLPRLETVLFQQQLGTLRDKTDRIAALAGWVAGQIGADVNHAKRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPSSPVACALAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGALRIIVEKRLPLDLQTLTEEAVRLYGDKLTN
FT                   ANVVDDVIEFMLGRFRAWYQEEGHSVDTIQAVLARRPTRPADFDARVKAVSHFRTLEQA
FT                   AALAAANKRVSNILAKSTETLNDGVQAALLKENEEIQLATYVTALTSKLAPWFAEGRYQ
FT                   EALVELAQLRESVDNFFDKVMVNAEDQQVRINRLTLLNELRNLFLKVADISVLQ"
FT   gene            complement(72706..73713)
FT                   /locus_tag="Dd703_0062"
FT   CDS_pept        complement(72706..73713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0062"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: par:Psyc_1209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83881"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6G2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83881.1"
FT                   /translation="MRLLFICPDWAGLATPIVAEMKRQGHDVIHIDHRDLSTFRYFDSC
FT                   HRIIAKLYKTFSGKHYKRQALDHQIQHGLHNFFIGREPFDAIIMTEPKLFNEQHLNILR
FT                   QHGKKLVATLWDSLSKAPDNALHINMFDHVLSYDSQDCARFHFTKINNYIDPSWKSAAP
FT                   YQACEYDVFSIMSFTSERYKQAVQFLDKNPELKSNLIFYIDKPGKRKYIKDARIKASEQ
FT                   LFLGAALAHEIDNARAILDIVQGQQAGLSFRAYESMAYQRKLITTNPHTADYDFYNPHN
FT                   VCMLNQDGSVPLDFIHTPYQPVAENIYRQYTLSAWVEKVMQEISGGTLPPTALN"
FT   gene            complement(73881..74975)
FT                   /locus_tag="Dd703_0063"
FT   CDS_pept        complement(73881..74975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0063"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: avi:Avi_5760
FT                   ABC transporter nucleotide binding/ATPase protein (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83882"
FT                   /db_xref="GOA:C6C6G3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6G3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS83882.1"
FT                   /translation="MAQLTLKNITKSFGNTQIIKGVDLDVKDGEFVVFVGPSGCGKSTL
FT                   LRLIAGLEDCTSGTIAIGGSDVTQVSPSDRGIAMVFQSYALYPHMTVAQNLSFGLENTA
FT                   MSKADIQTRVQEAARMLQIEPYLARKPRALSGGQRQRVAIGRAIVRNPSVFLFDEPLSN
FT                   LDAALRVDTRSEIIKLHKRLKSTIVYVTHDQIEAMTMADRIAILNGGMVEQFDKPLVLF
FT                   HHPRNRFVAGFIGSPKMNFYTGVIAELQGDHAQIAIEGFPPLTLTVNPQLAQPGMEIEL
FT                   GIRPSHFLLHTADENTLPFRVDYAEMIGTETYMYGHIEGNNSKTTLHLPDNLNVAEGDL
FT                   LALALPAERLHLFRVSDGLSLAAH"
FT   gene            complement(75338..76537)
FT                   /locus_tag="Dd703_0064"
FT   CDS_pept        complement(75338..76537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0064"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: avi:Avi_5412
FT                   transcriptional regulator ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83883"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6G4"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACS83883.1"
FT                   /translation="MIEIENDVPVLRQISVRAVMEYLLHAGPASRAAMAKATKLSKQTM
FT                   SEVILILEERGWVRPCGLESGKVGRAAMNYEIADDLAYVLGMDVGATTIRLSLVNLRGA
FT                   EITHYETENNSQGGIDLVNRLCQLKNDILAQQQIDESKLHSVSVAIPGVINQKTGALDM
FT                   APNLKNMSGFALRDTMQQAFGCEVLIENDVNAAAIGEYWRGCGQDDHSLAFISLGTGIG
FT                   LGLILEGILLRGAMGAAGEISYLPLGGDAYTPESLRQGTLESVLGAAGISQRYHFAGGA
FT                   ANTPVRDILNRYADKEPAAIVTIEETARTAALLVLSVSLMFDPESIIIGGNIGIRPELT
FT                   ERIRYYLSNCSPHPILLKSSTLGSQSVLTGAVAISLNKLHNLLFGLPDLSRKIPLPKNL
FT                   "
FT   gene            76787..77908
FT                   /locus_tag="Dd703_0065"
FT   CDS_pept        76787..77908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0065"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: avi:Avi_5514
FT                   transcriptional regulator ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83884"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6G5"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACS83884.1"
FT                   /translation="MANSQPLGKTLANALSQLERLSLEPISGWASVLDIPLASAQQLME
FT                   FLEKQDIIQRKPQGIELHPQSPVVIGFDLGGTKVKGRLATLAGEVLAQTAHPTRKGDEQ
FT                   AAMQQMSSLAEDLLSQAGVSSQRLKQIAIGIPGSIDKQGNVQLSPNLRLPARLPAVLSL
FT                   ADGKPCPTVFENDVNLAALGEYHYGHGKGSDSLVFVAFGTGVGMGIIAQGGIISGHSGM
FT                   AGEIALLPLSATPYEDARISVGGVFEDRVSSSAIRQRYQGGNIEVIDIFRQAEQGEPQA
FT                   LAVLENTARIAALGVASAVSLLNPEWLILGGGIGARPAFHERVRQQVEALIPVPVRLTG
FT                   SALLDDAGVVGAVHLAREACLTALSWHDVGEPA"
FT   gene            77905..79659
FT                   /locus_tag="Dd703_0066"
FT   CDS_pept        77905..79659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0066"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: avi:Avi_5513 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83885"
FT                   /db_xref="GOA:C6C6G6"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6G6"
FT                   /inference="similar to AA sequence:KEGG:Avi_5513"
FT                   /protein_id="ACS83885.1"
FT                   /translation="MNSNTSISSSEWKLQPQPDGQLVGDAVTRLPFMARRLQGSFCAAQ
FT                   GMVELALWGSGTLGRVHVAPLNGSCLFAPNRLLTAERGFYVAQSQPVALLTQTRFQRFY
FT                   PAKKRAWWDRQGGRAARERLGEQQRWVLPWGVVIVEQRGEDVLIAAGNDDAEARRGLAL
FT                   STEQIKQEAQRYIDDCDQLPQAQPLLRSMVQQSLHAALSSIRYDHAGKFAGLAAGMDYS
FT                   APARTYYRDGYWTLQALLPLQPQIVLEEIHLMAAGLQPTGEAPSGVILNGPGLSDAWED
FT                   ARQHNPAVTENHSRPQDWWSDHFDSPLFFILTIADYVRVTGDSSPCEQYWPQIATIIAR
FT                   YEGFILDDNGLPQKPSHNDRDWADNVYRFGYVAYDLGLWVGAVNAVAQWAAARDPALAE
FT                   RCERLAAQAARHLDAVLLQPNGHYADYGRPDEFIEDHLTLDSLTLLRYGAVDNARADAV
FT                   LRRIQAQLETRHNREQRYGDWGVMCAWPPFKRRQDTRAKSAFTLRYHNGSDWPYLDGLY
FT                   ADTLLQYGIPGSEYPLTRWWMTCLEQGWAGAVEYFSPPFGRGSLLQGWSSMPAAVVMKY
FT                   RHHFDGGQ"
FT   gene            79714..80958
FT                   /locus_tag="Dd703_0067"
FT   CDS_pept        79714..80958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0067"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bra:BRADO4396 putative sugar ABC transporter,
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83886"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6G7"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS83886.1"
FT                   /translation="MKKKAVIAVLAGAMTLACSSLQAAELTIMWYETDKNESAVLKQLL
FT                   NEYTQQHPQTTFNLQLVPYDNVIQKFRQYAASGSGMPDISKTSSMEAVIRPYLVDFNQY
FT                   FGKDYLNHYIKGWADGARLGDKAIAAPLYVTATGLLLNADAFKKAGVALPDVQQGWTWE
FT                   EFLPKIKEVAQKAHVRYPLVWDVSASRWIIHEYHYGNHVFSTEPPYKVVMDKQKAADTL
FT                   AGFVKIADEYMPRGQWSGSSADNPKELFIGGQAVAWMTGSWQLSSLAQRAKFDWRAGYT
FT                   PRGTVKSSVYGGEYVVAFNTSQHLDESTRVVKWLTSPDVLKRLSVPIGMIPATLSDEPV
FT                   KYEDPKISQAMALMQHELVESPAYAAADQANEAMQFVWAPMKDAVMQAVTHQITPEQAI
FT                   EKIMKAAQDGLGASQ"
FT   sig_peptide     79714..79785
FT                   /locus_tag="Dd703_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            80955..81902
FT                   /locus_tag="Dd703_0068"
FT   CDS_pept        80955..81902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0068"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rle:pRL120557 putative
FT                   transmembrane permease transporter component"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83887"
FT                   /db_xref="GOA:C6C6G8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6G8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS83887.1"
FT                   /translation="MKVMNPEQASLAGMSQSSGSFNSRIRKFWPYLLILPSFGLLLLFT
FT                   FYPLLQGFWMSVFQRGVVVLPQVASTHPKFVGIDNFIQVFTDPEFQHVLLRTVVFVVFA
FT                   VPLNLTIALVMALLLAPQMRGFGLARTIVFFPSMISLLTIGIMWKWLFGYNSGLINYVL
FT                   SLIDISPVPWLQQETMAQIAVVIVWVWASAGFNMMILLAGLTAIPEDLYEASRIDGTSR
FT                   WRTFWRITLPLLQPSVVVVVVLSSIEAFKVYELVLSLTGGGPGRATVYLIQTIYENAFM
FT                   QPATAGVAAAQSVVLFVILFALSVIQLRLSRSFK"
FT   gene            81899..82717
FT                   /locus_tag="Dd703_0069"
FT   CDS_pept        81899..82717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0069"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: xca:xccb100_1976 permease
FT                   component of a sugar import ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83888"
FT                   /db_xref="GOA:C6C6G9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6G9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS83888.1"
FT                   /translation="MKGSSLLTRWIVIGFMLLFFLLPPIWIFSNALKSVDEIFAWPPSL
FT                   WPEHITLENFVDVFANTNFVHTLGNSFFVSILSSLLSVSISVMAGYALAKFRFRGDTLV
FT                   FMIIMCALMIPLQIILIPIFLLLRDLHLLNTLWGVIIAPAATPTGVFLMRQYIKNIPDS
FT                   LLEAARLEGTSEWRILWRIVVPLSLPAIATLAAFTFVWRWNDFLWPFLVISDQSQWTVQ
FT                   LALASNVGQFDINWPRLLAMSAMAVLPMLAIFLALQRYFMNGLMAGATKE"
FT   gene            83208..83918
FT                   /locus_tag="Dd703_0070"
FT   CDS_pept        83208..83918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83889"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6H0"
FT                   /inference="similar to AA sequence:KEGG:ECA0086"
FT                   /protein_id="ACS83889.1"
FT                   /translation="MLADIRSRWLLPVMMFFMALQLSACGDKDKEQRQAFIAFLQGLPQ
FT                   EGRQLPELSEPQKQSFGRYTQDYAVLTSFNQQLNQVLADSLTPMLDEVSRIHVPQDYIN
FT                   QRDSVRQTVSALNLVNQQVQNAKAQAENARRALKQTEDLQPVFDKIYGRIVVQPANAMI
FT                   TVGPASVAFAQMLVQIGDYLQAQGNQAIFNGANVQFRTQQQVDQYNNMLTELTGQQQKL
FT                   FTQLKSQSLLTFAR"
FT   sig_peptide     83208..83282
FT                   /locus_tag="Dd703_0070"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.877) with cleavage site probability 0.832 at
FT                   residue 25"
FT   gene            complement(84020..85912)
FT                   /locus_tag="Dd703_0071"
FT   CDS_pept        complement(84020..85912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0071"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: eca:ECA0091 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83890"
FT                   /db_xref="GOA:C6C6H1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6H1"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS83890.1"
FT                   /translation="MAINFENIKVSKKLGFGFALVLLLTVVIAGVSVRYIEILKGRFEK
FT                   VIFSNQISDEVNQARYYRALYSANYSPDSMKENTTHIDNVIKLISSIQTKSWRSDYDGK
FT                   LGNISKLIDQYKEKQKNYLDAVAKKDDVRKSWNLSGADKPVKELEQQINASGDLSQQLQ
FT                   LTTLNQKLVTVRYLVRGLLLSLNSDAEKPLLAALDDARSSTDQFVKILSPEQQAILAPV
FT                   VSTLSTYKTRVQAYLPAYQEEMNQGNQLGAVAEQLMSEVDKLVTEETTSTQQDIANAEW
FT                   QIAITSIITLLLGVLVAWYISRQITHPLNQTVNIAERIATGDLTVTVETQRRDELGMLL
FT                   GAMAKMKANLHNMIDDIRMGVTQITTAASEIVTGNNDLAARTEAQAAAVEETAASMEQL
FT                   TATVKQNADNAHHANKLVLDATQTAQSGGKLVENVVQTMSEIEGSSKRIAEITSVINGI
FT                   AFQTNILALNAAVEAARAGEQGRGFAVVANEVRNLAQRSSQAAKEIEGLISTSVEQVSH
FT                   GAQLVHKAGKTMNDIVSAVTHVHDIMGEITMASDEQSRGIAQVNQAIVGMDSSTQQNAA
FT                   LVQESSAAANSLEDQAVLLSNAVSVFRLSSGRELGPATHGLPFAGSPRQLPLPR"
FT   sig_peptide     complement(85823..85912)
FT                   /locus_tag="Dd703_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.901 at
FT                   residue 30"
FT   gene            complement(86505..87131)
FT                   /locus_tag="Dd703_0072"
FT   CDS_pept        complement(86505..87131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0072"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   ent:Ent638_4063 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83891"
FT                   /db_xref="GOA:C6C6H2"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6H2"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ACS83891.1"
FT                   /translation="MSYSLPSLPYAYDALEPHFDKQTMEIHHTKHHQAYVNNANAALES
FT                   LPEFASLSAEELITKLDQLPADKKGPLRNNAGGHANHSLFWKGLKLGTTLEGELKAAIE
FT                   RDFGSVDAFKEKFEQAAATRFGSGWAWLVLKADGKLAVVSTANQDSPLMGEAISGASGY
FT                   PLVALDVWEHAYYLKYQNRRPDYIKAFWSVVNWDEAAKRFAEATK"
FT   gene            complement(87335..88168)
FT                   /locus_tag="Dd703_0073"
FT   CDS_pept        complement(87335..88168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0073"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: eca:ECA0093 formate dehydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83892"
FT                   /db_xref="GOA:C6C6H3"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6H3"
FT                   /inference="protein motif:TFAM:TIGR00129"
FT                   /protein_id="ACS83892.1"
FT                   /translation="MNSNVDNFPPTVSQNAATGACQRQVRHQGSLEYAQPDWLAEEVPV
FT                   ALVYNGISHVVMMATPKDLEPFALGFSLSEGIIESPREIYGMDIVPVCNGIEVQIELSS
FT                   RRFAGLKQRRRAMDGRTGCGVCGVEQLAEIGKPISPLPFTQTFSLSHLENALHALKNVQ
FT                   QAGQLTGATHAAAWIAPDGQLQGGCEDVGRHVALDKLLGLRAGQPWQQGAVLVSSRASY
FT                   EMVQKSAMCGVEILFAVSAATSLAVDVAQRCNLTLVGFCRPGRATVYTHPQRLRA"
FT   gene            88530..90068
FT                   /locus_tag="Dd703_0074"
FT   CDS_pept        88530..90068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0074"
FT                   /product="Aldehyde dehydrogenase (NAD(+))"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: eca:ECA0094
FT                   aldehyde dehydrogenase B"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83893"
FT                   /db_xref="GOA:C6C6H4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6H4"
FT                   /inference="protein motif:PRIAM:1.2.1.3"
FT                   /protein_id="ACS83893.1"
FT                   /translation="MTIDASGSRVAPGEYGYALNLKKRYDNFIGGAWVPPSSGEYYLNL
FT                   TPVTGLPLCEVASSNTLDVDHALDAAHKAKAEWGAMSASARALILNRIADRMEENLELL
FT                   ASAETWDNGKPIRETLNADVPLGIDHFRYFAACIRAQEGSISEIDHDTVAYHFHEPLGV
FT                   VGQIIPWNFPLLMACWKLAPALAAGNCIVLKPAKLTPLSVLLLMELIQDLLPPGVLNVV
FT                   NGAGGQIGEYLATSPRIAKVAFTGSTEVGQQIMGYAAQNVIPVTLELGGKSPNIFFADV
FT                   MDREDSFFDKVLEGFTLFAFNQGEVCTCPSRALIQESIYERFMERAIKRVESIRVGNPL
FT                   DSQTMMGAQVSSGQLDTILNYIDIGKKEGAQVLSGGRRKALPGDLAQGYYLEPTILFGH
FT                   NSMRVFQEEIFGPVLAVTTFKTIDDALEIANDTQYGLGAGVWSRNANIAYRVGRGVQAG
FT                   RVWTNCYHAYPAHAAFGGYKQSGIGRENHKMMLEHYQQTKCLLVSYSDKPLGLF"
FT   gene            complement(90118..91041)
FT                   /locus_tag="Dd703_0075"
FT   CDS_pept        complement(90118..91041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0075"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: spe:Spro_0094 AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83894"
FT                   /db_xref="GOA:C6C6H5"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6H5"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS83894.1"
FT                   /translation="MSRQVYFLMLPGVLMLDVAGPAEALRLAGHFSLHYVSPEAELQCS
FT                   TGMTLSHLAPLPDELPEGAILIVPGVFDSQHYFSTPQADIARRWLCRLQPASRAQRLTL
FT                   ACICSGTLLAAQAGLLDGYQCTTHHDVLERLIQQAPLALVKENRIFIEDRGIYTSAGIT
FT                   AGIDLTLHLIARFLDAQQSLQVAREMVVYFRRAGSDEQLSPWLQHRNHIHPVVHRAQDL
FT                   MSAEPEADWPLDALADRIHVSSRHLTRLFREQTGISVREYHERLRIAVAQQRLRQGIGV
FT                   EKAALMAGFSSGRQLRRAQQRQQQHC"
FT   gene            complement(91121..91669)
FT                   /locus_tag="Dd703_0076"
FT   CDS_pept        complement(91121..91669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0076"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: spe:Spro_0095
FT                   isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83895"
FT                   /db_xref="GOA:C6C6H6"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6H6"
FT                   /inference="protein motif:PFAM:PF00857"
FT                   /protein_id="ACS83895.1"
FT                   /translation="MAQSALLVIDVQNSFLHRPFWTESDVPAFQTALLRLIDGCQRQGV
FT                   AIADVFHVSQGPFSLASGHVVRQSFLTHRSDIQVHKHVHNALTESGLLTWLQQQEIRHL
FT                   IISGIRTEQCCETTARVASDLGYRVTFVTEATLTFPMTHDGLTLSSGELKHRTETVLID
FT                   RFAAIRSVDACLAELEQTS"
FT   gene            complement(91802..93262)
FT                   /locus_tag="Dd703_0077"
FT   CDS_pept        complement(91802..93262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0077"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: eca:ECA0096 xylulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83896"
FT                   /db_xref="GOA:C6C6H7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6H7"
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /protein_id="ACS83896.1"
FT                   /translation="MYIGIDLGTSGVKAVLLREDGEVIASQSAALTLSRPHPLWSEQDP
FT                   EHWWQATDGVLTQLARQHDLSAVRAIGLSGQMHGATLLDRRQQVLRPAILWNDGRSSLQ
FT                   CLELEQLTPDCQHITGNLMMPGFTAPKLKWVQQHEPEIFRQVDKVLLPKDYLRFRMTGD
FT                   FASDMSDAAGTLWLDVAKRDWSDVLLNACALTREQMPELFEGNSITGLLRADIAARWGM
FT                   KTVPVVAGGGDNAAGAIGVGVYQAGQAMLSLGTSGVYFAVSDGFRSNPQHAVHSFCHAL
FT                   PATWHLMSVILSAASCLDWAAKLTHADSVAALLTEAEQAGEDETATPIWFLPYLSGERT
FT                   PYNNPHAKGAFWGLTHSHGRAALGRAVLEGVGFALADGMDVLHMTGLEPERVTLIGGGA
FT                   RSAYWRQMLADISGKTLVYRTGGDVGPALGAARLAQIAMNPDQPLATLLPELPIEQIHT
FT                   PDPARHAHYGEQRGVFRQLYHHLLPMMS"
FT   gene            complement(93337..94656)
FT                   /locus_tag="Dd703_0078"
FT   CDS_pept        complement(93337..94656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0078"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="KEGG: eca:ECA0097 xylose isomerase; TIGRFAM: xylose
FT                   isomerase; PFAM: Xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83897"
FT                   /db_xref="GOA:C6C6H8"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6H8"
FT                   /inference="protein motif:TFAM:TIGR02630"
FT                   /protein_id="ACS83897.1"
FT                   /translation="MHAYFDQIEKIRFEGQGSSNPLAFRHYDPEQDILGKRMADHLRFA
FT                   VCYWHTFCWNGADMFGAGAFTRPWQGSGDPLALARAKADIAFEFFQKLGVPYYCFHDVD
FT                   VSPEGASLQEYRSNFAAMTDILAAKQQDTGVKLLWGTANCFTHPRYATGAATNPDPEVF
FT                   AWAATQVFTAMNATLQLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHK
FT                   IGFRGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKDIKVNIEANHATLAGHSFHH
FT                   EIATAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENALVLYEILRAGGFTTGGLNFDA
FT                   KVRRQSTDRYDLFHAHIGAMDTLALALKVAARMIEDNVLSRQVAQRYSGWNGELGQQIL
FT                   QGNASLETLAHYAERHQLAPQHRSGRQEMLENLVNRYLYG"
FT   gene            95013..96011
FT                   /locus_tag="Dd703_0079"
FT   CDS_pept        95013..96011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0079"
FT                   /product="D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="TIGRFAM: D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: eca:ECA0098
FT                   D-xylose transporter subunit XylF"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83898"
FT                   /db_xref="GOA:C6C6H9"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6H9"
FT                   /inference="protein motif:TFAM:TIGR02634"
FT                   /protein_id="ACS83898.1"
FT                   /translation="MMKVKYILLSVCAVIATLGQPGFAREVKIGMAIDDLRLERWQKDR
FT                   DIFVQKAETQGAKVFVQSANGNEETQISQIENMINRGVDVLVIIPYNGKVLSNVIAEAK
FT                   REGIKVLAYDRMINNADIDFYISFDNEKVGELQARYLVDKVPQGNYFLMGGSPVDNNAK
FT                   LFREGQMKVLKPLIDNGKIKVVGDQWVDAWLPENALKIMENALTANSNKVDAVVASNDA
FT                   TAGGAIQALAAQGLAGKVAISGQDADLAAIKRIVAGTQTMTVYKPITKLAQDAADIAIS
FT                   LGEGKTPSSNATLNNGKKAVPSFLLTPIPVDKNNIDSTVVADGFHKKSDVY"
FT   sig_peptide     95013..95087
FT                   /locus_tag="Dd703_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.992 at
FT                   residue 25"
FT   gene            96094..97635
FT                   /locus_tag="Dd703_0080"
FT   CDS_pept        96094..97635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0080"
FT                   /product="D-xylose ABC transporter, ATPase subunit"
FT                   /note="KEGG: eca:ECA0099 xylose transporter ATP-binding
FT                   subunit; TIGRFAM: D-xylose ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83899"
FT                   /db_xref="GOA:C6C6I0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6I0"
FT                   /inference="protein motif:TFAM:TIGR02633"
FT                   /protein_id="ACS83899.1"
FT                   /translation="MPCLLEMKNITKTFGAVKAVDNISLQLDAGQVLSLCGENGSGKST
FT                   LMKVLCAVYPHGSYEGSIRFAGDELRAAHIRDTEQRGIAIIHQELALVKEMTVLENVFL
FT                   GNEWSHFGVMDYDAMYLRCQTMLEQVKLDVDPNSRVGDLGLGQQQLVEIAKALNKQVRL
FT                   LVLDEPTASLTEKEAAVLLNIVQDLRHHGIACIYISHKLNEVKAISDMICVIRDGKHVG
FT                   TYPAASLGEEQIIAMMVGRELTELYPGEPHDIGDEVLRVEHLTAWHPVNRHIRRVDEVS
FT                   FSLHRGEILGIAGLVGAGRTETVQCVFGAYPGRWQGRVLVEGKPVTIRHCRDAIALGIA
FT                   MVPEDRKKDGIVPVMSVAQNITLAALEQFTGGGSVLDDAREQNCVRESIAHLKVKTSSP
FT                   ELAIARLSGGNQQKAILAKCLLLHPKILILDEPTRGIDIGAKYEIYKLINQLVKQGIAI
FT                   IVISSELPEVLGLSDRVLVMHQGRIRADLPNQGLTQEQVMEAALRSEHHAENVAV"
FT   gene            97613..98785
FT                   /locus_tag="Dd703_0081"
FT   CDS_pept        97613..98785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0081"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: eca:ECA0100
FT                   xylose transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83900"
FT                   /db_xref="GOA:C6C6I1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6I1"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS83900.1"
FT                   /translation="MLKTSLSERPNALAVPRRAKNFHLQVYVMIAAVVAIGLFFTLMTD
FT                   GAYLSARNISNLLRQTAITGILAVGMVFVIISAEIDLSVGSMMGLLGGAAAIFDVWFGW
FT                   PLPLTIVVTLLLGLLLGAWNGWWVAYRRVPSFIVTLAGMLAFRGVLIGVTSGTTVSPTS
FT                   PAMSRIGQSYLPDGVGFLFGVLGLLLFVAWQWRQRRSRQRLGLPVAPSSADVGRQALMA
FT                   AVVLGAIYLLNDYRGVPTPVLLLTLIMLAGVFMAARTAFGRRIYAVGGNLDAARLSGIN
FT                   VERTKLAVFAINGLLVAVAGLVLSSRLGAGSPSAGNIAELDAIAACVIGGTSLAGGVGS
FT                   VAGAVMGAFIMASLDNGMSMLDVPTFWQYIVKGGILLLAVWMDTATKRKA"
FT   gene            98921..100108
FT                   /locus_tag="Dd703_0082"
FT   CDS_pept        98921..100108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0082"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: eca:ECA0101 xylose operon
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83901"
FT                   /db_xref="GOA:C6C6I2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6I2"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS83901.1"
FT                   /translation="MFEKRYRITLLFNANKVYDRQVVEGVGEYLQASQCDWDIFIEEDF
FT                   RCRLENIGDWLGDGVIADFDDRDIIRRLADVSVPLVGVGGSYHDPADYPPAHYIATDNH
FT                   ALVESAFMHLKQKGIHRFAFYGLPAEAGKGWAQEREYAFRQLVAAEQYQGVVYQGMETL
FT                   PDNWQYAQNRLADWVQTLPPQTGIIAVTDARARHLLQVCEHLNIPVPEKLCVIGIDNEE
FT                   LTRYLSRVALSSVVQGTRQMGYRAAKLLHQLLLASQPLPLQRILVPPVRVAQRRSTDYR
FT                   SVHDPAVIQALHFIRHHACRGIKVEQVLDAVGLSRSNLEKRVKDETNQTIHGIIHREKR
FT                   DRARNLLVSTSLSVNEISTMCGYPSLPYFYSVFKKDYGMTPKEYRKRYGEGDYSD"
FT   gene            complement(100179..100766)
FT                   /locus_tag="Dd703_0083"
FT   CDS_pept        complement(100179..100766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0083"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: eca:ECA0102
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83902"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6I3"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACS83902.1"
FT                   /translation="MAKKVAVLLAPGFEEAEAVMVIDALHRTQVEVMTLSCQDMLELRS
FT                   YHNIRMFADALLERNMDTLFDAVVIPGGPQGTVNLAANPLVAEFIRRHDDAGRLICPLC
FT                   SAAARVLGGHNLLKGRRYVCSGDLWKDVTDGVYVDQNVVEDGNLISGKGLGVAFDFAFT
FT                   IAHRLTGNTDDINYQVEHIYYDSWRVKETAHA"
FT   gene            complement(100950..101228)
FT                   /locus_tag="Dd703_0084"
FT   CDS_pept        complement(100950..101228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0084"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   aha:AHA_0625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83903"
FT                   /db_xref="GOA:C6C6I4"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6I4"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ACS83903.1"
FT                   /translation="MPHTIKDKKKLLTRVRRIKGQAEALEKALDSGHSECLQILQQIAA
FT                   IRGAVNGLMSEVLEGHIRVHLMNENADPAERETDLDAIVAVIRSYLK"
FT   gene            101327..102442
FT                   /locus_tag="Dd703_0085"
FT   CDS_pept        101327..102442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0085"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   pmy:Pmen_2243 high-affinity nickel-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83904"
FT                   /db_xref="GOA:C6C6I5"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6I5"
FT                   /inference="protein motif:PFAM:PF03824"
FT                   /protein_id="ACS83904.1"
FT                   /translation="MLTMTDFVSLLQQGVANAWLFIPSAVLLGALHGLEPGHSKTMMAA
FT                   FIIAIQGTVRQAIMLGLAATLSHTVVVWLIALGGMYLSNAFTAEATEPWLQLCSGFIIL
FT                   GTAAWMFWRTWQGERQWDTHHHEHHHHEHHHDEQRIVDTGHGRVMLTIIEETGEPRWRL
FT                   TALSGAQWAAEQVYVETERSAGERQRFCFVEREGYLESAQTIPEPHSFLASLTLGHGDY
FT                   HHDYPLVFSDDGHGQPVGHNDEYQDAHEQAHASEIRRRFADGRATNGQILLFGLTGGLL
FT                   PCPAAITVLLLCLQVKAFSLGAALVVCFSIGLALTLVAVGVGAAISVKQVSRRWSGFST
FT                   LARRAPYFSSLLIALVGAYMLVHGAGRLNFF"
FT   gene            102770..104122
FT                   /locus_tag="Dd703_0086"
FT   CDS_pept        102770..104122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0086"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: eca:ECA0104 argininosuccinate synthase;
FT                   TIGRFAM: argininosuccinate synthase; PFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83905"
FT                   /db_xref="GOA:C6C6I6"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6I6"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ACS83905.1"
FT                   /translation="MTTILKHLPVGQRIGIAFSGGLDTSAALLWMRQKGAVPYAYTANL
FT                   GQPDEDDYEAIPRRAKEYGAENARLIDCRKQLVAEGIAAIQCGAFHNTTGGMTYFNTTP
FT                   LGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNAELKIYKPWLDTDFI
FT                   DELGGRQEMSEFMAQAGFNYKMSAEKAYSTDSNMLGATHEAKDLEFLNSSVKIVNPIMG
FT                   VKFWDENVHIPAEEVTVRFERGYPVALNGKTFTDDVELMLEANRIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGMALLHIAYERLVTGIHNEDTIEQYHAHGRQLGRLLYQGRWFDPQ
FT                   ALMLRDALQRWVASAITGEVTLELRRGNDYSILNTVSDNLTYKPERLTMEKGESVFSPD
FT                   DRIGQLTMRNLDIIDTREKLFNYAETGLLSSGNTGVPLVSGNSQLQDKSAK"
FT   gene            complement(104197..104697)
FT                   /locus_tag="Dd703_0087"
FT   CDS_pept        complement(104197..104697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0087"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: atc:AGR_C_466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83906"
FT                   /db_xref="GOA:C6C6I7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6I7"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACS83906.1"
FT                   /translation="MPRYLEVSDIIKQWEQERPDLDVSPMLLIGSLSRVSLLIDRALDR
FT                   VFSQHHLSAREFDILATLRRSGAPYAISPTQIVNALMINNSTLTSRLDRLESAGWLRRV
FT                   PIQGDRRSVNIQLTDEGFALINQVVAEHVENERQLLSLFSDEEKVTLRTLLSRFEKHLN
FT                   TTD"
FT   gene            105005..105877
FT                   /locus_tag="Dd703_0088"
FT   CDS_pept        105005..105877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0088"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ara:Arad_4435 transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83907"
FT                   /db_xref="GOA:C6C6I8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6I8"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS83907.1"
FT                   /translation="MRLKHFAFYAPCVWGTTYFVTTQFLPADRPLLAALVRALPPGLML
FT                   IAGTSMPSRYWLRRLFVLGALNIGIFFVMLFFAAYRLPGGVVALVGSFQPLVVIVLSCL
FT                   LLAQPIVKQQVMAAAMGGAGIVLLISLPDAPLNPEGLMAAMLATCSMASGLVLTKKWGR
FT                   PPGMSMLTFTGWQLFCGGIVILPLQLMVESFPVHFSLINAAGYFYLAIPGSLLAYFMWF
FT                   SGVEAHSPVAMSMLSFLSPLVALLLGFLFLSQGLSGAQLLGVVLIFGAVIAAQDLAFLK
FT                   RKAQLGRNG"
FT   gene            106261..107238
FT                   /locus_tag="Dd703_0089"
FT   CDS_pept        106261..107238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0089"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; KEGG: plu:plu0753 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83908"
FT                   /db_xref="GOA:C6C6I9"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6I9"
FT                   /inference="protein motif:PFAM:PF08541"
FT                   /protein_id="ACS83908.1"
FT                   /translation="MRENGTGAVHIPSETGVFCLNAIYHDAPSAIRRVPLSELGDSHRL
FT                   KAGQCRVMEKFYQLRTVPMHPASHEVMLESVVASLAAEWPELRQREGVVIYAKTQTHNT
FT                   FFDRDWLGSILIRQRLANWDVMTLSLNHCASALSALHLIRQGAVRRNIPIIVLTGEKAF
FT                   HPEINRFTVGVQGELPVAALFNARHSPWQVTFTAVKHLSRFYNNADNMTRQEKADLNDC
FT                   LLGELCDFVSHSVRLSGINPEDVDYFVPCNLNLPLLNQMAARLNIGGRLFDGNVADYGH
FT                   LYCSDVLFNFSSLLKTTSRARNYFCFSIGMGVTLSCALIQHTDI"
FT   gene            107251..107517
FT                   /locus_tag="Dd703_0090"
FT   CDS_pept        107251..107517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83909"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6J0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83909.1"
FT                   /translation="MSATLAVIQQALREVMDNDEIEINESTDLDNDLDLDSVMFVQFLL
FT                   TLEDKIEGLLFDPDQINMETFSTVGGLISWLNSNVMQEVRHVG"
FT   gene            107507..108118
FT                   /locus_tag="Dd703_0091"
FT   CDS_pept        107507..108118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83910"
FT                   /db_xref="GOA:C6C6J1"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6J1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83910.1"
FT                   /translation="MSAEHIGQIWTAFRDRPLAEALTLLLQPASGARHYLHQIGYQIQE
FT                   IGRIPDAGQPQRLFDRVLTHLELDVVRSQETLSLPAHFPLLVCVARLGILARMQAMSWQ
FT                   HLSGRTSFGAKTTRHQLIKASFADVAGRAALLLEQQQQRLQAGDMLGLEDDHYQITQLS
FT                   NDAEKMMGGHGFLLGNTHSLSYFSMMLYSIYGKASCLAAA"
FT   gene            108139..109500
FT                   /locus_tag="Dd703_0092"
FT   CDS_pept        108139..109500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0092"
FT                   /product="multi antimicrobial extrusion protein MatE"
FT                   /note="PFAM: multi antimicrobial extrusion protein MatE;
FT                   KEGG: plu:plu0761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83911"
FT                   /db_xref="GOA:C6C6J2"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6J2"
FT                   /inference="protein motif:PFAM:PF01554"
FT                   /protein_id="ACS83911.1"
FT                   /translation="MGLISRVMTRRTSSVHGDVLQIVVLAWPMMVTAIVVSLSQNLQIA
FT                   ILGNGAESQTLSTLSLLQPFNFLFIAIMECVAITNQVFSARSRHDWPRGRIWHSTLLSG
FT                   GLGLLATTAAAALCYLLASPLSSWMGSSDPSLMRSSAPWYLLSMTPFMLLEVGNAALRG
FT                   QGRTAAAMLLMCAYILGNALLCFVGFQHYQLGFDAVLLANAVAAAPLLPLVFVLVRRQA
FT                   RTADRPDDRPQAFLPRLLALLTNAGIPVFFSMVVVFFSSMVIFPMVARAGEGMLPAFLI
FT                   VIKLRAFFIIPAVALGSAIAILSNQRLKTASVVALAGLLKSGLWLVVLVCLCLTLAVGA
FT                   IRTGVLDGLSNDAVIRHASQTVLLLLLPTFFLTSLVAALQTLLEQLERGKRVLLFTLVL
FT                   ELAMAGVVLTTRSYFDDIRALAGLMVSFSVLYAVVFLREYRLLLKSLGERDAAV"
FT   gene            109487..110488
FT                   /locus_tag="Dd703_0093"
FT   CDS_pept        109487..110488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0093"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_0267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83912"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6J3"
FT                   /inference="similar to AA sequence:KEGG:PFL_0267"
FT                   /protein_id="ACS83912.1"
FT                   /translation="MLLYDLCYPLLWLFAQVHYSYYRVLVWLKRRPSLLLRIKIKPDTH
FT                   YQQVCHRLRMADLWLLQRFSQRLAAGYLLRLFESTRYFSYKQMDRDYLAAFDQEELLFQ
FT                   RRRVCVFRWFPARGAPLRNVLLVHGWEGRGIMFRPLCEALKAQGFGIVMPDLPAHGVSE
FT                   GDRVSNYELAELVLMLGKQYGPFDAVIGHSSGGLISALAMVQGLAAERLVLLASPDNLG
FT                   AMIDRFLAGTGVAPALAVPMKALYAQRFGFHPDNVGPEIYRSLFCPALICHDLQDARVA
FT                   PQTAQTLHGALRCSELFYTRGLGHLGILRSPLVHRRILDFLAVTPPGQLAIF"
FT   gene            complement(110470..111027)
FT                   /locus_tag="Dd703_0094"
FT   CDS_pept        complement(110470..111027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0094"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: pde:Pden_1138
FT                   helix-turn-helix-domain containing protein, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83913"
FT                   /db_xref="GOA:C6C6J4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6J4"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS83913.1"
FT                   /translation="MNLQNTYAHTLDNDSFNNNLIQDMYRRHPQLRKTLASSSKATNLA
FT                   VIIDYIIDNIGNNITLENLEQVSGKSKFDICRLFNQIYNITPMRWIWRVRLTLAKEIIH
FT                   ISPNWSLTDICYACGFSSLPHFSRCFTKTYNIPPLKYRKAVFQDKEAARVINNTSFDII
FT                   FGRQRHLFSRHVLLDNIQNIAN"
FT   gene            111476..112183
FT                   /locus_tag="Dd703_0095"
FT   CDS_pept        111476..112183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0095"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cps:CPS_2119 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83914"
FT                   /db_xref="GOA:C6C6J5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6J5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS83914.1"
FT                   /translation="MTVLVQLDNVHKIFLTDEIETHALSKINLSIHSGEYVSIAGPSGC
FT                   GKSTLLSIMGLLDTPTEGHYWLNGTDIEFISRKEMARLRNREIGFIFQSFNLISDLTIE
FT                   ENVALPLTYRNDISRSEQKARVIQALEKVGMSHRVRHYPSQLSGGQQQRVAVARAIVGR
FT                   PSLLLADEPTGNLDSANAEAVMNILDELHQDGATICIVTHDPRSAMRAQRTIVLSDGQV
FT                   VADGGNSQLLQAV"
FT   gene            112188..114629
FT                   /locus_tag="Dd703_0096"
FT   CDS_pept        112188..114629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0096"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cps:CPS_2120 putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83915"
FT                   /db_xref="GOA:C6C6J6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6J6"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACS83915.1"
FT                   /translation="MNIWFDIRYALRLLLKSPGFSVLTITVMACGLGLALYMFSIINTI
FT                   MYKTLPYPNGSGMVLLTPTVNGETFNDYGVNFLDYELIRQRARTLEDMSYFYAEYIDLK
FT                   TEDTSVRYIAVRNTPSMFSYTGVHPLLGRAFDDQDMAENALPVAIISYDLWQKYFQGRG
FT                   DIVGLTVKINSVNTQIVGVMPKGFAFPFYHDLWLPAAIPAASTLKREKAPEVFVFAHLA
FT                   KKRKPVDADRELDGIMRGVVGEAPNDKKEISVKVLSFQESFTGEETAQSFLVMLSAVGF
FT                   VLLLACCNVGNLLLARSNRRTREIAIRVALGSPTSRLLLQMVWESLIICTVAGIIGVLL
FT                   ASWGLDITNYIFPKFVPNKIPVWWHLSLDGEVIIDAIVLVIITALVTSALPAWKVANGQ
FT                   FAYALRDGANSDQGRRTGKFSRTLVVVEVALSCSILCISVLLLFLVIRATKADYGVPID
FT                   NYLVSQISLSKDNYPDSKSRGDFYIKTMEILKKIPGVSGGALISNAPGQFTFPHQVTTE
FT                   DLLSNTKEPQPYSLVNDIKLMPGNLSEIGAAVLYGREFSFNDDSNSLPVAVVSNSFAQR
FT                   YWPGEKSVIGKKIRFIDGNDSRWFTIIGVAPHIIHGRPFSEFKSRPTVYRSLLQLQQDN
FT                   PPLTLMLKTTQQQQVAPMMQQVIRQVNPSVGMSQPQMLSDMLIRNTAGVEFVTNLFLLF
FT                   GLAAMVLAASGIYGVTQNAINQRTQEIGIRQALGASPTNLMRMLMFSGLKQLFVGLALG
FT                   LPLAIFAAPKINRVYGDGSSGFILLFLSVAFFILITVSLATWIPSRRAIMMKPGEAIRY
FT                   E"
FT   gene            114948..116348
FT                   /locus_tag="Dd703_0097"
FT   CDS_pept        114948..116348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0097"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; ATPase associated with various cellular
FT                   activities AAA_5; SMART: response regulator receiver; AAA
FT                   ATPase; KEGG: cps:CPS_2121 sigma-54 dependent DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83916"
FT                   /db_xref="GOA:C6C6J7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6J7"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACS83916.1"
FT                   /translation="MADKQHVLIVDDDAHILASLQMLLSMEGYQVTLASTVEQVPLQLS
FT                   QHDFDVILMDMNYQRDTTSGQEGLILLEEIKKYDEYLPVVAMTGWGSVDIAVSAMQTGA
FT                   VDFIQKPWDNERLLSILRQQISFSRSQRSGKRLKEENKLLKLALEDDFNGEWVIESSQM
FT                   QQLMRMVEQVAVTDTNILILGENGTGKSLLARVIHQLSSRRDESLVSVNMGCINENLFE
FT                   SEMFGHVKGAFTDARESRVGRFELADKGTLFLDEIGNLPMTQQSKLLRILEERCFERVG
FT                   SSRTLKTHCRIVAATNANLAERVAEGTFRQDLYYRLNTIELHLPSLAERQEDIVPLTLN
FT                   FIERYARKYNKPVPALSPSGQAALFRYHWPGNVRELSHLLERAVLLCAASRLNSDDIFP
FT                   SLPTMSQKTFRAEAEFSSDATLADIEERLLSQRMTKFEGNAVKAAQSLGLSRSAFYRRL
FT                   EKYKINHE"
FT   gene            116341..117660
FT                   /locus_tag="Dd703_0098"
FT   CDS_pept        116341..117660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0098"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   cps:CPS_2122 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83917"
FT                   /db_xref="GOA:C6C6J8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6J8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS83917.1"
FT                   /translation="MSKLDTSFEPPHLLSLNIAAFVGLLGYFLLWFFPDQSVYLKILTV
FT                   FIIVLCLIYSSFTFSERLNARIHVVSNLLEALGQENFSLRGVTKGKGAFDNLIRQINQL
FT                   SGTMARSRQQQQETYYVLHKVISNISVSVFALDAEQRVMWCNDAASALLNKPVKLLVGQ
FT                   PAAEFGLEGLLQQSSGAEPIDWRFPSAQGMFQIRHDSYMEDGRQNHLLFISDVSKLLRN
FT                   EEQKTWQNLLRVISHEINNSLTPIASISQTLLQVFRKDTQHPAAPDLVNGMEIINNRAR
FT                   DLIAFVGSYRQLNRLPPPSKQPCDVTLLMTQMAMLFPQRRLVFSGESPLMVAVDANQMQ
FT                   QMFINLMKNADEAMEPGVGEIVLRWTVVARQLHIEIIDQGKGVANIENLFVPFYTTKNH
FT                   GSGIGLILCRQIVEGHGGHLTLENRKDAEGCIVNIFLPLG"
FT   gene            117617..118363
FT                   /locus_tag="Dd703_0099"
FT   CDS_pept        117617..118363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0099"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   cbs:COXBURSA331_A0314 phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83918"
FT                   /db_xref="GOA:C6C6J9"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6J9"
FT                   /inference="protein motif:PFAM:PF01648"
FT                   /protein_id="ACS83918.1"
FT                   /translation="MRKDASSISSCRWDELPSDEPHQPLCVVAPVDSLASAARQAAIRQ
FT                   AAGVDVDTAMTLSQQAWGILRLLLAPICRQMPQALRFERNAHGKPFLADYPAIQFNVSH
FT                   TRTALAFAMAMHHPVGVDVERCVGNPTGKRAVAARFFHPNEAHWLASLSDEAFLPAFIR
FT                   LWTRKEAYIKALGLGLHRQLNDFSCLSAAGHVLVRDKDQDVGAVIQEGWLDGAPATAFC
FT                   CCALPTAPAAVDIDAWRVRILTPDAG"
FT   gene            complement(118424..119164)
FT                   /locus_tag="Dd703_0100"
FT   CDS_pept        complement(118424..119164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0100"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: neu:NE1226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83919"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6K0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83919.1"
FT                   /translation="MSQADGSPASPHHREPQLKAAMRHGMKTLFFSVLALLPLTVACSP
FT                   TQQKSVELTHFSALNLSRGLEVTVQCGNENRVSATARPAVLEKLVIQRQDDTLTIDNPY
FT                   NDSNKLRDHSVVVTITLNAPLSRVNAQSGVQFALPACAVSPDQLTIDASMGADVNVEGA
FT                   TRTLNLTLAMGAAFNRNASDFSADNAVVRFAMGADARLCRVKRLSGSMTTGARASVSPT
FT                   TDVHIDGGLASLVEHSCPAETAAR"
FT   gene            complement(119398..120321)
FT                   /locus_tag="Dd703_0101"
FT   CDS_pept        complement(119398..120321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0101"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; KEGG: plu:plu0753 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83920"
FT                   /db_xref="GOA:C6C6K1"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6K1"
FT                   /inference="protein motif:PFAM:PF08541"
FT                   /protein_id="ACS83920.1"
FT                   /translation="MRLTHFVNWIPENRISAAEIITQSGASPSEARVFSQLFGFRQVAA
FT                   LDGKTSVEQVLFHLLDRLQQEAPQPALPADTLIYVHGMPVQHPDAPGWSARLRAHPFIT
FT                   PDAACYELDQQNCATLFWAFDLARRLLAARQARRIAIVAGDTLSTFPPEERYVAGCTLV
FT                   GDAFSALLLEEADEGLQIGPIFLAQRPEFHAGIHDGEQAKKDFYQAHDELVSAALLGAG
FT                   VTPHEQPMLLPHNVNRISWLNYSRRHHYPMESIALGLMPDIGHCYTTDSLLLLQMALPA
FT                   VLAGTPHVMLSVGLGAWIGSCRLFYV"
FT   gene            complement(120326..121162)
FT                   /locus_tag="Dd703_0102"
FT   CDS_pept        complement(120326..121162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83921"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6K2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83921.1"
FT                   /translation="MPTYLDPRSILHRSSTLTEEILPTGHQQRAYWHDYAARFLAANGL
FT                   SWRDTLANPPPDGGLSSFISLLDPLLPTYRARHDLSRIDSVLMAHWTPDLHLGSSVINY
FT                   VIHELGLPDCLALTISDRGPDAALFALASIANCQQENAGDALLLMADQGYLHYRSDLMS
FT                   TLTPENNAGLLTLSRRPQALRYQGYHRQPLTTQRTVIAEVQHLIARFELRPQHTVIIAD
FT                   ATLLALLPAAPLVIATHPQWLCAAPFAALAAHYQPGHDYLLLVEHQRRLSAVALRG"
FT   gene            complement(121146..122282)
FT                   /locus_tag="Dd703_0103"
FT   CDS_pept        complement(121146..122282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0103"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   plu:plu0762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83922"
FT                   /db_xref="GOA:C6C6K3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6K3"
FT                   /inference="protein motif:PFAM:PF02770"
FT                   /protein_id="ACS83922.1"
FT                   /translation="MKALTFSNLKKDLDALGEKLRLAAGQMETDRALALSSLEDELLYV
FT                   ISYIGIPPQFIPFRGWDYEACSYQDNIDMLEYLSRFDASALMSLPGASLSARAVIALGT
FT                   PQQQAFFFSRFTTPPCWAFFAVTEPEVGSDTQSVASSLTRCDDGYLLTAHKKFIGGAQL
FT                   ASVGLVFARDGDTQRLVMVDPKRYAQHISITPLEQFGLQGSNLTEISISDMPVQPADIL
FT                   GYERKGLNQGLHALGQVFERHRPMVSAMALGTTYGLLSALDGHPLDDEQQRWVTQQWRT
FT                   YHLLRRQLAEIAEHYQNGASQYYTTSQLKRRCTLFAESVAHRMPHLLNGQAWLENPQLR
FT                   RRCRDAFAFEYMEGTANIHLMNSFRCHTARGGVCAHVS"
FT   gene            complement(122330..123307)
FT                   /locus_tag="Dd703_0104"
FT   CDS_pept        complement(122330..123307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0104"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; KEGG: plu:plu0757 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83923"
FT                   /db_xref="GOA:C6C6K4"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6K4"
FT                   /inference="protein motif:PFAM:PF08541"
FT                   /protein_id="ACS83923.1"
FT                   /translation="MLGHIDAIEMAFPPDVHTLETVAQEVGLSRLDTRMFDRFYGLRRF
FT                   HGGNGTLDELLTPVITQLQASRPQAFAAISHVAHCHTVPDVRAFDQRALTPNWLQRFAP
FT                   QVEFASLTMGHCATPLTAAEWLLKQLSPEGYGLLLIGEKAFHPRVKLIRDTTLMGEAAC
FT                   AVLLSRQGDGPAILSRHTGQDGRFSIQKGYDERETTEFGEHYIDFTRRHLLAALDKANL
FT                   TLGQIDWIAPHNVNLSSWHRLAQLLDFPREKIFLDNIPHYGHCFGADPFINLHFLMRQQ
FT                   RVRPGDKVMLVSVGLGATYASLIVEIPTARHTQSRPATSGNPST"
FT   gene            complement(123358..123876)
FT                   /locus_tag="Dd703_0105"
FT   CDS_pept        complement(123358..123876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83924"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6K5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83924.1"
FT                   /translation="MVDIALTPAQETIGRLTVETVATPLSPSEVRSLHPWLALNPAEAG
FT                   APWYLHAPRHTDATGRHATEVVELCRRFNERHKQGTLLYEYCGVPLQFRTPLLQSLLFA
FT                   APGFRHSVGIRVQERPLEAQSLAQTLRETGSALLYLSDPLLRLSQRADAGPVTYAYRCF
FT                   TDPGRHHDA"
FT   gene            complement(123882..125012)
FT                   /locus_tag="Dd703_0106"
FT   CDS_pept        complement(123882..125012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0106"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   plu:plu0762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83925"
FT                   /db_xref="GOA:C6C6K6"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6K6"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS83925.1"
FT                   /translation="MTDYALFLQPLKTRIESTLDEGRHLGGQIDIDPEKARITAGYSLA
FT                   PMLNTLGVPADYRPQCWLEEAGVALNNLSLPLRCEAYESFGYIDPNLLFSSPGPGMAAM
FT                   VVDSIGSQTQRDEFFSQFSRELTWSSFAMSEPNVGSDVQQLQTRAVKVDGGWLINGEKY
FT                   LIGNGVIADTGVLFARTAPGPLGINVFIFSPRHQPGIAAERIPIVALPGCNVSHLRFHD
FT                   LFLPDSALLGQHLKPTERFARSALITFDALRPCVGAIALGIARSALDMVLQHRWTTPKS
FT                   VWLQKAQRQLQAAMAQARAICERLEQGEACGREAGLIKVVSTRIAEQVIMNAVHHAPPA
FT                   ALGECPRLAKAWRDVKALEYTEGTTFIHLLNHGYRR"
FT   gene            complement(125009..125440)
FT                   /locus_tag="Dd703_0107"
FT   CDS_pept        complement(125009..125440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0107"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_1038 methylmalonyl-CoA epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83926"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6K7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83926.1"
FT                   /translation="MKFSHLGYIVKNSDATIAAMAHFFPQILVYRKKIAAQQIFVSFMN
FT                   TAHGDMQIELVEPLPENRLLNGMLEKAHKECLPYHICFEVNDFAEKYQQLIHGGWLALT
FT                   RPFHAYPDGPLASHLYKPEAGIMEIMSGSTTLLAQGETA"
FT   gene            complement(125497..127017)
FT                   /locus_tag="Dd703_0108"
FT   CDS_pept        complement(125497..127017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0108"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   baa:BA_1915 AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83927"
FT                   /db_xref="GOA:C6C6K8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6K8"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACS83927.1"
FT                   /translation="MFSSVLNPLRDAMLRQPEDIALIASEGQYTFAQLGERIQALRNAI
FT                   RRHQPGCVMIYGHKQLDAAAAMIACAFEAVVFTFVDTANPAPRIANIATMTGAQLALLA
FT                   GEPPLPLPINPMPILRCQDCRTDEALQPVVPSHHDAVFYILSTSGSTGEPKGVKISYGN
FT                   FGALADWAIPLVHRHYPGAHVNHACLSFDMGVMDIFLALAVGKTVIMLNHRDNIRPLAN
FT                   LHILTPPTRRVSTWFSTPGFLEIMCMATQFQQAQLPDLRFIGIGGEMLSPSLVKTLHAR
FT                   FPQAQILNGYGPTEATCMTHAAILTPESLPDTPPLTVGLPGVGNGMAIVDKQRCPLPAL
FT                   AVGEIVLFGSQISPGYLPENDPRNQLFGLWRGQRCYYTGDMGYLNADGELFIKGRDDGQ
FT                   FKWQGNRIETGEVETTAQRIDGVQQAALVSKKTHGKVTALVLFVHLAIDDASHREAFRR
FT                   ELARRLPAYMVPRSVYFTHVFPLNLHGKTDRQALMQQFANGDENCNQE"
FT   gene            complement(126998..128548)
FT                   /locus_tag="Dd703_0109"
FT   CDS_pept        complement(126998..128548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0109"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bsu:BSU38500 D-alanine--D-alanyl carrier protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83928"
FT                   /db_xref="GOA:C6C6K9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6K9"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACS83928.1"
FT                   /translation="MCLIASWQPLITLFARFEGTSAIACHHIDGCLTYRQLYLGALALA
FT                   EQLDIATAGRTPRPPVLLFGHKNRVYLIAYWACLLTGHPIVPMETDNADARLRTIADSI
FT                   QAGLLLNLTDEAAPDCGIPVIPVTMALCEQAAPSLSERCRRMGMDFGHDNIISGTAYIM
FT                   FSSGTTGAPKGIRIGYPNLAHFVRWIEGRFPSPGAVSGNIRYCFDVSLYELWLAWLHLA
FT                   PISTLDYRDIINTRKMIARHAETGVQTWVSTPSLTRNYLQDRQFRQENLPQLNTFIFCG
FT                   EVLPKEMVEALWRAFPGCRIVNTYGPTECTVAVTACDITPEMMSDPAPLPIGRARPGVG
FT                   IHLDTTAAQDGRGEILLCGAAVGEGYLNAAASQQARFFTTHNGVRGYRTGDLGSLRDGL
FT                   LYFHGRKDDELKIQGYRISPGEIEHLLRQHPQVQDVIVSPWLRQGIPQALQAFVLSDQV
FT                   DICPALATYLQRHVPAYMIPRFWYPIDDPTLNLNSKLDRRQIAEQTPNRGKRYVFVGS"
FT   gene            complement(128539..128811)
FT                   /locus_tag="Dd703_0110"
FT   CDS_pept        complement(128539..128811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0110"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83929"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6L0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83929.1"
FT                   /translation="MSLDLYYDDVVAAIGLVLETDDLSELSPHTHLERDLGFTSGVFIE
FT                   LLMYLEERVDDLSINPVTLDTEQIATIEALCRFIHTQRENNASCA"
FT   gene            complement(128817..130397)
FT                   /locus_tag="Dd703_0111"
FT   CDS_pept        complement(128817..130397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0111"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mlo:mll6742 long chain acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83930"
FT                   /db_xref="GOA:C6C6L1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6L1"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACS83930.1"
FT                   /translation="MTPTAHLTAWLDRAAQEAANHAAIIDADREISWFMLRLQARQLAE
FT                   YLQQQGVERGDRVIVYMPNSLTFITCFWALQYLGAVFIPVSPDTRASKLSWLVDNAGCR
FT                   LVLADTALRNEIGIAYGSEHWQQYNRAVQVLFNDDVAASLIETPYRISVPDDAVPGIDL
FT                   DLACIIYTSGSTGYPKGVMLSRRNMTAAADSVAGYLQLRSDDRIMSMIPMSFDYGLYQM
FT                   IMATRVQCTLIVEPDFRRPLLSLQRMVTLRATVLPIVPTMLRLIAPFASRYDFSGIRTL
FT                   TNTAAALHPDDISRLRELFPQARIYSMYGLTECHRCTYLPPELLASHPQSVGVAIPNTE
FT                   LWVVDEQGQRHTRNATGELVIRGATVMCGYWRNEEKTTEKLRPGLLPGEKVLYTGDLCR
FT                   LDEQGLLYFVGRQDEMLKSCGEKVAPKEVETVLCRHPQVVQAAVFGVPHPIYGDEIVAC
FT                   VVTVGDITEKALSRWSKTQMESHLVPHRFQLLDQLPLTPNGKINRLQLKAQCTAAEPAA
FT                   SRLQPGLTE"
FT   gene            complement(130407..131324)
FT                   /locus_tag="Dd703_0112"
FT   CDS_pept        complement(130407..131324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0112"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu0764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83931"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6L2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83931.1"
FT                   /translation="MTLCIQPANMVWRTFSSQDDLSPHPSQDMMADYLRAFFLSHGETQ
FT                   EPDNEWLDRWLNSGQLSFVHMMQALLPELQTRHLLQDIDLALFAHWTPDTDIGCAVPNA
FT                   LINACGARQAFGLSISDRGLAAPLFALYAIDEYLTGDPSRQKALLMIADQDLAPYPSER
FT                   LRQLQPRKNCSLILIEKHAPAQASGLVYEGYYRQPYASDGDLTLTVRQLLARVREQHAD
FT                   PLPITLLVGATLFVALQNGVGDAQLAQVAESLLCAAPFVYLKTAAQPDNRYLMVVAEAR
FT                   HLTACAFRCQPDRNPFPHSPVLTR"
FT   gene            complement(131321..132649)
FT                   /locus_tag="Dd703_0113"
FT   CDS_pept        complement(131321..132649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0113"
FT                   /product="Orn/DAP/Arg decarboxylase 2"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG:
FT                   mpo:Mpop_3620 Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83932"
FT                   /db_xref="GOA:C6C6L3"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6L3"
FT                   /inference="protein motif:PFAM:PF00278"
FT                   /protein_id="ACS83932.1"
FT                   /translation="MHEPEPGAPCFDEGNIDGVAVSDIASRIGTPFYVYSARQLRRQFG
FT                   QLRQRLPSNIDIYYSLKANPNLSVVNLLVTEGAGCEVCSPTELETALAAGVAPQRVLYV
FT                   GPGKSLAALEHAIDKQVRAIVAESIAELDAINRQAAASGSVQTVALRINPDFNVEHARL
FT                   VMSGKPTQFGLSLENAHAALASLSRWPFIALRGFHIYLGTRILNAQAIADNTRHILQLA
FT                   RALRDRYRLSLDFVDVGGGFGVPYFPKEQPLDLPQLGDALTRIADDFAAQAPDTRIIIE
FT                   LGRYLVAEAGMFVTRVNTLKTAGDKQFAVCDGGANCHSAAAGLNSMLRKNFPLRRLGDN
FT                   RQRPTQRYQVSGPLCTPTDLLGDNVLLPELTVGDLIGITHSGAYGLTASPGHFLSFGYP
FT                   AEIMVDGDRVLLIRQPETSRQLLERQRPQPLMSAATVAVKDDA"
FT   gene            complement(132642..132950)
FT                   /locus_tag="Dd703_0114"
FT   CDS_pept        complement(132642..132950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83933"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6L4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83933.1"
FT                   /translation="MAHPALVNHEAENIHNLLREKMAVIGIDHHRINDIFQGSPLFGDD
FT                   GLFDSINLVSLIAVLSDHFETQGLSGELFNLMDDGVFDTFRDLSSLTRYLQEQTRHA"
FT   gene            complement(133173..133820)
FT                   /locus_tag="Dd703_0115"
FT   CDS_pept        complement(133173..133820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0115"
FT                   /product="3-dehydro-L-gulonate-6-phosphate decarboxylase"
FT                   /EC_number="4.1.1.85"
FT                   /note="PFAM: Orotidine 5'-phosphate decarboxylase; KEGG:
FT                   ppr:PBPRB0276 3-keto-L-gulonate-6-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83934"
FT                   /db_xref="GOA:C6C6L5"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6L5"
FT                   /inference="protein motif:PRIAM:4.1.1.85"
FT                   /protein_id="ACS83934.1"
FT                   /translation="MMTKPLLQIALDSTDLASAVTIANSVESFVDVIEVGTILAFAEGM
FT                   SAVRTLRKRHPNHILVCDMKTTDGGAILARMAFEAGANWITVSAAAHVATIAACKKVAD
FT                   EFSGEIQIELYGRWTLDDAKTWVDMGIRQAIYHRSRDAELAGVNWTPDDLNRMRALSEL
FT                   GIDVSITGGIVPEDIHLFAGINAKTLIAGRALATATGKATAEALRREIDTYW"
FT   gene            complement(134212..134904)
FT                   /locus_tag="Dd703_0116"
FT   CDS_pept        complement(134212..134904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0116"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: ppr:PBPRB0275 L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83935"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6L6"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ACS83935.1"
FT                   /translation="MFTALKQRVLEANLLLPHYGLVTFTWGNVSEIDRQQGVIAIKPSG
FT                   VSYDAMTVDDIVVVDLDGHTVEGVLNPSSDTATHLVLYHAFPALGGIVHTHSRSGTVWA
FT                   QAGMDIPALGTTHADYFYGDIPCTRPLTRTEIDTDYEKHTGDVIVETFRQRDLDPMAVP
FT                   SAVITGHAPFSWGKDAFDAVHNAVVLEEVAAMALSTRTLNREIRIQQALSDKHYFRKHG
FT                   ANAYYGQQ"
FT   gene            complement(134962..135438)
FT                   /locus_tag="Dd703_0117"
FT   CDS_pept        complement(134962..135438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0117"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: ppr:PBPRB0274
FT                   phosphotransferase system mannitol/fructose-specific IIA
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83936"
FT                   /db_xref="GOA:C6C6L7"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6L7"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACS83936.1"
FT                   /translation="MKFKQSLIDNHSILLQAHATDWRDAIRLGTDMLIASGAVEPRYHD
FT                   AIISSIEQMGPYIVIAPQFAMPHARPENGVNRTAFALVTLDAPVTFDGEDEPVDVLVTL
FT                   AGSSSDEHMEGLMEVTKVLEDDDSDTGVDLDKLRACRSREDVYRVIEAALGLIA"
FT   gene            complement(135508..137271)
FT                   /locus_tag="Dd703_0118"
FT   CDS_pept        complement(135508..137271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0118"
FT                   /product="putative sugar-specific permease SgaT/UlaA"
FT                   /note="PFAM: putative sugar-specific permease SgaT/UlaA;
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit; KEGG: ppr:PBPRB0273 ascorbate-specific PTS system
FT                   enzyme IIC/IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83937"
FT                   /db_xref="GOA:C6C6L8"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR017180"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6L8"
FT                   /inference="protein motif:PFAM:PF04215"
FT                   /protein_id="ACS83937.1"
FT                   /translation="METLYSIFYIFYSQVMTKAPLLLGLVTCIGYLLLRRDTTTVIKGT
FT                   TKTIVGFMLVQVGSGTLVAGFKPVIDKISEYHHLTGSVIDPYTTMMATMETMGDKYAWV
FT                   GYAVLLALGINILLVAFRRYTGIRTIMLTGHIMFQQAGLVAVFYLVLGASMWETIIYSA
FT                   VIMALYWGISSNIMFKATEAVTGGAGFSIGHQQQVASWIATKVAPKLGNKEDSVDHLQL
FT                   PKWLHIFHDSITATAIVMTVFFGIILLSFGLDNLQKMAGQTHWTIYILETGLKFAVAIQ
FT                   VIVAGVRMFVAELSEAFKGISERVIPNAVLAIDCAAIYAYSPNAMVFGFMWGTIGQFIA
FT                   VVGLLVFNAPIMIIPGFIPMFFSNATIGVFANHFGGWKAVMKICFVMGIIEVLGSAWAI
FT                   HLFALHGAKFNAWMGMADWALLFPPIMQGLSTSSLFFFVLLAGVGVYMYFASRLLRAEE
FT                   DAAAHAAPTVADIPETATHNDDAATQPGRAIRILAVCGNGQGSSMMMKMKIGKYLEQKG
FT                   VPHIMDSCAVADYKSKLATTDIIVSSRHLAGEMQPGEGKFVLGVQNMLNPNSFGDELLG
FT                   LIQKKLTAGDF"
FT   gene            137757..138824
FT                   /locus_tag="Dd703_0119"
FT   CDS_pept        137757..138824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0119"
FT                   /product="putative L-ascorbate 6-phosphate lactonase"
FT                   /note="KEGG: ppr:PBPRB0271 putative L-ascorbate 6-phosphate
FT                   lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83938"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6L9"
FT                   /inference="similar to AA sequence:KEGG:PBPRB0271"
FT                   /protein_id="ACS83938.1"
FT                   /translation="MSKIDEITRESWILSTFPEWGTWLNEEIEQEQVAPGTFAMWWLGC
FT                   TGIWLKSAGDTNISIDFWCGTGKKTHANPFMKQQHQMMRMGGVRKLQPNLRTSPFVLDP
FT                   FGIKKIDAVLATHDHADHIDVNVAAAVLQNCSKHVKFIGPQACVDLWTRWGVPAERCIV
FT                   ARVGDEIPVGDITIKVLDAFDRTALVTLPEGVSSRDKNILDGMDDRAVNYLVKTTGGNL
FT                   YHSGDSHYSNYFARHGNEYRVDVALLSYGENPRGVTDKMTASDILRAGESLNAQVVIPF
FT                   HHDIWANFQSDPREIEVLWQMKKGRLNYGFRPFFWQVGGKYTFPTDQTKMHYQHPRGFD
FT                   DIFIDEPELPYKSFL"
FT   gene            138901..139725
FT                   /locus_tag="Dd703_0120"
FT   CDS_pept        138901..139725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0120"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: ppr:PBPRB0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83939"
FT                   /db_xref="GOA:C6C6M0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6M0"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACS83939.1"
FT                   /translation="MNYRVLALDLDGTTLTSDHRILPPVREAIASIRDRATVLLVTGRH
FT                   HTAARPYHHELGLSTPIICCNGTYVYDYRTESVLAADAIGHDVARDFLALAAGHGLNLV
FT                   MYVTDRMVYSASRPIDYMQVLERWAQQFPATIRPSIARVASFDDELASQSHVWKFVVEG
FT                   DIDGVEAFARLPWVQEHFNGEKSWRNRIDFARRGNTKGSRLAAFLAQHAIDPAEVVAIG
FT                   DNHNDISMLQLAGLGVAMANADDAVKQAADVVTEETNDGLGIREVLHRYFGA"
FT   gene            139765..140637
FT                   /locus_tag="Dd703_0121"
FT   CDS_pept        139765..140637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0121"
FT                   /product="hexulose-6-phosphate isomerase"
FT                   /EC_number="5.1.3.22"
FT                   /note="KEGG: ppr:PBPRB0269 putative L-xylulose 5-phosphate
FT                   3-epimerase; TIGRFAM: hexulose-6-phosphate isomerase; PFAM:
FT                   Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83940"
FT                   /db_xref="GOA:C6C6M1"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6M1"
FT                   /inference="protein motif:TFAM:TIGR00542"
FT                   /protein_id="ACS83940.1"
FT                   /translation="MHNFDKPFRLGLYEKAMPAALSWEEKIQVARELGFDFIEISVDES
FT                   DERLRRLDWPDEDIYRLRHLCEHYGMPLQSMCLSAHRRFPFGSEDEAVRREAYLIMEKA
FT                   INLAYKLGIRCIQLAGYDVYYEPQSEATHLRFIEGMKAATKMAERAGVMLGVEIMDTPY
FT                   LNSLSKFEVLKKAIPSPYFMAYPDVGNITGWNYDTCTELKLSSEHIVQIHLKDTLKVSA
FT                   QSKGQFRDLVIGEGQVDFPAIFRTLAEMQYNGPMVVEMWAQDEQWASNLRLAKSRLVTM
FT                   GRQAGLALA"
FT   gene            140737..141492
FT                   /locus_tag="Dd703_0122"
FT   CDS_pept        140737..141492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0122"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; SMART: regulatory protein DeoR; KEGG:
FT                   ppr:PBPRB0268 transcriptional repressor UlaR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83941"
FT                   /db_xref="GOA:C6C6M2"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6M2"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACS83941.1"
FT                   /translation="MTEAQRHNAIIELLQQKRQMTVAGLMQAFDISPATARRDINKLNE
FT                   SGKLRKVRNGAEALAQKKAFWSPLNIHQASNHDEKVRIVQAAAALVLPGESAVINCGST
FT                   AFLLGQEMCGRDVQVITNYFPLANYLIEAEHDGVVIIGGQYNKSQSITLAPQDEISSLY
FT                   AGHWMFTSGKGLTADGLYKMDMLTAMAEQKMLDHVGKLVVLTDSSKVGQRAGMLFCPAE
FT                   RIDVVITGQDADPVVVQQLRDKGVDVRLV"
FT   gene            141641..142321
FT                   /locus_tag="Dd703_0123"
FT   CDS_pept        141641..142321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0123"
FT                   /product="amino acid adenylation"
FT                   /note="KEGG: swd:Swoo_4575 amino acid adenylation"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83942"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6M3"
FT                   /inference="similar to AA sequence:KEGG:Swoo_4575"
FT                   /protein_id="ACS83942.1"
FT                   /translation="MKLFFSVSNKLAKFLRLDAPRLSGPDGQQPGVQPTVTHSTQISWQ
FT                   LDLIVLDDEWLVVAVEAYSRYTLVIPYVLRPDWHEVEADFKEQWLQHLLSWMHMAGVVD
FT                   EEWQARQVATGVAALEETVCYRNRDMSIGGHLSDIQLWLRTYLEERRPKRFKQRQVWEF
FT                   CDYINQLSRRVGGQRRQQGMFLPAERFLTDGLYRFASGLNLASSADGGPANFPNPHRLR
FT                   GVKQ"
FT   gene            complement(142438..144480)
FT                   /locus_tag="Dd703_0124"
FT   CDS_pept        complement(142438..144480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_1382 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83943"
FT                   /db_xref="GOA:C6C6M4"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6M4"
FT                   /inference="similar to AA sequence:KEGG:Pfl01_1382"
FT                   /protein_id="ACS83943.1"
FT                   /translation="MKNEKYSIEYLIPIVMGLIFFGFVFNYHIVNPNYIAWLNHGDASQ
FT                   HYIGWAFFRKTPWSFPILGRSDYGMELASAIVYTDSNPLLAIIFKIFSPLLNEKFQYFG
FT                   IWLLACVILQSIVLWKIVRLYTEKKYLLILSVAILMFNPAWINRIEHINLMCFFLFSYG
FT                   IFLTLKQEANNRYQPYHWCFLLIISLTIHFYIFLMVFINWALLLVFSFKNDIKKRLTYT
FT                   TINIASIIFIAWIVGYFTVLHGSSSVGFGYFRSNLLAPIVSEKWSYLINVNHFFDGEIY
FT                   EGFNFFGSGIIALIAILSIKLIRQNIAVLNFIKRHKTLFSLCVIMWLISLSNVIGIGST
FT                   EFTIPLPDILLKIGGILRSSGRFFWPVTIIISLFFIVQAFRLEKAAAFGLLSFCLVLQI
FT                   ADTSKGWLAIHHQLAKTPIENDAVLNEYAPLWSAELGEYKNIRWVPFSNYSPQWSMISF
FT                   MAEQYNQNTDAIYFSRFDEKKAAVLNQKTISELSSGTYATDTAYLMKDNMIDLINLRPG
FT                   DKYYKYKNIYILAPAGKACSICESVEKNKISVLSFSEHNPSIMLLSTGWSTPEGWGVWT
FT                   LGRESSIKLPLADRIDLLFSAYINDKHPELSIEWRCGNKLLLTQKMEQRQGNKATMSLA
FT                   ECKKDANNMITLDIQLLNPASPKDTAGGADDRILGIGLEKVYLYQ"
FT   gene            complement(144554..145513)
FT                   /locus_tag="Dd703_0125"
FT   CDS_pept        complement(144554..145513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0125"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   sea:SeAg_B4458 bactoprenol glucosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83944"
FT                   /db_xref="GOA:C6C6M5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6M5"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACS83944.1"
FT                   /translation="MKISLVVPVYNEEDTIEIFYHAVREADFLEKIDVEIIFINDGSID
FT                   KTERIVNRIAQNDRLVTAINFTRNFGKEPAIFAGLEYATGDAVIPIDVDLQDPLEVIPL
FT                   LIEKWRDGADVVLAKRADRQTDSFFKRKSAEVFYKIHNKISHPKIEENVGDFRLMSRDT
FT                   IEHIKILPEKNLFMKGILSWIGGNVDIVEYTRHERSAGKSKFNAWKLWNLALEGITSFS
FT                   TVPLRLWTYIGLGIATMSIAYAIWMVIDKLIWGNPVPGYPSIMTAILFLGGVQLIGIGT
FT                   LGEYIGRIYIESKQRPRYIVKTINGISYTIPKTEKEQE"
FT   gene            complement(145783..146142)
FT                   /locus_tag="Dd703_0126"
FT   CDS_pept        complement(145783..146142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0126"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: sfv:SFV_0258
FT                   bactoprenol-linked glucose translocase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83945"
FT                   /db_xref="GOA:C6C6M6"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR016480"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6M6"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ACS83945.1"
FT                   /translation="MIKLFTKYCSVGMINTAIHWIVFALSVYVFSQTQALSNVIAFCVA
FT                   VTFSFFINARFTFNASATALKYIGYISFMGMLSLGTGKLADSCRLPPLVTLITFSALSL
FT                   ICGFLFSHLLLFKNR"
FT   gene            146864..147574
FT                   /locus_tag="Dd703_0127"
FT   CDS_pept        146864..147574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0127"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: Autoinducer-binding domain protein; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; KEGG:
FT                   eca:ECA1561 quorum-sensing transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83946"
FT                   /db_xref="GOA:C6C6M7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6M7"
FT                   /inference="protein motif:PFAM:PF03472"
FT                   /protein_id="ACS83946.1"
FT                   /translation="MVVSLPEVDFIRAAIQNHLARNLQCYSGLKYAYLIMNKRFPTDMV
FT                   IISNYPSEWVNTYKKRNYNSIDPVILTAVNKVSPFSWNDNMVRNSRLKLPQLFEHARQY
FT                   DICNGYTFVLHDQNNHMATLSLAADNIENMIHGNQEKLQMLLIATHEKTLSLYRELAES
FT                   RQHRSNDMLFSERENDILYWASMGKTYQEIALILGIKTSTVKFHIGNVVRKLGVTNAKH
FT                   AIRMGIEMNLIRRV"
FT   gene            147615..148295
FT                   /locus_tag="Dd703_0128"
FT   CDS_pept        147615..148295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_1780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83947"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6M8"
FT                   /inference="similar to AA sequence:KEGG:Shewmr7_1780"
FT                   /protein_id="ACS83947.1"
FT                   /translation="MGLKEAWGNVVKHKVVITSAALFQMVVAGLETYCIQHPHKQDIGV
FT                   ECFGRIWGQYQAGKKRSKFQVTSMTIDTSAKMHQNWALPRDDTEALKRAIGEVFRDELI
FT                   YLGDFHTHPYTAQEVRSAKQIRKQTLYQFSDDDKERSLSCEPIEDTTLTLSIVLTLFRQ
FT                   QRENTARDDRIDDNTFEFSLGNIKCWLHAQVYNVDTGQAEETELRSDFLESFANIATPF
FT                   YLTP"
FT   gene            complement(148332..149381)
FT                   /locus_tag="Dd703_0129"
FT   CDS_pept        complement(148332..149381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0129"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   mxa:MXAN_2524 putative homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83948"
FT                   /db_xref="GOA:C6C6M9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6M9"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACS83948.1"
FT                   /translation="MPVLHPDDDTAALADILRHRYGVAPIMQIERLPIGQGTLNYRVLG
FT                   AQRQYFMKRYTGQEDLQAETAGIALSETARHAGIPTARVIPNIDGQWIDHSTATALSLW
FT                   RWSEGAVITHGLQAGHYQEIGAMLGRIHRVFASLPTAGLPRHKPEQWRSTDLGKVQSEV
FT                   AQLLAILNEKIRNGTADAFDQRGLEALHARQQQLTTFTPLLAGLPALGVQPLHGDYTLV
FT                   NMLFTGDKISAVLDFRPPALFFRSYELGRIAFSPHMVVNDPNWLNMAKRLITAYREEHP
FT                   EVPLDDLIFSARVALLQLLKSLYGIKQHYLKPGLIPSDLDNFWALRHRTVGIMLPRLEE
FT                   IEAVLRQSL"
FT   gene            complement(149550..149849)
FT                   /locus_tag="Dd703_0130"
FT   CDS_pept        complement(149550..149849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83949"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6N0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83949.1"
FT                   /translation="MCHAISRCLTKSRQDKKAIVNHGLFCFMMEEEKHRLTHIKWIFWG
FT                   SVIQQLRRDGMYLTLDISPIFRIIEGSLFNLLRDKTAHFHIEVVTDFIFRHQLG"
FT   gene            complement(149849..150712)
FT                   /locus_tag="Dd703_0131"
FT   CDS_pept        complement(149849..150712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0131"
FT                   /product="YicC domain protein"
FT                   /note="PFAM: YicC domain protein; domain of unknown
FT                   function DUF1732; KEGG: yps:YPTB0040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83950"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6N1"
FT                   /inference="protein motif:PFAM:PF03755"
FT                   /protein_id="ACS83950.1"
FT                   /translation="MIRSMTAYARREIKGDWGNASWELRSVNQRYLETYIRMPEQFRSL
FT                   EPVIRERIRQRLTRGKIECNLRFDLDPRAQGQLLLNESLAKQLVDAANWVKMQSDEGEI
FT                   NPLDILRWPGVMSAQEQDLDTISAELMQALEATLDDFITARESEGNALKQLIEQRLVGV
FT                   SAEVTKVRAHMPSILQWQRERLLGKLEEAQVQLENNRLEQELVLLAQRIDVAEELDRLE
FT                   AHVKETYNILTKKEAVGRRLDFMMQEFNRESNTLASKSINADVTASAIELKVLIEQMRE
FT                   QIQNIE"
FT   gene            complement(150937..151407)
FT                   /locus_tag="Dd703_0132"
FT   CDS_pept        complement(150937..151407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpe:KPK_4062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83951"
FT                   /db_xref="GOA:C6C6N2"
FT                   /db_xref="InterPro:IPR024572"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6N2"
FT                   /inference="similar to AA sequence:KEGG:KPK_4062"
FT                   /protein_id="ACS83951.1"
FT                   /translation="MKKAALALFICTVVISNAFVPASYAEGPGDNRAPQQQPWNPGNPG
FT                   NPGNQGQGRQDHTGHDQGRPEARNDHGPGRQDHRAGPPQREHFAFGGHDFRRGHPVPRD
FT                   FRWDQYRMDDWRGRGLYAPPSGYRWAYIDGNYVLIAVATGIITSIILNSALH"
FT   sig_peptide     complement(151330..151407)
FT                   /locus_tag="Dd703_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.934 at
FT                   residue 26"
FT   gene            complement(151594..152502)
FT                   /locus_tag="Dd703_0133"
FT   CDS_pept        complement(151594..152502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0133"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: eca:ECA0131 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83952"
FT                   /db_xref="GOA:C6C6N3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6N3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS83952.1"
FT                   /translation="MRLRHIEVFQAIVQAGTISGAARLLNVSQPNVSRVLNHAEQQLGF
FT                   ALFERRVQGMVPTVEGRRLMPEIERLYSHLQDIAHLTEQIRRGKRQTVRLGAAHAFGQM
FT                   IVAPAMVAFQQQAAMVNVELVTEHFGTLCQNVQQQQLDLALVFGQQVPTDLLAEPLCQS
FT                   RMVAILPKNSPQQGPVSLEWLCHNNLLMMQQQDPLGQVVHRALRDRHLKPAASLYIKTY
FT                   SVIADMVLAGGGTGIVDLFTAHRYADQLKIVPISQPLPFEVMLISRSDMPQSREVLQLK
FT                   QELKIKCRELATRCLPMLQAA"
FT   gene            complement(152670..153737)
FT                   /locus_tag="Dd703_0134"
FT   CDS_pept        complement(152670..153737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0134"
FT                   /product="Membrane dipeptidase"
FT                   /EC_number="3.4.13.19"
FT                   /note="PFAM: peptidase M19 renal dipeptidase; KEGG:
FT                   atc:AGR_C_4575 membrane dipeptidase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83953"
FT                   /db_xref="GOA:C6C6N4"
FT                   /db_xref="InterPro:IPR000180"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6N4"
FT                   /inference="protein motif:PRIAM:3.4.13.19"
FT                   /protein_id="ACS83953.1"
FT                   /translation="MSDKPVFHDRIPVFDGHNDVLSRLWRQHRDTPTEAFLCGPSQGQI
FT                   DLPRLRQGGFAGGLFATYVPSAKKEDANSVPGGNSVFTTPTLDEARETSFWMISTLLRI
FT                   EAESAGQVKVCRSVAEIRRCMAQGVLATVMHIEGAEMLDPDLTLLDILYAAGLRSLGPL
FT                   WSRPNIFGQGVPFRFPSSPDTGDGLTEAGLRLIRACNARRILVDLSHMDEKGFWQTAEI
FT                   SDAPLVASHSNAHALCAQSRNLTDRQLAAIRESNGFVGVNFGTAFLRADGRKDPSATVL
FT                   EIVRHIEYLLEKVGEDNVGFGSDLDGTTVPPDLKDAAGFPILVQTMLDLGYSRTILEKI
FT                   CYSNWLRVLEATWGE"
FT   gene            153948..155543
FT                   /locus_tag="Dd703_0135"
FT   CDS_pept        153948..155543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0135"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: oan:Oant_3741 extracellular solute-binding protein
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83954"
FT                   /db_xref="GOA:C6C6N5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6N5"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACS83954.1"
FT                   /translation="MVTRRRFLAGCATVPFLSWLNLNTAFADTPPSMLVMAMQLDNMTS
FT                   LDPQECFETVGTEVIGNLYQRLVMPNPSNPQEVIGDLASSWAVSNEGQTFTFHLNPQAK
FT                   FADGAPVTAEDAAFSLQRAVKLDKSPAFIINQFGFTKDNVEQRITAPDAHTLVLNLEKP
FT                   AAETFLLYCLSAPVGSVVQKKIALANQQNNDLGNQWIKQNSAGSGPFTLVSWKPSESII
FT                   LQKNDNFPGDNVFKRVLLKHIVDPSAQLLMLQKGDVDIARDLTTEQIRPLLNDSNYHLV
FT                   RQSIASLMLLSCNTGNEFLKKPQVWQAIKWALDYDSIQKNILPLTHKVHQSFLPDGFPA
FT                   ALGDNPFHLDVAKAKALLKDAGYPDGFEITMDHYSAQPFPDIAQAIQTQLGAIGIKVKL
FT                   IAAENRQVLTKMRARQQQLALTAWGADYFDPNSNAEAFCINTDNSDSARNRTLAWRCNW
FT                   SDDAFNQMTEQALHEKDAAKRIELYQTLQRKHRELSPFTVMMQYERTLACRKNLSGVTL
FT                   TVLSKVPYQQVKKA"
FT   sig_peptide     153948..154031
FT                   /locus_tag="Dd703_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.992 at
FT                   residue 28"
FT   gene            155543..156553
FT                   /locus_tag="Dd703_0136"
FT   CDS_pept        155543..156553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0136"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oan:Oant_3740
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83955"
FT                   /db_xref="GOA:C6C6N6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6N6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS83955.1"
FT                   /translation="MRMLTRFFSTLGSLALTLLGLSILTFFIGRIMPTDPVLAAVGDNA
FT                   PQAVVERVRQEMGLDQPLWIQYGHYLNQLLHGDLGRSVLTSNPVVSDIARYFPATLELA
FT                   TAAIIVAALLGIPLGVWAAVRQGRWVDQTIRVICLAGHSLPVFVLALMSLLIFYAVLDI
FT                   APGPGRQDIIFQDMVPHVTGLLTVDSLLARDYDALRDALAHMVQPVLILAYFSMAYITR
FT                   MTRTFMLNALNGEFVITARAKGLSSRRVIWRHAFPTVAVQLVTVLALTYAGLLEGAVVT
FT                   ENVFSWPGLGQYLTNALLNADMNPVVGATLLVGAVYVLLNLLADILYRLLDPRVT"
FT   sig_peptide     155543..155662
FT                   /locus_tag="Dd703_0136"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.829 at
FT                   residue 40"
FT   gene            156550..157452
FT                   /locus_tag="Dd703_0137"
FT   CDS_pept        156550..157452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0137"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oan:Oant_3739
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83956"
FT                   /db_xref="GOA:C6C6N7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6N7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS83956.1"
FT                   /translation="MSFLVSRAWLLDETPATRRQAVWGQRYRLWLGLRTNPLAMIGLII
FT                   ITLVLLLSLAAPLLTPYYPGFQDLSNRLAAPSSAHWLGTDELGRDVYTRILFGGRTTLG
FT                   MVIAVVALTAPLGLLIGCIAGYAGSWLDKTLMRLTDIFLAFPRLVLALAFVAALKPGVE
FT                   SAILAIALTAWPPYARLARAETLQFRNSDFIAACRLTGASPFRIILRHIMPLCVPSLIV
FT                   RVTLDMSSIIITAASLGFLGMGAQPPSPEWGTMIATARRFLFNAWWVPLVPCIAIFLTS
FT                   LAFNFLGDGLRDVLDPKER"
FT   gene            157453..158283
FT                   /locus_tag="Dd703_0138"
FT   CDS_pept        157453..158283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0138"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: atc:AGR_C_4569 dipeptide transporter DppD homolog"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83957"
FT                   /db_xref="GOA:C6C6N8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6N8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS83957.1"
FT                   /translation="MLVEIENLRISFVNRTETFEAVRGISLSVGKEKFAIVGESGSGKS
FT                   LTARSLMQLLPGNARIEADKLSFDGIDLRGASEKTLRQIRGKRVGFILQDPKYSLNPVM
FT                   TIGQQIAEAWREHKGGSRRAAMDAAVALLEQVRIRDPQRVAGRYPHEVSGGMGQRVMIA
FT                   MMLAPDPELLIADEPTSALDATVQAEILSLIDDLVSQRGMGLILISHDLPLVSHFCDRV
FT                   AVMYAGRIVEMLKASELMQAQHPYTQGLLACLPSLRHPRERLQVLQRDPAWRNA"
FT   gene            158280..159020
FT                   /locus_tag="Dd703_0139"
FT   CDS_pept        158280..159020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0139"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: oan:Oant_3737 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83958"
FT                   /db_xref="GOA:C6C6N9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6N9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS83958.1"
FT                   /translation="MIHVENLRIAFGGLEVVKGVSFDVESGGSFGMVGESGSGKSTILR
FT                   AMAGLNRYWQGGITFGGMSLAGRQDRHFYRQVQMVFQDPYGSLHPRQTIDRILHEPLLV
FT                   HRFDRAEQRIARALEEVGLPAAVRFRFPHQLSGGQRQRVAIARALIAEPEVLLLDEPTS
FT                   ALDVSVQAEILNLLADLRHERKLTYIMVSHNLAVVSHLCQRVGVMQHGEMVEQVSTDDL
FT                   RARRVSHAHTAELYDLSMTLEEPA"
FT   gene            159017..160528
FT                   /locus_tag="Dd703_0140"
FT   CDS_pept        159017..160528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0140"
FT                   /product="beta-lactamase"
FT                   /note="PFAM: beta-lactamase; KEGG: spe:Spro_2075
FT                   beta-lactamase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83959"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6P0"
FT                   /inference="protein motif:PFAM:PF00144"
FT                   /protein_id="ACS83959.1"
FT                   /translation="MTLHWQRAIDIARDITQRWNQPGQPGGAITLFDGEQIRAACCGGL
FT                   ADLAQQTPFTAQSVVRFASVTKHLFASLATGPASNHLALSDRLDRHLPQLTGDNGKVTV
FT                   GQALDMTSGLPDVRENLSLLGLSVYNATSAASLLAYLAQWGDLNYPAGSEISYTNTGYR
FT                   LVEEALKAKGVYFADLLDRHINQPLGIALHAPETWFDIVPGLVPGYWQSPQGWMLSCAG
FT                   LHLSTSGCVAGSVQDLTRWLQSVLTNQGPGEGVLARLTQPRYLSDGRQTGYGLGMAHSQ
FT                   LGSVPLVGHGGSHAGYKSYFLLDPERKIGLALVANREDVATYDCALKVMSALLDQPLPP
FT                   KGHRLTPGLYVAEHGGDWLEVTAPGACWLGASETLYLDDEPGVAVSLSSHLPMRLRQNG
FT                   VAIEGEIGHAPKRFLPVEADDSVSRLQGRWRVPACRSELVIDGANIVMGIGPAAIAGTL
FT                   QPLGNGRSLATVQDGLWEKRFSLLPDGDELILLLNRSRVVRYQRG"
FT   gene            complement(160651..161610)
FT                   /locus_tag="Dd703_0141"
FT   CDS_pept        complement(160651..161610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0141"
FT                   /product="peptidase T2 asparaginase 2"
FT                   /note="PFAM: peptidase T2 asparaginase 2; KEGG: eca:ECA0132
FT                   L-asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83960"
FT                   /db_xref="GOA:C6C6P1"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6P1"
FT                   /inference="protein motif:PFAM:PF01112"
FT                   /protein_id="ACS83960.1"
FT                   /translation="MKPVIVIHGGAGALSRSAMSSDKEQRYRAALLSIVTRGQDILAAH
FT                   GSALDAVTEAVRLLEECPLFNAGRGSVFTHQGTHELDACVMDGHSLQAGAVTGVSHIRN
FT                   PVLAARTVLERSPHVMFTAAGAEAFARDHGLEMVEPTFFSTDERYQQLLRAQAGAGQIL
FT                   LDHDGERQAQGADPIDPDRKFGTVGAVALDAAGNLAAATSTGGMTNKQVGRVGDSPIVG
FT                   AGCYANNQTVAVSCTGTGEVFMRTVAAYDVSALMEYASLPLPDAADKVVMAKINALGGS
FT                   GGLIAVDHYGNIALPFNSEGMYRGYGYVGGTPVVGIYR"
FT   gene            complement(161638..162459)
FT                   /locus_tag="Dd703_0142"
FT   CDS_pept        complement(161638..162459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0142"
FT                   /product="peptidase M55 D-aminopeptidase"
FT                   /note="PFAM: peptidase M55 D-aminopeptidase; KEGG:
FT                   eca:ECA0133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83961"
FT                   /db_xref="GOA:C6C6P2"
FT                   /db_xref="InterPro:IPR007035"
FT                   /db_xref="InterPro:IPR027476"
FT                   /db_xref="InterPro:IPR036177"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6P2"
FT                   /inference="protein motif:PFAM:PF04951"
FT                   /protein_id="ACS83961.1"
FT                   /translation="MKVFISADIEGIAGVMRPEQCSPGAPEHQIARGLMEQEVNAAIEG
FT                   AFAGGASEVVVADSHAAMTNLRAENIDPRARLVQGKPRGLSMVEGLQQQQFDGLMFIGY
FT                   HSAAGEHGVLAHTINGRAFYRVKINGEVMGESDIYAAAGAELNTPLWLVSGDDTLQSWI
FT                   NRYYPATDFACVKRAISQTAAESLSPEAARNVIRAAATQAVQKAHTETTTRLQPPYELE
FT                   LMVAKPVLADLFCLIPGVRRKDAITVGYQSPTIAPIVSLLGAFSYLATTQN"
FT   gene            complement(162470..163528)
FT                   /locus_tag="Dd703_0143"
FT   CDS_pept        complement(162470..163528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0143"
FT                   /product="peptidase S58 DmpA"
FT                   /note="PFAM: peptidase S58 DmpA; KEGG: eca:ECA0134 putative
FT                   peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83962"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6P3"
FT                   /inference="protein motif:PFAM:PF03576"
FT                   /protein_id="ACS83962.1"
FT                   /translation="MTLYQQARLQPLLQRWREERRLGTPRLPAGEHNRLSDVPGVRVGH
FT                   STLADGDIQTGVTAIVPPGANLFVQPLPCGAAVLNGFAKPVGLVQIDELGRLQTPILLS
FT                   NTLSVGTLFTALVRDAIGKNPELGRSLPTINPLALECNDGWLNDIQALAVTEPMALAAL
FT                   DDARVDFARGSVGAGRGMSCFGLKGGIGTASRLIPELNATLGVLVLANFGTLSALTLDG
FT                   VQAGEAIAPLLPELAPQRDAGSIIIIMATDAPLDARQLTRIARRAGAGLGRLGSYWGHG
FT                   SGDIAVAFSTCPTPQPPEDAALEPMLNAAADATEHAVLDALLQAEAVTGFRGHHRPSLT
FT                   QVLDRLSQVRPE"
FT   gene            complement(163654..164550)
FT                   /locus_tag="Dd703_0144"
FT   CDS_pept        complement(163654..164550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0144"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA0135 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83963"
FT                   /db_xref="GOA:C6C6P4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6P4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS83963.1"
FT                   /translation="MNPAQDPVAAPTAFDDTIRSPWRDFLHAFVRNPMALFAGGFVLLL
FT                   VMVAVFAPWLAPWNPMEPDWMALSAPPSAEHWMGTDDLGRDVMSRIIYGARISLYVGFF
FT                   SVTLGMLAGIVLGLLAGYYGRWIDMLIMRGCDVLFAFPGMLLAIAVVAILGPGLNNVII
FT                   AVAVFSVPVFARIVRASTLSLKQAAYVEAVRCAGAPDRIILMRHILPGTLSNVIVYFTM
FT                   RIGTSILTAAGLSFIGLGPEPDVPEWGNILAMSRSMMMAGQWHVSVFPGLAIFCTVLAF
FT                   NLLGDALRDTLDPKLKR"
FT   gene            complement(164559..165479)
FT                   /locus_tag="Dd703_0145"
FT   CDS_pept        complement(164559..165479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0145"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA0136 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83964"
FT                   /db_xref="GOA:C6C6P5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6P5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS83964.1"
FT                   /translation="MFAYIVRRLLEMIPVLLVISLLVFGFIKLLPGDPARIYAGSDATI
FT                   EAVEAAREHLGLNNPLPQQYLDWLSGMMHGDFGITYRTQQPVLKVIQKSFMPTLWLALA
FT                   GFIWSVVLGLLIGVFAALKRGKWQDWTLMSAAVGGISMPTFWLGLLLIQFVAMPFGIFS
FT                   VSGFNKPLDIVLPALTLGASVAAVMARFTRSAFLEVMQEDYVRTARAKGLRQRLIVWKH
FT                   VMRNALIPVITMLGLQFGFLLGGSIVVESVFNWPGLGWLLIESIKTQDQPVIQALVMLF
FT                   VIEFILINLLVDLLYAVVNPAIRLR"
FT   gene            complement(165497..167038)
FT                   /locus_tag="Dd703_0146"
FT   CDS_pept        complement(165497..167038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0146"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: eca:ECA0137 ABC transporter periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83965"
FT                   /db_xref="GOA:C6C6P6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6P6"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACS83965.1"
FT                   /translation="MKPLLRRSALALGLSLCLAAAAQAQDLRISMYADITGFDPHDTSD
FT                   TLSYSIQSGVFERLFQFDNQMKLVPRLATSYTGNADATEYTITLREGVTFQDGTPFNAD
FT                   AVKANLDRLADQTKGLKRNSLFNMIKSVTVLSPTQVKIELNKSFGAFINTLAHPSAVMH
FT                   SPAALKQYPDETQLRVHPVGTGPFKFVEWQQGKDVKLVKNDSYWQKGWPKVDSVTFYPS
FT                   PEDATRVAALKANQSDAIYPLPSDLVKTVEDDAKLAIQRDPSIYLFYMAINTQHGPLSD
FT                   VRVRQALNYAINRNLWLKVGFAGMGLPASSAMAPRVQFFASQSEPNYTYSPAKAKELLK
FT                   EAGYEKGLELKLWTTNRTDYVRSAQFFKQQLEQVGIKVTVTPMDSGTRNEKLFGVKDPT
FT                   QAEFDLYYGGWSPSTGDADWALRPLFATESWVPKAYNVSYYSNADVDKAIVAGLATADN
FT                   TKRAAAYAEAQKLIWKDAPVVFLGVPDNLVGKVKNLSGVYMLADGSLIFDQAEFK"
FT   sig_peptide     complement(166964..167038)
FT                   /locus_tag="Dd703_0146"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.969 at
FT                   residue 25"
FT   gene            complement(167099..168973)
FT                   /locus_tag="Dd703_0147"
FT   CDS_pept        complement(167099..168973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0147"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: eca:ECA0138 ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83966"
FT                   /db_xref="GOA:C6C6P7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6P7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS83966.1"
FT                   /translation="MTDTTIIESTATASGQAPRPVLEINDLSVSFSGRSGTSEALKGVS
FT                   FSLNKGEVVAVVGESGSGKSVTSLTVMGLLADSATINRGSIRFTTRSGQAHSLLEMKDD
FT                   ARRALRGREMSMIFQEPMTSLNPVLKVSDQLTEALIDHQMCDAASASAQARELLRKVRI
FT                   ADVDRVMNSYPHALSGGMRQRVMIAQALACNPQLLIADEPTTALDVTVQARILQILRDL
FT                   QRQSDMAVLFITHDMGVVAEIADRVVVMYRGEVVEQGRVDDIFNRPQHDYTKALLAAVP
FT                   KLGDMRDSAWPRRFPLLGQQSEETAQDHMTAQYDALPLLDVRGLKVYYPVRSGLLSAVT
FT                   HRVHAVEQIDFAVWPGETLAIVGESGCGKSTTGRALLRLVESESESLLFEGHEIAVMRD
FT                   RDFLPLRRKMQMVFQDPYASLNPRLTVGFTIAEPLLLHGLVKSLEEATPQVQTLLKSVG
FT                   LPPEYARRYPHEFSGGQRQRIAIARAMALKPQVIIADEAVSALDVSIQAQVVNLMMDLQ
FT                   QKTGVSWIFISHDMAVVERIANRVAVMYLGQIVEIGPRQSVFNNPQHPYTRRLLASVPI
FT                   ADPNRRYARQLDDSEIPSPLRKANEQVAKAQYRQVGPHHWVSDAEIGR"
FT   gene            complement(168994..169959)
FT                   /locus_tag="Dd703_0148"
FT   CDS_pept        complement(168994..169959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0148"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: eca:ECA0139 putative mandelate racemase /
FT                   muconate lactonizing enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83967"
FT                   /db_xref="GOA:C6C6P8"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6P8"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACS83967.1"
FT                   /translation="MRQMQIETLELPLARPFAISRGTRTAVTVVRVTLEERGFIGRGEC
FT                   TPTAHYQETAQSVAAQLESVRHAVENGMTLDELQRLLPPGSARNALDCALWRLNAALSK
FT                   QTLWQYLAITPPQSIITAETLSLDSVEKMTHAAKDAVSRGALLLKIKLNGEQILEKVAA
FT                   IRQAAPNVTLIVDANEAWGGQDLEPLLRQLAAYRIAMVEQPLPAGQDAALADFTHAIPV
FT                   CADESCHHCGDIAALRDRYEMINIKLDKCGGLTEARAMVALAREQGMRIMVGCMLGSSL
FT                   AMEAALPVALSAEHVDLDGPIWLAADSSPYLTYNLGRIWL"
FT   gene            complement(169964..170971)
FT                   /locus_tag="Dd703_0149"
FT   CDS_pept        complement(169964..170971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0149"
FT                   /product="protein of unknown function DUF1611"
FT                   /note="PFAM: protein of unknown function DUF1611; KEGG:
FT                   ppr:PBPRA1897 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83968"
FT                   /db_xref="InterPro:IPR011669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035086"
FT                   /db_xref="InterPro:IPR035402"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6P9"
FT                   /inference="protein motif:PFAM:PF07755"
FT                   /protein_id="ACS83968.1"
FT                   /translation="MLIPQPYLLFLGDVTDPLAVKTARGIHTWRPEQCVGQLRLPGSAV
FT                   SLGLDDLDIADAAARGAKTLVLGTANAGGFLPAHWLDTVRAAIEAGMNVANGLHQRLTD
FT                   VPGLQELADKHQVQLFDIRHMRPELTVGSGKTRSGKRVLTVGTDCSVGKMYTSLALEAA
FT                   MRKRGMKADFRATGQTGVLVAGDGIAIDAVIADFIAGAAEALSPANDDDHWDIVEGQGS
FT                   LFHPSYAGVTTGLIHGAQPHWLVMCHEMGRPHMRHLPHQPMVELDECVEACLRAARVTN
FT                   TAVQLAGFAINTSNHSEQEARDYCRELSERFGVPATDPIRFGIDDIAQLLNTRG"
FT   gene            complement(171189..171506)
FT                   /locus_tag="Dd703_0150"
FT   CDS_pept        complement(171189..171506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0150"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA3001 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83969"
FT                   /db_xref="GOA:C6C6Q0"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6Q0"
FT                   /inference="similar to AA sequence:KEGG:ECA3001"
FT                   /protein_id="ACS83969.1"
FT                   /translation="MTPPPSPPRDPGLQPERTRLAWSRTAFIMLINSVLLLRAGSTPSH
FT                   PPLMAIGVFLLLATLMMYLWSRLRLRHACASSPLSARMMLLFTMAVVGANFALLITLLQ
FT                   A"
FT   gene            complement(171517..171891)
FT                   /locus_tag="Dd703_0151"
FT   CDS_pept        complement(171517..171891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0151"
FT                   /product="protein of unknown function DUF202"
FT                   /note="PFAM: protein of unknown function DUF202; KEGG:
FT                   eca:ECA3000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83970"
FT                   /db_xref="GOA:C6C6Q1"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6Q1"
FT                   /inference="protein motif:PFAM:PF02656"
FT                   /protein_id="ACS83970.1"
FT                   /translation="MNTTPPADKKRPWYQQGTPPDYRFSLANERTFLAWLRTALAFLAG
FT                   AIAIDQFAPTLAPPAIRASIAVFLTLTSALLAWMAYRRWVANELAMRTGQALPYTRLLL
FT                   VVACCVGAISIALTLMILWL"
FT   gene            172330..173042
FT                   /pseudo
FT                   /locus_tag="Dd703_0152"
FT   gene            173760..174476
FT                   /locus_tag="Dd703_0153"
FT   CDS_pept        173760..174476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0153"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="KEGG: eca:ECA0140 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83971"
FT                   /db_xref="GOA:C6C6Q2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6Q2"
FT                   /inference="protein motif:TFAM:TIGR01966"
FT                   /protein_id="ACS83971.1"
FT                   /translation="MRPTGRSAQQTRPITLTRHYTKHAEGAVLVEFGDTKVLCTATVEE
FT                   GVPRFLKGQGQGWITAEYGMLPRATHSRNAREAARGKQGGRTLEIQRLIARSLRAAVDL
FT                   AKLGEYTITLDCDVLQADGGTRTASITGACVALADAIAGLVASGKLAKNPMKGMVAAVS
FT                   VGIVNGEAVCDLEYVEDSAAETDMNVVMTEDGRMIEVQGTAEGEPFSHEQLLELLALAR
FT                   GGIEDIIRAQKAALAN"
FT   gene            174662..175303
FT                   /locus_tag="Dd703_0154"
FT   CDS_pept        174662..175303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0154"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="KEGG: esa:ESA_04090 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83972"
FT                   /db_xref="GOA:C6C6Q3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6Q3"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ACS83972.1"
FT                   /translation="MKAYQRQFIEFALSKQVLKFGEFTLKSGRTSPYFFNAGLFNTGRD
FT                   LALLGRFYAAALVDAGIEFDVLFGPAYKGIPIATTTAVALAEHHDQDVPYCFNRKEAKD
FT                   HGEGGNLVGSPLTGRIMLVDDVITAGTAIRESMEIIAAQGATLAGVLIALDRQERGRGE
FT                   LSAIQEVERDYHCRVTSIITLNELIGYLAEKPEMASHLAAVQAYRRQYGV"
FT   gene            complement(175345..175941)
FT                   /locus_tag="Dd703_0155"
FT   CDS_pept        complement(175345..175941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0155"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: eca:ECA0142
FT                   nucleoid occlusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83973"
FT                   /db_xref="GOA:C6C6Q4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6Q4"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS83973.1"
FT                   /translation="MAEKENTKKNRREEILQALAQMLESSDGSQRITTAKLAASVGVSE
FT                   AALYRHFPSKTRMFDSLIEFIEDSLTTRINLILQDEKDTFNRLRLILLLILGFAEKNPG
FT                   LTRILTGHALMFEQDRLQGRINQLFERIESQLRQVLREHKLRSGQAFQHDETLLASQLL
FT                   AFCEGMLSRFTRSEFRYLPTQDFDTRWPLLAAQIQ"
FT   gene            complement(176049..176507)
FT                   /locus_tag="Dd703_0156"
FT   CDS_pept        complement(176049..176507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0156"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /note="TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase;
FT                   KEGG: ent:Ent638_0099 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83974"
FT                   /db_xref="GOA:C6C6Q5"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6Q5"
FT                   /inference="protein motif:TFAM:TIGR00576"
FT                   /protein_id="ACS83974.1"
FT                   /translation="MMKKIDVKILDPRIGEQFPLPTYATPGSAGLDLRACLDSAIALAP
FT                   GATTLIPTGLAIHIADPELAAVILPRSGLGHKHGVVLGNLVGLIDSDYQGQLMVSVWNR
FT                   GNQSFTVQPGERIAQMVFVPVVQAEFNLVNDFVSSERGDGGFGHSGRH"
FT   gene            complement(176491..177726)
FT                   /locus_tag="Dd703_0157"
FT   CDS_pept        complement(176491..177726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0157"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number="6.3.2.5"
FT                   /note="KEGG: eca:ECA0144 bifunctional
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate synthase; TIGRFAM:
FT                   phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   DNA/pantothenate metabolism flavoprotein domain protein;
FT                   flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83975"
FT                   /db_xref="GOA:C6C6Q6"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6Q6"
FT                   /inference="protein motif:TFAM:TIGR00521"
FT                   /protein_id="ACS83975.1"
FT                   /translation="MTALSNLHGLSGKHILLGISGGIAAYKCPELVRRLREQGADVRVV
FT                   MTPAAKAFITPLTLQAVSGHPVADDLLDPAAEAAMGHIELGKWADLVILAPASADLIAR
FT                   IAAGMANDLLSTLCLATPGAIAIAPAMNQQMYRAAPTQQNLDTLASRGIAIWGPDSGSQ
FT                   ACGDIGPGRMIDPREIVSRAEQHFSRVNDLQHLNIMITAGPTREALDPVRFISNHSSGK
FT                   MGFAIAQAAAERGAHVTLVAGPVNLPTPDNVARIDVISAQDMHQAVMARAAQQHIVIGC
FT                   AAVADYRPQAVASEKIKKSQRHGDEMCVTLVKNPDIIAAVAAMVEHRPYVVGFAAETTN
FT                   VEEYARQKMARKKLDMICANDVSLTDSGFNSDNNALHLFWPEGDKRLPQGSKRQLGQQL
FT                   IDEIVSRYDEKN"
FT   gene            complement(177887..178372)
FT                   /locus_tag="Dd703_0158"
FT   CDS_pept        complement(177887..178372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0158"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: swi:Swit_3729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83976"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR019243"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6Q7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS83976.1"
FT                   /translation="MQSRFFSNACLLLIALSAPPLYARQPLDNAAKTALQTALHDEYHA
FT                   EAFYAAVIEKFGQVAPFSHIVKAEQNHAHALAQLMQKYGIPIPPNVLSGSVEIKNTVPA
FT                   TLKAACKMGVDAEIANQALYEKTLLPTVSAHQDITLVFQRLRDASQNNHLPAFKQCQ"
FT   sig_peptide     complement(178301..178372)
FT                   /locus_tag="Dd703_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            178581..179246
FT                   /locus_tag="Dd703_0159"
FT   CDS_pept        178581..179246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0159"
FT                   /product="DNA repair protein RadC"
FT                   /note="TIGRFAM: DNA repair protein RadC; PFAM: DNA repair
FT                   protein RadC; KEGG: eca:ECA0145 DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83977"
FT                   /db_xref="GOA:C6C6Q8"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR022820"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6Q8"
FT                   /inference="protein motif:TFAM:TIGR00608"
FT                   /protein_id="ACS83977.1"
FT                   /translation="MKWNDGCAPREKLMSFGVETLSDVELLAIFLRTGVEGIHVMELAQ
FT                   HLLQQFGSLYGLMTADWTAFNAVRGVGLSKYTQLQAVAELARRLFSCQLAQEDAMLSPE
FT                   VTLQYLQLLLAHQEREIFLVMFLDNQHHVIRYQEMFAGTINSVEVHPREVVREALKSNA
FT                   AALILAHNHPSGRAEPSQADRRITEHIVNACRLLEIRVLDHLVIGRGEYVSFAERGWI"
FT   gene            179485..179721
FT                   /locus_tag="Dd703_0160"
FT   CDS_pept        179485..179721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0160"
FT                   /product="ribosomal protein L28"
FT                   /note="TIGRFAM: ribosomal protein L28; PFAM: ribosomal
FT                   protein L28; KEGG: eta:ETA_00670 50S ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83978"
FT                   /db_xref="GOA:C6C6Q9"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6Q9"
FT                   /inference="protein motif:TFAM:TIGR00009"
FT                   /protein_id="ACS83978.1"
FT                   /translation="MSRVCQVTGKRPVTGNNRSHAMNATKRRFLPNLHSHRFWVEGEKR
FT                   FVTLRVSAKGMRVIDKKGIEAVLADLRARGEKY"
FT   gene            179733..179900
FT                   /locus_tag="Dd703_0161"
FT   CDS_pept        179733..179900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0161"
FT                   /product="ribosomal protein L33"
FT                   /note="TIGRFAM: ribosomal protein L33; PFAM: ribosomal
FT                   protein L33; KEGG: yen:YE0065 50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83979"
FT                   /db_xref="GOA:C6C6R0"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6R0"
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /protein_id="ACS83979.1"
FT                   /translation="MAKGVREKIKLVSSAGTGHYYTTTKNKRTMPEKLELKKFDPVVRQ
FT                   HVVYKEAKIK"
FT   gene            179976..180785
FT                   /locus_tag="Dd703_0162"
FT   CDS_pept        179976..180785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0162"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /EC_number="3.2.2.23"
FT                   /note="KEGG: eca:ECA0148 formamidopyrimidine-DNA
FT                   glycosylase; TIGRFAM: formamidopyrimidine-DNA glycosylase;
FT                   PFAM: Formamidopyrimidine-DNA glycosylase catalytic domain
FT                   protein; zinc finger Fpg domain protein; DNA glycosylase/AP
FT                   lyase, H2TH DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83980"
FT                   /db_xref="GOA:C6C6R1"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6R1"
FT                   /inference="protein motif:TFAM:TIGR00577"
FT                   /protein_id="ACS83980.1"
FT                   /translation="MPELPEVETSRRGIEPYLVGHTILYAEVRNARLRWPVSPEILSLS
FT                   DTPVLSVQRRAKYLLIELTSGWMIVHLGMSGSLRVLPEYIEPDKHDHVDLVLDSGKVLR
FT                   YTDPRRFGAWLWSPDPSTSPVLAHLGLEPLGAAFTGEYLFSQSRGRKTPVKLWIMDNKL
FT                   VVGVGNIYASESLFGAGILPDRPAGSLSEQEAHRLVATIRAVLQRSIEQGGTTLRDFLQ
FT                   SDGKPGYFAQALQVYGRTGEPCRQCGTPVESVKQGQRSTFFCRHCQH"
FT   gene            complement(181026..181505)
FT                   /locus_tag="Dd703_0163"
FT   CDS_pept        complement(181026..181505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0163"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="KEGG: eca:ECA0150 phosphopantetheine
FT                   adenylyltransferase; TIGRFAM: pantetheine-phosphate
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83981"
FT                   /db_xref="GOA:C6C6R2"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6R2"
FT                   /inference="protein motif:TFAM:TIGR01510"
FT                   /protein_id="ACS83981.1"
FT                   /translation="MKTRAIYPGTFDPLTNGHLDLLTRAARMFDHLILAIAASPSKNTL
FT                   FTLDERVALARQATGHLKNVEVIGFSDLMASFAKQQHATILVRGLRAISDFEYELQLAK
FT                   MNTHLMPTLESVFLMPSEKWSFISSTLVKEVARHGGDVSHFLPAPITAALSQKLL"
FT   gene            complement(181495..182286)
FT                   /locus_tag="Dd703_0164"
FT   CDS_pept        complement(181495..182286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0164"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   yps:YPTB0051 lipopolysaccharide core biosynthesis glycosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83982"
FT                   /db_xref="GOA:C6C6R3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6R3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACS83982.1"
FT                   /translation="MSRKRLSVVLISRDAAELLPDCLSSVAWADEIIVLDSGSRDDTVE
FT                   VARQFGAIVHQTTDWPGYGKQRQRAQQYASGDYIFMLDTDERVTPELRQSIEAVLVSSA
FT                   ADTVYRCARRNLFLGRFMRHSGWYPDHVIRLYSRQYHYNDNDVHESLAYGNARVVTLQG
FT                   DLKHLTCRDFFTFQQKQHAYAESWARARFRQGKRCGYLSILTHTLGAFVKTWLLRGGVL
FT                   DGKQGFLLALVNAQYTFNKYTGLWALNQQRDLSNQGQHHED"
FT   gene            complement(182286..183569)
FT                   /locus_tag="Dd703_0165"
FT   CDS_pept        complement(182286..183569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0165"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; glycosyl transferase group 1;
FT                   KEGG: kpn:KPN_03972 3-deoxy-D-manno-octulosonic-acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83983"
FT                   /db_xref="GOA:C6C6R4"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6R4"
FT                   /inference="protein motif:PFAM:PF04413"
FT                   /protein_id="ACS83983.1"
FT                   /translation="MIMLQTLYTLLFYMIQPLIWLRLWLRGRKIPAYRKRWGERYGFYK
FT                   NQVKPEGILLHSVSVGETLAAVPLVRALRHRYPSLPITVTTMTPTGSERALSAFGKDVY
FT                   HVYLPYDLPGAMSRFLNHIQPRLVIVMETELWPNMIQALHQRHIPLIIANARLSERSAN
FT                   GYRKLGGFMRALLRRITLIAVQNAEDGERFIDLGLKRSQLNVTGSLKFDISVTPELAAR
FT                   AVTLRRQWASQRPVWIAASTHEGEEKIIIDAHCELLRSFPTLLLILVPRHPDRFDDAKA
FT                   IVKKAGLEYTLRSSGAIPPASSHVVIGDTMGELMLLYGIADLAFVGGSLIERGGHNPLE
FT                   PAAHAIPVLMGPHIFNFKDICARLRESDGLITVTDTRSLVEQASNLLADEDYRRYYGRH
FT                   AVEVLHKNQGALQSLLTLLEPYLPPRSQ"
FT   gene            184132..185256
FT                   /locus_tag="Dd703_0166"
FT   CDS_pept        184132..185256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0166"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   plu:plu4862 WalR protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83984"
FT                   /db_xref="GOA:C6C6R5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6R5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACS83984.1"
FT                   /translation="MLDTSLNILHTESSCGWGGQEIRILTESQGMMKRGHKVTILCCPH
FT                   SNIYREAQARGIAVVGLPIEKKRFSALTALTGWLKQYGCAFDVINTHSSTDAWLVGVAG
FT                   LILGKRLPPMVRTRHVSTDINQSFTTRWLYLKATRHIATTGERLRQQLHRDNRYPLTHM
FT                   TSVPTGIDLDFYRQHSRQNARQTIGIPERPTLGILATMRSWKGHAYLLDAWQTLSKDFP
FT                   DWQLLMVGDGPQRSALEQQVASMGLSDNVLFLGNRDDVPDCLNSMDVFVLPSYGNEGVP
FT                   QSIMQAMACGLPVVSTTVGAIDEAVVSGETGYLIAPKDAVQLASTLRQLMGDDALRVRF
FT                   GQAALQRAATCFGADIMLDRMTTIFQNSLRTRNQ"
FT   gene            185257..186366
FT                   /locus_tag="Dd703_0167"
FT   CDS_pept        185257..186366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0167"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   bma:BMA1910 heptosyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83985"
FT                   /db_xref="GOA:C6C6R6"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6R6"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ACS83985.1"
FT                   /translation="MSKFAARLQIFPRAALRLLMKFRRRRPQRVSRILVAHNLLLGDTV
FT                   MLTPLLAKLRRNYPDADIVLLCKPPFAEVYRLNPYGVSLMPYHPASAASVKAIVRSGPY
FT                   DLAFVPGDNRYSWLALAAGSRWIVAHTPAKPDVKSWPVDEFVAYPQMPTAWSDAVADMT
FT                   HGDTPVPLAWALPDVDLGLPDSPYVVLHVGASNSVRFWPSERWLALADWLAGEGFTPVW
FT                   SGGGNERHIVDAIDPTRRYRSFAGELSLSQLLTLLAHARVLICADTGVAHLAKWVDTPT
FT                   MTLYGPGNPTAFGPGQFWQANPIINVGFIPIACRDQKTLFSRQLPWLERCNRNEKSCLQ
FT                   FCDGHSACMKGIVLAEVQTAFIHLLRNTR"
FT   gene            186363..187565
FT                   /locus_tag="Dd703_0168"
FT   CDS_pept        186363..187565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0168"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: hch:HCH_01051
FT                   O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83986"
FT                   /db_xref="GOA:C6C6R7"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6R7"
FT                   /inference="protein motif:PFAM:PF04932"
FT                   /protein_id="ACS83986.1"
FT                   /translation="MTQLSFSPRRPDNRVMYFLSALAIFVNPLFEAPKNIVMASMLLWF
FT                   FYKIGTDRRSRHWSGWDTFFILYVLSYVVALPFSYYHTDIRSLTDVARYILFGWLIYRA
FT                   NFSAQQKLGLVFWAVMGTVVGLIYGAWDHYYLDHGQFWTLNSVGHVNHAAIYNAIICGM
FT                   ALTTLFSHWTSFSAGRRLLWLAMLALCLVYVAFGESRATFGAILAVVLFLGLGFARKSK
FT                   KFLWVPTLFIVGMIGVAILSNARVVVKQEQNDLENNMLSYRDTIWRSAFDTFREHPLFG
FT                   VGKENFIEVGIKWQGEVMFPHVSHAHNIFMNVLAENGIWGELWLLGLLGAIGLSLLRCL
FT                   PKRNAMPVSWLSWGMACSAFGITVIVGLVNTTFHHEHANLAMLCFALWISQYRYDRQRF
FT                   I"
FT   gene            complement(187707..188825)
FT                   /locus_tag="Dd703_0169"
FT   CDS_pept        complement(187707..188825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0169"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   eta:ETA_00760 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83987"
FT                   /db_xref="GOA:C6C6R8"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6R8"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACS83987.1"
FT                   /translation="MKLAIVRQKYRPDGGAERFVSRALDALGQHRSLDISIITRSWEGS
FT                   TQSDRQVIICDPRITGRIQRESAFAVEAARHFADFDLVQSHERIPGCHIYRAGDGVHQE
FT                   WLTQRSRILNPLQRKLLWWSGFHRYVMAQEQAMYQHPALKAVICNSRMVADEIRRYFGV
FT                   PEEKIHLIYNGVNTDSFTPSLRQTHRRAVRQQLGIADDTPLMLFVGSGFERKGLAGAIH
FT                   AIAGARHQPHLLVVGKDKHVRRYQRLAQRLRVADRVHIAGMQSDTRPYYGAADMLLLPT
FT                   LYDPFPNVVLEAMASGLGVITSSQCGGKEFIQAGVNGFVCDSLDYDGLAQAVTAACDAG
FT                   FDALGTQARAKVETYNLAFLSDNMLKLYERLI"
FT   gene            complement(188822..189907)
FT                   /locus_tag="Dd703_0170"
FT   CDS_pept        complement(188822..189907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0170"
FT                   /product="lipopolysaccharide heptosyltransferase III"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase III;
FT                   PFAM: glycosyl transferase family 9; KEGG: dar:Daro_0152
FT                   lipopolysaccharide heptosyltransferase III, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83988"
FT                   /db_xref="GOA:C6C6R9"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011916"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6R9"
FT                   /inference="protein motif:TFAM:TIGR02201"
FT                   /protein_id="ACS83988.1"
FT                   /translation="MTSPRNVEFRRILITKFRHHGDVLLTSPLFSILRQRYPEARIDAL
FT                   VFAETAEMLSLHPAIDQLYTVDKKWKKLGPFRHIAKEWELLKTLRQQRYDLIIHLTESM
FT                   RGFWIARLARIPAGVTFRNAGRDKLSFWRNTFQFRVPRISRRHTVESHLDTLRVLGIQP
FT                   EMDERRLRLVSGETADRSVERKLRDQHWQGQPFIVVHPTSRWLFKCWKSSAMAETINHL
FT                   CRQGHTIVLSASPADSEMAMIAEIKSRLEYPVLDLAGQLSLKELAGLIGKAQLLLGVDS
FT                   VPMHIASAMQTPVVALFGPSGETEWSPWMTVNRVIVSERHHCRPCGKDGCGGSKVSDCL
FT                   QQISVQQVLLAIDSALLEAQA"
FT   gene            complement(189920..190888)
FT                   /locus_tag="Dd703_0171"
FT   CDS_pept        complement(189920..190888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0171"
FT                   /product="lipopolysaccharide heptosyltransferase I"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase I;
FT                   PFAM: glycosyl transferase family 9; KEGG: eca:ECA0163
FT                   ADP-heptose:LPS heptosyl transferase I"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83989"
FT                   /db_xref="GOA:C6C6S0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011908"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6S0"
FT                   /inference="protein motif:TFAM:TIGR02193"
FT                   /protein_id="ACS83989.1"
FT                   /translation="MRVLIVKTSSMGDVLHTLPALTDAMNIIPGLQFDWVVEEGFAQIP
FT                   GWHPAVDRVIPVAIRRWRKHWFSGPVRRERARFKTQLREKRYDAVIDAQGLLKSTLLVT
FT                   RLARGPRHGLDWKSVREPLASWFYQYRHPVARQLHAVERIRELFAVSLNYRKPAEQGDY
FT                   AIAARFLTTPPADAGRYLVFLHATTRDEKHWPEAHWRKLIALAAPSGLRIKLPWGAEHE
FT                   HQRALRLAAGFPHVDVLPKLTLEQVATVLAGARAVVSVDTGLSHLSAALDRPNITLYGP
FT                   TDPGLIGGYGKHQLVCRPANSRNLADLDAANVWQLCIPLIE"
FT   gene            complement(190885..191937)
FT                   /locus_tag="Dd703_0172"
FT   CDS_pept        complement(190885..191937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0172"
FT                   /product="lipopolysaccharide heptosyltransferase II"
FT                   /note="TIGRFAM: lipopolysaccharide heptosyltransferase II;
FT                   PFAM: glycosyl transferase family 9; KEGG: eca:ECA0164
FT                   ADP-heptose:LPS heptosyltransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83990"
FT                   /db_xref="GOA:C6C6S1"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6S1"
FT                   /inference="protein motif:TFAM:TIGR02195"
FT                   /protein_id="ACS83990.1"
FT                   /translation="MKILVIGPSWVGDMMMSHSLYRTLKAEHPDAIIDVMAPAWCRPLL
FT                   ARMPEVNQALAMPLGHGALALRERRQLGRGLREQDYDRAIVLPNSFKSALVPFFAAIPR
FT                   RTGWRGEMRYGLLNDIRPLDKTAFPLMVQRYVALAYARESIRRADDLPQPLLWPQLQVS
FT                   ETEIADVTSAFNLMDARPSIGFCPGAEFGPAKRWPHYHYGALAQRLIEQGYQVILFGSA
FT                   NDRQAGEDIRQTLDESTREYCINLSGQTSLDQAVVLLAACQAVVSNDSGLMHVAAALGR
FT                   PLVALYGPSSPDFTPPLSHQARVIRLITGYHRVRKGDAEQGYHQSLIDIQPSQVLAALA
FT                   DYLPGQGEPA"
FT   gene            complement(191970..192902)
FT                   /locus_tag="Dd703_0173"
FT   CDS_pept        complement(191970..192902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0173"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /note="TIGRFAM: ADP-L-glycero-D-manno-heptose-6-epimerase;
FT                   PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: eca:ECA0165
FT                   ADP-L-glycero-D-mannoheptose-6-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83991"
FT                   /db_xref="GOA:C6C6S2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6S2"
FT                   /inference="protein motif:TFAM:TIGR02197"
FT                   /protein_id="ACS83991.1"
FT                   /translation="MIIVTGGAGFIGSNIVKALNDAGHRDILVVDNLKDGTKFVNLVDL
FT                   DIADYMDKEDFIAGIMAGDDFGDIDAVFHEGACSSTTEWDGKYMMENNYQYSKELLHYC
FT                   LERSIPFLYASSAATYGGRVDNFVENRQYEQPLNVYGYSKFLFDQYVRDILPDADSQVC
FT                   GFRYFNVYGPREGHKGSMASVAFHLNNQINQGENPKLFSGSENFKRDFIYVGDVAAVNL
FT                   WFWQHGVSGIFNCGTGRAESFQAVADAVLAYHQQGSLEYIPFPEKLKGRYQAYTQADLT
FT                   NLRGAGYDKPFKTVAEGVADYMAWLNRSV"
FT   gene            193178..194374
FT                   /locus_tag="Dd703_0174"
FT   CDS_pept        193178..194374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0174"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="KEGG: spe:Spro_4824 2-amino-3-ketobutyrate coenzyme
FT                   A ligase; TIGRFAM: 2-amino-3-ketobutyrate coenzyme A
FT                   ligase; PFAM: aminotransferase class I and II;
FT                   aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83992"
FT                   /db_xref="GOA:C6C6S3"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6S3"
FT                   /inference="protein motif:TFAM:TIGR01822"
FT                   /protein_id="ACS83992.1"
FT                   /translation="MPSSFYQQLNSQLASVRADGLFKDERIMTSAQQAQISLSQGDELL
FT                   NFCANNYLGLANHPALIDAAKAGLDSHGFGMASVRFICGTQDNHKVLEHRLAAFLGMED
FT                   SILYSSCFDANGGLFETLMGPDDAIVSDALNHASIIDGIRLSKARRYRYANNDMQQLEA
FT                   RLKQARADGCRYILIATDGVFSMDGVIANLHGICDLAERYDALVMVDDSHAVGVVGENG
FT                   RGTHEYCQVMGRVDIITGTLGKALGGASGGYTAGRRDLVEWLRQRSRPYLFSNSLAPSI
FT                   VSASLRVLDLLEDGNELRQRLWRNAALFRERMTAAGFQLAGADHAIIPVMLGDARLAQA
FT                   FAAALQQEGIYVTGFFYPVVPHGQARIRTQMSAAHTPEQIAQAVAAFIRVGQRLGVIG"
FT   gene            194386..195411
FT                   /locus_tag="Dd703_0175"
FT   CDS_pept        194386..195411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0175"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /note="TIGRFAM: L-threonine 3-dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase GroES domain protein; Alcohol dehydrogenase
FT                   zinc-binding domain protein; KEGG: pmr:PMI3178 L-threonine
FT                   3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83993"
FT                   /db_xref="GOA:C6C6S4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6S4"
FT                   /inference="protein motif:TFAM:TIGR00692"
FT                   /protein_id="ACS83993.1"
FT                   /translation="MKALAKLRPEPGIWLTDVPQPEPGHNDVMIKIRKTAICGTDVHIY
FT                   NWDAWSQKTIPVPMAVGHEYVGEIVAIGQEVEGFHIGDRVSGEGHITCGYCRNCRAGRR
FT                   HLCRNTVGVGVSRPGAFAEYLVIPAYNAFRIPDAIPDDIAAIFDPFGNAVHTALSFDLV
FT                   GEDVLVSGAGPIGVMAAAICRHVGARHVVITDINDYRLALARRMGVTRAVNVARESLAE
FT                   VMRELGMTEGFDVGLEMSGAPSAFRTLLSVMNHGGRVAMLGIPSEAMAVDWSEIIFKGL
FT                   VIKGIYGREMFETWYKMVALIQSGLDLSPMITHRFAIDDFQQGFDVMRSGQSGKVVLSW
FT                   D"
FT   gene            complement(195863..196822)
FT                   /locus_tag="Dd703_0176"
FT   CDS_pept        complement(195863..196822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0176"
FT                   /product="protein of unknown function DUF610 YibQ"
FT                   /note="PFAM: protein of unknown function DUF610 YibQ; KEGG:
FT                   eca:ECA0169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83994"
FT                   /db_xref="GOA:C6C6S5"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6S5"
FT                   /inference="protein motif:PFAM:PF04748"
FT                   /protein_id="ACS83994.1"
FT                   /translation="MRSLILRVISLFVSCVLALPVWAGKLSLVIDDFGYRPHNENQVLA
FT                   MPVAISVAVLPNAPYARDMATKAHAQGREVLIHLPMAPMSKQPLERDTLRPDMSSEEIA
FT                   RILRDAVGKVPYAVGLNNHMGSAMTASLPGMQKVMQAMTTYRLYFLDSMTIGSSQASRA
FT                   AAGTGIRVLKRKVFLDDTQNTADIRRQFNRAVELARRDGVAIAIGHPHPTTIQVLQQML
FT                   PTLPPDIELVRPSQLLNEPESAPRHYEPVPVYTASARIPVGKHTIRPIRQCVSKVPLPP
FT                   ITQQDMLQRLAADVMQSAAIVYLEQRWKTWRGEWVFRQ"
FT   sig_peptide     complement(196751..196822)
FT                   /locus_tag="Dd703_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            complement(196826..198100)
FT                   /locus_tag="Dd703_0177"
FT   CDS_pept        complement(196826..198100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0177"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: eca:ECA0170 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83995"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6S6"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACS83995.1"
FT                   /translation="MNENAPSVPLLTGRHKLLIRCASALCVGVLLLPCRSWGEDNQQQL
FT                   KSLQQDIAAKEKSVKEQQRQRGALLEQLKKQEQSISQASRQLHETRNTLERLNQEINRL
FT                   SASISALQARQKTQEHLLAQQLDAAFRQGQHSGLQLILSGEENQRRERILAYFNYLNQA
FT                   REKSINDLQQTRSELSAQKQQIEQKQAQQKRLMSDQQQQQKTLEQAQGERQNTLSSLEN
FT                   SLEKDQQQLTELRQNETRLRDQIAKAEREAKARAEKEAREAARIREKEEQAKRSGTRYK
FT                   PNENERSLMARTGGLGPPSGQYIWPVRGHTLHRFGEQQQGELRWKGLVISAASGAEVKA
FT                   IADGTVLMADWLQGYGQVVVIEHGKGDMSLYGYNQSALVNVGTQVKAGQPIALAGNSGG
FT                   QSQPALYFEIRRQGQAVNPLPWLGR"
FT   sig_peptide     complement(197984..198100)
FT                   /locus_tag="Dd703_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.898 at
FT                   residue 39"
FT   gene            198357..198788
FT                   /locus_tag="Dd703_0178"
FT   CDS_pept        198357..198788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0178"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: eca:ECA0171 putative
FT                   rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83996"
FT                   /db_xref="GOA:C6C6S7"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6S7"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACS83996.1"
FT                   /translation="MQEIMPFISKHPILSVAWIALLVAVIVLTVKSKFSKVKEVARGEA
FT                   IQLINKEDAVVVDLRNRDDFRRGHIANAINVQPNDIKNGSLGELEKHKAQAIILVCANG
FT                   MASREAGENLYRAGFERVLTLKDGLAGWSGDNLPLVRGK"
FT   gene            199013..199489
FT                   /locus_tag="Dd703_0179"
FT   CDS_pept        199013..199489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0179"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: yen:YE0080 preprotein
FT                   translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83997"
FT                   /db_xref="GOA:C6C6S8"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6S8"
FT                   /inference="protein motif:TFAM:TIGR00809"
FT                   /protein_id="ACS83997.1"
FT                   /translation="MSEQNNVEVNFQIQRIYTKDISFEAPNAPQVFQQEWNPEVKLDLD
FT                   TASTQLADDVYEVVLRVTVTATLGEETAFLCEVQQAGIFTVGGMEGQQLAHCLGAYCPN
FT                   VLFPYVRECITSLVSRGTFPQLNLAPVNFDALFMNYLEQQAANEGAEQNQTLDA"
FT   gene            199489..200505
FT                   /locus_tag="Dd703_0180"
FT   CDS_pept        199489..200505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0180"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; Ketopantoate reductase
FT                   ApbA/PanE domain protein; KEGG: eca:ECA0173
FT                   NAD(P)H-dependent glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83998"
FT                   /db_xref="GOA:C6C6S9"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6S9"
FT                   /inference="protein motif:PRIAM:1.1.1.94"
FT                   /protein_id="ACS83998.1"
FT                   /translation="MNMSQAAMTVIGAGSYGTALAITLARNGHQVVLWGHDPAHVQALQ
FT                   AARCNQAFLPDVPFPETLRLEADLAQAVTASRNILVVVPSHVFGDVLRQIKPHLRPDAR
FT                   LVWATKGLEADTGRLLQDVAREMLGDDIPLAVLSGPTFARELAAGLPTAIALAATDRAF
FT                   SDDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGMSDGMGFGANARTALITRG
FT                   LAEMTRLGVALGADPATFMGMAGLGDLVLTCTDNQSRNRRFGMMLGQGMDVTTAQAQIG
FT                   QVVEGYRNTREVMALAQRYGVEMPITEQLWQVLYCGKDAGEAALTLLGRASKDEVLR"
FT   sig_peptide     199489..199554
FT                   /locus_tag="Dd703_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.811) with cleavage site probability 0.764 at
FT                   residue 22"
FT   gene            200760..201581
FT                   /locus_tag="Dd703_0181"
FT   CDS_pept        200760..201581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0181"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /note="KEGG: eca:ECA0174 serine acetyltransferase; TIGRFAM:
FT                   serine O-acetyltransferase; PFAM: serine acetyltransferase
FT                   domain protein; transferase hexapeptide repeat containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACS83999"
FT                   /db_xref="GOA:C6C6T0"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:C6C6T0"
FT                   /inference="protein motif:TFAM:TIGR01172"
FT                   /protein_id="ACS83999.1"
FT                   /translation="MSNEELELVWRNIKDEARSLAECEPMLASFFHATLLKHENLGNSL
FT                   SYMLANKLANAIMPAIAIREVVEEAYRADPDMIVSAARDIQAVCLRDPAVDKYSTPLLY
FT                   LKGFHALQAYRIGHWLWLQDRKALAIYFQNQISVTFGVDIHPAARIGCGIMLDHATGIV
FT                   IGETAVVENDVSILQSVTLGGTGKTNGDRHPKIREGVMIGAGAKILGNIEVGCGAKIGA
FT                   GSVVLQPVPPHTTAAGVPARIVGRPESEMPSLDMDQYFNGSLRGFEDGDGI"
FT   gene            202086..202586
FT                   /locus_tag="Dd703_0182"
FT   CDS_pept        202086..202586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0182"
FT                   /product="Antimicrobial peptide resistance and lipid A
FT                   acylation PagP"
FT                   /note="PFAM: Antimicrobial peptide resistance and lipid A
FT                   acylation PagP; KEGG: eca:ECA0175 palmitoyl transferase for
FT                   lipid A"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84000"
FT                   /db_xref="GOA:C6C6T1"
FT                   /db_xref="InterPro:IPR009746"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6C6T1"
FT                   /inference="protein motif:PFAM:PF07017"
FT                   /protein_id="ACS84000.1"
FT                   /translation="MENDGQDGFWQRAKNNLSETWHNGQSQDLYVPAMTWHNRWTYSRQ
FT                   KIDKYNERPWGAGYGVSRLDSDGDWHGIYLMAFKDSFNKWEPIGGYGYEKRWKPVAGND
FT                   DFQLGLGFTAGVTMRDNWNYIPIPVLLPLASINYQRLSFQMTYIPGTHNNGNVYFAWLR
FT                   WQL"
FT   gene            202688..203587
FT                   /locus_tag="Dd703_0183"
FT   CDS_pept        202688..203587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0183"
FT                   /product="carboxylate/amino acid/amine transporter"
FT                   /note="TIGRFAM: carboxylate/amino acid/amine transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   eca:ECA0179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84001"
FT                   /db_xref="GOA:C6C783"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:C6C783"
FT                   /inference="protein motif:TFAM:TIGR00950"
FT                   /protein_id="ACS84001.1"
FT                   /translation="MPLLVITTIVWAFSFSLIGEYLAGQVDSWFSAMFRLVLAAAVFLP
FT                   FLRWRGYSPRILGLYLLIGVFQLGIMYLFLFRSYLYLNVPTILLFSVMTPLYVTLIYDL
FT                   FSGRRLRWGYLFSALLAVLGAAVIHYHGVSDHFWWGLLLVQAANICFAIGQVGYKRLME
FT                   LHPMPQHSAFSWFYLGAALVTLVAWGLFGNAARLPTTGVQWGVLAFLGVVVSGLGYFMW
FT                   NYGATQVDAGTLSIMNNFHVPAGLLVNFAFWQKTPNWTSFIIGSAIIAAALWIHHRWVL
FT                   KRPAQTADARRHAGAPNE"
FT   gene            complement(203490..204428)
FT                   /locus_tag="Dd703_0184"
FT   CDS_pept        complement(203490..204428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0184"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: eca:ECA0180 transcriptional activator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84002"
FT                   /db_xref="GOA:C6C784"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:C6C784"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS84002.1"
FT                   /translation="MIELKHLRTLQALRNTGSLAAAAAQLHQTQSALSHQFSDLEQRLG
FT                   FRLFVRKSQPLRFTPQGEILLQLAEQVLPQIQQALQACHQPHQTTLRLAIECHSCIQWL
FT                   TPALENFHQHWPQVVMDFKSGVTFDPQPALQQGELDLVMTSDILPRSGLHYSPLFDFEV
FT                   RLVLAPDHPLAARPRIDPEDLAQETLMIYPVQRQRLDIWRHFLQPAGVSPSLKSVDNTL
FT                   LLIQMVSARMGIAALPHWVVESFERQGLVVTKTLGEGLWSRLYAAVRDGEQRQPVIEAF
FT                   IRSARQHACEHLPFVRDASRPSGGVSTAPQQ"
FT   gene            204533..206800
FT                   /locus_tag="Dd703_0185"
FT   CDS_pept        204533..206800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0185"
FT                   /product="5-methyltetrahydropteroyltriglutamate/homocysteine
FT                   S-methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="KEGG: eca:ECA0181
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase; TIGRFAM:
FT                   5-methyltetrahydropteroyltriglutamate/homocysteine
FT                   S-methyltransferase; PFAM: Methionine synthase vitamin-B12
FT                   independent; Cobalamin-independent synthase MetE domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84003"
FT                   /db_xref="GOA:C6C785"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:C6C785"
FT                   /inference="protein motif:TFAM:TIGR01371"
FT                   /protein_id="ACS84003.1"
FT                   /translation="MAILNHTLGFPRVGLRRELKKAQESYWAGNATQEELLAVGRELRA
FT                   RHWQQQQAAGVDLLPVGDFAWYDHVLTTSLLLGNVPARHQNADGSVNLDTLFRIGRGRA
FT                   PSGEPAAAAEMTKWFNTNYHYMVPEFTQGQQFSLTWTQLLDEVDEALALGHKVKPVLLG
FT                   PVTYLWLGKVKGEAFNRLELLNAILPVYQQVLAELAKRGIEWVQIDEPLLALELDAEWK
FT                   AAFKPAYDALQGQVKLLLTTYFDSIGQNLDVITTLPVQGLHVDLVHGKDDATALNAQLP
FT                   ADWVLSLGVINGRNVWRADLASWFERLQPLLGKRTLWLASSCSLLHSPIDLSVETRLDE
FT                   EVKSWFAFAIQKCQELALLTRALNDGNGDELVAYSAPIRARRTSARVNNPAVAKRLAAI
FT                   TAQDSLRQNPYLVRADAQRARFNLPAWPTTTIGSFPQTTEIRSLRLDFKQGRLDSQNYR
FT                   VGIAEHIKQAIVEQERLGLDVLVHGEAERNDMVEYFGEHLDGFVFTQNGWVQSYGSRCV
FT                   KPPVVIGDISRPEPITVEWAKYAQSLTDKPVKGMLTGPVTILCWSFPREDVSRETIAKQ
FT                   IALALRDEVADLEQAGIGIIQIDEPALREGLPLHRSDWAAYLAWAVDAFRLNAAVAKDD
FT                   TQIHTHMCYCEFNDIMDSIAALDADVITIETSRSDMELLESFEEFEYPNEIGPGVYDIH
FT                   SPNVPSVAWIEALLRKAAQRIPAERLWVNPDCGLKTRGWPETRQSLANMVQAAKQLRET
FT                   TR"
FT   gene            complement(206961..207788)
FT                   /locus_tag="Dd703_0186"
FT   CDS_pept        complement(206961..207788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0186"
FT                   /product="Carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="PFAM: dienelactone hydrolase; KEGG: spe:Spro_0243
FT                   carboxymethylenebutenolidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84004"
FT                   /db_xref="GOA:C6C786"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6C786"
FT                   /inference="protein motif:PRIAM:3.1.1.45"
FT                   /protein_id="ACS84004.1"
FT                   /translation="MKTDELLRLRETDRGFSPAVIPLASSTITTDTSGLIVGETTIPSQ
FT                   GDELPAYIAMPREEAGALPIVLVVQEIFGVHEHIRDICRRLAKLGYLAIAPELYFRQGD
FT                   PQQYHDIPTLMAELVSTVPDTQVLSDLDHATHWAIRQGGDASRLAITGFCWGGRISWLY
FT                   AAHNPQLKAAVAWYGRLTGAKTLTSPTHPVDIATSLIAPVLGLYGGQDAGIPLEQVDIM
FT                   RQALRAANADAEIVVYPQAEHAFYADYRPSYHEASAKDGWQRMLDWFAQHGVA"
FT   gene            208079..208837
FT                   /locus_tag="Dd703_0187"
FT   CDS_pept        208079..208837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0187"
FT                   /product="uridine phosphorylase"
FT                   /note="TIGRFAM: uridine phosphorylase; PFAM: purine or
FT                   other phosphorylase family 1; KEGG: eca:ECA0185 uridine
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84005"
FT                   /db_xref="GOA:C6C787"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C6C787"
FT                   /inference="protein motif:TFAM:TIGR01718"
FT                   /protein_id="ACS84005.1"
FT                   /translation="MSDVFHLGLTKNDLQGATLAIVPGDPARVEKIARLMDNPVFLASH
FT                   REFTSWRAELAGKAVIVCSTGIGGPSTSIAVEELAQLGVRTFLRVGTTGAIQPHIAVGD
FT                   VLVTTAAVRLDGASLHFAPLEYPAVADFACTSALVDAAKEAGTTLHVGVTASSDTFYPG
FT                   QERYDTYSGRVVRRFQGSMAEWQSMGVLNYEMESATLLTMCASQGLYAGMVAGVIVNRT
FT                   QQEIPDAATMKQAESISVSVVLAAARKLLA"
FT   gene            208982..209764
FT                   /locus_tag="Dd703_0188"
FT   CDS_pept        208982..209764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0188"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /note="KEGG: eca:ECA0186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84006"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C6C788"
FT                   /inference="similar to AA sequence:KEGG:ECA0186"
FT                   /protein_id="ACS84006.1"
FT                   /translation="MTASSFHHPSLLPLDGGVNFRDLGGILVSDGRRVRSGKLFRSGAL
FT                   DLLSDTDCDHLARVPVAHIVDYRDENEAALRPDRLWDGARYHQVPANPLRHEITANLES
FT                   LGSEKLEAFDSRAFMLELYRRLPFGNPAYQHLVALLRQPDDGALVQHCAVGKDRTGIGS
FT                   ALVLFALGADEQTVMEDYLLTERTLTPFRRQLLEDLAASLSEKALRRFDFVLSAREEFL
FT                   SMALHTMRERYGSVDGWLTQEFGLDAGARDALKAKYLE"
FT   gene            210228..210710
FT                   /locus_tag="Dd703_0189"
FT   CDS_pept        210228..210710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpa:RPA2267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84007"
FT                   /db_xref="UniProtKB/TrEMBL:C6C789"
FT                   /inference="similar to AA sequence:KEGG:RPA2267"
FT                   /protein_id="ACS84007.1"
FT                   /translation="MNVDTDNRYASLSAFSSLSPADAGDSAFSSTLRTALASAGLDSTG
FT                   QDVDVKQIDFSNMTRDELKDWINDKLQSGEMTFDESTTFVSMTVNGLSAAGNGINNNNA
FT                   EGTFNYRQMIQDGLDNALSHGDQASVASLQSVLSIMQRYQGEQTDPYSQSGVDITA"
FT   sig_peptide     210228..210299
FT                   /locus_tag="Dd703_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.746) with cleavage site probability 0.734 at
FT                   residue 24"
FT   gene            complement(210782..213424)
FT                   /locus_tag="Dd703_0190"
FT   CDS_pept        complement(210782..213424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0190"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /EC_number="4.1.1.31"
FT                   /note="PFAM: phosphoenolpyruvate carboxylase; KEGG:
FT                   eca:ECA0187 phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84008"
FT                   /db_xref="GOA:C6C790"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:C6C790"
FT                   /inference="protein motif:PRIAM:4.1.1.31"
FT                   /protein_id="ACS84008.1"
FT                   /translation="MNEKYSAMRSNVSMLGKLLGDTIKDALGENILDRVETIRKLSKAS
FT                   RAGSEKHRQELLTTLQNLSNDELLPVARAFSQFLNLTNTAEQYHSISPHGEAAGNPGML
FT                   ADAFRSLKSRDNLSDSAIREAVESLSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDH
FT                   NDLADYERHQIMRRLRQLIAQYWHTDEIRRDRPTPVDEARWGFAVVENSLWDGVPAFLR
FT                   ELDEQLENAFGFRLPVESVPVRFTSWMGGDRDGNPNVTSEITRHVLLLSRWKAADLFLR
FT                   DIQVLVSELSMTQCTPAFRQWLGCGEEEQEPYRVVMKHLRAQLRETLTYLTAQVKGEAA
FT                   APPKDLITHNQQLWEPLYACYQSLHACGMGIIADGQLLDTLRRVRCFGVPLVRIDVRQE
FT                   STRHTEAIAEITRYLGLGDYENWSESDKQAFLIRELNSKRPLLPRQWEPSAETREVLET
FT                   CQVIAETPRDAIASYVISMARTPSDVLAVHLLLKEAGCPYALPVAPLFETLDDLNNADS
FT                   VMTQLLNIDWYRGFIQGRQMVMIGYSDSAKDAGVMAASWAQYRAQDALIKTCDKFGIAL
FT                   TLFHGRGGSIGRGGAPAHAALLSQPPGSLKGGLRVTEQGEMIRFKFGLPEVTISSLSLY
FT                   TSAILEANLLPPPEPKQEWHHIMDELSRISCDMYRGYVRENPGFVPYFRAATPELELGK
FT                   LPLGSRPAKRRPNGGVESLRAIPWIFAWTQNRLMLPAWLGAGAALQKVIDDGHQDQLET
FT                   MCRDWPFFSTRIGMLEMVFAKADLWLAEYYDQRLVDETLWPLGQQLREQLEKDIKAVLT
FT                   ISNDDHLMADLPWIAESIALRNVYTDPLNVLQAELLHRSRQQDTLDPQVEQALMVTIAG
FT                   VAAGMRNTG"
FT   gene            complement(213741..215115)
FT                   /pseudo
FT                   /locus_tag="Dd703_0191"
FT   gene            215424..216623
FT                   /locus_tag="Dd703_0192"
FT   CDS_pept        215424..216623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0192"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: eca:ECA0189 putative mandelate racemase /
FT                   muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84009"
FT                   /db_xref="GOA:C6C791"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034589"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C6C791"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACS84009.1"
FT                   /translation="MTPTIITHIKCLITKPDRHNLVTVIVDTNKGITGYGCATFQQRPL
FT                   AVKTLIDEYLCPLLVGKDANHIEDLWHLMMVNAYWRNGPVINNAIAGIDMALWDIKGKL
FT                   ADMPLYQLFGGKSRDAITLYTHAASETLTGLFDEVDRHYADGYRHIRCQLGFYGGTPEQ
FT                   LHSTRQPTPGAYYDQEQYIANTLSMFRALRERYGDKFHILHDVHERLFPSQAVQFAQAV
FT                   EGYRPYFIEDILPPAQNGWLAQIRAQTSVPLATGELFNNPAEWQDLVIHRHIDFIRCHV
FT                   SQIGGISPALKLAAFCQNFGIRLAWHCPPDMTPIGAAVNLHLNIHLHNAAIQEYIAYPE
FT                   NTRRVFPDSPIPDNGYLYPIEKAGIGVEMAEDVAQAFPVVYRPHEWTQSRLPDGSLHTP
FT                   "
FT   gene            complement(216647..217375)
FT                   /locus_tag="Dd703_0193"
FT   CDS_pept        complement(216647..217375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0193"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein GntR HTH; SMART: regulatory
FT                   protein GntR HTH; KEGG: eca:ECA0190 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84010"
FT                   /db_xref="GOA:C6C792"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C792"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACS84010.1"
FT                   /translation="MKKKDFIAQDLLSKIYQHAALRPEQRMSEKLPPERTLAEEYGVSR
FT                   FTIRKALEKLASIGAIRLVQGAGNYINPDIRNNPLVYNSVTEKKFHQIAFRLLSLHKRL
FT                   PTRDEQQMFGISDAVFLWEFCRLRYVENQKVQIEVSRMPADLFADMTRRIPEQSIQKYI
FT                   LGKGYEISHFLTHYQAVTVNQAQAELLGCKKGIAAMHILNRGMLKDGRVYEVSDIIDIN
FT                   YTCTYVIPFNQDNLTFRQST"
FT   gene            complement(217465..218613)
FT                   /locus_tag="Dd703_0194"
FT   CDS_pept        complement(217465..218613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0194"
FT                   /product="acetylornithine deacetylase (ArgE)"
FT                   /note="TIGRFAM: acetylornithine deacetylase (ArgE); PFAM:
FT                   peptidase M20; peptidase dimerisation domain protein; KEGG:
FT                   eca:ECA0191 acetylornithine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84011"
FT                   /db_xref="GOA:C6C793"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6C793"
FT                   /inference="protein motif:TFAM:TIGR01892"
FT                   /protein_id="ACS84011.1"
FT                   /translation="MKMNLPPFIELYRALIATPSISATDRALDQSNETLINLLAGWFAD
FT                   LGFHVDVQPVPGTYNKYNLLARLGEGSGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDNK
FT                   LYGLGTADMKGFFAFILDALRDIDADKLTRPLYILATADEETTMAGAKYFSESTGIRPD
FT                   CAIIGEPTSLQPIRAHKGHMSNAVRVQGQSGHSSDPSRGVNAIEVMHDAISHLMVLRDD
FT                   LKTRYHNPAFHIPHPTMNFGHIHGGDAANRICACCDLHMDIRPLPGMTLSDLNGLITEA
FT                   LSPVSDRWPGRLTVSELHPPIPGYECPADHELAQVVEKLLGQPTDVVNYCTEAPFIQTL
FT                   CPTLVLGPGSINQAHQPDEFLDMSFIQPTRTLITQLVHHFCR"
FT   gene            218826..219830
FT                   /locus_tag="Dd703_0195"
FT   CDS_pept        218826..219830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0195"
FT                   /product="N-acetyl-gamma-glutamyl-phosphate reductase"
FT                   /EC_number="1.2.1.38"
FT                   /note="KEGG: eca:ECA0192 N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; TIGRFAM: N-acetyl-gamma-glutamyl-phosphate
FT                   reductase; PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   Semialdehyde dehydrogenase dimerisation region"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84012"
FT                   /db_xref="GOA:C6C794"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6C794"
FT                   /inference="protein motif:TFAM:TIGR01850"
FT                   /protein_id="ACS84012.1"
FT                   /translation="MLNTLIVGASGYTGAELALYLNRHPQMNITALAVSAQSVDAGKRI
FT                   SDLHPQLKGIIELPVQPLTDVAEAAKGVDVVFLATDHKVSHDLAPQFLAAGCTVFDLSG
FT                   AFRVQDAEFYNRYYGFEHQHADLLSQAVYGLAEWQADNIRQAQLIAVPGCYPTASQLAL
FT                   KPLVEGGLLNPEQWPVIDATSGVSGAGRKASMTNSFCEVSLQPYGIFNHRHHPEIATHL
FT                   GIPVIFTPHLGNFPRGILATITCRLQPGVTAQDVAEAYHNAYHDKPLVRLYEKGVPALK
FT                   SVVGLPFCDIGFAVQGEHLIVVAAEDNLLKGAAAQAVQCMNIRFGFPETQSLL"
FT   gene            219856..220629
FT                   /locus_tag="Dd703_0196"
FT   CDS_pept        219856..220629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0196"
FT                   /product="acetylglutamate kinase"
FT                   /note="TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: eca:ECA0193
FT                   acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84013"
FT                   /db_xref="GOA:C6C795"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041731"
FT                   /db_xref="UniProtKB/TrEMBL:C6C795"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACS84013.1"
FT                   /translation="MNPLIIKLGGVLLDSEEALERLFTALVEYRQQHQRPLVIVHGGGC
FT                   LVDDLMKKLSLPVVKKNGLRVTPADQIDIITGALAGSANKTLLAWAIRHDINAVGLSLA
FT                   DGGSTSVTQLSEELGHVGKAEAGSPALINTLLAAGYLPVVSSIGITAEGELMNVNADQA
FT                   ATALAQTLGADLILLSDVSGILDGKGQRIAEMTAEKAEALIAQGIITDGMIVKVNAALD
FT                   AARALGRPVDIASWRHADQLPALFNGVPIGTRILA"
FT   gene            220742..222115
FT                   /locus_tag="Dd703_0197"
FT   CDS_pept        220742..222115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0197"
FT                   /product="argininosuccinate lyase"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: eca:ECA0194 argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84014"
FT                   /db_xref="GOA:C6C796"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:C6C796"
FT                   /inference="protein motif:TFAM:TIGR00838"
FT                   /protein_id="ACS84014.1"
FT                   /translation="MALWGGRFTQAADQRFKQFNDSLRFDYRLAEQDIVGSIGWSKALV
FT                   TVNVLTVQEQQQLEQALNTLLVEVQADPQAILHSDAEDIHSWVEQRLIEKVGDLGKKLH
FT                   TGRSRNDQVATDLKLWCKAQVGEMVQAVRHLRAALVATAEVNQDAVMPGYTHLQRAQPV
FT                   TFAHWCLAYHEMLVRDESRLEDTLKRLDVSPLGCGALAGTAYPIDREQLAGWLGFASAT
FT                   RNSLDTVSDRDHVLELLSDASIGMVHLSRFAEDLIFFNSGESAFVELSDRVTSGSSLMP
FT                   QKKNPDALELIRGKCGRVQGALAGMLVTLKGLPLAYNKDMQEDKEGLFDALDTWHDCLL
FT                   MAALVLEGIQVKRPRCQEAAEQGYANATELADYLVSKGVPFREAHHIVGEAVVEAIRQG
FT                   KALEALPLSELQKFSAVIGDDVYPCLSLQSCLEKRAAQGGVSPQQVARAIAEAKQRLA"
FT   gene            complement(222273..222554)
FT                   /locus_tag="Dd703_0198"
FT   CDS_pept        complement(222273..222554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0198"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: eca:ECA4216 peptidyl-prolyl cis-trans isomerase C"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84015"
FT                   /db_xref="GOA:C6C797"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:C6C797"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACS84015.1"
FT                   /translation="MATTAAALHILVDTEQQAHDLLAQLEQGADFQQLAQKHSTCPSRR
FT                   NGGDLGEFRKGDMVPAFDKAVFSCELLKPFGPVKTQFGYHLIKVLYRN"
FT   gene            222727..224751
FT                   /locus_tag="Dd703_0199"
FT   CDS_pept        222727..224751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0199"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase Rep; PFAM:
FT                   UvrD/REP helicase; KEGG: eca:ECA4215 ATP-dependent DNA
FT                   helicase Rep"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84016"
FT                   /db_xref="GOA:C6C798"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C6C798"
FT                   /inference="protein motif:TFAM:TIGR01074"
FT                   /protein_id="ACS84016.1"
FT                   /translation="MRLNASQQHAVESVSGPCLVLAGAGSGKTRVITQKIAYLIRTCGY
FT                   QARHIAAVTFTNKAAREMKERVAQTLGRKETRGLMIATFHTLGLEIIKREYLALGMKSN
FT                   FSLFDDQDQLALLKELTEQWLQNDKDLLQQLISAISNWKNDLMGPEQAMGMARSERDRL
FT                   FAHCYRLYDDHLRACNVLDFDDLILLPTLLFLRDEPARERWQQRIRYLLVDEYQDTNTS
FT                   QYELVKMLVGARARFTVVGDDDQSIYSWRGARPQNLSLLQQDFPALQVIKLEQNYRSSG
FT                   RILKAANILIANNPHVFEKRLYSELGYGTELKIITANNEDDEAERVVGELIAHHFINKT
FT                   QYGDYAILYRGNHQSRLFEKVLMQNRIPYRISGGTSFFSRPEIKDLLAYLRVLTNPDDD
FT                   SAFLRVVNTPKREIGPATLQKLGEWARQRNRGLFSASFDVGLSQTLSGRGLESLQRFTR
FT                   WMDDIARLAEREPVKAVRDLLHGLDYESWLYETSTSPKAAEMRMKNVNQLFTWMTEMLE
FT                   GSDLDEPMPLTQVVTRFTLRDMMERNESEEELDQVQLMTLHASKGLEFPYVYLVGMEEG
FT                   LLPHQTSIDEDNVDEERRLAYVGITRAQKALTFTLCRERRQYGELVRPEPSRFLLELPQ
FT                   DDVVWESGRREVSPQERMQKGQNHLANLRAQLAKARDKP"
FT   gene            complement(224944..226761)
FT                   /locus_tag="Dd703_0200"
FT   CDS_pept        complement(224944..226761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0200"
FT                   /product="glycoside hydrolase family 28"
FT                   /note="PFAM: glycoside hydrolase family 28; Fibronectin
FT                   type III domain protein; SMART: Fibronectin type III domain
FT                   protein; KEGG: yen:YE0164
FT                   exo-poly-alpha-D-galacturonosidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84017"
FT                   /db_xref="GOA:C6C799"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C6C799"
FT                   /inference="protein motif:PFAM:PF00295"
FT                   /protein_id="ACS84017.1"
FT                   /translation="MSTPSLPRNTFCLATLIPLLLLAPPTLAASRQAPQKLQVPTLAYD
FT                   DHSVVLVWDAPEDTAAITDYQVYQNGRLVGLASQIADKYSPAQPYITAFYRADTRSFHH
FT                   KIVLQNARIEGLKADTEYRFTVRTVYADGTVSADSNAVVAKTAAPPQIINITHYGAKGD
FT                   GTTLNTTAIQNAINACNTGCRIDIPAGVFKTGALWLKSDMTLNLMEGATLLGSENAADY
FT                   PAAYQIYSYSSQMRPASLLNAIDKHHSTVGTFQNIRIIGKGVIDGNGWKRDTATEAKDE
FT                   TGAVIPHYVKSNNSKVGKDGILASSQVAAAIADGLDAKTAYGQARSSLITLRGVKNVYL
FT                   ADITIRNPAFHGMMFLENQHVVVNGVTHHTYDANNGDGIEFGNSQDTMVFNSVFDTGDD
FT                   CINFAAGMGKSAEHQEATQTSWLFNNAFIHGHGAVVLGSHTGAGIADVLAENNVMNQTD
FT                   IGLRAKSATSIGGGAHNITFRNNAMKNLAKQAVIVTLSYSDANSTTDYTPAATSARFYN
FT                   FMVKNVTVQNSTGKSPSIDITGDSKNGIWHSQLNFSNMKLDNVMPVAISDLADSQFTHL
FT                   TFTHLQSGNTPWNFGAVKNVSVDGKTVTP"
FT   sig_peptide     complement(226675..226761)
FT                   /locus_tag="Dd703_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 29"
FT   gene            complement(226927..228423)
FT                   /locus_tag="Dd703_0201"
FT   CDS_pept        complement(226927..228423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0201"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: eca:ECA4214
FT                   guanosine pentaphosphate phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84018"
FT                   /db_xref="GOA:C6C7A0"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7A0"
FT                   /inference="protein motif:PRIAM:3.6.1.40"
FT                   /protein_id="ACS84018.1"
FT                   /translation="MLRSSSLYAAIDLGSNSFHMLVVREVAGSVQTLARIKRKVRLAAG
FT                   LDASNHLSQEAMQRGWQCLALFSERLQDIPPEQVRVVATATLRLATNADEFLERAQKIL
FT                   GLPIQVISGEEEARLIYQGVAHTTGGPEQRLVVDIGGGSTELATGTGAQTTQLFSLSMG
FT                   CVTWLERYFGDRNLGAENFARAEQAARERLHPIKDALLNQGWQVCVGASGTVQALQEIM
FT                   VAQGMDEYITLSKLQQLKQRAIQCGKLEELEIEGLTLERALVFPSGLSILLAIFQELQI
FT                   GAMTLAGGALREGLVYGMLNLPIEQDIRHRTLQNLQRRYLLDAEQAQRVSALADNFMQQ
FT                   VARDWQLDNRCRELLRSASLVHEIGLSIDFRQAPQHAAYLIRNSDLPGFTPAQKKLLAT
FT                   LLQNQCNTIDPIPLTQQNALPVVQAQRLCRLLRLAIIFASRRRDDTLPAVRLRAEGDTL
FT                   RVILPSGWLNQHPLRSETLTQESLWQSYVHWSLLIEEHSA"
FT   gene            complement(228431..229717)
FT                   /locus_tag="Dd703_0202"
FT   CDS_pept        complement(228431..229717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0202"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; KEGG: eca:ECA4213 ATP-dependent
FT                   RNA helicase RhlB"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84019"
FT                   /db_xref="GOA:C6C7A1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7A1"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACS84019.1"
FT                   /translation="MSKTHLTEQKFSDFALHPLVIEALESKGFHNCTPIQALALPLTLS
FT                   GRDVAGQAQTGTGKTLAFLASTFHHLLSHPALADRQVNQPRALIMAPTRELAVQIHTDA
FT                   EALARVTGFKLGLAYGGDGYDKQLKVLENGVDILIGTTGRLIDYTKQNHVNLGAIQVVV
FT                   LDEADRMYDLGFIKDIRWLFRRMPSANQRLNMLFSATLSYRVRELAFEQMNNAEYVEVE
FT                   PEQKTGHRIKEELFYPSNEEKMRLLQTLIEEEWPDRCIVFANTKHRCEEIWGHLAADGH
FT                   RVGLLTGDVAQKKRLRILEEFTHGNLDILVATDVAARGLHIPAVTHVFNYDLPDDCEDY
FT                   VHRIGRTGRAGASGYSISLACEEYALNLPAIETYIGHNIPVSKYNSDVLLNDLPEPKRL
FT                   SRPRSTGGPRRPGAPRRSGAPRNNRKRPG"
FT   gene            229837..230163
FT                   /locus_tag="Dd703_0203"
FT   CDS_pept        229837..230163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0203"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: spe:Spro_0159 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84020"
FT                   /db_xref="GOA:C6C7A2"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7A2"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ACS84020.1"
FT                   /translation="MSDKIIHLTDGSFDAEVLQAEGPTLVDFWAEWCGPCKMIAPILDE
FT                   IADEFEGKLTVAKLNIDENPATAPKYGIRGIPTLLLFKNGELAATKVGALSKGQLKEFI
FT                   SHNL"
FT   gene            230583..231842
FT                   /locus_tag="Dd703_0204"
FT   CDS_pept        230583..231842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0204"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: cko:CKO_00124 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Ribonuclease B OB region domain; Rho termination
FT                   factor domain protein; Rho termination factor RNA-binding;
FT                   SMART: Cold shock protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84021"
FT                   /db_xref="GOA:C6C7A3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7A3"
FT                   /inference="protein motif:TFAM:TIGR00767"
FT                   /protein_id="ACS84021.1"
FT                   /translation="MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARNKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LAAPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTQEELQKMWILRKIIHPMGEIDAMEFL
FT                   INKLAMTKTNDEFFDMMKRS"
FT   gene            232325..233458
FT                   /locus_tag="Dd703_0205"
FT   CDS_pept        232325..233458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0205"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="KEGG: yen:YE0171 UDP-N-acetylglucosamine
FT                   2-epimerase; TIGRFAM: UDP-N-acetylglucosamine 2-epimerase;
FT                   PFAM: UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84022"
FT                   /db_xref="GOA:C6C7A4"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7A4"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ACS84022.1"
FT                   /translation="MVKVLTVFGTRPEAIKMAPLIRTINQDCLFESRICVTAQHREMLD
FT                   QVLNLFGIVPDYDLDIMQPDQELAEISARILSGLKPVLADFQPNVVLVHGDTTTTLMAS
FT                   LAAFYHRIPVAHVEAGLRTGNLNSPWPEEANRTLTSRLATYHFAPTPQARGNLLREQVP
FT                   DDRIWVTGNSVIDALYWVRDLIGRDPVLRRGLEDQYAFLKPDSKMILVTGHRRESFGGG
FT                   MARICTALAAIAHHHPDVQIVYPVHRNPSVAEPVNRILHGISNIFLIEPQDYLSFVYLM
FT                   DRAWLVLTDSGGIQEEAPALGRPVLVMRETTERPEVLATGAVRLVGTDTDAILHGVSAL
FT                   LSDEEAYQSMLQRYHPYGDGRASQRIVDVLKQHQVML"
FT   gene            233455..234717
FT                   /locus_tag="Dd703_0206"
FT   CDS_pept        233455..234717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0206"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG: yps:YPTB0171
FT                   UDP-N-acetyl-D-mannosamine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84023"
FT                   /db_xref="GOA:C6C7A5"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR032891"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7A5"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ACS84023.1"
FT                   /translation="MSFDTISVIGLGYIGLPTAVMFALRHPNVVGVDLDRSLVEAINQG
FT                   EMTVTEPDLARLTRMAVAQGFLRATHRPMAADAFLIAVPTPLQGDHQPDLTFVQMAARG
FT                   LADVLKPGDLVVLESTSPVGTTEQLAEWLALARPDLSFPQQRGEQSDVRIAYCPERVLP
FT                   GNIMQELARNDRVIGGMTERCAARACELYRIFLEGECMVTDTRTAEMCKLTENSFRDVN
FT                   LAFANELSLICAEQGIDVWALIRLANRHPRVDILLPGPGVGGHCIAVDPWFIVSQHPRQ
FT                   AQLIHTARLVNDAKPLWVVDRVKIAVADALAQSGKTPKSLCIACFGLTFKPDIDDCRGS
FT                   PALDITAMIAEWHAGKTLVVEPYLPELPPILRGCAVPADIRQALRDADVLVMLVDHQAF
FT                   RAVPAEQIAQRWVVDTRGIWR"
FT   gene            234741..235463
FT                   /locus_tag="Dd703_0207"
FT   CDS_pept        234741..235463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0207"
FT                   /product="TDP-D-fucosamine acetyltransferase"
FT                   /note="TIGRFAM: TDP-D-fucosamine acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; KEGG: eca:ECA4205
FT                   TDP-fucosamine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84024"
FT                   /db_xref="GOA:C6C7A6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7A6"
FT                   /inference="protein motif:TFAM:TIGR02382"
FT                   /protein_id="ACS84024.1"
FT                   /translation="MTLCAVIEPLVWESEFFQRSCGRLGFGQDAPPLTAAALDRFALCQ
FT                   AKIAASELVRADALATWGFRLAEGEASFCMSVVPAARAQFAVGVRQAEIGDIPVLRAAA
FT                   AQSFVWSRFRPPWYREDDCGRFYARWVEKAVDGEFDDACLVTVAPGGALTGFVTLRQQS
FT                   PQLARIGLLSVLPGMQGQGIGRQLMQVSRVWCQQRRIRRLAVATQTSNLPAMRLYLGSG
FT                   ARLESTAYWLYRSAHDPI"
FT   gene            235450..236577
FT                   /locus_tag="Dd703_0208"
FT   CDS_pept        235450..236577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0208"
FT                   /product="TDP-4-keto-6-deoxy-D-glucose transaminase"
FT                   /note="TIGRFAM: TDP-4-keto-6-deoxy-D-glucose transaminase;
FT                   PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aminotransferase class V; KEGG: eca:ECA4204
FT                   TDP-4-oxo-6-deoxy-D-glucose transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84025"
FT                   /db_xref="GOA:C6C7A7"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7A7"
FT                   /inference="protein motif:TFAM:TIGR02379"
FT                   /protein_id="ACS84025.1"
FT                   /translation="MIPFNAPAVVGSELAYIQTAMQSGRLSGDGDFSRRCQQWLEQYSG
FT                   SQRVLMTPSCTASLEMAAILLDIGPDDEVIMPSYTFVSTANAFVLRGARIRFVDIRPDT
FT                   LNIDARAIEAAITAKTRAIVVVHYAGVSCEMEAIMALAQRYGLFVVEDAAQGIMSRYQG
FT                   RPLGAIGHIGCFSFHETKNVTAGGEGGATLINAPELVERAEVIREKGTDRSRFFRGLTD
FT                   KYTWRDIGSSYLMAEVQAAYLWGQLEAISRIHQRRCQLWQRYAAAFRALADAGRLTLPH
FT                   VPADCEHNGHLFFLRLQDRAERTAFIRHMSERDILTVFHYLPLHTSPAGRQFGRFIGDD
FT                   GCTLRESDRLVRLPLFYNLSDAEQRTVIDAALAFF"
FT   gene            236577..237830
FT                   /locus_tag="Dd703_0209"
FT   CDS_pept        236577..237830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0209"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   eca:ECA4203 entero common antigen biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84026"
FT                   /db_xref="GOA:C6C7A8"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7A8"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ACS84026.1"
FT                   /translation="MSSLARASVWTAGSVLVKVGAGLVVIKLLALSFGPEGVGLAGNYR
FT                   QLITVLGALAGAGISNGVTRMIAAAPTTADAPSASLGTAVTITLGWSLALALLLWWGAV
FT                   PLSRLLFGIEDYDRVIRVLALLQVGMAVASLLQAILKGFRDARACALTVVIGSVSGMMA
FT                   FVLCVWLTGYAGALVGLALAPTLLVFPACWLLHRRTPLRWRTFAPRWDRRQARLLGTFT
FT                   LMTLITAVTLPVSYVLMRNLLAAQDGWDAVGIWQGMMTISDAWLQFITASLSVWLLPTL
FT                   SRLTEKTAVRDEILRTLRFVLPWLSFGAVALWLSRDIGIGLLFSPKFTPMRSLFGWQLA
FT                   GDVLKVGAYVFGYLVVARASLRFYVLAETCQCALLLAFAYWLIPLHGAIGAAQAYLAAY
FT                   LIYFLLCSGVFTLYCRRA"
FT   gene            237827..238897
FT                   /locus_tag="Dd703_0210"
FT   CDS_pept        237827..238897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0210"
FT                   /product="4-alpha-L-fucosyltransferase"
FT                   /note="PFAM: 4-alpha-L-fucosyltransferase; KEGG:
FT                   spe:Spro_0170 4-alpha-L-fucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84027"
FT                   /db_xref="GOA:C6C7A9"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7A9"
FT                   /inference="protein motif:PFAM:PF07429"
FT                   /protein_id="ACS84027.1"
FT                   /translation="MNTLIHILGADIPHHNQTLLGFFNDNLTSEIPHHFMVAAQDAAAL
FT                   RRAFPALRIDAFGSKSALAMAVVRRAWADRSTRFFFHGQFNVWLWLALLARLILPTQVS
FT                   WHIWGADLYETACGWQYRMFYLLRRRAFRQVGHVFATRGDLGVVQRFRPHLPASLLYFP
FT                   TRMPPLSEPAANPGPSTPMTILVGNSGDRSNRHREALAAIHRQFGADVQVVLPMGYPAG
FT                   NAAYVAQVVRQGTRLFGANFRVLHQPLAFDDYLALLRRCDLGYFIFQRQQGIGTLCLLI
FT                   QLRVPFVISRSNPFWQDLAEQQLPVLFCEDQLDETCVWEARRQLARTDIRGITFFSPNY
FT                   LPAWRQALVQATGGAA"
FT   gene            238894..240231
FT                   /locus_tag="Dd703_0211"
FT   CDS_pept        238894..240231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0211"
FT                   /product="WzyE family protein"
FT                   /note="PFAM: WzyE family protein; KEGG: esa:ESA_03766
FT                   putative enterobacterial common antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84028"
FT                   /db_xref="GOA:C6C7B0"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7B0"
FT                   /inference="protein motif:PFAM:PF06899"
FT                   /protein_id="ACS84028.1"
FT                   /translation="MTAWQGVGLGCVWLLCSGLITQAIASEYRHRGFSFHGLFSLMYWV
FT                   TFYGGFPFTAILAFHFNVQPVGAGALLQALLAAAAFYAVYLAGYRIWRPTANGSAHAFS
FT                   VGMNRSEALLTAGFLGAVAVMTAAVFFANNGFLLFRLHTYSQIFSRDVSGVALKRFFYF
FT                   FLPAMLVWFFLYQTRRAWLAFLLTTATFGALTYLIVGGTRANLMMALMLFVCIGVARGW
FT                   IALRWIAVVGVASVALMFWLALRRYGLNVHGEQAFYTFLYLTRDSFSPWENLALLCQRY
FT                   EQIVLQGLAPIARDFYVFIPAWLWPERPAQILNSANYFTWEVLNYHAGLAMSPTLLGSL
FT                   LVMVGWWGVLPGAILVGWIIKGVDVLYQQGCRTTNRALAAVIQAFCFGALFNLIVLVRE
FT                   GLDAFVSRMVFFSLVFIASVLMAKGLYRLLVRAGVITDAPSTGVGE"
FT   sig_peptide     238894..238971
FT                   /locus_tag="Dd703_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.895) with cleavage site probability 0.841 at
FT                   residue 26"
FT   gene            240237..240968
FT                   /locus_tag="Dd703_0212"
FT   CDS_pept        240237..240968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0212"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /note="TIGRFAM: glycosyl transferase, WecB/TagA/CpsF
FT                   family; PFAM: glycosyl transferase WecB/TagA/CpsF; KEGG:
FT                   kpn:KPN_04295 putative UDP-N-acetyl-D-mannosaminuronic acid
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84029"
FT                   /db_xref="GOA:C6C7B1"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7B1"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ACS84029.1"
FT                   /translation="MRETVPIYMLRGIAVSGFRDRDQCVAYLFPDGQPRPGMLVALNAE
FT                   KVLTTERNDELRALMTVSCNYADGISVVCSIRRKYRAADVTRIAGVDLWEALMQRAGTL
FT                   GTPVFLIGGRAQVLAETAERLRTRWRVNIVGMQDGYFDAEQQSTLLERINESGAQLVTV
FT                   AMGSPRQELLIRDAYRRYPGALYMGVGGTYDVFTGHVRRAPAFWRRNGLEWCYRLLTQP
FT                   SRIRRQWRLLRYLFYHFSGRL"
FT   gene            241205..242599
FT                   /locus_tag="Dd703_0213"
FT   CDS_pept        241205..242599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0213"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   eca:ECA4199 putative transport protein YifK"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84030"
FT                   /db_xref="GOA:C6C7B2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7B2"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACS84030.1"
FT                   /translation="MANTTKQDKLHRGLEARHIELIALGGTIGVGLFMGAASALKWAGP
FT                   SVLLAYIVAGIFVFFIMRSMGEMLFLEPVTGSFAVYAHNYLSPFFGYLTAWSYWFMWMA
FT                   VGISEITAIGVYVQYWFPELPQWIPAIAAVVMVAVANLAAVRLYGEIEFWFSMIKITTI
FT                   IVMIVVGLGIIFFGFGNHGQSTGLANLTEHGGFLAGGWKGLLFALCLVVASYQGVELVG
FT                   ITAGEARNPQVTLKRAINNILWRILIFYVGAIFVIVTIFPWNEIGTTGSPFVLTFSRIG
FT                   ITAAAGIINFVVLTAALSGCNSGMYSCGRMLYSLSSNRQLPAALGRVTAGGVPAAGVAV
FT                   SILCLIAGSMLNYIIPNPEKVFVYVYSASVLPGMVPWFVVLISQLRFREQHRAAIASHP
FT                   FRSVLFPWVNYLTMVFLACVLVGMYVNVDTRMSLIVGCIFLGVVSVCYALLGLGKKQAE
FT                   IQAEAE"
FT   gene            242746..242822
FT                   /locus_tag="Dd703_R0001"
FT                   /note="tRNA-Arg1"
FT   tRNA            242746..242822
FT                   /locus_tag="Dd703_R0001"
FT                   /product="tRNA-Arg"
FT   gene            242896..242971
FT                   /locus_tag="Dd703_R0002"
FT                   /note="tRNA-His1"
FT   tRNA            242896..242971
FT                   /locus_tag="Dd703_R0002"
FT                   /product="tRNA-His"
FT   gene            242992..243077
FT                   /locus_tag="Dd703_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            242992..243077
FT                   /locus_tag="Dd703_R0003"
FT                   /product="tRNA-Leu"
FT   gene            243104..243180
FT                   /locus_tag="Dd703_R0004"
FT                   /note="tRNA-Pro1"
FT   tRNA            243104..243180
FT                   /locus_tag="Dd703_R0004"
FT                   /product="tRNA-Pro"
FT   gene            243372..243710
FT                   /locus_tag="Dd703_0214"
FT   CDS_pept        243372..243710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0214"
FT                   /product="steroid delta-isomerase domain-containing
FT                   protein"
FT                   /note="KEGG: aha:AHA_0731 steroid delta-isomerase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84031"
FT                   /db_xref="GOA:C6C7B3"
FT                   /db_xref="InterPro:IPR008317"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7B3"
FT                   /inference="similar to AA sequence:KEGG:AHA_0731"
FT                   /protein_id="ACS84031.1"
FT                   /translation="MSVIIPVQEQFEAYNARDLARFIACYSDNFRAYRMPATSPFIEGK
FT                   IVLEAFYCEQRFNNPALRAELLSRTVLGNKVFDHEKIYGIAPEPVESIAVFEVKDGLIV
FT                   TAWFYFVD"
FT   gene            243962..245326
FT                   /locus_tag="Dd703_0215"
FT   CDS_pept        243962..245326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0215"
FT                   /product="adenylosuccinate lyase"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: eca:ECA4197 adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84032"
FT                   /db_xref="GOA:C6C7B4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7B4"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ACS84032.1"
FT                   /translation="MASHLIDFLLIGNNFGTPEMRAVWSEQNRMTRQVDVEVALALAEG
FT                   ELGVIPQDAADAIARHADASTLNIESIAQDAARMKHSLMPTITAIQKQCGDAGEYIHYG
FT                   VTTQDVVDTATVLQLRQSFDIVVRDTRLVARELKRLAKQYQYTPMTGRTHGMQALPTTF
FT                   GFKLAVWLDEFVRHLQRLNEIRERVLVGNISGAICTYASFGELGPEIERQTLKRLGLNT
FT                   PNIGWQSARDRFSEYASVAVLISGTLGKIGNELYNLMRTEINEIEEPFSEGKIGSTTMP
FT                   HKRNPAALEGLASLTAPLFKSAALIHESMKVEHERDAMSWRAEWIALPEINIYLSAQLQ
FT                   NALGILRGMSVNEKQMRANLELQNGLLLSEKVMFEIGKRLGKQTAHHLVYECSMAAFEQ
FT                   NRHFKDVLLEHPVLASQLSADDLDAWLDPTNYLGSAPQKVDDVIRYADDSGLLAE"
FT   gene            245338..245874
FT                   /locus_tag="Dd703_0216"
FT   CDS_pept        245338..245874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0216"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   eca:ECA4196 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84033"
FT                   /db_xref="GOA:C6C7B5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7B5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS84033.1"
FT                   /translation="MSTIFRQVTLADDEAFLELALAAYAPVREMGIKFDAAYADIERIR
FT                   FHIQHNGVYVMEKEGRFASSCSIRYPWGPEPGPFGLPHIGWFATHPDFKQQGLGRQMLD
FT                   WLEQDILLEQLKAPAVSLGTAKNHPWLLEMYRNYGFKDVCQADLGKGHLTIFMEKVLDP
FT                   QRYDQWKKKHPRAEI"
FT   gene            245875..246642
FT                   /locus_tag="Dd703_0217"
FT   CDS_pept        245875..246642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0217"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   eca:ECA4195 putative amino-acid ABC transporter binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84034"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7B6"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS84034.1"
FT                   /translation="MKKIILSAFAFAAALLMAGCDSQKDDKVLRVGATGQSYPSAFKQD
FT                   NKLVGFDVEVTETIAKDLNYKVEWVTADFSGLMGQLEAKKLDTIANVVAITPAREEKYN
FT                   FSQPYSYYGSQIVTHKDNTGINTLDDLKGKTVAGVLGSNHVNNLKKAFADGSVNIRTYE
FT                   TRDGAMSDALAKRVDGYINSRPILLAEINKRNLPFKMVGSPLVVEKVGFPFQKDEKGNA
FT                   LRKQFDDELSKMRTDGRLKALSVKYFGEDITAG"
FT   sig_peptide     245875..245943
FT                   /locus_tag="Dd703_0217"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.407 at
FT                   residue 23"
FT   gene            246706..247377
FT                   /locus_tag="Dd703_0218"
FT   CDS_pept        246706..247377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0218"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: eca:ECA4194
FT                   amino-acid ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84035"
FT                   /db_xref="GOA:C6C7B7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7B7"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS84035.1"
FT                   /translation="MNIDFSYLLKVFPQVLMYLPTTALLAIVSMAFAIVLGLILALIRE
FT                   SRLLVVAKLVELYISLFRGIPSLVQLFIIYFGLPQLFPALNGLSAMAAAIIGFSLKNSA
FT                   YMAEIFRAALASVDFGQTEAGLSVGMSRVQIYRRIVLPQAMLNALPATGNTFISLIKDT
FT                   SVAFALGVSELFAEGKMIAAESLRFFETFLVVGLIYWLVIIAYSWFQTRLEKKLSHSRQ
FT                   R"
FT   sig_peptide     246706..246807
FT                   /locus_tag="Dd703_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.693) with cleavage site probability 0.663 at
FT                   residue 34"
FT   gene            247387..248148
FT                   /locus_tag="Dd703_0219"
FT   CDS_pept        247387..248148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0219"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMC domain protein;
FT                   SMART: AAA ATPase; KEGG: eca:ECA4193 putative amino-acid
FT                   ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84036"
FT                   /db_xref="GOA:C6C7B8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7B8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS84036.1"
FT                   /translation="MISVRNLTKRFGEQVVLNDISLDIEEGEVVAIIGPSGSGKSTLLR
FT                   CLNLLEKPEAGTITIGDQTLDTRHYTTKAEYALRRQTAMVFQNYNLFKNKTALENITEA
FT                   LIVVKKIPKKHAEEIGLVLLEQVGLLPQANQYPITLSGGQQQRVSIARALAVDPKAILF
FT                   DEPTSALDPERVHEVLQVIQKLAANTTTMVIVTHEMQFAREVADRVIFMADGHIVEQGP
FT                   AEKVIRFSDNPQTRRFLRQLTNIEEPSEFDI"
FT   gene            248227..249384
FT                   /locus_tag="Dd703_0220"
FT   CDS_pept        248227..249384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0220"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /note="KEGG: eca:ECA4192 putative peptidase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84037"
FT                   /db_xref="GOA:C6C7B9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR033846"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7B9"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACS84037.1"
FT                   /translation="MKVHTQHEPLAQYIQAFRHELHQHPELSNQEFETTRKIRAELEKE
FT                   GIRILDLPLKTGLVAEVGGLQDGPLVVVRSDIDALPIEEESGVEFSSKNPGVMHACGHD
FT                   FHSSAALGAAILLKRAEAELKGTVRILFQAAEETGLGAPEVIAAGALDGATAIFGIHND
FT                   PTLPVGVIGGKDGALTAGVDRFEINIAAKGCHAAKPHEGNDPIIIIGQLITAVQTIVSR
FT                   NVPSDNNAVVSITQVHSGSTWNVIPDTAYVEGTVRTFSQEARDLIERRFRQVVAGIAST
FT                   FGAEIEFIWHAGPPSVVNTPRWVEFALQVAGDEGFDARRVEASPIGEDFAFYQQKLPGT
FT                   FMMVGSGGPYALHHPKFRVDDQALFPTAHYLYQLAKLSLEQLSAH"
FT   gene            250337..251368
FT                   /locus_tag="Dd703_0221"
FT   CDS_pept        250337..251368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0221"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   seh:SeHA_C4888 L-idonate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84038"
FT                   /db_xref="GOA:C6C7C0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7C0"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACS84038.1"
FT                   /translation="MVESTQSCVVEGKKKVNVIHQECHYQGSGTLVKITRGGICGSDLH
FT                   YYHEGKVGNYEVKQPMVLGHEVIGVIEQSDNKELRYQQKVAINPSKPCGHCKYCLAHEE
FT                   NQCVSMRFFGSAMYFPHVNGGFTQYKVVDTAQCIPFDNQADDRVMVFAEPLAVAIHAVN
FT                   QAGDIKGKRVFVSGVGPIGCLVVAAAKAMGAAEIVCADVSERSLALASTMGATQTVHAQ
FT                   SGDFSDYLRDKGYFDISFEVSGHPQSIVRCLEVTRAKGVQVQVGMGGAVPDFPMMMLIA
FT                   KEIKLVGTFRFTEEFATAVHWLNDHIIDPLPLLSAEFTFTDLEEALLFASDKSKAAKVQ
FT                   LVF"
FT   gene            251394..252158
FT                   /locus_tag="Dd703_0222"
FT   CDS_pept        251394..252158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0222"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   ypg:YpAngola_A1800 gluconate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84039"
FT                   /db_xref="GOA:C6C7C1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7C1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS84039.1"
FT                   /translation="MKNIFSLENKKVLITGSAQGIGFLLAKGLAEQGAEIIVNDITAER
FT                   AEHAVAQLTAQGYRAYAAPFDVTRCQEVNEAIDGIEKNIGAIDVLINNAGIQRRHPFTE
FT                   FPENEWNDVIAVNQSAVFFVSQAVARNMVERRAGKIVNICSMQSELGRDTITPYAASKG
FT                   AVKMLTRGMCVELARYNIQVNGIAPGYFKTEMTKALVENQEFTAWLTKRTPAARWGNPE
FT                   ELIGAAVFLSSGASNFVNGHLLFVDGGMLVAV"
FT   gene            252251..253570
FT                   /locus_tag="Dd703_0223"
FT   CDS_pept        252251..253570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0223"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: stm:STM4482
FT                   L-idonate transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84040"
FT                   /db_xref="GOA:C6C7C2"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7C2"
FT                   /inference="protein motif:TFAM:TIGR00791"
FT                   /protein_id="ACS84040.1"
FT                   /translation="MPLVIIAIGVALLLILMIGFKINGFIALILVAALVGVGEGMAPLK
FT                   VMSSIQSGIGGTLGGLSMILGFGAMLGRLISDTGAAQRIATTLIHHFGKSRIQWALVIT
FT                   GLIVGLAMFYEVGFVLLLPLVFTIVAAAQLPLLYVGVPMVAALSVTHCFLPPHPGPTAI
FT                   ATIFNANLGVTLLYGMIITIPTVIIAGPVFSRCLKKYEKEPPKGLFNPKIFTEEEMPGF
FT                   GVSLLAAIIPVILMAAAAICEMLLPKENAVRQCFEFIGHPAVALFIAIVLAVFTLGLRG
FT                   GRNMASVMDIVSDSIGAIAMILFIIAGGGAFKQVLVDSGVGQYIAELMKGSSLSPLLMC
FT                   WTVAALLRIALGSATVAAITTAGIVLPLISANHADPALMVLAVGSGSVIASHVNDPGFW
FT                   LFKGYFNLSVGETLKVWTVMETLISVLGIIGVLILNNIIH"
FT   gene            253638..254636
FT                   /locus_tag="Dd703_0224"
FT   CDS_pept        253638..254636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0224"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: see:SNSL254_A4829 HTH-type
FT                   transcriptional regulator IdnR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84041"
FT                   /db_xref="GOA:C6C7C3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7C3"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACS84041.1"
FT                   /translation="MRKYRVSLQDIANLANVTKMTVSRYLRTPNQVSPETGKKIAQVMA
FT                   DIDYIPNRAPEMLLNIKSYTIGVLIPSFTNQLFADMLAGIESVTSGNQYQILIANYNYK
FT                   RDSEEKQILNLLSYNIDGIILSEKSHTLRAVKNLRNANIPIVEVMDTEGESLDMEVGFQ
FT                   NSRAAFDMVSTMLENRQKKKIIYFGSQDDLRDELRYQGYCDAMRQHGLSAYRINPRSIS
FT                   SMQLGAQLIEQAFIEYPDLDGIFCTNDDIAVGALLYCLRKGIRVPEEVSIAGFHGLDIG
FT                   REMIPSLATVITPRFAIGQRAATILLNKISDRDYSTYSTDLGYQIYRGDTL"
FT   gene            complement(254842..256035)
FT                   /locus_tag="Dd703_0225"
FT   CDS_pept        complement(254842..256035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0225"
FT                   /product="HemY protein"
FT                   /note="TIGRFAM: HemY protein; PFAM: HemY domain protein;
FT                   Tetratricopeptide TPR_2 repeat protein; KEGG: eca:ECA4191
FT                   putative protoheme IX biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84042"
FT                   /db_xref="GOA:C6C7C4"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7C4"
FT                   /inference="protein motif:TFAM:TIGR00540"
FT                   /protein_id="ACS84042.1"
FT                   /translation="MLKVFLLFAMLIAGIVVGPMLAGHQGYVLIQTDNYNIETSVTGLV
FT                   IMLVLLLLAFIALEWLLRRLFRTGARTRGWFIGRKRSRARQQTRAALLKLTEGDYHQVE
FT                   KLLTRNADHADQPVVNYLLAAEAAQQRGDDFRTRQYLERAAEIADNDQLPVDITRVRIQ
FT                   LARNEDHAARHGVDRLLEVAPRHPEVLRLAEQAFLRTSAYSALLDILPAMRKTRIHDEA
FT                   HLQSLQQRATIGLMDQAMAEGGSEGLKQWWKNQNRKVRQDLSMQVAMAEHLIACDDHTT
FT                   SQNIIIDGLKRQYDHRLVQLMPRLQTGNPEPLEKTLRQQLKQRADDALLHSTLGQLLMK
FT                   HGEWKQASEAFLAALALRPDAYDYAWCADAFDRLKRYEDAARMRREGLTLTLQTEQK"
FT   sig_peptide     complement(255964..256035)
FT                   /locus_tag="Dd703_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.929) with cleavage site probability 0.853 at
FT                   residue 24"
FT   gene            complement(256038..257162)
FT                   /locus_tag="Dd703_0226"
FT   CDS_pept        complement(256038..257162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0226"
FT                   /product="Uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="PFAM: protein of unknown function DUF513 hemX; KEGG:
FT                   eca:ECA4190 putative uroporphyrinogen III
FT                   C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84043"
FT                   /db_xref="GOA:C6C7C5"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7C5"
FT                   /inference="protein motif:PRIAM:2.1.1.107"
FT                   /protein_id="ACS84043.1"
FT                   /translation="MTEHVTPSTPSEEVVERVEPAHPQKSPTPPARQGIVPCAVAIVVA
FT                   LALSGGVYYYAHQQLQRQSTETALLQEQIVALQKQQTQSQQQWQQAQEQQSKIQNADEQ
FT                   RLAALARQAGEMQEKLATLSNSDAKTWLLAQADFLVKQAGRKLWSDKDVTTAGALLKSA
FT                   DTSLAEMNDPSLLDVRRAITHDINQLANISQIDFDGIILKVNLLADQVDNLRLADTESS
FT                   NDEPMEENDTTLSASLSEWRQNLSKSWHNFLSDFITIRRRDNTAEPLLAPNQDVYLREN
FT                   IRSRLLIAAQAVPRHQNETYKQSLETAATWIRAYFDEEDPTTKAFLEQLDMLSQQSITM
FT                   DLPTELQSQPLLEQLMQTRVRNLLTQPAATPREG"
FT   gene            complement(257186..257926)
FT                   /locus_tag="Dd703_0227"
FT   CDS_pept        complement(257186..257926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0227"
FT                   /product="Uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   eca:ECA4189 uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84044"
FT                   /db_xref="GOA:C6C7C6"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7C6"
FT                   /inference="protein motif:PRIAM:4.2.1.75"
FT                   /protein_id="ACS84044.1"
FT                   /translation="MTILVTRPSPAGEQLVARLRLAGFHAYHSPLIEFSPGRELASLPT
FT                   RLAALQAGDLVFALSQHVVEFADPLMSRGGHVWPSSLTYYAVGRTTGLALHTVSGLPVH
FT                   YPPVRATSETLLQLTELQNIAGRHALLLRGNGGRELLGDTLQERGAIVSYCECYQRTLV
FT                   HYDGAEQCQRWQTLGVNTLVITSGEMLQALHDLVPDVYQANWLLTCRVIVVSERLAEAA
FT                   RKLGWSDVDVADNADNDALMRALQ"
FT   gene            complement(257923..258864)
FT                   /locus_tag="Dd703_0228"
FT   CDS_pept        complement(257923..258864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0228"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: spe:Spro_0178 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84045"
FT                   /db_xref="GOA:C6C7C7"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7C7"
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /protein_id="ACS84045.1"
FT                   /translation="MVDNILRIATRQSPLALWQAHYVQQRLQACHPGLRVELVPMVTRG
FT                   DVLLDTPLAKVGGKGLFVKELELALLEDRADIAVHSMKDVPVEFPAQLGLVTICERDDP
FT                   RDAFVSNRYANLDALPPGAVVGTSSLRRQCQLRARRPDLVIRDLRGNVGTRLGKLDNGD
FT                   YDAIILAVAGLNRLGLEGRIRAALSPEQSLPAVGQGAVGVECRLDDTRTRALLAPLNHD
FT                   DTAARVLAERAMNTRLEGGCQVPIGSYAELQGDAIWLRALVGSPDGSRIIRGERTGRRQ
FT                   DAEQLGISLADELLAAGAREILQAVYYGGANS"
FT   gene            259192..261747
FT                   /locus_tag="Dd703_0229"
FT   CDS_pept        259192..261747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0229"
FT                   /product="putative adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="PFAM: adenylate cyclase class-I; KEGG: eca:ECA4187
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84046"
FT                   /db_xref="GOA:C6C7C8"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7C8"
FT                   /inference="protein motif:PRIAM:4.6.1.1"
FT                   /protein_id="ACS84046.1"
FT                   /translation="MYFYIETLKQRLDAINQLRVDRALEAMKPAFQQVYSLLPVLLHHH
FT                   HPLMPGYVEGKVPHGICLFTPDEKQQHYLDSVELRWGELSAPDHKGELPITGVYSMGST
FT                   SSIGQSCSSDLDIWVCHQSWLDNDERQRLQQKCSLLEKWAAGQGVDVSFFVMDENRFRH
FT                   NESGSLSGEDCGSTQHILLLDEFYRTAVRMAGKRILWNMVPVEEESNYDEYVLSLYAQG
FT                   ALAPNEWLDLGGLSTLSAEEYFGASLWQLYKSIDSPYKAVLKTLLLETYSWEYPNTRLL
FT                   STEIKTRLHKGEIVSYGLDPYCMMLERVTQYLNDIGDTTRLDLVRRCFYLKVCEKLSLE
FT                   RACTPWRRQILTQMVQEWGWDETRIRVLDNRANWKIGRVREAHNELLDAMMQSYRNLIR
FT                   FARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSETNLTFIHVPPGR
FT                   ANRSGWYLYNQAPSMDAIVSHQPLEYNRYLNKLVAWAYFNGLLTPSTRLHIKGHDLCDI
FT                   ARLQELVSDVSSHFPLRVPAPTPKALYSPCEIRHLAIIVNLEYDPTAAFRNQVVHFDFR
FT                   QLDVFSFGQQQQCLVGSIDLLYRNSWNEVRTLHFSGEQAMLEALKTILGKMHQDAALPE
FT                   SLEVFCYSQHLRGLIRTRVQQLVSECIELRLTSTRQDPGRFKAVKVAGETWGLFFERLS
FT                   VSAQKLENAVEFYGAISNNKLQGLPVQVETNPIHLPPVVDGVASEGIIQFFFEDQQDNQ
FT                   GFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQIV
FT                   QLEGRVQAVPFRSNAISHLYSASASEEKNPVLNHRLQML"
FT   gene            complement(261790..262110)
FT                   /locus_tag="Dd703_0230"
FT   CDS_pept        complement(261790..262110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0230"
FT                   /product="iron donor protein CyaY"
FT                   /note="TIGRFAM: iron donor protein CyaY; PFAM: Frataxin
FT                   family protein; KEGG: spe:Spro_0180 frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84047"
FT                   /db_xref="GOA:C6C7C9"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7C9"
FT                   /inference="protein motif:TFAM:TIGR03421"
FT                   /protein_id="ACS84047.1"
FT                   /translation="MNDSEFHQLADALMLKIEETLDRFDGDADIDYETNGGVMTLSFEN
FT                   GSKIVINRQEPMHQVWLATKSGGYHFDYRDGLWICDRSGNEFMALLATACSEQSGEDVN
FT                   FG"
FT   gene            262188..262361
FT                   /locus_tag="Dd703_0231"
FT   CDS_pept        262188..262361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ses:SARI_03711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84048"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7D0"
FT                   /inference="similar to AA sequence:KEGG:SARI_03711"
FT                   /protein_id="ACS84048.1"
FT                   /translation="MNKVFRQSALALLVLSLVGCGLKGPLYFPPENTPAPAKQVQQQTN
FT                   QTQQQSSPAKTQ"
FT   sig_peptide     262188..262259
FT                   /locus_tag="Dd703_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.636 at
FT                   residue 24"
FT   gene            262456..263280
FT                   /locus_tag="Dd703_0232"
FT   CDS_pept        262456..263280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0232"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="KEGG: eca:ECA4183 diaminopimelate epimerase;
FT                   TIGRFAM: diaminopimelate epimerase; PFAM: diaminopimelate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84049"
FT                   /db_xref="GOA:C6C7D1"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7D1"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ACS84049.1"
FT                   /translation="MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLSDRHCGVGFDQL
FT                   LIVEPPYDPELDFHYRIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDINVSTHNGRM
FT                   VLSVTEDELVRVNMGEPNFEPQQVPFRAAKSEKTYILRVAERTVMCGVVSMGNPHCVIQ
FT                   VENVDTAPVETLGPLLESHERFPERANIGFMQIINRNAIQLRVYERGAGETQACGSGAC
FT                   AAVAVGIQQGLLAADVNVRLPGGELNIHWDGPGNPLFMTGPATHVYDGFIHL"
FT   gene            263277..263978
FT                   /locus_tag="Dd703_0233"
FT   CDS_pept        263277..263978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0233"
FT                   /product="protein of unknown function DUF484"
FT                   /note="PFAM: protein of unknown function DUF484; KEGG:
FT                   eca:ECA4182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84050"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7D2"
FT                   /inference="protein motif:PFAM:PF04340"
FT                   /protein_id="ACS84050.1"
FT                   /translation="MNGNEEQVARQEMTDEQVLQYLHQHPDFFIRHAHQAAQMRVPHPV
FT                   RGTVSLVEWQMSRQRAKIQYLEEEIALLMEQAMRNEALFNQLLQLQLALSTADSLQSLL
FT                   DRLYRWARDLGLSGATIRLFSDRWRIGAPSDFTHLALNRTLFEPLRIQRLGDQKHYLGT
FT                   LNSAELLLLLPQARQVGSVALSLMGKNGDLGLLMFSSRDSHHYQDGMGTDLLQHLAILV
FT                   PTLLERWIERL"
FT   gene            263975..264883
FT                   /locus_tag="Dd703_0234"
FT   CDS_pept        263975..264883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0234"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: eca:ECA4181 site-specific tyrosine
FT                   recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84051"
FT                   /db_xref="GOA:C6C7D3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7D3"
FT                   /inference="protein motif:TFAM:TIGR02224"
FT                   /protein_id="ACS84051.1"
FT                   /translation="MTAPSPLVIPVNAFLRYLRVERRLSPLTLRSYQHQLQVIASTLEE
FT                   SGISDWRRLDAAGVRSLAARGKRDGLSAASLAQRLSALRSFLDWLVSRGELSANPARGV
FT                   SAPKAGRHLPKNMDVDETDRLLAIDLNDPLAVRDRAMLEVMYGAGLRLAELVGLDCRHL
FT                   DLADGEIWVLGKGSKERRLPIGATAVAWLRRWLDVREIYAPDDDAVFVSSRGKRISMRN
FT                   VQKRFAEWGVKQGISSHVHPHKLRHSFATHMLESSGDLRAVQELLGHANLSTTQIYTHL
FT                   DFQHLASVYDAAHPRAKRGKS"
FT   gene            264883..265599
FT                   /locus_tag="Dd703_0235"
FT   CDS_pept        264883..265599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0235"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: eca:ECA4180 flavin mononucleotide
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84052"
FT                   /db_xref="GOA:C6C7D4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7D4"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACS84052.1"
FT                   /translation="MHFYRPLGPIGAMTFDLDDTLYDNHDVILRTERETLRFLQDYHPA
FT                   LASLTVDTLARLRQELRQQEPEIYHDVTHWRWRSVQLAMRRAGLTPSESHRGADAVMAE
FT                   FAHWRSRIEVPQETHDTLTALAQRWPLVAITNGNADPHACGLGGYFRFILRAGPDGRSK
FT                   PWGDMYHRAAEKLNLPLHSLLHVGDDLTTDVAGAVRNGMQSCWINLRDGNLMHIPDARL
FT                   LPHVEIFRLASLTALL"
FT   gene            265686..267848
FT                   /locus_tag="Dd703_0236"
FT   CDS_pept        265686..267848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0236"
FT                   /product="DNA helicase II"
FT                   /note="TIGRFAM: DNA helicase II; PFAM: UvrD/REP helicase;
FT                   KEGG: eca:ECA4179 DNA-dependent helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84053"
FT                   /db_xref="GOA:C6C7D5"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7D5"
FT                   /inference="protein motif:TFAM:TIGR01075"
FT                   /protein_id="ACS84053.1"
FT                   /translation="MDVSDLLDSLNDKQRDAVAAPRSNMLVLAGAGSGKTRVLVHRIAW
FT                   LLTVENCSPYSIMAVTFTNKAAAEMRHRIDQLIGTSQGGMWIGTFHGLAHRLLRAHHLD
FT                   AGLPQDFQILDSEDQLRLLKRLIKALNLDEKQWPPRQAMWYINGKKDEGLRPHHIDSYG
FT                   NPVEQTWLRVYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILQHYRDRFTNILVDEF
FT                   QDTNRIQYAWIRLLAGDSARVMIVGDDDQSIYGWRGAQVENIQHFLRDFQQVETIRLEQ
FT                   NYRSTATILNAANALIAHNGDRLGKNLWTDGVEGEPISLYCAFNELDEARFVVNRIKVW
FT                   QDAGGALIECAILYRSNAQSRVLEEALLQQNLPYRIYGGMRFFERQEIKDALSYLRLIA
FT                   NRNDDAAFERVVNTPTRGIGDRTLDVVRQTARDRQLTLWQATRALLQEKVLAGRAASAL
FT                   QRFLELVDALASDTADLPLHVQTDRAIRDSGLWGMYEQEKGEKGQARVENLEELVTATR
FT                   QFSYQEEDQDLMPLQAFLSHAALEAGEGQADAYQDAVQLMTLHSAKGLEFPQVFIVGME
FT                   EGMFPSQMSLDEGGRLEEERRLAYVGVTRAMHKLTLTYAESRRLYGKENYHRPSRFIGE
FT                   LPPECVEEVRLRASVSRPINHQRLGTPVSQNESGYRLGQRVRHDKFGEGTIVNVEGSGE
FT                   HCRIQVAFVGQGIKWLVAAYARLETV"
FT   gene            268230..269180
FT                   /locus_tag="Dd703_0237"
FT   CDS_pept        268230..269180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0237"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: eca:ECA4177 magnesium/nickel/cobalt transporter CorA"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84054"
FT                   /db_xref="GOA:C6C7D6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7D6"
FT                   /inference="protein motif:TFAM:TIGR00383"
FT                   /protein_id="ACS84054.1"
FT                   /translation="MLSAFKLENCRLTRLELDENDDLTSSLWVDLVEPEAEEREQVQNQ
FT                   LGQSLATRPELEDIEASARFFEDEDGMHIHSFFFYEDADDHAGNSTVAFTIRDGRLYTL
FT                   RERELPAFRLYRMRTRNQMLVDGNAYELLLDLFETKIEQLADEIENIYSDLESLSRVIM
FT                   DGRQGDEYDDALSTLAELEDIGWKVRLCLMDTQRALNFLVRRARLPSGQLEQAREILRD
FT                   IESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFE
FT                   FMPELKWSYGYPGALVLMLLAGLAPYLYFKRRNWL"
FT   gene            269382..270440
FT                   /locus_tag="Dd703_0238"
FT   CDS_pept        269382..270440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0238"
FT                   /product="membrane protein AbrB duplication"
FT                   /note="TIGRFAM: membrane protein AbrB duplication; PFAM:
FT                   putative ammonia monooxygenase; KEGG: eca:ECA4176
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84055"
FT                   /db_xref="GOA:C6C7D7"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7D7"
FT                   /inference="protein motif:TFAM:TIGR03082"
FT                   /protein_id="ACS84055.1"
FT                   /translation="MERLSASIQWAILLSVSLVLGFGLQIYHVPAALLLGPMLVGTTMG
FT                   LNGATIRIPKRLFYASNSVLGALVAQSLSLSILSPLVSAWPLVVFVLLATLVASGLSGW
FT                   LLMRYSELPGTTGTWGASPGGASAMVAMAADFGADVRLVAFMQYLRVLMVTAAAAFVAS
FT                   AGIGSNAAAHNGMLEWFPSLSWHFPATLLVAFSSAWLARRLRIPSGQLLGPMLVGAMLH
FT                   STGTLTLQTPEWLLALAYAFIGWSIGLAFTRSVFLLALRTLPKMMVSIVTLMLLCGGMA
FT                   LMLAHLLQVDMLTAYLATSPGGLDSIAIIAASSRVDMAFVIAMQTLRLFSTLIFSPILS
FT                   RYISRHAVVGAA"
FT   gene            complement(270399..271319)
FT                   /locus_tag="Dd703_0239"
FT   CDS_pept        complement(270399..271319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0239"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   eca:ECA4175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84056"
FT                   /db_xref="GOA:C6C7D8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7D8"
FT                   /inference="protein motif:TFAM:TIGR00688"
FT                   /protein_id="ACS84056.1"
FT                   /translation="MNVQQHRQGVGYALGAYIIWGIAPVYFKLLSAIPPNEILSHRIIW
FT                   SFFFMLLLLSLSRKWGVVRQALRHPRQLLLLAVTALLVACNWLIYIWAVNNNHILEASL
FT                   GYFINPLINVLLGMLFLGERFRPMQWLAMLLAAFGVLVQLWTFGSLPVIALSLAFSFGF
FT                   YGLLRKKIGIDGQTGMLVETLWLLPAAMIYLLLFADSPTSHVMQNPPSLTLLLMMAGVV
FT                   TTVPLLLFTAAAMRLRLSTLGFFQYLGPTLTFLLAVVVYGETISVDRLITFGFTWLALI
FT                   IFIADALYTQRRLRRADNRVTRNIA"
FT   gene            complement(271394..271864)
FT                   /locus_tag="Dd703_0240"
FT   CDS_pept        complement(271394..271864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0240"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   eca:ECA4174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84057"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7D9"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACS84057.1"
FT                   /translation="MENMILTPDSVHQYVSELFVHQMPFNQELGLELITFTPDSATLRF
FT                   RHQPRLEGNVLQHILHGGVIAAGLDVAAGLVCVGHALLRHPQLTEQELRRRLSRMGTID
FT                   LRVDYLRPGYGDLFTLTSHLMRGGNKIAVARAELHNERHQHIASAVATYIVG"
FT   gene            272077..272946
FT                   /locus_tag="Dd703_0241"
FT   CDS_pept        272077..272946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0241"
FT                   /product="Phospholipase A(2)"
FT                   /EC_number="3.1.1.4"
FT                   /note="PFAM: phospholipase A1; KEGG: eca:ECA4173
FT                   phospholipase A"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84058"
FT                   /db_xref="GOA:C6C7E0"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7E0"
FT                   /inference="protein motif:PRIAM:3.1.1.4"
FT                   /protein_id="ACS84058.1"
FT                   /translation="MRKTGVMAVALLMTAQVQAQDATTRKTDTGEAAQGSIIRGLLQKY
FT                   DTPFILYPYESNYLLYTYTSNINKQAIQSYSWSDHARKDEVNFQISLGFPLWRGIAGDN
FT                   SLLGASYTQRSWWQMSNKSESTPFRETNYEPQLFLGWATEYRFAGWTLQDVELGFNHQS
FT                   NGRADPTSRSWNRIYARLMARNGPWLVEVKPWVRLHDSEDDNPDITRYMGHYRMRIGYQ
FT                   WGDSIFSAEGRYNWNTGYGSGELGWSYPMTDHVRFYTKVFSGYGESLIDYNHRQTRYGI
FT                   GITLNDLF"
FT   sig_peptide     272077..272136
FT                   /locus_tag="Dd703_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            273050..274873
FT                   /locus_tag="Dd703_0242"
FT   CDS_pept        273050..274873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0242"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: eca:ECA4172 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase RecQ; ATP-dependent DNA
FT                   helicase, RecQ family; PFAM: DEAD/DEAH box helicase domain
FT                   protein; HRDC domain protein; helicase domain protein;
FT                   SMART: DEAD-like helicase; helicase domain protein; HRDC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84059"
FT                   /db_xref="GOA:C6C7E1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7E1"
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /protein_id="ACS84059.1"
FT                   /translation="MSTADVLNREALAAQILRETFGYQQFRPGQQAIIHAAVSGRDCLV
FT                   IMPTGGGKSLCYQIPALVLDGLTLVVSPLISLMKDQVDQLQAYGVSAACLNSTQTREQQ
FT                   MAVIAGCRSGQIRLLYIAPERLTNEGFLEQFTGWNPSLIAIDEAHCISQWGHDFRPEYR
FT                   ELGYIKQRFPQLPVVALTATADETTRNDIIRLLGLRDPLVQISSFDRPNIRYTLVEKFK
FT                   PLDQLWLFVQGQRGKSGIIYCNSRAKVEDISARLQNRGLSVGAYHAGLDNERRAQVQEA
FT                   FLRDDLQVVVATVAFGMGINKPNVRFVVHFDIPRTIESYYQETGRAGRDGLAAEAALFY
FT                   DPADMAWLRRCLEEKPASAQLDIERHKLNAMGAFAEAQTCRRLVLLNYFGENRQQPCGN
FT                   CDICLDPPKRYDGLVDAQKALSCVYRAGQRFGMGYIAEVLRGANNQRIREFGHDKLPVY
FT                   GIGKDKTQEQWISILRQLIHLGLLTQNIIQHSALQLTESARPVLRGEVPLQLAVPRTIN
FT                   LKPRASQKSYGGNYDRKLFAKLRKLRKSIADEDNIPPYVVFSDATLLEMAEVMPVTPGE
FT                   LLNINGVGQRKLERFGVPFMTLIREHLDNDE"
FT   gene            274962..275582
FT                   /locus_tag="Dd703_0243"
FT   CDS_pept        274962..275582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0243"
FT                   /product="homoserine/threonine efflux pump"
FT                   /note="TIGRFAM: homoserine/threonine efflux pump; PFAM:
FT                   Lysine exporter protein (LYSE/YGGA); KEGG: eca:ECA4171
FT                   threonine efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84060"
FT                   /db_xref="GOA:C6C7E2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7E2"
FT                   /inference="protein motif:TFAM:TIGR00949"
FT                   /protein_id="ACS84060.1"
FT                   /translation="MLMLFLTVALVHLIALMSPGPDFFFVSQTAISRSRGEALMGVLGI
FT                   TLGVVVWAAIALMGLHLLLEQMTWLHRIVTVGGGLYLCWMGWQMLSSARRHNPHQDDEP
FT                   EVALPQQGKAFIRGLITNLSNPKALIYFGSVFSLFVGDEVGAGARWGLFALISLETLLW
FT                   FSLVAVVFALPVMRRGYRRLAKWVDGVAGVLFAGFGIHLIISR"
FT   gene            complement(275738..276358)
FT                   /locus_tag="Dd703_0244"
FT   CDS_pept        complement(275738..276358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0244"
FT                   /product="homoserine/threonine efflux pump"
FT                   /note="TIGRFAM: homoserine/threonine efflux pump; PFAM:
FT                   Lysine exporter protein (LYSE/YGGA); KEGG: eca:ECA4170
FT                   homoserine/homoserine lactone efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84061"
FT                   /db_xref="GOA:C6C7E3"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7E3"
FT                   /inference="protein motif:TFAM:TIGR00949"
FT                   /protein_id="ACS84061.1"
FT                   /translation="MTQDWWLTYLITTLILSLSPGSGAINTMSTSISHGYRGAMASIAG
FT                   LQVGLGIHIVLVGVGLGALLSQSLLAFDILKWVGAAYLIWLGIQQWRSAGSLDLQALAS
FT                   SMPRRRLFRRAILVNLTNPKSIVFLAALFPQFIIPHQPQAAQYLILGVTTIAVDVIVMV
FT                   GYATLARRISSWLKGPRQMKQLNRTFGSLFMLVGALLATARKA"
FT   gene            276502..277494
FT                   /locus_tag="Dd703_0245"
FT   CDS_pept        276502..277494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0245"
FT                   /product="Lysophospholipase"
FT                   /EC_number="3.1.1.5"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: spe:Spro_0196
FT                   lysophospholipase L2"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84062"
FT                   /db_xref="GOA:C6C7E4"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7E4"
FT                   /inference="protein motif:PRIAM:3.1.1.5"
FT                   /protein_id="ACS84062.1"
FT                   /translation="MSSYLECLLTREAQFAAFVTGPLLDFWRRREEGEFAGVDGVPIRF
FT                   VRFCAPWHQRLVVIFSGRTDSYVKYAEVAYDLFQCGYDVMMMDHRGQGRSGRLLKDSHR
FT                   GHVRRFDDYVDDVATFMCQQVETKAYQRCFALAHSMGGAILSLFLARQPQVFAAAALCS
FT                   PMCGILLPMPHWLAWRILNWAERHPVMRDYYAVGTRQWRPLPYVLNALTHSYERYRRNV
FT                   RFYADDPDLRIGGPTYHWVREALLAGKRLLAQAADITTPLLLLQAEEDKVVDNRSQDAF
FT                   CRALSEAGHPSVGGVPRVIQGARHDILFETDAMRAEALGLILTHFSQFH"
FT   gene            277549..278349
FT                   /locus_tag="Dd703_0246"
FT   CDS_pept        277549..278349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0246"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: eca:ECA4168 putative sugar
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84063"
FT                   /db_xref="GOA:C6C7E5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7E5"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACS84063.1"
FT                   /translation="MYPIVASDLDGTLLSPDHTLSPFAKETLRLMTERGIHFVFATGRH
FT                   HMDVAQIRDNLAITAFMITSNGARVHNTEGELVFSHNLDRDIAQDLYAMVYHHPDILTH
FT                   VYRDDEWFLCRSRPEEERFFTESVFRYTLFDPDTLGTDGVGKVFFTCEDHDKLLLLEEA
FT                   LNARWGDRVNVSFSTLSCLEVMAGGVSKGHALEQVAKILGHTIKDCIAFGDGMNDYEML
FT                   SMAGKGCVMGNAHQRLKDVLPGNDVIGTNIDDAVPRYLRKLYLA"
FT   gene            complement(278468..279820)
FT                   /locus_tag="Dd703_0247"
FT   CDS_pept        complement(278468..279820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0247"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /note="TIGRFAM: glycerol-3-phosphate transporter;
FT                   phosphoglycerate transporter; PFAM: major facilitator
FT                   superfamily MFS_1; KEGG: eca:ECA4166
FT                   sn-glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84064"
FT                   /db_xref="GOA:C6C7E6"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7E6"
FT                   /inference="protein motif:TFAM:TIGR00712"
FT                   /protein_id="ACS84064.1"
FT                   /translation="MLSIFKPATHRPRVAEHQVDPLYRRLRWQIFLGIFFGYAAYYLVR
FT                   KNFALAMPYLIEQGFSRGDLGFALSGISIAYGFSKFIMGAVSDRSNPRIFLPAGLILAA
FT                   VVMLLMGFVPWATSSIMIMFALLFVCGWFQGMGWPPCGRTMVHWWSQKERGGIVSIWNC
FT                   AHNVGGGIPPLLFLLGMAWFNDWKAALYMPAFGAILVALFAFALMRDTPQSCGLPPIEE
FT                   YKNDYPADYTEKDEQELTAKEIFMQYIFPNKLLWYIAVANVFVYLLRYGILDWSPTYLR
FT                   EVKHFALDKSSWAYFLYEYAGIPGTLLCGWMSDKVFKGNRGATGVFFMTLVTIATVIYW
FT                   LNPAGNPTVDMACMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVA
FT                   ASAIVGYTVDFFGWNGGFMVMIAGSAMAVVLLFLTMINEKKHKEALAERTA"
FT   gene            280130..281788
FT                   /locus_tag="Dd703_0248"
FT   CDS_pept        280130..281788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0248"
FT                   /product="glycerol-3-phosphate dehydrogenase, anaerobic, A
FT                   subunit"
FT                   /note="TIGRFAM: glycerol-3-phosphate dehydrogenase,
FT                   anaerobic, A subunit; PFAM: FAD dependent oxidoreductase;
FT                   BFD domain protein [2Fe-2S]-binding domain protein; KEGG:
FT                   eca:ECA4165 sn-glycerol-3-phosphate dehydrogenase subunit
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84065"
FT                   /db_xref="GOA:C6C7E7"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7E7"
FT                   /inference="protein motif:TFAM:TIGR03377"
FT                   /protein_id="ACS84065.1"
FT                   /translation="MANTDLRRETDVIIIGGGATGAGTARDCALRGLRCLLLERHDIAT
FT                   GATGRNHGLLHSGARYAVTDAESARECIEENQILRRIARHCIEPTDGLFLTLPEDDLHY
FT                   QSTFIDACRQAGINAQAIDPQEALLLEPAANPTMIGAVRVPDGTVDPFRLTAANMIDAC
FT                   EHGAEVLTYHEVTGLIRQGDRVIGVRVFDHKRGLAGEIYAQVVVNAAGIWGQRIAEYAD
FT                   LRVRMFPAKGALLILGHRINNRVINRCRKPADADILVPGDTISLIGTTSTRIDYDQIDN
FT                   MTVTPQEVATLIREGSMLAPQLAHTRILRAYAGVRPLVASDSDPSGRSVSRGIVLLDHA
FT                   ERDGLEGFVTITGGKLMTYRLMAEWVTDKVCEKLGHAVAGTTASRPLPGSETRAADAPA
FT                   IASDLPAPLRGSILYRHGQRAIPLIAGPLADSSLVCECEAVTAGEVRYAVDSLQVNNLT
FT                   DLRRRTRVGMGTCQGELCACRAAGLLYRLGQSTPQQSVGQLSRFLNERWKGMRPVAWGH
FT                   TLRESEFTSWIYQGLCGLTGSDIPAVQKEENDHAL"
FT   gene            281778..283034
FT                   /locus_tag="Dd703_0249"
FT   CDS_pept        281778..283034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0249"
FT                   /product="glycerol-3-phosphate dehydrogenase, anaerobic, B
FT                   subunit"
FT                   /note="TIGRFAM: glycerol-3-phosphate dehydrogenase,
FT                   anaerobic, B subunit; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein; FAD dependent
FT                   oxidoreductase; KEGG: eca:ECA4164 anaerobic
FT                   glycerol-3-phosphate dehydrogenase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84066"
FT                   /db_xref="GOA:C6C7E8"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7E8"
FT                   /inference="protein motif:TFAM:TIGR03378"
FT                   /protein_id="ACS84066.1"
FT                   /translation="MRYDVIIIGGGLAGLTCGIRLQEQGKRCALVSVGQSALHFASGAL
FT                   DLLAALPDGTPVGEPLAALAPLTVQAPNHPYSLLGAEQIALLAPQAQVLLERCGLALRG
FT                   DSERNHQRLTLLGKWQPCWLSPMDGVMRGLPGTSAWQRPLVAGIEGFLDFQAPLLSGAL
FT                   CAQGIDAQCEDLRLPMLDKLRQNPSEFRSLSIARVLETHAGIELLAEELSRLISDRDSV
FT                   ILPACLGMQPSSVARLNSALGKPVGLLATLPPSLPGMRLHQALLSRFRAVGGTVMAGDR
FT                   VTGASFQAQGIEVATRAHGDIPLRATKVVLASGSFFSNGLVAEQQRVVEPVFGLDVDFA
FT                   PEHENWSMADVFAAQPYLQFGVKVDEHLHPMIQGETQPHLYAIGSVLRGYDPLRQGCGG
FT                   GVSMLTALSVANDVLRENP"
FT   gene            283034..284236
FT                   /locus_tag="Dd703_0250"
FT   CDS_pept        283034..284236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0250"
FT                   /product="glycerol-3-phosphate dehydrogenase, anaerobic, C
FT                   subunit"
FT                   /note="TIGRFAM: glycerol-3-phosphate dehydrogenase,
FT                   anaerobic, C subunit; PFAM: protein of unknown function
FT                   DUF224 cysteine-rich region domain protein; KEGG:
FT                   eca:ECA4163 sn-glycerol-3-phosphate dehydrogenase subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84067"
FT                   /db_xref="GOA:C6C7E9"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7E9"
FT                   /inference="protein motif:TFAM:TIGR03379"
FT                   /protein_id="ACS84067.1"
FT                   /translation="MSQTDNSFEQCIKCTVCTTACPVARVNPDYPGPKQAGPDGERLRR
FT                   KDPSLFDEALKFCTNCKRCEVACPSDVKIGDIIQRAKANHSRHKPGLRDAILSHTNLMG
FT                   SLSTPFAPLVNAATGMKPMRMLLDKVLKIDHRRELPKYSSGTFRQWYRKQAARQRQFAE
FT                   QVAYFHGCYVNYNHPQLGRDLIRVFNAAGVGVQLLTKEKCCGVALIANRFLDKARKQAH
FT                   FNLASLDEAINTRGLPVIATSSSCTFTLRDEYPHLLGIDNQQVRDGIELATRHLYRLLE
FT                   QGKTLPLRPLPMKVVYHTPCHLERMGWTAYTLDLLRRIPGLELQVLDSQCCGIAGTYGF
FT                   KKENYDAAQNIGAPLFRQIEESGADLVITDCETCKWQIEMSTSKVCEHPFSLLAKALPP
FT                   E"
FT   gene            284842..285537
FT                   /locus_tag="Dd703_0251"
FT   CDS_pept        284842..285537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0251"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: eca:ECA4162
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84068"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7F0"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ACS84068.1"
FT                   /translation="MIYLRQANDRGHANHGWLDSWHTFSFADYYDPDFMGFSALRVINE
FT                   DWIEAGQGFGTHPHRDMEILTYVLEGAVEHQDSMGNKEQVPAGEFQIMSAGTGIRHSEY
FT                   NARQDSVLHLYQIWIIPEQTGLTPRYEQRRFDALEGRQLVLSPDARDGSLKVFQDMTLW
FT                   RWALKPQEQAEYRIESGRHVWIQVVRGSIEVGGQHAVTSDALAVWAEEAITLRASEQSE
FT                   ILLFDLPPV"
FT   gene            complement(285677..286465)
FT                   /locus_tag="Dd703_0252"
FT   CDS_pept        complement(285677..286465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0252"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   plu:plu0187 CpmF protein involved in carbapenem resistance"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84069"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7F1"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACS84069.1"
FT                   /translation="MPAEIKINGGSYYVGGIFGNKDFASHANTSLSPFYMTTTEIDYNR
FT                   YMQVYSQAKPLGYSVNPGCNGGDVDDCLPPETDHGRHPVTTVSWWDAIIFANALSVMNH
FT                   LTPNYLWADGRPINAAPADNNRDIRRDADATGFRLPTLNEWQVAARGGEIGLKHGSYGQ
FT                   RFSGSNAAETVANMPTEKTTEFHTQPVGSRRANPLGLYDLTGNVSEWLDDDVHMPGLNN
FT                   MHYFCGGSYLMKVNNVSECDVHTPNFPTSDIGFRLVRPLR"
FT   gene            complement(286909..287448)
FT                   /locus_tag="Dd703_0253"
FT   CDS_pept        complement(286909..287448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgl:SG0585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84070"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7F2"
FT                   /inference="similar to AA sequence:KEGG:SG0585"
FT                   /protein_id="ACS84070.1"
FT                   /translation="MHLKLFPLVMTLIITISAKASAQCPTEIKLVPGVNYLDLISHQKK
FT                   DLAIIATFDNNTSHPHQGLSFYIHDADSYSIIPVPDSQVFIWFDYSIAASRTKVFDYRL
FT                   YRFPQGIRLVTALKIGDDPSDRQRIELKRYAIMENHEDPGVPPYSWYIDKTVKTEQSYD
FT                   SADEIFKNTAFFCTVF"
FT   sig_peptide     complement(287380..287448)
FT                   /locus_tag="Dd703_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.959 at
FT                   residue 23"
FT   gene            287951..289579
FT                   /locus_tag="Dd703_0254"
FT   CDS_pept        287951..289579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0254"
FT                   /product="Oligopeptide transporter OPT superfamily protein"
FT                   /note="PFAM: Oligopeptide transporter OPT superfamily
FT                   protein; KEGG: vei:Veis_1103 oligopeptide transporter OPT
FT                   superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84071"
FT                   /db_xref="GOA:C6C7F3"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7F3"
FT                   /inference="protein motif:PFAM:PF03169"
FT                   /protein_id="ACS84071.1"
FT                   /translation="MNQLSSSDVNAGSHTGAHPRAFAPGTLLLLLALSIFGAIVGVQLL
FT                   TTLGVTPNTSIIGAMMAMIVARIPLQSMARFRSVHIQNLAQSATSAATFGAANSLLLPI
FT                   AIPWLFGRQDLVMPMFFGVALAMLLDGYMLYRLFNTRIFPAEGAWPPGIAVAESIKAGD
FT                   KGGRQAGLLGIGIAIGVFGAWLKFPIAALGTAFIGNIWALAMLGIGFLLRGYSLPLLGV
FT                   DINQHYIPHGIMAGAGVVALFQIIKLMRNRDGGGSAVNQTQTQALSASQGEAIGKTMRL
FT                   GAVGFIVISALIALGSGLFSQMSLPWILAFVLYAALAAFLHEVIVGLAAMHSGWFPAFA
FT                   VALITLLIGILIGFPPEALVMLCGFSAATGPAFADMGYDLKAGFILRGRDSVSRFELEG
FT                   RKQQLLAALLAFVVAIPVVFFIYREYFSAGLVPPVAKVYVAAIQAGVSPDIAKSLLLWA
FT                   IPGALIQLIGGPGRQMGVLLATGLLINNPLAGWAVMIGILIRVVVLRVKGDAARNLMEV
FT                   LAAGLIAGDALFSFFNSMLSPGRKK"
FT   gene            289634..290575
FT                   /locus_tag="Dd703_0255"
FT   CDS_pept        289634..290575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0255"
FT                   /product="protein of unknown function DUF1177"
FT                   /note="PFAM: protein of unknown function DUF1177; KEGG:
FT                   vei:Veis_1102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84072"
FT                   /db_xref="InterPro:IPR009561"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7F4"
FT                   /inference="protein motif:PFAM:PF06675"
FT                   /protein_id="ACS84072.1"
FT                   /translation="MSLHQTLKVFELLDSAYASGETVRQLFSAYDKVDVAVTEIAGPKG
FT                   KTDFVKIVIPGAQGKRQGGTAPTLGVVGRLGGIGARPGRLGIVSDGDGAVAAVATALKL
FT                   AEMQKQGDTLTGDVIVTTHICPDAPTRPHEPVDFMDSPVETETMNEQEVSEEMDAVLSI
FT                   DTTKGNRIINHKGFALSPTVKQGYILRISEDLLQIMEMTTGQLPVTFPITTQDITPYGN
FT                   GVYHLNSILQPSIATTAPVVGVAITSVSAVPGCGTGASHEVDIAAASRFAVEVAKAFTR
FT                   GNCQFYSREEYARLVQLYGAMSHLQLRQPAGA"
FT   gene            290577..291257
FT                   /locus_tag="Dd703_0256"
FT   CDS_pept        290577..291257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0256"
FT                   /product="AroM family protein"
FT                   /note="PFAM: AroM family protein; KEGG: spe:Spro_1025
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84073"
FT                   /db_xref="InterPro:IPR010843"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7F5"
FT                   /inference="protein motif:PFAM:PF07302"
FT                   /protein_id="ACS84073.1"
FT                   /translation="MSGIRLATLTIGQAPRADITPILEAALPEGVSCRHAGVLDGLGID
FT                   DIERRFAPVAGEAVLTSRLLDGQAVVMGKTAVKHAVQDKIDLLEQEGCQIIALLCTGEF
FT                   HGLTTQGAWLIEPDHLLPPTLGALVAGRRVGVMVPLAEQVSSEQQKWRGLRQSPVFAVA
FT                   SPYTATEHEIADAARSLQQQGADVIVMDCMGFTGWHRNAAHRQTNLPVVLSNGLLAALL
FT                   AALL"
FT   gene            291285..291980
FT                   /locus_tag="Dd703_0257"
FT   CDS_pept        291285..291980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0257"
FT                   /product="Dipeptidase E"
FT                   /EC_number="3.4.13.21"
FT                   /note="PFAM: peptidase S51 dipeptidase E; KEGG:
FT                   sek:SSPA3737 peptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84074"
FT                   /db_xref="GOA:C6C7F6"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR023172"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7F6"
FT                   /inference="protein motif:PRIAM:3.4.13.21"
FT                   /protein_id="ACS84074.1"
FT                   /translation="MELLLLSNSSLPDQPYLQHAVEPIGQQLAGRRKVLFVPFAGVTQS
FT                   WDAYTDKVRQALSALELDIVGIHTVEDPLAAVQSAEAIMVGGGNTFVLLKQCRERHLLG
FT                   AIRRRVQQGAPYIGWSAGANLACPSIRTTNDMPIADPGGFDALDLLAWQINPHFTNALP
FT                   AGHQGETREQRIRELLCVEPALSVIGLPEGNWIQVSGEHAYLAGPNPTWLFRAGQAAQP
FT                   LPTGLLTLG"
FT   gene            complement(292518..293528)
FT                   /locus_tag="Dd703_0258"
FT   CDS_pept        complement(292518..293528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0258"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:blr1357 peptide ABC transporter
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84075"
FT                   /db_xref="GOA:C6C7F7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7F7"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACS84075.1"
FT                   /translation="MSKEKILDVIGLKKTFRTHTGGWLGTATHTVTAVDNVSFSLYRGE
FT                   TLGIVGESGCGKSTTARMIIGLLNPSAGQVRFHDRDVHQGERADRQQITRQLQMVFQDP
FT                   FSSLNPRHNVNTLLSEPFEIHRPELSRAQVRQAVVELLALIGLDDSALNKYPHEFSGGQ
FT                   RQRLNIARAIALRPEIIICDESVSALDVSIQAQILNLLKKLQSELGLTYLFVSHDLSVV
FT                   RYISDRIAVMYLGRIVEIGDCETVYQDPKHPYTRLLFSAIPADSPRHKKPRPPQPDGDL
FT                   VMPPAGHQGCAFYARCDHASPRCLSPVPDITLDDGRRVACHRYDVDAHTPSDSAA"
FT   gene            complement(293525..294502)
FT                   /locus_tag="Dd703_0259"
FT   CDS_pept        complement(293525..294502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0259"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bar:GBAA4733 oligopeptide ABC transporter,
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84076"
FT                   /db_xref="GOA:C6C7F8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7F8"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACS84076.1"
FT                   /translation="MTPLLEIRNLTVDFTTGKRAARVIDGLSLSLQPGEILAIVGESGS
FT                   GKSVTALSVMGLLPAQAALGAQSQILFNGLDLRTLSAAQMRALRGKDIAMIFQDPMSSL
FT                   DPCYTIGEQIIETLRAHRSISRADAFQEALALLKQVRLTEPERRMKQYPHELSGGMCQR
FT                   VMIAMALCTKPRLLIADEPTTAVDVTIQAQILALLRELNETLGIGIIMITHDLGVVAEL
FT                   CHRVLVMYAGACVEYSDVDTLFTAPAHPYTLGLMNSRPTLTRLGQPLTPIEGNPPDLFR
FT                   RLPGCQFAARCTYAVAECRQSAPTLVSPTHGHQVACFLVEEKHP"
FT   gene            complement(294505..295674)
FT                   /locus_tag="Dd703_0260"
FT   CDS_pept        complement(294505..295674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0260"
FT                   /product="amidohydrolase"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase
FT                   dimerisation domain protein; peptidase M20; KEGG:
FT                   scl:sce8630 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84077"
FT                   /db_xref="GOA:C6C7F9"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017144"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7F9"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACS84077.1"
FT                   /translation="MIDSINTIATTLSDDLINAAHFIHANPELGLEETKAQATLVELLR
FT                   KYGFSVTTGLAGMDTSFVAEFSTGAGPTIAYLSEYDALPGIGHACGHNIIGTAGVGAGL
FT                   ITKQIMEQRNLSGTVKVYGTPAEEIGIGKIRMIDAGLFAGVDAAMLMHPSDTAMADDIS
FT                   FANYTFEYHFTGSPAHAAAYPWEGRNALSGVIEMFNAVNALRLHVRDFCRINGIITEGG
FT                   VASNIIPASAKALFNLRALDGETLKTVIEKVHNCAKGAALATDTEVAITQIGLGTKEIR
FT                   NNKRIVSLVASHFDAFGVPHIPRDLTQGIGSTDMANVTHEIPAVQSYIGIGKEAGATHT
FT                   LSFAKAAGSATGDRAVIDAAKVMAASGLQMMTDPALLADVKAEFDQRRK"
FT   gene            complement(295686..296516)
FT                   /locus_tag="Dd703_0261"
FT   CDS_pept        complement(295686..296516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0261"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0030 oligopeptide ABC
FT                   transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84078"
FT                   /db_xref="GOA:C6C7G0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7G0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS84078.1"
FT                   /translation="MDVLQRFCRNRMALAGLIVIIAIVLMALLAPWLAPHDPNQMNLGF
FT                   SLKKLGTPGSPLGTDNYGRDILSRLIYGSRISILIAFVAIAIGGLLGTVLGLVAGHFGG
FT                   WVDSAIMRLMDALFAFPSVLLAIALMTVLGDGIINLIIAISIVNVPNFARIIRGEALAI
FT                   KKESYIDVVRTLGAGHARIIFRHILPNTIAPLIVYGTMSIAGAILSEAALSFLGLGIQP
FT                   PTATWGNMLRDGQEFLRIDSTMTLTAGFAILITVLAFNLVGDGFREALDPKLKK"
FT   sig_peptide     complement(296427..296516)
FT                   /locus_tag="Dd703_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.777) with cleavage site probability 0.471 at
FT                   residue 30"
FT   gene            complement(296516..297478)
FT                   /locus_tag="Dd703_0262"
FT   CDS_pept        complement(296516..297478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0262"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dde:Dde_1184 dipeptide ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84079"
FT                   /db_xref="GOA:C6C7G1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7G1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS84079.1"
FT                   /translation="MIRFLANRILQTIVVLFLVATVVFLITRIIPGDPATIMLGPQASV
FT                   EAVHELRVKLGLDRSLLTQYLLFLRDLLRGDLGYSIYYGDSVINLILERLPNTLLLGGF
FT                   ALTLALLVAIPAGIISAVRQHSLFDYASVLFALIGVSMPVFWLGLLLVLLFSVRLAWLP
FT                   ATGMGDWDDGFMDVLGHLILPGVALSTVPMATFVRITRTAMLEVINAPYIRTARAKGLS
FT                   EFSVIGKHAFRNAFNPILTVLGIQISTLLSGAVLTETIFAWPGMGRLIISSIEKRDFMV
FT                   VQGTIMFTALIFVVVNTCVDLLYVVVNPKIGLNNPRGDA"
FT   gene            complement(297495..299045)
FT                   /locus_tag="Dd703_0263"
FT   CDS_pept        complement(297495..299045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0263"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bha:BH0031 oligopeptide ABC transporter
FT                   (oligopeptide-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84080"
FT                   /db_xref="GOA:C6C7G2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7G2"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACS84080.1"
FT                   /translation="MNKRLLMLIAGVASTTLLTLGNTSYAASQNLNIGLEAVPRTLDPV
FT                   KYTGTYESDVMMNIFNTLVYYDKDLKSIIPGLATQWQVSPDLKEYTFTLRDDVYFQPGK
FT                   FQPGRKMTAEDVRYSLLRSAKESVMKRARMVQDVQVLSPTQVKVTLSQPNAAFLAVLTD
FT                   IGNAIVPQEEVTGQGDGFGLHPVGTGPFLLKEWNKDEKISLARFDKYFDHDVKLNKVVW
FT                   KFIPDLNMMTNALLTGEIDIASNIDGPNRKTVQDNDKTRLLSVPGMNITFSAMNLKDGP
FT                   TKDVRVRQAILKAVNVNDIVSGIFQWGGGTRSYSPLPKSSWGYWDDANSTAMAQDLEGA
FT                   KKLMAEAGYANGFQATLVTPQDPDRIKAATIMQQQLKSIGIDLSIKSMEWGSFSESVTK
FT                   GQPTFYNLSWSWYPDPDFFLYQMFSSKQIGSLGNGQGYSNPDVDTLLTAAVGKSSDQQE
FT                   RRALYQQVQQKVLADSPRVELWTKDFVNGVSRKVQGYQVSPDGLLRIATPDTHVTVNK"
FT   sig_peptide     complement(298965..299045)
FT                   /locus_tag="Dd703_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 27"
FT   gene            299652..300422
FT                   /locus_tag="Dd703_0264"
FT   CDS_pept        299652..300422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0264"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   cti:RALTA_A1843 putative transcription regulator, IclR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84081"
FT                   /db_xref="GOA:C6C7G3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7G3"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACS84081.1"
FT                   /translation="MSILNSAAAVLQLMSRLKRSVTVSDVVEHLGYPKSTASRLLKQLS
FT                   ETGFLDRDSRTLAYQPSLLLLEVTYLVRHNSNLSDHIEQVLQRLCQQTGHTGYISMLSG
FT                   HDVLVLRVVPGVHALRVITHPGTRSPAWGTSTGRALLAYLPESELARQYRPVLAPEKAA
FT                   AMSFAALEEKVRVIAQRQWASAVDESVPGAASVSCAVSDPHSGETLAFCLTFPSSIADE
FT                   QEIANLAELVSQAARQVGKTVGDPRWLTGDYVAE"
FT   gene            300571..301566
FT                   /locus_tag="Dd703_0265"
FT   CDS_pept        300571..301566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0265"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: spe:Spro_4652 LacI family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84082"
FT                   /db_xref="GOA:C6C7G4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7G4"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS84082.1"
FT                   /translation="MKKKRPVLQDVADRVGVTKMTVSRYLRDPALVSAALQGKIAAALD
FT                   ELGYIPNRAPHILANDTSRAIGILLPSLTNQVFAEVLRGIERVTEARGYQTMLAHYGYL
FT                   PEMEEKRLMSLLSFHIDGLILAERRHTARTRQMIAVAGIPVVELMDSVSPCLDMAVGFD
FT                   NVAAARHMTEHMIASGRRHVVYLGARLDERTLMKQQGYEQAMQAAGLRCHSVMIENPSS
FT                   YTIGGDLFRRARVEYPAMDSVFCTNDDLAIGAMFECQRQGIRVPEEIGIAGFHGHDIGQ
FT                   VTVPRLTSILTPRERIGETGATQLLARLNGETVEHPIVDVGFSIQQGESL"
FT   gene            complement(301708..302235)
FT                   /locus_tag="Dd703_0266"
FT   CDS_pept        complement(301708..302235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0266"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: eca:ECA1839 gluconokinase; TIGRFAM:
FT                   carbohydrate kinase, thermoresistant glucokinase family;
FT                   PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84083"
FT                   /db_xref="GOA:C6C7G5"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7G5"
FT                   /inference="protein motif:TFAM:TIGR01313"
FT                   /protein_id="ACS84083.1"
FT                   /translation="MSGQSIILMGVSGSGKSSVGAGLAKRIGAKFIDGDDLHPRANIQK
FT                   MAGGQPLNDDDRAPWLQRLNDAAYSLYHKNETGIIVCSALKKRYRDLLRADNEGMVFIH
FT                   LNGSFELVLQRHQARAGHFMPTELLKSQFDALEEPGTDEADVLSVSIDGSLDQVVEHCV
FT                   AALQAYQARQSA"
FT   gene            302496..303812
FT                   /locus_tag="Dd703_0267"
FT   CDS_pept        302496..303812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0267"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: yen:YE4021 putative
FT                   gluconate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84084"
FT                   /db_xref="GOA:C6C7G6"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7G6"
FT                   /inference="protein motif:TFAM:TIGR00791"
FT                   /protein_id="ACS84084.1"
FT                   /translation="MPLVIVAVGVALLLVLMIRFKLNGFIALILVALAVGVMQGMPVNK
FT                   VIASIKSGVGGTLGSLALIMGFGAMLGKMLADCGGAQRIATTLIDRFGRKHIQWAIVLT
FT                   GFTVGFALFYEVGFVLLLPLVFSIVASARIPLLYAGVPMAAALSVTHGFLPPHPGPTAI
FT                   ASLFHADMGKTLLYGTLLGIPTVILAGPVYARFLKKIDKPVPEGLYNPKQFTEEEMPSF
FT                   SISVFTALVPVLLMALRAVAEMVLPKGHAFLAYAEFFGDPVMATLIAVLIAIFTFGLNR
FT                   GRSMDEVMSTITDSIKIIAMMLLILGGGGAFKQVLVDSGVDKYIAGMMHDSGVSPLLLG
FT                   WLIAAVLRLALGSATVAALTAGGIVAPIIATSGVSPELMVIAVGSGSVIFSHVNDPGFW
FT                   LFKEYFNLTIGETLKSWSALETIIAVCGLVGCLLLGMVV"
FT   gene            complement(303916..304509)
FT                   /locus_tag="Dd703_0268"
FT   CDS_pept        complement(303916..304509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0268"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; Integral membrane protein TerC; KEGG: eca:ECA4157
FT                   dITP- and XTP- hydrolyzing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84085"
FT                   /db_xref="GOA:C6C7G7"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7G7"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ACS84085.1"
FT                   /translation="MTEMISATVLLLLIMDPLGNLPIFMSVLKHLDPKRRRKVLIREMI
FT                   IALAVMLVFLFAGEKILAFLNLRTETVSISGGIVLFLIAIRMIFPSQEGFTSGLPAGDE
FT                   PFLVPLAIPMVAGPSILAALMLLSHQYPNQLPHLTLALFIAWAITITVLLLSNLFLRLL
FT                   GDKGVNALERLMGLVLVMISTQMFLDGIRAYLKL"
FT   gene            304684..305784
FT                   /locus_tag="Dd703_0269"
FT   CDS_pept        304684..305784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0269"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: eca:ECA4155 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase
FT                   dimerisation region; Semialdehyde dehydrogenase NAD -
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84086"
FT                   /db_xref="GOA:C6C7G8"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7G8"
FT                   /inference="protein motif:TFAM:TIGR01745"
FT                   /protein_id="ACS84086.1"
FT                   /translation="MKNVGFIGWRGMVGSVLMQRMVEERDFDLIRPVFFSTSQHGQPAP
FT                   TLGGHQGVLHDAYNLEALRALDIIITCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMK
FT                   DDAIIILDPVNLGVIKSGLDNGIKTFVGGNCTVSLMLMSLGGLFANDLVEWASVATYQA
FT                   ASGAGARNMRELLVQMGQLNAEVASELSDPASAILDIERKVTALSRGGLAVENFGVPLA
FT                   GSLIPWIDKQLENGQSREEWKGQAETNKILNTASTIPVDGLCVRIGALRCHSQAFTLKL
FT                   KKDVSIPEIEQMLATHNDWVKVVPNDREITMRELTPAAVTGTLSTPVGRLRKLNMGPQY
FT                   LSAFTVGDQLLWGAAEPLRRMLRILL"
FT   gene            complement(305880..306941)
FT                   /locus_tag="Dd703_0270"
FT   CDS_pept        complement(305880..306941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0270"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   pde:Pden_1080 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84087"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7G9"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACS84087.1"
FT                   /translation="MPTLIAVSGVGGKSPAAFMVEVDGFRLMLDLGEGPRPGQLPDIGE
FT                   LPPPDAICLSHAHIDHCGGLILREAWGYPPVYATERVWRQIPATWVAEEDRRILPEHGR
FT                   CEIGPVLMITGRSGHSPGGIWMHVVAGGGLTYTGDWSTESSLFPFDLPPEAALLITDAS
FT                   YGDRAQSLAEQKAIMLQACRDGALIGVPGWGRAPDMALYLMEYGVVPRLCSQVQQEIKL
FT                   LIDSQIPYLRQYLHHLLSHQSARPYRPDDVIICSDGTASSGLSAALRSQADRFHFIFSG
FT                   QIPYSSPAMMMLQAGRARWLPWNVHPRLSDQLMLANLTHAQTVIPAFIEPHNASQIEEQ
FT                   LAGRVSWQTEHVF"
FT   gene            307333..307740
FT                   /locus_tag="Dd703_0271"
FT   CDS_pept        307333..307740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0271"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="PFAM: NikR nickel binding; CopG domain protein
FT                   DNA-binding domain protein; KEGG: azo:azo3128 nickel
FT                   responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84088"
FT                   /db_xref="GOA:C6C7H0"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7H0"
FT                   /inference="protein motif:PFAM:PF08753"
FT                   /protein_id="ACS84088.1"
FT                   /translation="MQRLTISMDDQLAADFDDLMARKGYANRSEAFRDMLRRELGEMTV
FT                   ASDRNGECVAVLSYVYDHHERQLSSRLAGMQHDHHSLTVSTMHTHLSHDECVETVILRG
FT                   QTWQVEQFAEQVIAETGVRHGRLNLIPLYLE"
FT   gene            308122..308898
FT                   /locus_tag="Dd703_0272"
FT   CDS_pept        308122..308898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0272"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; UbiE/COQ5
FT                   methyltransferase; Methyltransferase type 12; KEGG:
FT                   msu:MS0467 SmtA protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84089"
FT                   /db_xref="GOA:C6C7H1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7H1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACS84089.1"
FT                   /translation="MSQLAIENDQPLLDDVQRYWRGRAADYSQINIGELAMPKRAVWLA
FT                   KILEQAPQKPVLRVLDIGTGPGFFAVTLALAGHRVTAVDVTQAMLDQARANAAHYRTTI
FT                   DFVHSDVHALPFADNGFDLVVSRNVTWNLTDPQRAYQEWRRVLAPGGRLINFDANWYLQ
FT                   LFDASSRRGYLADRANAREQGLDDHYVNTDTQAMEAIARQLPLSREQRPAWDSAALLAC
FT                   GFRRIWLETDVGDALWDETEKVNYASTPMFMVCAEK"
FT   gene            308909..310486
FT                   /locus_tag="Dd703_0273"
FT   CDS_pept        308909..310486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0273"
FT                   /product="nickel ABC transporter, periplasmic
FT                   nickel-binding protein"
FT                   /note="TIGRFAM: nickel ABC transporter, periplasmic
FT                   nickel-binding protein; PFAM: extracellular solute-binding
FT                   protein family 5; KEGG: pmr:PMI2947 ABC transporter.
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84090"
FT                   /db_xref="GOA:C6C7H2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR011980"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7H2"
FT                   /inference="protein motif:TFAM:TIGR02294"
FT                   /protein_id="ACS84090.1"
FT                   /translation="MTLTRWLLVLLLAALALYGVSALATPTDNILNYASTKDIRDINPH
FT                   LYGGEMAAQNMVFEPLVINTDQGVKPWLAQRWDISPDGLHYRFYLRPGVTFSDGEPFNA
FT                   QAVKLNIDAVLANLPRHAWLELARQIDQVSVVDALTLDITLKNPYYPTLIELGLTRPFR
FT                   FLSPRCFNHGQTKDGVRCYAGTGPWLLAQHVTQQYARFDANPHYWGAKPALAGVEWRVI
FT                   PDGQSLLLALRKGDIQLIFGADGDMLDGDNFAALQASGQFRTAISEPVASRALVLNSSR
FT                   PIVADQRLRQALQYAVDKEAIAQGVMAGGESVAQTLLARSVPYADIPDLPVYAYDPARA
FT                   AALLDEAGWRREGNGIRSKQGMPLRLVFSYNSNNANERAIAEVIQSQFRQVGVELVLLG
FT                   EEKQAYLDRQKSGDFDLQYSLSWGKPYDPQSYVSSFRIPAHADYQGQKGLPDKAEIDRM
FT                   IGDVLIAHDENARRALYRQILTRLAQEAVYIPLTYSRTRAVFNQTLQGVAFNPSQYEIP
FT                   FENMSFQR"
FT   sig_peptide     308909..308983
FT                   /locus_tag="Dd703_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            310497..311435
FT                   /locus_tag="Dd703_0274"
FT   CDS_pept        310497..311435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0274"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pmr:PMI2946
FT                   ABC-transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84091"
FT                   /db_xref="GOA:C6C7H3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7H3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS84091.1"
FT                   /translation="MARYLLRRLGTMLPLVLAISLATFTLIRLSPSDPAEVALRVNAVV
FT                   PTDAAIALTRQQLGLDRPFGAQYLDWLSRALRLDFGMSFVTRQPVREALAQALPATLQL
FT                   AGAALLMVLASSLSLATLCVLQAGRWPDRLLRVLLFLLTAMPGYWAGLLLLWLAAVAWP
FT                   QLPTGGITAPGATLLPALTLALGYIGTYVRLLRNNMLHHLAQPYVTYARARGLSERRIL
FT                   WRHVLPNAGYSPLIALGMSLPKLMAGALVVENIFAWPGLGRLCVTAIFNRDYPVIQAYV
FT                   LLMALLFVLGNFLVDALQLWLDPRLRRGVIS"
FT   gene            311432..312283
FT                   /locus_tag="Dd703_0275"
FT   CDS_pept        311432..312283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0275"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pmr:PMI2945 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84092"
FT                   /db_xref="GOA:C6C7H4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7H4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS84092.1"
FT                   /translation="MMRRVGRALRGDRLACVCLLFLLLVLAAGILAPWLAPHDPLLVSW
FT                   RDKFQPPGWRYPLGADALGRCIFSRLLFGIRTTVGMALLAMSLTLLVGTMAGVLAGFFR
FT                   GRVDALLMRLCDLMLAFPAEVMIFALVGMLGPGLGNILLAVLLAKWAWYARMVRGIVMQ
FT                   YSGGGYVQYARLIGATPRYVILRHLLPVAAAELVLLATADSGAVILLLSALSFLGLGVQ
FT                   PPTPEWGAMLGDARNVMLAYPWQMLPAGCAVMLVVAAFNYLGDFFRDVLDVVRAPGGNA
FT                   DA"
FT   sig_peptide     311432..311515
FT                   /locus_tag="Dd703_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.670 at
FT                   residue 28"
FT   gene            complement(312380..314065)
FT                   /locus_tag="Dd703_0276"
FT   CDS_pept        complement(312380..314065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0276"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: eca:ECA4152 putative two-component system
FT                   sensor kinase; PFAM: histidine kinase internal region; GAF
FT                   domain protein; 5TM Receptors of the LytS-YhcK type
FT                   transmembrane region; ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84093"
FT                   /db_xref="GOA:C6C7H5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7H5"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACS84093.1"
FT                   /translation="MFDQLDLILLLLQQMCVYLVIAYLLSKTPLFIPLMQITIQLPHKL
FT                   VCYLVFSLFCILGTYFGLRIDDAIANTRAIGALLGGVLGGPAVGLLVGLTGGLHRYSMG
FT                   GMTAFACMLSTMMEGAIGGLLNHCMTRRNRVDLLFQPQVIAATALLAEILQMGILLAVS
FT                   RPFDTTFALVKNIALPMIIANSIGAAMFMRILLDRRAMFEKYTTAFSTKALKIAAKAEG
FT                   ILREGFTPQTSMRVARILYKELGVGAVAITDREKLLAFIGIGEDHHIVGSLISSPHTTK
FT                   AIELNQVVYADGSEQPFRCPHSPRCRLGSTLVIPLRGEAQQVLGTIKLYEPKNRLFSSI
FT                   NRTLGEGIAHLLSAQIFAGRFEQQKLLLIQSEIKLLHAQVNPHFLFNALNTLSTVIHRN
FT                   PEHARSLVLSLATFFRKNLKRSGDEVSLGDELEHVNAYLDIEQARFANHLTVQINIPRV
FT                   LMMARLPAFSLQPLVENAIRHGISHMLEDGVLRIEARPHANCLEVTVEDNAGAYHPRNG
FT                   SDGLGMNLVDRRIKAHYGCGYGITVNSEPDHFTQVRIRVPLQLG"
FT   gene            314638..316821
FT                   /locus_tag="Dd703_0277"
FT   CDS_pept        314638..316821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0277"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: eca:ECA4151 glycogen branching enzyme;
FT                   TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM: alpha
FT                   amylase all-beta; glycoside hydrolase family 13 domain
FT                   protein; alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84094"
FT                   /db_xref="GOA:C6C7H6"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7H6"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ACS84094.1"
FT                   /translation="MSGFSDQRVINLLFSGHYADPFAVLGMHDTPAGLEVRALLPGALE
FT                   AHVVDAHNGRKVGKLERQDERGFFASVIPRRKHHFSYRLAVTWPRDTCIIDDPYRFGTL
FT                   LQELDVWLLAEGRHLRPFEQMGAHLRTLDGVDGACFSVWAPNAQRVSVVGDFNFWDGRR
FT                   HPMRLRRESGIWELFVPGVGVGDLYKFELIDCYGNLLLKSDPYAFESQMRPDNASLVTR
FT                   LPAPLPASPERQQANDLQSPISIYEVHLGSWRRHTDDNFWLSYRELAEQLVPYVKSMGF
FT                   THVELMPVHEHPFDGSWGYQPLGLYAPTRRFGSPEEFRQLVDAFHEAGINVLLDWVPGH
FT                   FPADSYGLARFDGTALYEYADPKEGFHQDWNTLIYNFDRHEVRNYLTGNAVYWAERFGA
FT                   DGLRVDAVASMIYRDYSRRDGEWVPNHYGGKENLEAISFLRYTNQTVGQHCPGLITIAE
FT                   ESTDYAGVTLPPEHNGLGFHYKWNMGWMHDTLAYMQLDPVHRKFHHDLLTFGMLYAYSE
FT                   NFVLPLSHDEVVHGKRSLLDRMPGDPWQKFANLRAYYGFMWAYPGKKLLFMGGEFAQGK
FT                   EWNHDISLDWHLLDEPEGWHAGVQNLVRDLNHCYCQHPPLYQCDYLHQGFEWVVVDDRE
FT                   NSVFAFIRRDNDGNEMLVVSNFTPVPREGYRIGINQPGRWREVLNTDSLHYHGGNLGNA
FT                   GAVNSEPVGSHSRPQSLVLTLPPLATLYLVREA"
FT   gene            316821..318788
FT                   /locus_tag="Dd703_0278"
FT   CDS_pept        316821..318788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0278"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="KEGG: eca:ECA4150 glycogen debranching enzyme;
FT                   TIGRFAM: glycogen debranching enzyme GlgX; PFAM: glycoside
FT                   hydrolase family 13 domain protein; alpha amylase catalytic
FT                   region; SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84095"
FT                   /db_xref="GOA:C6C7H7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR040784"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7H7"
FT                   /inference="protein motif:TFAM:TIGR02100"
FT                   /protein_id="ACS84095.1"
FT                   /translation="MTVLQAGHPYPLGAHFDGRGVNFALSSADAVGVELCLFDGAYEQR
FT                   VPMTARTDAIWHGYLPGARPGLQYGFRVDGPFDPARGLRFNRNKLLLDPCARMMMGTVR
FT                   DNERLHGGYHRPDPRDDADVMPRCVVVDERYDWRDDSFPMTPWPRTVLYEAHVRGLTKR
FT                   HPDIPQAIRGTYAALAHPVMLAYFARLGVTALELMPVHQHADEPRLQAMGLRNYWGYNT
FT                   LLPFAADNLLSASEHPLNEFRDMVRVLHKAGIEVILDVVFNHSAELDLDGPTLTLRGMD
FT                   NASYWLTDDGDYHNWTGCGNVLRLDYPATLDWVVSCMVFWRDVCHVDGFRLDLATVLGR
FT                   SPDFSSRAPFFAVLRNHPSLRDIKLIAEPWDVGPGGYQLGRFPAPFAEWNDRFRDDMRR
FT                   FWLHRDVPVGVFARRFAASSDVFDHDGRHPWASVNLLTSHDGFTLRDLVCFNHKHNEAN
FT                   GEQNRDGTNSNFSNNHGVEGEQADQETQARRHVSQRALLTTLLLSQGTPMLLAGDEFGN
FT                   SQQGNNNAYCQDNALAWLHWDQADDTLIAFTSGLIRLRRSIPVLQGGGWWRDGESDVRW
FT                   LNEQGTPMTPQDWEQGERRLQIPLSECWLLLINATEQACDFLLPAGAWRVSPPFDAVAN
FT                   PVEGRVWRGEANAVCVLVKQ"
FT   gene            318803..320086
FT                   /locus_tag="Dd703_0279"
FT   CDS_pept        318803..320086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0279"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /note="KEGG: eca:ECA4149 glucose-1-phosphate
FT                   adenylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   adenylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84096"
FT                   /db_xref="GOA:C6C7H8"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7H8"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ACS84096.1"
FT                   /translation="MVSSDKHDPLMLARQLPLKSVALILAGGRGTRLKDLTAHRAKPAV
FT                   HFGGRYRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWSFLNTEMNEFVDLLPA
FT                   QQRHDENDHWYRGTADAVCHNLDIIRRYRAEYVVILAGDHIYKMDYSRMLLDHVENGAE
FT                   CSVACIPVPIDEAKAFGVMSVDANNRILSFDEKPDHPTAMADNPDMALASMGIYVFNAE
FT                   YLYHVLEEDVCTSDSSHDFGKDLIPKIVERGQAWAHPFTLSCVTSTEDAPPYWRDVGTL
FT                   EAYWRANLDLASVMPELDMYDHHWPIRSAMEALPPAKFVQDRSGSHGLTMNSLVSGGCI
FT                   VSGSVVTHSVLFPRVRVNSFCSIDSSVLLPDVQVGRSCRLHRCVIDRACELPEGMVIGE
FT                   NAEDDSRRFYRSEEGIVLVTRAMLARIK"
FT   gene            320149..321582
FT                   /locus_tag="Dd703_0280"
FT   CDS_pept        320149..321582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0280"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PFAM: Starch synthase catalytic domain protein; glycosyl
FT                   transferase group 1; KEGG: eca:ECA4148 glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84097"
FT                   /db_xref="GOA:C6C7H9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7H9"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ACS84097.1"
FT                   /translation="MRVLHVCSEFFPLLKTGGLADVVGALPNAQIETGLDVRVLLPAFP
FT                   DVKRGIPDTQVVRELETFAGHVTIRYGHFNGVGVYLIDVPHLFERAGSPYHDTSMFAYT
FT                   DNFLRFGLLGWVGAEMASGIDPFWRPDIVHAHDWHAGLACAYLAAKGRPAKSVFTVHNL
FT                   AYQGLFDARHMADLRLPPEFFHMYGLEFYGQISYLKAGLYYADHVTTVSPTYAHEITQT
FT                   EFGYGMEGLLKAREDEGRLSGILNGVDESIWNPAHDALLTATYSRDELAKKAENKRHLQ
FT                   TAMGLKVDDRVPVFAIVSRLTNQKGLDIALQAVPELLEQGGQLVVLGAGDAVLQEGFLA
FT                   AAAEYHGRVGVQIGYHEAFSHRIIGGADVIMVPSRFEPCGLTQLYGLKYGTLPLVRRTG
FT                   GLADTVADCSLENLADGLASGFVFSDCNVASLSRAIRRVFVLWSRPSLWRYVQRQAMAM
FT                   DFSWQVAAQAYRALYQRLW"
FT   gene            321607..324054
FT                   /locus_tag="Dd703_0281"
FT   CDS_pept        321607..324054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0281"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: eca:ECA4147 glycogen phosphorylase; TIGRFAM:
FT                   glycogen/starch/alpha-glucan phosphorylase; PFAM: glycosyl
FT                   transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84098"
FT                   /db_xref="GOA:C6C7I0"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7I0"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ACS84098.1"
FT                   /translation="MNSPFIYNSPTLSVDALKHSIAYKLMFTVGKDPSVASKHDWLNAT
FT                   VLAVRDRMVERWLRSNRAQLSQDVRQVYYLSMEFLLGRTLSNALLAMGMFDDLKLALDA
FT                   MGLDLNELLEEEDDPGLGNGGLGRLAACFLDSLATMALPGRGYGIRYEYGMFKQNIVEG
FT                   KQAESPDYWLEYGNPWEFARHSTRYKIRFGGRIQQEGSKTRWLETEEIVACAYDQIIPG
FT                   FDTDATNTLRLWAAQASNEINLGKFNQGDYFAAVQDKNHSENVSRVLYPDDSTYSGREL
FT                   RLRQEYFLVSATVQDILSRHWMMHKTYDNLAEKFAIHLNDTHPVLAIPELMRLLIDEHK
FT                   FKWDAAWKVVTQVFSYTNHTLMGEALETWSVEMLGNILPRHLQLIFEINERFLEEVQAR
FT                   FPNERDLLKRVSVIDEDHGRKVRMAWLAVICSHKVNGVSQLHTDLMVQSLFADFARLYP
FT                   ERFCNKTNGVTPRRWLALANPWLSKVLDDAIGHNWRTDLSQLEDLKPNIDFPAFLQKVR
FT                   NAKRENKKRLAIYIAQHLDVVVDPNALFDVQIKRIHEYKRQLLNVLHLITLYNRIKDDP
FT                   SLDRVPRVAIFAGKAASAYYMAKHIIHLINDVAKVVNNDPAVKDKLKIVFIPNYGVSLA
FT                   QIIIPAADLSEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEMRERVGDDNIFIFG
FT                   NTTEQVEELRRNGYNPRDFYNQDDELHRVLTQIATGVFSPDDPHRYADLFDSLVNFGDH
FT                   YQLLADYRSYVDTHDKVDDIYRDEDEWTRRTLYNIANMGYFSADRTIQEYADEIWNIKP
FT                   IRL"
FT   gene            complement(324132..325043)
FT                   /locus_tag="Dd703_0282"
FT   CDS_pept        complement(324132..325043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cko:CKO_01694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84099"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7I1"
FT                   /inference="similar to AA sequence:KEGG:CKO_01694"
FT                   /protein_id="ACS84099.1"
FT                   /translation="MNPITRRHLHRLKVSPQIYRWFLRRFPQGAHYPQLHDALLHDGYR
FT                   EWMESLVDYSYAQHFSQPFFVRQELAATRSLLAQLLSTTVAAAQNTPDITENGPYTLAV
FT                   SASDQRIGSASPQGRLASAGDGNLIGCQGEHHRIASTGYACQLVSAGCAAHIGNTGPNS
FT                   RIGALGERARIANSGNAVKIVSDGHGSHIASTGSRTYISGTGDRDRIVSAGDMCCLHSL
FT                   GDSAHIAATGEQLSVTACGADSVVVVVGSMMTLQLGQGGCAAVTYHDGVRTRFRVIYEG
FT                   EDGVRAGVRYRLTTAGELEACE"
FT   gene            complement(325060..325839)
FT                   /locus_tag="Dd703_0283"
FT   CDS_pept        complement(325060..325839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0283"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: pmr:PMI0066
FT                   oxidoreductase, cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84100"
FT                   /db_xref="GOA:C6C7I2"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7I2"
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /protein_id="ACS84100.1"
FT                   /translation="MNTLPHAEQFQAQLAGYVTRYTPDHWPTLLILAGLALAGMLGVLA
FT                   LHGVLRYRFARPHPAGHEEKIYLYSGAVRLWHWSNALLFLLLLLSGAINHFALASPDDT
FT                   ARLVSLHALCGYLLLADWLLFVSINALGGNGRHYVIEPQGWKPRAMKQVRFYLYGIIRG
FT                   EDHPFPATRHCKFNPLQQAAYLGVMYGLLPLLLLTGVLLQHPEWLPAALSPYWLLQLHA
FT                   LLAVVSVFFIVGHLYLCTTGRTPTQTFRSMIDGYHRH"
FT   gene            complement(325836..326507)
FT                   /locus_tag="Dd703_0284"
FT   CDS_pept        complement(325836..326507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0284"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: pmr:PMI0067 oxidoreductase, Fe-S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84101"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7I3"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACS84101.1"
FT                   /translation="MTCSRRKFVLGMGSVVFFSAPLFSTLAGTEKGKAVRYAMIHDETL
FT                   CNGCNLCVTACRKVNDVPEGMARMSIAHIPLTPPDQGNQYHFFRYACQHCEEAPCITVC
FT                   PTGASYRDQATGIVRVNRPTCIGCSYCISACPYQVRYLNPVTHVADKCDFCFESRLSKG
FT                   FPPICVSACPQQALLFGREDSEPIQRWLKTHDYYRYQLPGAGEAHVYRRPGPHSAEEVK
FT                   A"
FT   sig_peptide     complement(326424..326507)
FT                   /locus_tag="Dd703_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.732 at
FT                   residue 28"
FT   gene            complement(326589..327272)
FT                   /locus_tag="Dd703_0285"
FT   CDS_pept        complement(326589..327272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eck:EC55989_1839 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84102"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7I4"
FT                   /inference="similar to AA sequence:KEGG:EC55989_1839"
FT                   /protein_id="ACS84102.1"
FT                   /translation="MNSEHHNDACETPPDSVADPGLRRLLLPFSQHAQRPTATPAEVPP
FT                   STDEPLPAFMALAEYIRQSSLREELVARSTLAEPPFALTPEQAAQQLAEIQASEACTDI
FT                   RCIAQDEEAYYYSGRSISDNYARILACIRHQDICRTVAESVRFECRTYPRPYQLRMLQL
FT                   APYNLDNATIDSALAAIARTDEFRDIHTVLASNGTVYLYSDRFMSSGKAQGLCEWLEVE
FT                   QYENP"
FT   gene            complement(327294..329396)
FT                   /locus_tag="Dd703_0286"
FT   CDS_pept        complement(327294..329396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0286"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="KEGG: pmr:PMI0069 aldehyde ferredoxin
FT                   oxidoreductase; PFAM: Aldehyde ferredoxin oxidoreductase;
FT                   aldehyde ferredoxin oxidoreductase; SMART: Aldehyde
FT                   ferredoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84103"
FT                   /db_xref="GOA:C6C7I5"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7I5"
FT                   /inference="protein motif:PRIAM:1.2.7.5"
FT                   /protein_id="ACS84103.1"
FT                   /translation="MTNGWTGNLLRIDLSSGKITKEDSSKYKQFIGGMGFGYKIMYDEV
FT                   APGTQPFDEANKIVFAVGPLTGSGAPCSSRVNITTLSTFTRGNLVVDAHMGGFFAAYMK
FT                   YAGYDAIIIEGKSPKPVWINIQDDKVTLENAAFLWGKGTRETTAEICRATSEETCVAAI
FT                   GPAGENRVPLSGILNSRNHSGGAGSGAVLGAKNLKAIAVRGNKGVNVADRQELKALNDY
FT                   MMTQLIGANNNHVVPSTPQAWAEYSSPQSRWTARKGLYWKAAEGGPIETGEIPPGNQNT
FT                   VGFRTMKSTFDLGPEAEQYTVKMGGCHSCPIRCMSQLNVPQAKQFGVPSTGGNTCVANF
FT                   VHTTIFPKGPKDIQEKGDGNVVGNLVGLNTFDDMGLWCNYGQLHRDFTYCYTHGVFKRV
FT                   LPADEYSAIPWNWLEEGDPRFITDFYHRLAHRIGELSHLADGSYILAQRWELGDEYWNY
FT                   AKNKLWSPMGFPVHHANEASAQVGSIVNCMFNRDAMTHTHINYIGSGLPLALQKEIAGE
FT                   LFGSPDAYDETKNYTPINPYKIKYAQWAIFRSCLHDAITLCNWVWPMTVSPHKSRRYRG
FT                   DLAMEAKFFAAVTGEPTTPEDLDVAAERIFTLHRAYTVKLMNTKDMRREHDQICDWVFD
FT                   KDPKIKVFTEGTDKMDREDMHQSLTMFYTAMGWDPDLGCPTRATLLRLNMADVAEDLAS
FT                   RGLLPS"
FT   gene            complement(329456..330085)
FT                   /locus_tag="Dd703_0287"
FT   CDS_pept        complement(329456..330085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0287"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: pmr:PMI0070 oxidoreductase, Fe-S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84104"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7I6"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACS84104.1"
FT                   /translation="MSNQVERPILTLGLTRLEFLRISSKGLAGITIAPALLSLLGCRQE
FT                   DISSGRVGLTTTPKGVLVTKRARCTGCHRCETICTTVNDGSVGSFFSRVKIHRHFFFGD
FT                   KGIGSGGGLYGDLNFTTDTCRQCKDPQCMKACPLNVISYNPEYGCISVDTKRCIGCAAC
FT                   TSSCPWMMATVNPQIKKSGKCILCGECAAACPTGALSIIEWKDITV"
FT   gene            complement(330796..332295)
FT                   /locus_tag="Dd703_0288"
FT   CDS_pept        complement(330796..332295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0288"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   eca:ECA4141 glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84105"
FT                   /db_xref="GOA:C6C7I7"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7I7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACS84105.1"
FT                   /translation="MESKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLASATSSAS
FT                   SKLIHGGLRYLEHYEFRLVGEALSEREVLLKMAPHIIFPMRFRLPHQPHLRPAWMIRAG
FT                   LFLYDHLGKRVSLPSSHGLKFGRESVLKPELTRGFEYSDCWVDDARLVVLNAQEVVRHG
FT                   GEVKTRTKVTRAWRENGLWHVEAQDMLSGDTLRWQAKGLVNATGPWVREFFDDGLALPS
FT                   PYGIRLIKGSHIVVPRVHHEEQAYILQNKDNRIVFVIPWQDEFSIIGTTDVEYHGDPRD
FT                   VAINDQEIGYLLDVYNDHFRKPLTREDIVWSYSGVRPLCDDESDSPQAITRDYTLSVAD
FT                   DNGRAPLLSVFGGKLTTYRKLAEHALEKLGQYFPHAGKAWTRQTVLPGGDIKGSRDDYA
FT                   AALRRRHNLPEALARRYSRTYGSHSEKILAQANGVAELGEHFGHNLYEAELRYLVEHEW
FT                   VVTLEDAIWRRTKLGMWLDETQQQRVSEWLDRYRSQLAQAS"
FT   gene            332630..332950
FT                   /locus_tag="Dd703_0289"
FT   CDS_pept        332630..332950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0289"
FT                   /product="Thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="KEGG: eca:ECA4139 thiosulfate sulfurtransferase;
FT                   PFAM: Rhodanese domain protein; SMART: Rhodanese domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84106"
FT                   /db_xref="GOA:C6C7I8"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7I8"
FT                   /inference="protein motif:PRIAM:2.8.1.1"
FT                   /protein_id="ACS84106.1"
FT                   /translation="MEQFEAIDIEQAYQRWQRGNVLVDIRDLQSFGAAHVPGATHLTNE
FT                   TLSDFVRGADLEQPVLVMCYHGISSRNAAQYLISLGFDAVYSVDGGFEAWRQRFPQEVA
FT                   AG"
FT   gene            333057..333587
FT                   /locus_tag="Dd703_0290"
FT   CDS_pept        333057..333587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0290"
FT                   /product="endonuclease"
FT                   /note="KEGG: ypp:YPDSF_4129 endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84107"
FT                   /db_xref="GOA:C6C7I9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7I9"
FT                   /inference="similar to AA sequence:KEGG:YPDSF_4129"
FT                   /protein_id="ACS84107.1"
FT                   /translation="MSTPRLMSCTWLLALLPLTAGAAPPSVQAGFSPEGSAQTLVLETI
FT                   RNAKLSIRMMAYNFSAPDVIKALADAQKRGVDVRIVIDEQANLSGASLAAKNLLVNAGV
FT                   KLRTNNHYKIQHDKVMVVDRRIVQTGSFNYTASAEKHNSENVLVIRSPALAKTYLVHWQ
FT                   SRWAQGSDWHSTY"
FT   sig_peptide     333057..333125
FT                   /locus_tag="Dd703_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.811 at
FT                   residue 23"
FT   gene            complement(333637..333972)
FT                   /locus_tag="Dd703_0291"
FT   CDS_pept        complement(333637..333972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0291"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84108"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7J0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84108.1"
FT                   /translation="MNTAAYEKHLAPVRKLLDDINVMNSLSLVAYMNDYIHRQRIGTLT
FT                   TNEFEFLKDRLRKIKIGVDQVAHITQTEKDNIVAACLEIMAFIESRKAPHPTTHTQRAA
FT                   VSMVRQA"
FT   gene            complement(334546..335295)
FT                   /locus_tag="Dd703_0292"
FT   CDS_pept        complement(334546..335295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0292"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; SMART: EAL domain protein;
FT                   KEGG: lch:Lcho_1614 diguanylate cyclase/phosphodiesterase
FT                   with PAS/PAC sensor(s)"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84109"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7J1"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ACS84109.1"
FT                   /translation="MIFTDNDLAAAVHQRSGFCLHYQPIINLNSREVSGFEALIRWHHP
FT                   QFGLIPPDRFIPMAEQSGLIRPLGEWIIQEVCRQLLRQPGYAIATNVSPVQFSDTNFVD
FT                   TLLEYLHRHQCDTRNIEVEITESVLLSDIENIRNKIKTLRSAGIAVVLDDFGAGYTSVH
FT                   YLYQYEFDKVKIDKSLIMHLGENRKNRIVVGYLIDTLHKMGIKVTAEGVETAAQMHILG
FT                   ELECDSIQGFFVSRPLTVDQLDRFISG"
FT   gene            complement(335276..335908)
FT                   /locus_tag="Dd703_0293"
FT   CDS_pept        complement(335276..335908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0293"
FT                   /product="putative diguanylate phosphodiesterase"
FT                   /note="KEGG: spe:Spro_2163 diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84110"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7J2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84110.1"
FT                   /translation="MPFPTMNKFQLLAIKLQYIRTAWLSSTLPVPVLSIELDRELLMFL
FT                   VGNKALLDIVGQTKDIRFLVSEHIDIIGDEQSHRALQLLTSMTKIWLNNFGAGRTNISL
FT                   LNRVTFEYIKIEKSFLLKYGELTFFRKILADINGWSQGAILTGIDNDEMYRQFNARDIY
FT                   GMQGALWQTTTLMADYDAVGSMATADIAQPAPFITEGITVANDIYRQ"
FT   gene            complement(336234..337256)
FT                   /locus_tag="Dd703_0294"
FT   CDS_pept        complement(336234..337256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0294"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: mmw:Mmwyl1_1602 periplasmic binding protein/LacI
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84111"
FT                   /db_xref="GOA:C6C7J3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7J3"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS84111.1"
FT                   /translation="MASASEKNMASAAEVARLAGVSRSAVSRTFTPGGSVSPATRRKVL
FT                   AAADALNYHVNHLARGLSKEECRPVCILGGHLRAPYQAHLLDQLTRRLQQAGRAVMVIN
FT                   TDGGETSADAALRQTLNYRAAATIVLSGLPQASLVETCLHSGQQVILINRLGEFDGADH
FT                   IAIDYTSTLHETYQMLADAGCRRLAMISSTARSPSMVMRETQFLAAARHAAEPCLLVRA
FT                   GPTGYETGAQAARELLAGAQRPDGVFCATDLIACGFLDVARYEFGLRIPQDLCLVGFDD
FT                   IEQAGWVGYQLTTFSQPLTTMADAIVSLLSSPPAARQPATRLFKAPLVWRNTVRRRAVD
FT                   "
FT   gene            complement(337262..338725)
FT                   /locus_tag="Dd703_0295"
FT   CDS_pept        complement(337262..338725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0295"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG:
FT                   mmw:Mmwyl1_1604 inositol-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84112"
FT                   /db_xref="GOA:C6C7J4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7J4"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ACS84112.1"
FT                   /translation="MTQTNLERREAALKQIILDAGDTALRHFRTRQPGAFTLKGHQDFL
FT                   TEADALVEKQIRQAISAAFPDDALLGEETGGATTDAARLWVVDPIDGTANFARGIEHFC
FT                   IAIAFVSQGITELGGIYNPATQELYLARRSHYAQKNGQPLHTARTSDARNATFELGWST
FT                   RTAQRRYLDVMAALLSTGANVRRGASGALALAWVAEGRTDGYIELHMNAWDCLAGLLLV
FT                   SEAGGRVGQINDPCAAIFNGQPVLAAATGVADALARASGIPLDSADTCPIDAQSATPHY
FT                   PRPAISLIEADVPGWGMDIYIGGAAGTTDLALLDQYGIGTVINCAVNLDIDWVHAPEPE
FT                   SPAHLLRHGAGPVRYYKLGLIDGDGNPATMLHAGYHLMRSALLQRIPDKPSYRNRERGN
FT                   LLVNCRGGRSRSVTLVALFLHLECPARYPTLADAIAHVQDKRQLHPDEWFDAPKPALIT
FT                   LAQRAIEMEQALRAAGLGTPTPVMDEPRS"
FT   gene            complement(338771..339874)
FT                   /locus_tag="Dd703_0296"
FT   CDS_pept        complement(338771..339874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0296"
FT                   /product="ABC transporter periplasmic solute-binding
FT                   protein"
FT                   /note="KEGG: mmw:Mmwyl1_1605 ABC transporter periplasmic
FT                   solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84113"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7J5"
FT                   /inference="similar to AA sequence:KEGG:Mmwyl1_1605"
FT                   /protein_id="ACS84113.1"
FT                   /translation="MNRTTIASLALLAAGTVGASAAEPFDVSSLVAAARQEAPITVYAS
FT                   TGKIVQQAKAFSERYGVNAVGIKADAPQIIEILSREALAHNVKADVAIVEDAPAGIEQL
FT                   LSKGYVQSWVPTDLKTTIPANYQDPLTVVLAPNVFAYNTTHHDACPITNIWQLTEPQWR
FT                   GKVALQDPTGKPAYTDWFSQLATHYDQPMREAYQQQYGKPLPASEHSATEAFVKALAAN
FT                   SPLLTHSDNDAAEAVGAPDGKGDFVGLVSTAKFRDNQQGMKLGLCHGMKPVIGWNYPSL
FT                   GVIAAGSRSPNAAKLFIRYLMTAEGIAPQGVDGKMSTNQTVALPANEPSGIEKYRDELM
FT                   AYQTSSAKTDWQTRQDWQDLWNLNYRK"
FT   sig_peptide     complement(339809..339874)
FT                   /locus_tag="Dd703_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.866 at
FT                   residue 22"
FT   gene            complement(339912..340991)
FT                   /locus_tag="Dd703_0297"
FT   CDS_pept        complement(339912..340991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0297"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mmw:Mmwyl1_1606 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84114"
FT                   /db_xref="GOA:C6C7J6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7J6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS84114.1"
FT                   /translation="MPAITLTNLTKTYPGARQPAVDAINLTVRDGEFMCLLGPSGCGKT
FT                   TILRMIAGIEHASGGEIAIGGQIMDSVARATFIPPERRRVGLVFQSYALWPHMTVAQNV
FT                   DFGLRLQKVPEAERTARRQDVMEKLRIADYADRYPAQLSGGQQQRVALARMLAVNPGVL
FT                   LLDEPLSNLDATLRLEMRAELRRLHETFGTTIVFVSHDQWEAMTLATTIAVMSAGHLQQ
FT                   VGTPDEIYARPANRFVAEFIGTPKLNMIPLNQPASSLAAHIHTRFAPQDDLQLCGIRPE
FT                   ELQLFEQPLADSVPMTIDNIMPTGGSWVIELVSNDDRLFHSTQLRPCWHAKQQVHCQLP
FT                   AGSLHFFNQQGLRQEPVAH"
FT   gene            complement(340993..342828)
FT                   /locus_tag="Dd703_0298"
FT   CDS_pept        complement(340993..342828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0298"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mmw:Mmwyl1_1607
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84115"
FT                   /db_xref="GOA:C6C7J7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7J7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS84115.1"
FT                   /translation="MRLVIPELVNRETPVRGARLRRLLAVARHEPANLLGLALALLFVW
FT                   LILAPVISVLLDAVVVQSGDSVRAQAMEGNLTPYYLLRTLSSRMSALLLWTPLINTLLV
FT                   ALNVVAGSLVIGVALAWLVNRTDMAGRKGFATALIVPFMLPSWTFALAWKTLFKNRAVG
FT                   GQPGWLETLGIQTPDWLAYGYFPIVVILIIHYTPLVILIVGNALNRIDIQLEDCARVLG
FT                   ASRQTIAWRIVVPLVRPALLSAALLIFADGIGEFAIPYILGLPVHFDTLSTGLYRALSS
FT                   RQTGVAAVIATVIMLMGTLTLLLDMRMLREARRFVTVGGKGGGMDRRRRLGRWRFAASG
FT                   VALAYLLTGVAIPLLALFLSTVMKLPGRFSADNFTADFWIGHNLDTVALHTGILITPAF
FT                   WLAVGNTLVIVGSAALVAGVLGLLVGYAATRGSVSGLNGFLRQITFLPYLVPGIAFAAA
FT                   MLSLFAVAHGPLPALYGTPLLLVIALIAEKMPYASRSGIAAMTQLGREPEEAARVAGAG
FT                   WLTRLRRIVIPIQAAPLATGILLPFISGIKGVSLFVILAIPATDVLTTYSLRLIDYNYE
FT                   QAANAVVLMIALISWAGTVLIQRISGTGLAEGLEN"
FT   gene            complement(343046..344341)
FT                   /locus_tag="Dd703_0299"
FT   CDS_pept        complement(343046..344341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0299"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: ppg:PputGB1_3154 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84116"
FT                   /db_xref="GOA:C6C7J8"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7J8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS84116.1"
FT                   /translation="MKNATSTLQDNTVVKTSPMTRLRWGIIFILLMAAVINYLDRANLS
FT                   IANTTIAKEFGFSATQMGMLLSAFLWPYAIANLPAGWLVDKLGPKRMFSWAVGLWSTFT
FT                   VLAGFVNGYAMFYGLRMLLGVSESPFFTSGIKITHRWFSSRERGLPTAIINTGSQIANA
FT                   VAPPILTVLLLTLGWRGMFIAIGLLGLPLLLAWLKFYREPTPAEEREIHREAPVSSPAA
FT                   DNTHQQAGWGSLFRHKTTWFMILGNFSIMFTIWVYLTWLPSYLEKSLGFSLKQTGWLAS
FT                   IPFFAGILGVLCGGALSDRFIRRGMSTITARKIPIVLGAAMAACFVAPIPFVHDTALSI
FT                   LLLSLGYFCSQLPSGVIWTLATDIAPKNQVASLGAIQNFGGFLGAASAPIITGVILDAT
FT                   GVFTNVFFLGAGLLMLGALSYGLFVKKPIVEN"
FT   gene            complement(344347..344826)
FT                   /locus_tag="Dd703_0300"
FT   CDS_pept        complement(344347..344826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   sew:SeSA_A3867 YiaL"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84117"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7J9"
FT                   /inference="protein motif:PFAM:PF04074"
FT                   /protein_id="ACS84117.1"
FT                   /translation="MIICDQQDWSREKYALHPIIHQAIHYISTTDFATMETGKYDIIPG
FT                   KMFCLLQEFTTEPVENRLAESHFQFVDIQYLLQGEETIGVARGSRNNTIIDDKKATNDI
FT                   VFYRDIHNESLITLIPGMFAVFFPEDLHRPCCQRREPSFIRKAVIKIHISLFTDC"
FT   gene            complement(345069..345995)
FT                   /locus_tag="Dd703_0301"
FT   CDS_pept        complement(345069..345995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0301"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   efe:EFER_0075 putative dihydrodipicolinate synthetase
FT                   (DHDPS)"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84118"
FT                   /db_xref="GOA:C6C7K0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7K0"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ACS84118.1"
FT                   /translation="MKSIEGIVPVMLTPFTPNNEIDYPGLARLIDWYLEKGVDALFAVC
FT                   QSSEMLFLSLEERVELARFVVAHVAGRIPVIASGHISDGINEQVAELQAMAETGIDALV
FT                   LVTNHLDPKNQGTETFFRTLDTLLAALPASLPLGLYECPAPYRRLLTDEELTHCANTGR
FT                   FVVLKDVSCDLPTVERRVKLTAGTSLNIINANAAIAFPAMRAGSKGFSGVFTNFHPELY
FT                   QWLYSQSQHHPELAQELATFLSLTAVTETLGYPKNAKIYHQRLGTFEHSDCRVTKDDVL
FT                   EKFWALTVILDQIRQGTEHYQNKIQPR"
FT   gene            complement(346043..355639)
FT                   /pseudo
FT                   /locus_tag="Dd703_0302"
FT                   /note="split by an insertion event"
FT   gene            346626..347228
FT                   /locus_tag="Dd703_0303"
FT   CDS_pept        346626..347228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0303"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu3694 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84119"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7K1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84119.1"
FT                   /translation="MHFDTRTPKPRYAVLAPDTLPPCRGSRLQPPHHSSGGSRCHPLLG
FT                   VRFGGSSQPVTGPQLACGSGAGSAGADGTESASDALRRSVAPTVKETAHLHDHAGQQPA
FT                   RRPPGRPPAGAARGGDGEHGNEQGACDCEPGAASEAGLGRGRGNALQRRPDGPTSSWGL
FT                   GLGVDLRAEERTLPPTAEGAALRAAPHPRCRWRGRKT"
FT   gene            complement(347474..347806)
FT                   /locus_tag="Dd703_0304"
FT   CDS_pept        complement(347474..347806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0304"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   eca:ECA1466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84120"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Z3"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ACS84120.1"
FT                   /translation="MDYQVVYATQAQEQLARLYDYIARAATPKTALSYTEGLVDYCESL
FT                   SQFPHRGSQRDDILPGLRVTNYRKRTIVAFVVEEVSMVVSVVGIWHGGQDYERDLLPAE
FT                   NDWAGV"
FT   gene            complement(347806..348084)
FT                   /locus_tag="Dd703_0305"
FT   CDS_pept        complement(347806..348084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0305"
FT                   /product="putative addiction module antidote protein,
FT                   CopG/Arc/MetJ family"
FT                   /note="TIGRFAM: addiction module antidote protein, CC2985
FT                   family; PFAM: protein of unknown function UPF0156; KEGG:
FT                   eca:ECA1467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84121"
FT                   /db_xref="GOA:C6C5Z4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Z4"
FT                   /inference="protein motif:TFAM:TIGR02606"
FT                   /protein_id="ACS84121.1"
FT                   /translation="MRTTQQMSITLPNEMAAQVKARVASGEYASESEVIREGLRALMAR
FT                   DNAVDNWLREQVVPAWESLQRGESTALSGEEVRSKLKAMHRKATGEA"
FT   gene            complement(348117..349217)
FT                   /locus_tag="Dd703_0306"
FT   CDS_pept        complement(348117..349217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0306"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: plu:plu3588
FT                   site-specific tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84122"
FT                   /db_xref="GOA:C6C5Z5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Z5"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACS84122.1"
FT                   /translation="MANRKPRADALLTVDDVYRKPIGPASDPKSLYALLLRFVAWRRER
FT                   NWSETTLKTQTHHQYRFILWAAERGLHYGRDITLPILEHYQRHLYQYRKPNGEPLSTRT
FT                   QRSQLGPLVVWFGWMTRHHLLLADPASGLVLPRLEKRLPRHILSVADVEQVLALPDLTT
FT                   LQGIRDRALMELLWSTGIRRGEVAVLEVYSVDASRHIVTIVQGKGKKDRVIPVGQRALR
FT                   WLTYYVQAVRPQLLVNPHCPALFVALDGVEGLTPNGITNLVSHYIKASGIAKWGSCHLF
FT                   RHAMATQMLENGADLRWIQAMLGHASVESTQIYTQVSIRALQAVHASTHPAEQPDSDET
FT                   GLPADLMADEEADNPSPDKREKNGYD"
FT   gene            complement(349204..352464)
FT                   /locus_tag="Dd703_0307"
FT   CDS_pept        complement(349204..352464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0307"
FT                   /product="zinc finger CHC2-family protein"
FT                   /note="PFAM: zinc finger CHC2-family protein; DNA primase
FT                   catalytic core domain; TOPRIM domain protein; SMART: zinc
FT                   finger CHC2-family protein; KEGG: plu:plu3714 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84123"
FT                   /db_xref="GOA:C6C5Z6"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Z6"
FT                   /inference="protein motif:PFAM:PF01807"
FT                   /protein_id="ACS84123.1"
FT                   /translation="MGRMTPAELEQLKRGVSLRAVAQSQGHTLKKQGADSYVCRCPFHQ
FT                   ENTPSCVITPSKNLYHCFGCGASGSVLDWLQHTERLTYPQTLLRLRELAGSASSLAAAP
FT                   ALSSPPAPPRQKLADLDDDGQALLNQVIQFYHQSLLASAEAQQWLAGRGLAHPELVSHF
FT                   RLGFAGHHGIGGSAGLLPSSSSQEGKRLREKLAGLGVLRSATRQDHFRGCVVMPVIGWS
FT                   ESASVAQRGRVMQLYGRRVQPDHKILKGSPKHLYLPSPLAGVWNEDALKASSEVILCES
FT                   LIDAMTFWCAGYRNVTTAYGANGFTADHLAALQYHGVKRVQIAYDRDEAGDRGAASVAA
FT                   ELLEAGIEAWRVRFPPGLDANAYALNSGSPESALGLALEQAQWMGNGSGPGVVFSHETV
FT                   VTDGREPSSLAAPAGVPAPMVAGELTASGDLLLTHGPRVWRVRGWQKNTVAEVMKVNVQ
FT                   VRDESTGALYVDSLDLYSSRQRQGYVSAAAAELGCEASVIKRECGRVLLMLEQKQDDVR
FT                   QAAEQAERAPAVTVSAEEEADALALLKSPDLAARIVDDLAACGVVGESTNLLTGYLAAT
FT                   SRKLDKPLAVLIQSSSAAGKSSLMEAVLGMMPEEERIQYSAMTGQSLYYLGETSLQHKI
FT                   LAIAEEEGVRQAAYALKLLQSDGELKIASTGKNEQSGELVTREYKVQGPVMLMLTTTAS
FT                   DVDEELLNRCLVLTVNESREQTQAIHAMQRHGQTLAGLLQSSEKQYLTRLHQNAQRLLR
FT                   PLKVVNPYADRLTFLSDKTRTRRDHMKYLTLIQAIALLHQYQREVKRVTHRGQVIEYIE
FT                   VEKSDIALANQLAHEVLGRTLDEMPPQTRKLLVWLKGWVQERAQGQAVKADEIRFTRRD
FT                   VRSSLGWGDTQLKIHLGRLLEMEYLLLFRRGLTYEYGLLWDGDDNGGAHLCGLLEVEDA
FT                   TPETEGNADRSGLEVTQSAPGRGMVGSRSVGEKPASGQTAQGSDTEPVGVTPDVVIRGK
FT                   EKSPAVPLPASKNGVAEGNADRSGLEVAQSAPGRGVVGNRSVGEKPASGQTAQRLTAEP
FT                   VGSEPDAVIRGKPTLPSAPLPAVGDTPVESAGVTHGQP"
FT   gene            352579..353013
FT                   /locus_tag="Dd703_0308"
FT   CDS_pept        352579..353013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0308"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: eca:ECA3401 putative
FT                   phage regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84124"
FT                   /db_xref="GOA:C6C7K6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7K6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACS84124.1"
FT                   /translation="MAIRTLPAQGSSTMAASISSEEQTFMTELGKRITALRKDAGLTQV
FT                   QLAQALNVSQQAVQSWESGRRRIQISALPAVARQLSVSLDALLGDSHTPPPRKRGPASR
FT                   LEQQIQMIGQLPRSRQKLVSEMLDAVIAQAQQAGTDGLDG"
FT   gene            353099..353386
FT                   /locus_tag="Dd703_0309"
FT   CDS_pept        353099..353386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0309"
FT                   /product="Domain of unknown function DUF1813 HSP20-like
FT                   protein"
FT                   /note="PFAM: Domain of unknown function DUF1813 HSP20-like;
FT                   KEGG: plu:plu3380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84125"
FT                   /db_xref="GOA:C6C5Z8"
FT                   /db_xref="InterPro:IPR014944"
FT                   /db_xref="UniProtKB/TrEMBL:C6C5Z8"
FT                   /inference="protein motif:PFAM:PF08845"
FT                   /protein_id="ACS84125.1"
FT                   /translation="MAVRDDKAIQRISQAERYARARFQAVSLQGAWLTEAGFTDGMPLK
FT                   IRVMPDCMVITAQNTRELWHCLEGLSIEPFDPDAAANWIRHYPGGLKFAE"
FT   gene            complement(353628..353975)
FT                   /locus_tag="Dd703_0310"
FT   CDS_pept        complement(353628..353975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0310"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu3717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84126"
FT                   /db_xref="InterPro:IPR028964"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Y1"
FT                   /inference="similar to AA sequence:KEGG:plu3717"
FT                   /protein_id="ACS84126.1"
FT                   /translation="MKATLRTLGCDICNLETFMPEEVNDFNLSLVLSIGPVDEVGTNYF
FT                   YLNVCTPEWLCKHRWLPELMRHTLLVRKYDLDEIKKTITDYIDQCEGEDWMEIAQKLSR
FT                   VFAWEYEDYQP"
FT   gene            complement(353979..354914)
FT                   /locus_tag="Dd703_0311"
FT   CDS_pept        complement(353979..354914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0311"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: plu:plu3718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84127"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Y2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84127.1"
FT                   /translation="MENNYLSSTDKSRQTYLNHKENLTEQEKQERDALNRKDAQTSKEL
FT                   VTACMDGSASACSAARQDALEKQATYQNLGYQNPKETQDGYQQIQQLLVSTGEEAKQTR
FT                   ELFNGMVAAYMRTGMSEEAAKSAVGYQMGAMYIAGGLAGIGAGKAADEGLTPGVKPSAP
FT                   SEKPGAGSTQTEGKPSSGAENVATYPKLKEDLVQQNLDNIAKQDPRLAAVVQGDNGKLN
FT                   YGVGSGTKAEADRLGQIWVGDGARATSDGSGLVSADGTRVYRFPKEKPNAPESLNPTGT
FT                   QANFETYRINPATGDRTRVGDAHLSVLAEK"
FT   gene            355904..356728
FT                   /locus_tag="Dd703_0312"
FT   CDS_pept        355904..356728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0312"
FT                   /product="Rhomboid protease"
FT                   /EC_number="3.4.21.105"
FT                   /note="PFAM: Rhomboid family protein; KEGG: eca:ECA4138
FT                   intramembrane serine protease GlpG"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84128"
FT                   /db_xref="GOA:C6C7Y3"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Y3"
FT                   /inference="protein motif:PRIAM:3.4.21.105"
FT                   /protein_id="ACS84128.1"
FT                   /translation="MIRIISLSNPRLAQAFVDYMRTHQVRLVIQFDGDQADIWLPDESQ
FT                   QARVQQELEQFLREPWHARYQAASWQTGSTGAGLRYQSFSYLTMLRQRAGPLTLGVMLA
FT                   TVVVYLLMQLYGVDRMLLVLAFPDAAHRLQLWRWFSHALMHFSLLHLLFNLMWWWYLGG
FT                   PVERVLGTRRLCLILLLSAAVSGWVQYGFSGIYFGGLSGVVYALMGYVWLRGEREPDGE
FT                   LHLQRGLMIFALLWLIAGYFDILGLSIANAAHVAGLVIGLLMAWWDTYGKRR"
FT   gene            356753..357511
FT                   /locus_tag="Dd703_0313"
FT   CDS_pept        356753..357511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0313"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR; KEGG: eca:ECA4137 DNA-binding transcriptional
FT                   repressor GlpR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84129"
FT                   /db_xref="GOA:C6C7Y4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Y4"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACS84129.1"
FT                   /translation="MKQTQRHDAIIELVRRQGYVSTEELVEHFAVSPQTIRRDLNDLAE
FT                   QSKIHRHHGGAALPSSSVNAAYHDRKMMWSDEKARIAKQVASLIPDGATLFIDIGTTPE
FT                   AVAHALMNHKELRVVTNNLNVATLLTAKEDFRLILAGGEVRSRDGGIIGEATLDFISQF
FT                   RLDFGILGISGIDMDGSLLEFDYHEVRTKRAIIENSRCVMLVTDHSKFGRNAMVNLGNM
FT                   DLIDYLFTDQLPPPSVLKIIEQHKVQLELC"
FT   gene            357557..359974
FT                   /locus_tag="Dd703_0314"
FT   CDS_pept        357557..359974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0314"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: eca:ECA4136 maltodextrin phosphorylase;
FT                   TIGRFAM: glycogen/starch/alpha-glucan phosphorylase; PFAM:
FT                   glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84130"
FT                   /db_xref="GOA:C6C7Y5"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Y5"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ACS84130.1"
FT                   /translation="MSSSFNLSQFSDSLFRKLNAYGRSSLRELTPRQCWQAVCAALSEQ
FT                   VDALAADSDARLAGAPVEYRHVNYLSMEFLPGRLTANNLINLGWYGVVAQVLERHGLAL
FT                   SDILEQETDPALGNGGLGRLAACYLDAMATAAQPAIGYGLHYQYGLFRQHFDAGEQHET
FT                   ADDWQRDSYPWSHPRPELAVEVGFGGDLIPQPDGGERWVPAQVVIGEATDIPVIGYHNG
FT                   VMLPLRLWQATHPQPFDLAQFNAGHYLRAEQQGIAASSLTKVLYPNDNHPAGKRLRLMQ
FT                   QYFQCACAVADIFRRHLQAGRALETLPNLEVIQLNDTHPTLAIPETLRLLLDEHQLPWE
FT                   QAWDITHRLFAYTNHTLMPEALECWDERLFRRLLPRHFSIIKIINARFRQQVEAHWPGN
FT                   RRLWPRVAVLHRRQVRMANLCVVACFAVNGVAQLHSDLIIRDLFPEYHQLWPEKFHNVT
FT                   NGITPRRWLLQCNPALSSLIDETLHTPWANRLTALETLADYADDAGFQARYRKIKQDNK
FT                   ADLARFIQREYGILIDPSAMFDVQIKRLHEYKRQHLNLLHILSLYRQLRDNPGLDIVPR
FT                   IFLFGAKAAPGYVLAKNIIHAINGVAERINRDKRVNDRLKVVFLPDYRVSLAERIIPAA
FT                   DVSEQISTAGKEASGTGNMKLALNGALTVGTLDGANVEMAQQVGEENLFIFGHTVDQVK
FT                   ALQAKGYKPERYIAGHPLLASVLDELASGVFSHGDRTAFAPLLESLLKNGDPYLVLADF
FT                   TPYCQAQQRVDALYRKPEEWTRRCILNTARMGMFSADRAIHDYQQRIWIVRR"
FT   gene            359987..362110
FT                   /locus_tag="Dd703_0315"
FT   CDS_pept        359987..362110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0315"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: eca:ECA4135 4-alpha-glucanotransferase;
FT                   TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84131"
FT                   /db_xref="GOA:C6C7Y6"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Y6"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ACS84131.1"
FT                   /translation="MVLKAKKSVRYPVGLVDTYKDAYGNEQVIAEETREKLMQLLAPQD
FT                   IAGARLPPVCVFRQGKAMTLKPGGEGDYGWIITYEKGGGTEGKVSAGQVLSLPDTLPIG
FT                   YHQLVLEQGEKQWSCRIIVAPSGCYEPEPLTNGRRWWGITVQLYTLRSQHNWGIGDFGD
FT                   LKSLVENVARRGGAFVGFNPLHSLYPAEPEAASPYSPSSRHWLNIIYIDVNQVEDFHHS
FT                   EAAQAWWRRDDIQRQVLVARTNRWVDYTSVTTLKLAALRLAFQHFCRRSPLDHRKTALQ
FT                   QFIRNGGESLQQQATYDALLVYLKAQGDIPADWRRWPEEYREAGGDAVMRFRQENAEEI
FT                   QFYCWLQWVAHEQLAACFERSRQLGMPIGLYRDLAVGGAQGGVDTWGDRQLYCLDVTLG
FT                   APPDPLGPQGQNWNLTPMHPYALQQRGYQPFIDMLRRNMASSGALRIDHVMGLLRLWWI
FT                   PGGDTAAGGAYVRYPVDDLLAIVALESQRYRCLVIGEDLGTVPEEVVQRLEENGIYSYK
FT                   VLFFEKDRKNRYRAPCEYPRRSMATITTHDLPTLRGFWQGMDLTLGKDLGLYPSDEILQ
FT                   LQLEERELAKQGMLDALHEQGLLPQRVGRNAALTSMSSHLNRGVQRYLADSASALLGLQ
FT                   LEDWLDMATPVNVPGTDREYPNWRRKLSRTLDSIFTDRNLERLIRDIDLRRGGPVPVRG
FT                   RKKKTDATPSADA"
FT   gene            complement(362199..362774)
FT                   /locus_tag="Dd703_0316"
FT   CDS_pept        complement(362199..362774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0316"
FT                   /product="IscR-regulated protein YhgI"
FT                   /note="TIGRFAM: IscR-regulated protein YhgI; PFAM:
FT                   HesB/YadR/YfhF-family protein; nitrogen-fixing NifU domain
FT                   protein; KEGG: eca:ECA4134 putative DNA uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84132"
FT                   /db_xref="GOA:C6C7Y7"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Y7"
FT                   /inference="protein motif:TFAM:TIGR03341"
FT                   /protein_id="ACS84132.1"
FT                   /translation="MIRITDSAQEHFAKLLAKQEEGTQIRVFVINPGTPNAECGVSYCP
FT                   PDAVEANDTELKFEKLSAYVDELSAPYLEEAEIDFVTDQLGSQLTLKAPNAKMRKVSDD
FT                   APLMERVEYVLQSQINPQLAGHGGRVTLMEITEEGYAILQFGGGCNGCSMVDYTLKEGI
FT                   EKELLQKFPELKGVRDLTEHQRGEHSYY"
FT   gene            complement(362834..363535)
FT                   /locus_tag="Dd703_0317"
FT   CDS_pept        complement(362834..363535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0317"
FT                   /product="gluconate periplasmic binding protein"
FT                   /note="KEGG: eca:ECA4133 gluconate periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84133"
FT                   /db_xref="GOA:C6C7Y8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Y8"
FT                   /inference="similar to AA sequence:KEGG:ECA4133"
FT                   /protein_id="ACS84133.1"
FT                   /translation="MLTPMARCWLCQQSLYDSHHGICSHCLRHLPQPPVCCPRCGLPAA
FT                   NRVLPCGRCLQHPPAWHRLLLVGDYQPPFNQLIWHFKLQGKTELAPALARLLLLCWLER
FT                   RRQMALTRPDDLPRPDMLLTVPLHRWRHWRRGFNQSDLLARHLAHWVGCAYHPDVLART
FT                   RNTAQQRTLPAAARRRNLKGAFECRMALDGKRVALLDDVVTTGSTVEEISRTLLAAGAA
FT                   QVQIWCLCRTL"
FT   gene            363591..364370
FT                   /locus_tag="Dd703_0318"
FT   CDS_pept        363591..364370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0318"
FT                   /product="bioH protein"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: eca:ECA4132 putative biotin biosynthesis
FT                   protein; TIGRFAM: bioH protein; PFAM: alpha/beta hydrolase
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84134"
FT                   /db_xref="GOA:C6C7Y9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Y9"
FT                   /inference="protein motif:TFAM:TIGR01738"
FT                   /protein_id="ACS84134.1"
FT                   /translation="MESLHWQTEGSGKCELVLLHGWGMNAQVWNSIVVRLAPHFRLHRV
FT                   DLPGYGRSQGFGALSLEEMTTTVLAGAPARAVWLGWSLGGLVASLAALRAPERVSALVT
FT                   VASSPCFEARDEWPGIKPLVLSGFQQLLNEDFAGTIERFLALQTLGTESARKDARLLKS
FT                   VVTEQPSPTAAVLSGGLEILRRADLRQELAGLTTPFLRLYGALDGLVPRKVAMLMDEQF
FT                   PHSTSVVMPKASHAPFISHPEPFVEHLVAFARQHGER"
FT   gene            complement(364374..364625)
FT                   /pseudo
FT                   /locus_tag="Dd703_0319"
FT   gene            complement(364706..367033)
FT                   /locus_tag="Dd703_0320"
FT   CDS_pept        complement(364706..367033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0320"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; RNA binding S1
FT                   domain protein; KEGG: eca:ECA4122 putative RNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84135"
FT                   /db_xref="GOA:C6C7Z0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Z0"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACS84135.1"
FT                   /translation="MTNALSQIIAHELQARPEQVSAAVQLLDEGNTVPFIARYRKEVTG
FT                   GLDDTQLRQLETRLAYLRELEERRQTILKSIDEQGKLSDGLAAAINATLSKTELEDLYL
FT                   PYKPKRRTRGQIAIEAGLEPLADSLWNDPSRQPESTAQAYVDADKGVADVKAALDGARY
FT                   ILMERFAEDAALLAKVRDYLWKNAHLVAAVVEGKEEEGAKFRDYFNHREPLSQVPSHRA
FT                   LAMFRGRNEGVLQLSLNADPQYDEPPKESYCEQIIADHLGVRPAGAAADGWRRAVISWT
FT                   WRIKVLLHLETELMGSVREKAEEEAINVFARNLHDLLMAAPAGMRATMGLDPGLRTGVK
FT                   VAVVDATGKLVATDTIYPHTGQTAKAAAAVAALCIKHRVELVAIGNGTASRETERFFLD
FT                   TQKQFPDIKAQKVIVSEAGASVYSASELAALEFPDLDVSLRGAVSIARRLQDPLSELVK
FT                   IDPKSIGVGQYQHDVSQTQLAKKLDAVVEDCVNAVGVDLNTASVPLLTRVAGLTRLMAQ
FT                   NIVAWRDENGRFNNRDQLLKVSRLGPKAFEQCAGFLRINHGDNPLDASTVHPETYPVVE
FT                   RILSVTEQKLQELMGNANALRTLKAADFTDERFGVPTVTDIIKELEKPGRDPRPEFKTA
FT                   NFADGVETLNDLTPGMILEGAVTNVTNFGAFVDIGVHQDGLVHISSLADRFVDDPHKVV
FT                   KAGDIVKVKVLEVDLPRKRIALTMRLDEQPGEGNTRRGGGRDNNNTPRQQPSTNKARPR
FT                   QNTTPAGNSAMSDALAAAFKKR"
FT   gene            complement(367161..368867)
FT                   /locus_tag="Dd703_0321"
FT   CDS_pept        complement(367161..368867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0321"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: eca:ECA4119
FT                   putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84136"
FT                   /db_xref="GOA:C6C7Z1"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Z1"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACS84136.1"
FT                   /translation="MFSLDTILQDIAPHRPTPNWQRSILSALLFETEMQDFAQRYPHLK
FT                   GLDLVEQILDYFHLNCEMTDGALENIPSRGPVVLVSNHPIGSLDGLALLRAVATVRPDV
FT                   RIVASQLLSYVEPLKKLFFAVDNFSNRTRRQQITAIQEHLGNDGAVILFPAGEVSRMSL
FT                   KGIRDSHWHSGFIRLAAKARAPIVPIHVSGRNSNLFYLSSLIYRPLSTLLLVREMFRQQ
FT                   GNRLRIRIGAQIPYATWSQGEWSPNDLAARFRRHVYRLGQGKPGCFAGEKPIALPEDRT
FT                   LLRRALSDCEILGTTPDGKTIYLYQRRNEDYVPILRELGRLREIAFRAVGEGSGKRRDL
FT                   DSFDDDYLHLILWDERELDIVGAYRFAPTARLLAEKGLNGLYSHSLFQYGEEMAPILAN
FT                   GIELGRSFIQPKYWGKRGLDYLWLGIGAYLARYPQYRYLFGPVSLSGSLPSPARDLLIA
FT                   FYRIHFAPSQQLAQSRRPYPASLPDVLRQFEGTDYQQDLTRLKSMLNNIGCSIPTLYKQ
FT                   YSELCEPGGVQFIDFGVDPDFNNCVDGLVLVDLQQLKASRHQRYIAPFINE"
FT   gene            complement(369011..370999)
FT                   /locus_tag="Dd703_0322"
FT   CDS_pept        complement(369011..370999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0322"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: asu:Asuc_0556 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84137"
FT                   /db_xref="GOA:C6C7Z2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Z2"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACS84137.1"
FT                   /translation="MYQQRTRIFLRTLWWQVLLLSLLLSGARLTMFQVFADKQQLQQYD
FT                   AAVKLMWLTGLRYDLRAVSIILAPLLVIGLLLGLHRAGWRWLQRLTPGYLGVSALLVSA
FT                   IAIINYFYYQTYHTYIDIFAFGLIDDGPSAVLRNIWQDYPVVISLLLVSLCAWCASRLG
FT                   KRILRTPPPSGMLSTTTFIVYLLISLLLFFAMIRGSMSTFPLRRNDSQISSVTILNKLA
FT                   PNGLMASAWAIGDRDDDIRFEPVTRTAGEQLRHQSGLPTLDARTPDNPWLAAHRPNVVV
FT                   ALMESMGSNMLVYDRLPDNDMLGALRPHFASDFVFRRFVSEGNGTAPSFAALFFHSPIQ
FT                   NLSHSSAQYTALDDTPYATYKKAGYKVIFITPGSGMWRNFGNYLPRLGVDEIYDQSSLM
FT                   ERYPESRAMLTDWGVPDEFAFRLAQKLLAEARQPLFISILTVTNHPPYQVPASYRPQPV
FT                   RAGPEMMAHAEVGQQEQESIAATYQYATNALGDFIAAVKASSMGESTLIAATGDHQMRR
FT                   LKAQYPHEQFLDRAVPFYLYIPKTILAQTAWRFDASRPGSHKDIFPTLYAYSLSDTPYY
FT                   ALGGRNMLAPQDDATRAFGYNQVLWIDEQGITPIGSGGRYPWDPANPMLTQADAQPISA
FT                   EQQQRTVAYPALLRWQINAREQGIIDQ"
FT   sig_peptide     complement(370889..370999)
FT                   /locus_tag="Dd703_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 37"
FT   gene            complement(371143..371625)
FT                   /locus_tag="Dd703_0323"
FT   CDS_pept        complement(371143..371625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0323"
FT                   /product="transcription elongation factor GreB"
FT                   /note="TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: spc:Sputcn32_3809 transcription elongation factor
FT                   GreB"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84138"
FT                   /db_xref="GOA:C6C7Z3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Z3"
FT                   /inference="protein motif:TFAM:TIGR01461"
FT                   /protein_id="ACS84138.1"
FT                   /translation="MKTDLITREGYEALHQELNYLWKERRPEITEKVAWAASLGDRSEN
FT                   ADYLYNKRLLREIDRRVRYLRKRLQIVRVVDYSPQQEGKVFFGAWVEVENEAGDIKRFR
FT                   IVGPDEIYGRKDYISIDAPMARALLKKTVDEDVVVNTPAGPRVWYVNKIDYRNPMV"
FT   gene            371899..372618
FT                   /locus_tag="Dd703_0324"
FT   CDS_pept        371899..372618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0324"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: eca:ECA4108 osmolarity response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84139"
FT                   /db_xref="GOA:C6C7Z4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Z4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS84139.1"
FT                   /translation="MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLT
FT                   RESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIP
FT                   KPFNPRELLARIRAVLRRQANELPGAPSQEEAIISFGKFKLNLGTREMFRDDEPMPLTS
FT                   GEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYI
FT                   QTVWGLGYVFVPDGSKA"
FT   gene            372615..373973
FT                   /locus_tag="Dd703_0325"
FT   CDS_pept        372615..373973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0325"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   eca:ECA4107 osmolarity sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84140"
FT                   /db_xref="GOA:C6C7Z5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Z5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS84140.1"
FT                   /translation="MIRWRFSPRSAFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQ
FT                   FNKVLAYEVRMLMTDKLQLEDGSTLEVPPAFRREIYRELGISLYTNAAAEESGLRWAQH
FT                   YKFLSQQMAQQLGGPTEVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRY
FT                   TLAIMLLVIGGAWLFIRVQNRPLVELEHAATQVGRGIIPPPLREYGASEVRSVTRAFNH
FT                   MAAGVKLLADDRTLLMAGVSHDLRTPLTRIRLATEMMSKEDDYLAESINKDIEECNAII
FT                   EQFIDYLRTGQEMQMEVADLNSILGEVVAAESGYERVIDSQFADGELTVRISPLSIKRA
FT                   ALNLVVNATRYGNGWIRVSSGRELQRAWFQVEDDGPGIDPLQLKHLFQPFVRGDSARST
FT                   SGTGLGLAIVQRIVDAHNGSLDIGTSERGGLRIRAYLPLTFSSPVAVAAKKGG"
FT   sig_peptide     372615..372707
FT                   /locus_tag="Dd703_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.464 at
FT                   residue 31"
FT   gene            complement(374177..375796)
FT                   /locus_tag="Dd703_0326"
FT   CDS_pept        complement(374177..375796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0326"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="KEGG: eca:ECA4106 phosphoenolpyruvate carboxykinase;
FT                   TIGRFAM: phosphoenolpyruvate carboxykinase (ATP); PFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84141"
FT                   /db_xref="GOA:C6C7Z6"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Z6"
FT                   /inference="protein motif:TFAM:TIGR00224"
FT                   /protein_id="ACS84141.1"
FT                   /translation="MQITDIRPEALLVYGIHDVREIVYNPSYDLLFEEETSPALQGYER
FT                   GVETRLGAVAVDTGIFTGRSPKDKYIVRDDVTRNTVWWSDQGKGKNDNHPLSQETWQHL
FT                   KQRVTQQLSGKRLFVVDTFCGANADSRLKVRFITEVAWQAHFVKNMFIRPSDEELQSFE
FT                   PDFIVMNGAKCTNPQWQEQGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSIMNYLL
FT                   PLKGIASMHCSANVGEKGDVAVFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDDGVFNFE
FT                   GGCYAKTINLSAEAEPDIYHAIRRDALLENVTVLTDGTVDFSDGSRTENTRVSYPIYHI
FT                   DNIVKPVSKAGHATRVIFLTADAFGVLPPVSRLTSDQTQYHFLSGFTAKLAGTERGITE
FT                   PTPTFSACFGAAFLSLHPTQYAEVLVKRMQAAGAKAYLVNTGWNGTGKRISIKDTRGII
FT                   DAILDGSIDDAETTELPIFNLAIPTSLPGVDPAILDPRDTYADPAQWQSKAEDLAQRFV
FT                   ANFDKYTDTPAGAALVSAGPQR"
FT   gene            complement(376067..376939)
FT                   /locus_tag="Dd703_0327"
FT   CDS_pept        complement(376067..376939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0327"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: eca:ECA4105 HSP33-like
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84142"
FT                   /db_xref="GOA:C6C7Z7"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Z7"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ACS84142.1"
FT                   /translation="MANHDQLHRYLFENYAVRGELATVSETFQHMLANHDYPAAVKTLL
FT                   GELLVATSLLTATLKFSGDITVQVQGDGPLKLAVINGNHQQQMRGVARLQGEVTQGSSL
FT                   REMVGNGYLVITITPTEGERYQGVVGLDGDTLAACLENYFQQSEQLPTRLFIRTGEHEG
FT                   KSCAAGMLLQVLPSQQGSRDDFDHLAQLTATVKGEELFGLAANDVLYRLYHQESVTLYE
FT                   PQPVEFQCHCSRERCADALMTLAESEIQEILEQDGQIDMHCDYCGSHYLFSQSDIAALR
FT                   QARPTQTLH"
FT   gene            complement(376966..377379)
FT                   /locus_tag="Dd703_0328"
FT   CDS_pept        complement(376966..377379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0328"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; KEGG: eca:ECA4104 heat shock
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84143"
FT                   /db_xref="GOA:C6C7Z8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Z8"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACS84143.1"
FT                   /translation="MSKKPESDDDHAVRLDKWLWAARFYKTRAIAREMVDGGKVHYNGQ
FT                   RSKPSKLVELDAEITLRQGNDARTVIVCAISDQRRSAQEAQTLYQETPASIEKREKLAL
FT                   ARKLNALSMPHPDRRPDKKERRDLIKFKYSDTE"
FT   gene            complement(377390..378067)
FT                   /locus_tag="Dd703_0329"
FT   CDS_pept        complement(377390..378067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0329"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: eca:ECA4103 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84144"
FT                   /db_xref="GOA:C6C7Z9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6C7Z9"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACS84144.1"
FT                   /translation="MSSELNWSEIDTVLLDMDGTLIDLAFDSYFWLQLVPQTLSHRRGI
FT                   SLEQAHQLVEREYHAVQHTLNWYSLDYWSKQLELDIYQMTSDIGHRASLRQDTAPFLNA
FT                   LRTRGKKTILLTNAHPHSLSVKVEHTGLDQYLDLLLSTHTYGYPKEDQRLWHAVQAQTG
FT                   FNPARTLFVDDSEPILDAAKTFGIRYCLGVSNPDSTSRKEKQFFQHPSMNDYRGLLPAL
FT                   GQP"
FT   gene            complement(378156..380300)
FT                   /locus_tag="Dd703_0330"
FT   CDS_pept        complement(378156..380300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0330"
FT                   /product="Intracellular growth attenuator IgaA"
FT                   /note="PFAM: Intracellular growth attenuator IgaA; KEGG:
FT                   eca:ECA4102 intracellular growth attenuator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84145"
FT                   /db_xref="GOA:C6C800"
FT                   /db_xref="InterPro:IPR010771"
FT                   /db_xref="UniProtKB/TrEMBL:C6C800"
FT                   /inference="protein motif:PFAM:PF07095"
FT                   /protein_id="ACS84145.1"
FT                   /translation="MSTILIILAVLFTTLIAIGAFIGYRMHRRTIFAKRLPTTPAGHRQ
FT                   LTPEECIAVEHYLDMNVQNRASSAFPSPAPCRPRLLQNSRVYQISHSINRYGLGTDAPN
FT                   QWRYFIDTQEIYLPAQWEQYIAQDNQIELIKTRSIPLVISLNGHSLSELVDNLHTTAGR
FT                   DIPGDRASISAEQHEHTELVSIRKETQEEHAIHRSRGIRDASLLGLAFLLLVFSLNSPI
FT                   TILPWLAGTALLIAIWCCWQLFRPPLSRELRDVHCLNGTPQCLGLFSDMGQTPLKNVSL
FT                   GNIDLIYPPHWQPYIGYDLGKKTDVDIYLNRQVVRQGKYLSLHNEVKFFPLQHWGRNLV
FT                   LACGSLISLLLLLVYIPLDLPLKLSMAWMQGVENIHVSQVDELERMTLHIGDKLQIQGS
FT                   GMCYVPPLNHDTPAPKSSSFSPFDCSAIYWNKAAPLPLPESEIIDKTIALKKTLNDQLH
FT                   PPANNDSSVNSPLANTIQKSGMILLNDFSDIVLKTDALCEKDDDCVRLKNALVNLGNAK
FT                   NWDMLVKRARTGALKGTSVILRPVSAESLESLVNNAADSFYGREISAATNSLNSPSPGG
FT                   FLIRSDEGRQFVTHPLPGTPLRDFPPQEQWQELQRLSSLLLRTPFSANGVITQISVDAN
FT                   GTRHLSLHSEPDAVTLWRSLGSCLLLLMFGVIVVLNLALIIIKYRRGQQRIANIQQYYA
FT                   RHLAPEAPASAVVYGNTIHS"
FT   sig_peptide     complement(380241..380300)
FT                   /locus_tag="Dd703_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.677) with cleavage site probability 0.602 at
FT                   residue 20"
FT   gene            380733..381287
FT                   /locus_tag="Dd703_0331"
FT   CDS_pept        380733..381287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0331"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: eca:ECA4100 ADP-ribose
FT                   diphosphatase NudE"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84146"
FT                   /db_xref="GOA:C6C801"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C6C801"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACS84146.1"
FT                   /translation="MNNNLQKPRILKVETVARSRLFDVESVDLEFSNGARRVFERMRPS
FT                   GREAVMIVPVIDDELLLIREYAVGIEQYELGFPKGLIDPGETVFEAANRELMEEAGFGA
FT                   EQFELLSTLTMAPSYFSSTMNVVIARGLYPQQLEGDEPEPLQQVRWPLRDMMTLLQEPD
FT                   FREARNVSALFLAQQRLSRDD"
FT   gene            complement(381362..383917)
FT                   /locus_tag="Dd703_0332"
FT   CDS_pept        complement(381362..383917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0332"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: eca:ECA4099 peptidoglycan
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84147"
FT                   /db_xref="GOA:C6C802"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C6C802"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ACS84147.1"
FT                   /translation="MKFVKYLLILAVSCILLGTASLYGLYRYIEPQLPDVATLKDVRLQ
FT                   TPMQVYTADGELIAQFGEKRRIPLKLDQIPPVMVRAFIATEDSRFYEHHGIDPQGIIRA
FT                   TMIALTSGHASQGASTITQQLARNFFLSPEKTLLRKIKEVFLAVRIEQMMTKDEILELY
FT                   LNKIYLGYRAYGVGAAAQVYFGRTIDQLTLGEMAMIAGLPKAPSTFNPLYSYDRAIARR
FT                   NVVLARMLDENYITQAQYDQARNEKLNADYHAPEVAFSAPYMAEMVRQEMVKRYGEDAY
FT                   NDGYKVYTTITRKLQQAADEAVRNNVMAYDMRHGYRGPDQELWKPRTAAWPQDKITEAL
FT                   KKLPTYGPLMPAAVLDATADKAHAMLPSGEKIELTLAGVRWARAYRSDTEQGPTPKRVM
FT                   DVLDAGQQIWVRKVDKEWWLGQVPDVNSALVSVNPTNGAILALVGGFDFSQSKFNRATQ
FT                   ALRQVGSNIKPFLYTAAMDKGLTLATILNDAPITRWDPGAGSDWSPKNSPPVYDGPIRL
FT                   RQGLGQSKNVVMVRAMRAMGVDYAADYLERFGFPEQNIVHTESLALGAASFTPLQVVRG
FT                   YAVMANGGYLIDPYFISKIENEAGATVFSASPKIVCDTCNLPVIYGETQRSAVLSDDSM
FT                   ENVATSQENPVQTAPQADPITPSEVARQANQSYAPHVISTPLAFLIKDALNSNVFGEPG
FT                   WMGTGWRAGKVLQRHDIGGKTGTTNNSKDAWFSGYGPNIVASVWIGFDDHRRDLGRSSV
FT                   SGVIRDQISGYEGGAKTAEPAWDDFMKVALAGLPEQKTPTPPGVVSVVIDRSSGKLSDG
FT                   GGNSRQEYFIDGTQPTEKAVHDAGTTLFNTSSGQAEELF"
FT   sig_peptide     complement(383843..383917)
FT                   /locus_tag="Dd703_0332"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.444 at
FT                   residue 25"
FT   gene            384035..384886
FT                   /locus_tag="Dd703_0333"
FT   CDS_pept        384035..384886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0333"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84148"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:C6C803"
FT                   /inference="similar to AA sequence:KEGG:ECA4098"
FT                   /protein_id="ACS84148.1"
FT                   /translation="MAYPVWQIGMDVQNGVLRALAVQRRRHGWQLRQWWQLPLPGDTLR
FT                   GGSLHNPAALCAVLQRWKRELPHYVSLRLAFPADRVLQQRLSEPDGRLREPERGWYIEK
FT                   MAAKKLPVSSDALIFDYRIDPAVADSVLVTAARKAELALWLDCFRHAGLQLDAVDITPC
FT                   ALRCMAHQAGLASDNMLVHRFEDRWLWISSLNAPLAFGTVHVDDAADFSALLSYVSAHY
FT                   EPMASEPIYLSTSAPDFLPEASSSFTLWSPLPAFSQQQPPLPAFPSAFVIAGGLAIRPE
FT                   DV"
FT   gene            384886..385446
FT                   /locus_tag="Dd703_0334"
FT   CDS_pept        384886..385446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0334"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   spe:Spro_4609 fimbrial assembly family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84149"
FT                   /db_xref="GOA:C6C804"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:C6C804"
FT                   /inference="protein motif:PFAM:PF05137"
FT                   /protein_id="ACS84149.1"
FT                   /translation="MPMTNLLPWRQSRRQYRMRRLVCALVIQFAATSIVLFAMRLQFRQ
FT                   QQHVLRQLIVQISDGQRQYAGLSLQAADLRRQVLAQQALLDQKRQNQQRNQRYLTLLEQ
FT                   LPRVIPDVIWLTSVSDSNAAIRLSGVSNHYSSVVEFSKRLAGLPVFTVAELQEAQRDHS
FT                   DASRLQFSLRLYWKPVTDAERQP"
FT   sig_peptide     384886..385002
FT                   /locus_tag="Dd703_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.817) with cleavage site probability 0.778 at
FT                   residue 39"
FT   gene            385443..386003
FT                   /locus_tag="Dd703_0335"
FT   CDS_pept        385443..386003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0335"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA4096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84150"
FT                   /db_xref="GOA:C6C805"
FT                   /db_xref="UniProtKB/TrEMBL:C6C805"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84150.1"
FT                   /translation="MIEGVLLRFSRWLHVPLRVSLPVQTLGVMALSIVFGILLAAHERN
FT                   QLRELRQQQEEGMRQIAEWRQKLIAMPAISDLRRQRDEYSVSGRTLTTEVVVALVEQSL
FT                   RDAGVSLVSWQSRDVENASGVTSGWLLVFAGGYEGVLRFLRSMDAIPGALRVEHLHISK
FT                   MQHELRVEVLLSAPVPDSPERSV"
FT   gene            386000..386371
FT                   /locus_tag="Dd703_0336"
FT   CDS_pept        386000..386371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA4095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84151"
FT                   /db_xref="InterPro:IPR019684"
FT                   /db_xref="UniProtKB/TrEMBL:C6C806"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84151.1"
FT                   /translation="MRLLWGAACGFLLAGAQATEWRDPFQPIASRACEQESAASWRLKG
FT                   VIGDGLRWSGWLEQPQQAWRRIRLGDVLQPEGWRVVQLGRQGGVFRPEGGDAACKNEDV
FT                   YLVAPLQHSIDETGQKNAE"
FT   sig_peptide     386000..386056
FT                   /locus_tag="Dd703_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.843 at
FT                   residue 19"
FT   gene            386382..387662
FT                   /locus_tag="Dd703_0337"
FT   CDS_pept        386382..387662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0337"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; Secretin/TonB short
FT                   domain; NolW domain protein; KEGG: eca:ECA4094 putative
FT                   outer membrane porin HofQ"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84152"
FT                   /db_xref="GOA:C6C807"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:C6C807"
FT                   /inference="protein motif:TFAM:TIGR02515"
FT                   /protein_id="ACS84152.1"
FT                   /translation="MKGMFIYGMTLVMAAQCADTWANAETPVSLAFDDVPVQRVLQALA
FT                   EHQQLNLVIAPGVEGNVSLTLERVPWRQALDIILRMGDLTLEREGRVLMVYPREHLEML
FT                   RLQQAEEDERKQQQQALLNLSVTLRHAESTEVAASLQSQRGTLLTERGSVTVDKRTNTL
FT                   IVRDVSSALEQIRSWLDVLDKPLAQVQLAAHIVTISSEHLKALGVNWGLDAGDATKQAL
FT                   RMNNFNINLPVETPTVNAGFHLARLNGRLLDLELMALEQEDEVEIIASPRLFTAHQQTA
FT                   SIKQGTEIPYQVSSGASGSTSIEFKEAVLGMEVTPRILQGGFITLNLLISQNMPGRSIK
FT                   QGEGEMLAIDKQEIQTQVTVKDGETIVLGGIFQQQKNRTERKVPGLGALPGIGRLFSSS
FT                   DRQNTRRELVIFITPTLIQASLPTKQP"
FT   gene            387943..388512
FT                   /locus_tag="Dd703_0338"
FT   CDS_pept        387943..388512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0338"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: esa:ESA_04351
FT                   shikimate kinase I"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84153"
FT                   /db_xref="GOA:C6C808"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C6C808"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ACS84153.1"
FT                   /translation="MAGRVIINEFLSNTKKMAEKRNIFLVGPMGAGKSTIGRQLAQQLN
FT                   MEFFDSDQEIERRTGADVGWVFDLEGEEGFREREEKIINELTEKQGIVLATGGGSVKSR
FT                   ETRNRLSARGVVVYLETTIEKQLARTQRDKKRPLLQVENPPREVLEALARERNPLYEEI
FT                   ADVTIRTDEQSAKVVANQIISMLENN"
FT   gene            388566..389651
FT                   /locus_tag="Dd703_0339"
FT   CDS_pept        388566..389651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0339"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="TIGRFAM: 3-dehydroquinate synthase; PFAM:
FT                   3-dehydroquinate synthase; KEGG: yen:YE3974
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84154"
FT                   /db_xref="GOA:C6C809"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:C6C809"
FT                   /inference="protein motif:TFAM:TIGR01357"
FT                   /protein_id="ACS84154.1"
FT                   /translation="MERITVTLGERSYPITIAAGLFQEPGSFMPLKTGDQAMLVTNETL
FT                   APLYLDTVRSVLEKGGIRVDQVILPDGEQYKSLAVMEQVFSALLEKPHGRDTTLIALGG
FT                   GVIGDLTGFAAACYQRGVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASV
FT                   VIDINCLKTLPARELSSGLAEVIKYGIILDRAFFEWLEGHIEEVRALKEGPLAYCIRRC
FT                   CELKADVVAADERESGLRALLNLGHTYGHAIEAEMGYGNWLHGEAVAAGMMMASHTAHR
FT                   LGQFSVEDIERVASLLLRAGLPVTGPAEMAPESYLPHMMRDKKVLAGELRLVLPTAIGR
FT                   SEMRGGVPHELVLASIADCLP"
FT   gene            389784..390833
FT                   /locus_tag="Dd703_0340"
FT   CDS_pept        389784..390833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0340"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: eca:ECA4091
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84155"
FT                   /db_xref="GOA:C6C810"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032899"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C6C810"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ACS84155.1"
FT                   /translation="MDEFNPEEELKPDASDRRPTRPQSRNRSAGFSMPSVSLSRQHTMI
FT                   GIGIVVLLLLIVGIGSALQSPGQGPTQQSGAAKNIDLSSSMTQSQQSGSLPPPTAPAQT
FT                   TSVPSGNQSAADPQSLSGQPISSSPTQAVPSSPNGNQQRIELPGNITDALSQPQQQDRV
FT                   NALSQGAMGDGAISGLPTAPATVVPTGKGHTQSMDKSPTMRQPTKPAEIKADKETSRHV
FT                   VDNVHKMPTTAITPAPASKPAAVSKPATVAASGHGGSIQSAPVSAFTLQLSSASREESL
FT                   KAYARDQRLANYWVYETKRDGKPWYVLVNGVYASSDDAKRAIASLPADVQAKKPWVKPI
FT                   RQVKQDLTK"
FT   gene            390911..391726
FT                   /locus_tag="Dd703_0341"
FT   CDS_pept        390911..391726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0341"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: eca:ECA4090 DNA adenine methylase; TIGRFAM:
FT                   DNA adenine methylase; PFAM: D12 class N6 adenine-specific
FT                   DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84156"
FT                   /db_xref="GOA:C6C811"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6C811"
FT                   /inference="protein motif:TFAM:TIGR00571"
FT                   /protein_id="ACS84156.1"
FT                   /translation="MKKNRAFLKWAGGKYPLVEEIRRYLPAGECLIEPFVGAGSVFLNT
FT                   DYSHYILADINSDLINLYNIVKNETDEFIGDARQLFIDRVNTPDAFYLLRDEFNICTHA
FT                   YRRALLFLYLNRHCYNGLCRYNMRGEFNVPFGRYKKPYFPEEELHWFAEKAQNATFVCE
FT                   HYHQTLINAAAGSVVYCDPPYAPLSATANFTAYHTNNFNNQDQLNLARLALRLSAESRI
FT                   PVLISNHDTLLTREWYQDASSLYVVRARRTISRNITGRSKVNELLALYC"
FT   gene            391850..392527
FT                   /locus_tag="Dd703_0342"
FT   CDS_pept        391850..392527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0342"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="KEGG: eum:ECUMN_3844 D-ribulose-5-phosphate
FT                   3-epimerase; TIGRFAM: ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84157"
FT                   /db_xref="GOA:C6C812"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:C6C812"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ACS84157.1"
FT                   /translation="MKPFLIAPSILSADFARLGEDTEKALKAGADVVHFDVMDNHYVPN
FT                   LTIGPLVLKSLRDYGITAPVDVHLMVKPVDRLIPDFAQAGANFITFHPEASEHVDRTLQ
FT                   LIRDNGCKAGLVFNPATPLSYLDYVMDKLDIILLMSVNPGFGGQSFIPATLDKLRQVRR
FT                   RIDDGGYDIHLEVDGGVKVDNIADIAAAGADMFVAGSAIFGQPDYQAVIARMRQELAKV
FT                   SHG"
FT   gene            392520..393221
FT                   /locus_tag="Dd703_0343"
FT   CDS_pept        392520..393221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0343"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   eca:ECA4088 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84158"
FT                   /db_xref="GOA:C6C813"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6C813"
FT                   /inference="protein motif:TFAM:TIGR01449"
FT                   /protein_id="ACS84158.1"
FT                   /translation="MADLTSIRGIAFDLDGTLVNSAPGLADAVDMALRAMALTPAGEAR
FT                   VITWIGNGADVLVERALRWAGGEITTRLIQDTRSLFDKYYARTVDSGSSLFPDVEETLA
FT                   ALSAQGVPLAVVTNKPTPFVAPLLEVLGIGHYFSLIVGGDDVPQKKPHPAPLYLVMGKL
FT                   GLRANELLFVGDSRNDIQASQAAGCPCVGMTYGYNYGEAIALSGPDVVLDRFADLLPLV
FT                   GASLSNHQDAL"
FT   gene            393218..394222
FT                   /locus_tag="Dd703_0344"
FT   CDS_pept        393218..394222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0344"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: kpe:KPK_0361 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84159"
FT                   /db_xref="GOA:C6C814"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:C6C814"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ACS84159.1"
FT                   /translation="MSKPIVFSGAQPSGELTIGNYMGALRQWVNMQDEFDCIYCIVDQH
FT                   AITARQDPQQLRKATLDTLALYLACGIDPQKSTIFVQSHVPEHAQLGWLLNCYTYFGEL
FT                   SRMTQFKDKSARYAENINAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDVAQR
FT                   FNSIYGDIFKVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDPKSVVKKIKR
FT                   AVTDSDEPPVVRYDLENKPGVSNLLDILSAVTGQTVAELETAFEGQMYGHLKGAVADAV
FT                   SGMLSELQERYYRFRNDEAFLQQVMRDGAAKAGARAQETLRKVYDVVGFVARP"
FT   gene            394472..395626
FT                   /locus_tag="Dd703_0345"
FT   CDS_pept        394472..395626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0345"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: eca:ECA4077 putative mandelate racemase /
FT                   muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84160"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C6C815"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACS84160.1"
FT                   /translation="MKIESIDVTVFTYPTRRVSDSAGHSHPGDEHQASMALLTITADEG
FT                   SKGYAFSPVEVVRPYVVNAFFRKVLIGQDPFQRERLWQDLVHWQRGSAHQLTDRALAIV
FT                   EQALWDLIGRKLNVPVYQLLGGYRDKVPAYGSTMCGDELSGGLSTPEEYGLFAEKLVQR
FT                   GYKAIKLHTWMPPVSFAPSPKMDVKACAAVREAVGPDICLMLDGYHWYSRSDALYIGRE
FT                   LQKLNFTWFEEPMEEQSMASYSWLSKNLEIDVIGPESLGGKYFSRADWVKEGACDILRA
FT                   GVQGVGGIAPCVKVAHLAESFGMDCEIHGNGAANLAVVGAIKNCRWYERGLLHPFLNYD
FT                   EPAAYLNALVDPMDENGFVHLPQAPGLGEDINFAWIDAHTISKA"
FT   gene            395966..396538
FT                   /locus_tag="Dd703_0346"
FT   CDS_pept        395966..396538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0346"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: eca:ECA4071 peptidyl-prolyl
FT                   cis-trans isomerase A (rotamase A)"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84161"
FT                   /db_xref="GOA:C6C816"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C6C816"
FT                   /inference="protein motif:PFAM:PF00160"
FT                   /protein_id="ACS84161.1"
FT                   /translation="MSKRILAAVATVLSLTAFSPAFAASGSTHVLLTTSAGNIELALED
FT                   QKAPGSVKNFVDYVNSGFYNGTIFHRVIPGFMVQGGGFSSDLKQKSPNPPIKNEADNGL
FT                   RNLRGTIAMARTSEKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQ
FT                   VQTENVGPYQNVPIKPIVIQSAKVIKK"
FT   sig_peptide     395966..396037
FT                   /locus_tag="Dd703_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            complement(396599..398194)
FT                   /locus_tag="Dd703_0347"
FT   CDS_pept        complement(396599..398194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0347"
FT                   /product="diguanylate cyclase with hemerythrin-like
FT                   metal-binding domain"
FT                   /note="KEGG: ajs:Ajs_4122 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; hemerythrin-like metal-binding
FT                   protein; PFAM: GGDEF domain containing protein; Hemerythrin
FT                   HHE cation binding domain protein; SMART: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84162"
FT                   /db_xref="GOA:C6C817"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:C6C817"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS84162.1"
FT                   /translation="MHADVPTMFMMIIVCSSALAICMRWSAHGIKDRALIICTRALVCH
FT                   ATAYSLYALRGTIPDVISIVAANILIATTYSTLLLAITQFQQRHIRPVILWLPVIFTAG
FT                   FFSIMLDNQYARTLASSLICLSQAILVVTYLMTQDQSLPTRGRNLMVLGLTINVMAFIV
FT                   RIILLIYTGATPFSVLSSSTAQTVTYMTSFMTLLFIANGMIMMAKDRAEHLNNLMARQD
FT                   SLTGCWNRIRIQEIARQEMERLERYGYPVSLLMFDLDHFKEVNDKFGHSVGDKVLKGFS
FT                   DTALALLRTTDVFGRWGGEEFVAILPATGFTGAVQTAERIRAALEAQTFPGGVKITTSI
FT                   GVSVCQSTDHWESWLGRADAALYRAKAAGRNRTETETLVSQGHDVSLPDSNLVRLIWND
FT                   AYNIGNQAIDQEHRQLFNRANQLLQVIVLNGSQTAFMVQLRELIDELSDHMQHEEQFLW
FT                   DAHHPDADQHAKIHNHLLWRAEEMVQRYEQQQIGLIELFHYVVYEVITQHMLIEDRKLN
FT                   LSSYNVEVHHALQE"
FT   gene            complement(398592..398966)
FT                   /locus_tag="Dd703_0348"
FT   CDS_pept        complement(398592..398966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0348"
FT                   /product="glutathione S-transferase"
FT                   /note="KEGG: eca:ECA1072 glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84163"
FT                   /db_xref="GOA:C6C818"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6C818"
FT                   /inference="similar to AA sequence:KEGG:ECA1072"
FT                   /protein_id="ACS84163.1"
FT                   /translation="MNESRSICVLWLLEAAHIPYELIIYQRNQDNPLAPDTLKATPPLG
FT                   KSPELEDNGEIIVESGAIVEYWIKRYASQFAPAEHSEDNIAYLQWIRCAESAAMTPMLF
FT                   ILFNGTLSQPCHPSRAYFSS"
FT   gene            complement(399001..399678)
FT                   /locus_tag="Dd703_0349"
FT   CDS_pept        complement(399001..399678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0349"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: eca:ECA3563
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84164"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6C819"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACS84164.1"
FT                   /translation="MNVLMVLTSHDQLGHTGKKTGFWLEEFAAPYYTFKDAGMNVVLAS
FT                   PAGGQPPLDPKSDLPDFQTASTHRFKADAASQHALATTVKLDTVNMDDFDAVFYPGGHG
FT                   PLWDLAESADSIALIEAFERAGKPIGFVCHAPGVLRHVKAANGDPLIKGRHVTGFTNSE
FT                   EAAVELSAIVPFLIEDEFQQLGGLYTKGSDWTPYIVEDGKLITGQNPASSEGVAEALLK
FT                   QLQ"
FT   gene            complement(399725..399886)
FT                   /pseudo
FT                   /locus_tag="Dd703_0350"
FT   gene            complement(399903..401168)
FT                   /locus_tag="Dd703_0351"
FT   CDS_pept        complement(399903..401168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0351"
FT                   /product="pectate lyase"
FT                   /note="KEGG: eca:ECA4070 pectate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84165"
FT                   /db_xref="GOA:C6C820"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C6C820"
FT                   /inference="similar to AA sequence:KEGG:ECA4070"
FT                   /protein_id="ACS84165.1"
FT                   /translation="MKRNLLFAVLCGASVLSAQAASTAAPDLKGFGTDTVAGSGGKIIR
FT                   VTTLAASGSGSLREALATKGPRIIVFEVGGVIDLNEADLKLSEPYVTIAGQTAPSPGIS
FT                   LIKGGMVISTHDVLMQHIRFRIGDAGHAKKSGFEKDVSLYGPNAYNVVVDHCSFAWGTD
FT                   ENLSVSGPRYDGQSGTAHNVTFSNNIIAEGLYNASHSKGIHSMGTLVHDNVTNAAIIGN
FT                   LYAHNNERNPWFKGGSTGVVVNNLIYNPGVWAIRVGAIQSEWEGKTLPENPKVAIAGNV
FT                   MYYGANTPSGLALVGSNTTGGNVWMNDNLAYNAAGKAVSQTSGTDITQLKAAPVWPTGL
FT                   TAISASSVASQVTQKAGARPNDRDSVDQRIVSNFQKRTGAFVDSQDDVGGYPTATTVKR
FT                   TLTVPSSNVDAWLQQLAKALEE"
FT   sig_peptide     complement(401106..401168)
FT                   /locus_tag="Dd703_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 21"
FT   gene            complement(401304..402431)
FT                   /locus_tag="Dd703_0352"
FT   CDS_pept        complement(401304..402431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0352"
FT                   /product="Pectate lyase/Amb allergen"
FT                   /note="PFAM: Pectate lyase/Amb allergen; SMART: Pectate
FT                   lyase/Amb allergen; KEGG: eca:ECA4069 pectate lyase III"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84166"
FT                   /db_xref="GOA:C6C821"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C6C821"
FT                   /inference="protein motif:PFAM:PF00544"
FT                   /protein_id="ACS84166.1"
FT                   /translation="MKALITPIAAGLLLALSLPALAASTGGYATTAGGNISGAVSKTAT
FT                   SMQDIVDIIAAARYDSSGKKVKNGAYPLIITYTGNEDSLINAAAANICAQSAKDARGVE
FT                   VKDFTKGITIIGANGSSANFGIWIVNSSDVIVRNMRIGYLPGGASDGDMVRIDNSPNVW
FT                   IDHNELFAANHECDGSKDGDTTFESAVDIKKGATYVTVSYNYIHGVKKVGLSGFSSSDT
FT                   AERNITYHHNVYNDVNARLPLQRGGNVHAYNNLYTNVTSSGLNVRQSGKALIESNWFQD
FT                   AVNPVTSRYDGSNFGTWVLKNNNITKPADFTTYGITWTADTKAYVNADSWTSTGTYPTV
FT                   SYSYSPVSAQCVKNKLANYAGVSKNLAELTSSSCN"
FT   sig_peptide     complement(402363..402431)
FT                   /locus_tag="Dd703_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 23"
FT   gene            complement(402889..404019)
FT                   /locus_tag="Dd703_0353"
FT   CDS_pept        complement(402889..404019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0353"
FT                   /product="Pectate lyase/Amb allergen"
FT                   /note="PFAM: Pectate lyase/Amb allergen; SMART: Pectate
FT                   lyase/Amb allergen; KEGG: eca:ECA4069 pectate lyase III"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84167"
FT                   /db_xref="GOA:C6C822"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C6C822"
FT                   /inference="protein motif:PFAM:PF00544"
FT                   /protein_id="ACS84167.1"
FT                   /translation="MKSLVTPIATGLLLAVGLPTLAASTDTGGYATTAGGDITGAVSKT
FT                   ATSMQDIVDIIAAARYNDSGKKVKNGAYPLIITYTGNEDSLINAAAADICSQWSKDARG
FT                   VEIKEFTKGITIIGANGSSANFGIWIKKSSDVVVRNMRIGYPPGGASDGDMIRVDDSPN
FT                   VWIDHNELFAANHECDGTPDGDTTFEAAVDIKGDSEYVTVSYNYIHGVKKVGLDGSSSS
FT                   DTGRNVTYHHNLYSDVNARLPLQRGGLVHAYNNLYTGVTSSGLNVRQNGLALIESNWFE
FT                   NAVNPVTSRYDGKNFGTWELRNNNITSASDFTTYGITWTSDTKAYVNADTWTSTGTFPT
FT                   VSYSYSPVSAQCVKNKLASYAGVSKNLAVLTSSACN"
FT   sig_peptide     complement(403951..404019)
FT                   /locus_tag="Dd703_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.907 at
FT                   residue 23"
FT   gene            404444..405790
FT                   /locus_tag="Dd703_0354"
FT   CDS_pept        404444..405790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0354"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   vvu:VV2_1425 glutamate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84168"
FT                   /db_xref="GOA:C6C823"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6C823"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /protein_id="ACS84168.1"
FT                   /translation="MKLDKTLMIPPEGIPDAQRQDILRAYMANMHERRSHFVGFQTNQS
FT                   GSFQEDLRPLLQMNLLNLGDNTEPGAYQVNSKAFELAVLDYYARLWNMPLSAWGYLTAM
FT                   GSTEGNLFALWNAREYLCGAATAPTTPVVLYSDRGHYSLAKAAQLLQLPTPADIGPTLG
FT                   RCPVNDGVWSPTVGCDAAGRVKVDELMRLTTFFYRHGRPVILCLTCGTTFSGACDDWPQ
FT                   ITEHLRRLLPPNTEQQRHYWLHIDGALSANYLSFWPEPDGRHLAVHGKASALHSVCCSP
FT                   YKWLGMSWPCGVVMLSEAFQVTARARPDYIGSRDATLSGSRPGLTAVVLWEMLSRLGEQ
FT                   GQQALIRHCFAVREYAHSQLQQLFARLDPMGVRLCLYPLVCGSLMVQFTAPSPAVIDYF
FT                   SLSTEQRMWRGQPTQVCHLVLLPHCRRALIDELVRRLEQPGAFTSVGGQ"
FT   gene            405792..406805
FT                   /locus_tag="Dd703_0355"
FT   CDS_pept        405792..406805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fph:Fphi_0374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84169"
FT                   /db_xref="GOA:C6C824"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR036719"
FT                   /db_xref="InterPro:IPR036734"
FT                   /db_xref="UniProtKB/TrEMBL:C6C824"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84169.1"
FT                   /translation="MRILWLCMVFFISLPAWSLPQNSQSDARPTSVEVSIFINKIYSVN
FT                   TLEQTYKVDGYMVAQWTDAPRKTPNNKPLIIENNQIDPFIAKGQWVPALEFINVVGSPD
FT                   TSNKRLVLYPDGRVIYNARFLGTFSNDMDFRRFPFDRQQFVLELEPFSYSNQHLRFSKV
FT                   TVYNENVGNQDIDEWWMTGTPVTRISNVHYDHLDAGENEYSRVTVQIDARRNPSYYLWS
FT                   FILPLGLIIAASWSVFWLESFSEQLQTAFTLMLTVVAYAFYTSNILPRLPYTTIIDQMI
FT                   ITGYGSIFASILLIIFAYHHQMEGTPDRVLIRRCRVIFPVAVVLFCGLLIVRGMGL"
FT   sig_peptide     405792..405848
FT                   /locus_tag="Dd703_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.676 at
FT                   residue 19"
FT   gene            406802..408088
FT                   /locus_tag="Dd703_0356"
FT   CDS_pept        406802..408088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0356"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="KEGG: dal:Dalk_2018 PAS/PAC sensor hybrid histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84170"
FT                   /db_xref="GOA:C6C825"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:C6C825"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84170.1"
FT                   /translation="MRHSSWQSVLLEALFASLIFVGLLGFSTYMVYHKSINALEQEIKI
FT                   GLLSNVRSAASTLSGDLHQRITGQTSPDDPVYQQLAAEMERMREASQDVRYIYTTVLDG
FT                   DTVRFVVNPSPQNDNDGDGLPDPAPALMQVYDNAPPELVTALREHQTGVSVEPYRDQWG
FT                   TFISAYAPFYDRQGRFSGILAMDLELSSFYQRLEAINRVFSKANVTIAFLGLMVGLMVC
FT                   WLRRSSQQVRQQLASREQDYQSLQQATEPLQLRRVYDWPLPLLFLRGGAYPRLMEALPS
FT                   DDASPGGATRDVRQASLRDWWLSQTLSLRPCAASELVVNLNDATEACFAPEHLHAFWQR
FT                   SFLLWRQLARQPLTIVVGVKDEDLMHWVLDIRLTLTCEPEALSDDDRDWWNRFLRWQGE
FT                   AAAEQVVIREVARGQLCLDWRVPKFEEAL"
FT   gene            408085..409227
FT                   /locus_tag="Dd703_0357"
FT   CDS_pept        408085..409227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0357"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   xau:Xaut_3861 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84171"
FT                   /db_xref="GOA:C6C826"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6C826"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS84171.1"
FT                   /translation="MIQRFLPALLIFQTFVLQLVSGINYVTIPVLMNQQGNSNLWIGIA
FT                   MACEIVGVLLFHQRLSLMISKVGLVWVTLLLVLLRAALCASMMWQQFFLGWLVAILGYG
FT                   LCTGMQLILLQTWLNRLPLRRRGMVMGMFSAALSLGVALGPVLLQMLSMTLAERFWLTA
FT                   LLSLGELTLVWVAFVSPQSGGMAAVRFRFVHRHARAILVSALVGGVSFYGLPNFLTLYG
FT                   MSDGLTEERASLLMTMFMLGSVTLGMLVSLLSDWVNRQWIVVSCIFCAVVCAVFLTLAV
FT                   YSDYGVTLGLLYVWGGCMGGVYSIGLSLIGDRFHPQQQMSANMSYTMMDSLGGIVGLIG
FT                   IGLMMDVMGTEGMTMVLVVVGCTFLCYLVWELTEMRTPFQ"
FT   gene            409370..409993
FT                   /locus_tag="Dd703_0358"
FT   CDS_pept        409370..409993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0358"
FT                   /product="glycoside hydrolase family 19"
FT                   /note="PFAM: glycoside hydrolase family 19; KEGG:
FT                   pap:PSPA7_2430 lytic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84172"
FT                   /db_xref="GOA:C6C827"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C6C827"
FT                   /inference="protein motif:PFAM:PF00182"
FT                   /protein_id="ACS84172.1"
FT                   /translation="MALDITQEKLQQLMPNASAEDIALFQPALQQECLEAGINTSLRFA
FT                   HFIAQIAHESAELRARSENLNYSAKGLRAVFGRYFTTDQMAEQYARKPEAIANVVYANR
FT                   LGNGATESGDGWAFRGRGLIQLTGRDNYRTCGEAIGHKLTDDPDVIGQKPEISVAVAIW
FT                   FWNRNQLNVLADQDDLNAITRRINGGLNGLEDRKAYLEKAKRLF"
FT   gene            410479..411696
FT                   /locus_tag="Dd703_0359"
FT   CDS_pept        410479..411696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0359"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: smt:Smal_2105 putative sigma54
FT                   specific transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84173"
FT                   /db_xref="GOA:C6C828"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C828"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS84173.1"
FT                   /translation="MKTAGNILKKSKINVFRTGQVNRWEIPVATALPEFISLSASLRNQ
FT                   IQKIAALKKSIILYGEPGTELSDVAAYIFMQTQEPQAGYIEFHHATYQPAMLDDVIRKL
FT                   NRQQNFTLFFQNFDEFSADQQQDIMNRLKMLRFIGRTPLHFARLIFGLRHTLAQSQQSG
FT                   RLSVMLGRHLDYHQVYISPLRERPQDVVELLHIACREFRQSGSQQIHPDVLQQLQHYDW
FT                   PGNAQQLRRSIARLLMLSDNREIGLNQAHGILPEIIRLPAVSASASLAVTDPVLCDTLL
FT                   KCDEQALRQFHPSVSKALLFLGENFQRELTLSALAEKAHISPSHLSYLLKHSLKLSFKQ
FT                   ILNQIRIFYACQQLKCRPLSRITNLYLDCGYGDLSHFEKMFKRYTGLTPVEFRKTLKPV
FT                   IVREDT"
FT   gene            411699..412094
FT                   /locus_tag="Dd703_0360"
FT   CDS_pept        411699..412094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0360"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: swd:Swoo_2358 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84174"
FT                   /db_xref="GOA:C6C829"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C6C829"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS84174.1"
FT                   /translation="MSAMVPAATDILTPVMPLSCQDRLFQQACDYMLKHLCEKISLDNV
FT                   CQAVGTNRNKLSALFRARCGYGVARWLREQRLKKAAELLYLTDMSVCLVAVELGFSDAA
FT                   NFCHSFKLKYGISPREYRQSCIFHANK"
FT   gene            412229..412816
FT                   /locus_tag="Dd703_0361"
FT   CDS_pept        412229..412816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bur:Bcep18194_B1924 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84175"
FT                   /db_xref="InterPro:IPR024510"
FT                   /db_xref="UniProtKB/TrEMBL:C6C830"
FT                   /inference="similar to AA sequence:KEGG:Bcep18194_B1924"
FT                   /protein_id="ACS84175.1"
FT                   /translation="MADSSVQDSATAQLGNIPFGTLIGGPLNAAVEAQANAAKSSVDFI
FT                   RQVAIGEDGQIRSVVFKYEKEGQNATLSVPVLTIVPIPYLRIDYLDIAFKANISASTTT
FT                   SDKSSSSSQLDVKANASWSGWGAKVNFSAAYSSKKDSSSARDSKYNVEYTMDINLHAVQ
FT                   DDMPAGMNKVLNILQECITSKPASATTTTASA"
FT   gene            412877..413662
FT                   /locus_tag="Dd703_0362"
FT   CDS_pept        412877..413662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0362"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pin:Ping_2136 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84176"
FT                   /db_xref="UniProtKB/TrEMBL:C6C831"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84176.1"
FT                   /translation="MAQLDQFLGTVLTDLTQARVTSDICSRDTSRFYQQDPVLRSYSVP
FT                   RVALDSFEFELQFAITGVKVRKNDYDDKLKLERMYACGGLQLAEKMCQHSDQYLTNRDG
FT                   IDTMQPAVRTLLMRLRNSSERSKLSQSLIQLLNEAQLVDEEGHFQSDKAAPLLVDRFVQ
FT                   IATQDLELSESLRLVMPELRNELKQVTDRELDELENSVRFLMECSEDFNLEVEVCADRL
FT                   RERPVNTLSTLKLKGGFKNYVWTQSHQQDGTLVQKLVHE"
FT   gene            413674..414231
FT                   /locus_tag="Dd703_0363"
FT   CDS_pept        413674..414231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lch:Lcho_2130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84177"
FT                   /db_xref="InterPro:IPR024510"
FT                   /db_xref="UniProtKB/TrEMBL:C6C832"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84177.1"
FT                   /translation="MSKQDSIEFYELIGAPLLGFVQAEHQAAQATLEMVEQLGFEHTSE
FT                   GKRLRTTAFFTEKCGADGRIERTEHQIPILSLMPIPMMQTKHADLEFGIKINDFELSAT
FT                   SPGLASTEEENGFMAPRRLQMKASLGRMDAGDGGQHRGAQMDMRIKLTIQPGDFPNGIS
FT                   RLLRLMDEAGYSRPLPEGENKA"
FT   gene            414228..414470
FT                   /locus_tag="Dd703_0364"
FT   CDS_pept        414228..414470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0364"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84178"
FT                   /db_xref="UniProtKB/TrEMBL:C6C833"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84178.1"
FT                   /translation="MSRKQFIDAGSIACPGCQHPIAVHWQLLQQGVNPRCAHCGLTLEL
FT                   DRASSADALDAAEQLNTRLDDAERRRLAAMPPGRR"
FT   gene            414470..415294
FT                   /locus_tag="Dd703_0365"
FT   CDS_pept        414470..415294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0365"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84179"
FT                   /db_xref="UniProtKB/TrEMBL:C6C834"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84179.1"
FT                   /translation="MFRADFYGLKGMPPSVLNRQTLVEQRLQQCWKVIRPALKVRLEQA
FT                   FFEHPEQYDGSWWWQGYGCNDHWGRWYQQTLSLWVLWRSLCHGGKRQPRWPADILVDLP
FT                   ELEQEAGDLWFQWACQFAGSPVYPDAQQVVAALQQWLRRFELLRQVELDVSLQPSLADG
FT                   DRLGLDTMQRHWPMLCQAAAQHCWLPLRVFPDGKPWQSLALLLVAQSDALRLECHDPMQ
FT                   QRTVWLYQEQQRFWLTSDRGPLRVHSFYPLAAARPALKPSFWLRCRHRLHLR"
FT   gene            415478..415792
FT                   /locus_tag="Dd703_0366"
FT   CDS_pept        415478..415792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0366"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_II1638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84180"
FT                   /db_xref="UniProtKB/TrEMBL:C6C835"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84180.1"
FT                   /translation="MTMPSLEMPKVLAFVAGVGSSNRTTAGAQQVRVSFPQPLAAGVTP
FT                   VVAVTPLQGSEYAPGSIPDTFALTITGINNTGFTVNIWRVDNGGKGWGQNLRLSCLISA
FT                   "
FT   sig_peptide     415478..415558
FT                   /locus_tag="Dd703_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.753) with cleavage site probability 0.508 at
FT                   residue 27"
FT   gene            416229..416807
FT                   /locus_tag="Dd703_0367"
FT   CDS_pept        416229..416807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0367"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   yen:YE3958 para-aminobenzoate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84181"
FT                   /db_xref="GOA:C6C836"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6C836"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACS84181.1"
FT                   /translation="MSLLIIDNYDSFTYNLYQYFCELGAQVTVMRNDELTLADIERLAP
FT                   QRLVISPGPCTPDDAGISLAAIRHFAGKLPILGVCLGHQALGQAFGAQVIRARQVMHGK
FT                   TSAIRHSGQGVFLGLENPLTVTRYHSLILASETLPACFDVTAWTERDGRPDEIMGIRHR
FT                   ALPLEGVQFHPESILSRQGHQLLKNFMNL"
FT   gene            416929..418149
FT                   /locus_tag="Dd703_0368"
FT   CDS_pept        416929..418149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0368"
FT                   /product="succinylornithine transaminase family"
FT                   /note="TIGRFAM: succinylornithine transaminase family;
FT                   acetylornithine and succinylornithine aminotransferase;
FT                   PFAM: aminotransferase class-III; KEGG: eca:ECA4065
FT                   bifunctional
FT                   N-succinyldiaminopimelate-aminotransferase/acetylornithine
FT                   transaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84182"
FT                   /db_xref="GOA:C6C837"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:C6C837"
FT                   /inference="protein motif:TFAM:TIGR03246"
FT                   /protein_id="ACS84182.1"
FT                   /translation="MATEKSAVTRETYDKVILPIYAPAQFVPVKGKGSRVWDQQGKEYI
FT                   DFSGGIAVTALGHCHPALVEALKTQGETLWHTSNVFTNEPALRLASKLIAATFADRVFF
FT                   ANSGAEANEAAFKLARHYAIERHSPYKTKIIAFYQAFHGRTLFTVSVGGQAKYADGFGP
FT                   KPADIIHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITPATPEFLTGVRELCDQYNAL
FT                   LVFDEVQCGMGRSGKLFSYMHYGVRPDILTTAKALGGGFPISACLTTEEVASVMSVGLH
FT                   GTTYGGNPLACAVAEAALDVINTPEVLSGVEARHERFAAALHRINERFGIFDEVRGMGL
FT                   LIGAQLKKAWHGRARDFLSASAELGLMILVAGPDVIRFVPSLVIELDDIDQGMALFEQA
FT                   VAKVVEQ"
FT   gene            complement(418218..418850)
FT                   /locus_tag="Dd703_0369"
FT   CDS_pept        complement(418218..418850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0369"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: kpe:KPK_0374 catabolite gene activator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84183"
FT                   /db_xref="GOA:C6C838"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C838"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACS84183.1"
FT                   /translation="MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVK
FT                   GSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFR
FT                   QLIQVNPDILMRLSSQMARRLQVTSQKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDG
FT                   MQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR"
FT   gene            419166..419573
FT                   /locus_tag="Dd703_0370"
FT   CDS_pept        419166..419573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0370"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: eca:ECA4063
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84184"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6C839"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACS84184.1"
FT                   /translation="MQARVKWVEGLTFLGESASGHQVLMDGNAGDKAPSPMEMVLMAAG
FT                   GCSAVDVVSILQKGRQDVADCEVRLTSERREEAPRMFTTINLHFIVKGRGLTDKAVERA
FT                   VALSAEKYCSVALMLGKTVHITHSHEVVELE"
FT   gene            complement(419626..420495)
FT                   /locus_tag="Dd703_0371"
FT   CDS_pept        complement(419626..420495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0371"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   eca:ECA4062 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84185"
FT                   /db_xref="GOA:C6C840"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C840"
FT                   /inference="protein motif:PRIAM:2.7.1.19"
FT                   /protein_id="ACS84185.1"
FT                   /translation="MSHQHPIIAVTGSSGAGTTTTSLAFHKIFQQLNIRAAQVDGDSYH
FT                   RYTRPEMDMAIRKARDLGRHISYFGPEANDFSLLEQAFIDYGRSGSGKTRKYLHTYDEA
FT                   IPYKQVPGTFTPWEPMPEPTDILFYEGLHGGVVTESHNVAQHVDLLVGVVPIVNLEWMQ
FT                   KLVRDINDRGHSREAVMDSVVRSMEDYITYITPQFSRTHINFQRVPTVDTSNPFAAKSV
FT                   PSMDESFVVIHFQGMSNIDYPYLLAMLQGSFISHINTLVVPGGKMGLAMELIMTPLVQR
FT                   LLAGDNIG"
FT   gene            complement(420613..420849)
FT                   /locus_tag="Dd703_0372"
FT   CDS_pept        complement(420613..420849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0372"
FT                   /product="protein of unknown function UPF0270"
FT                   /note="PFAM: protein of unknown function UPF0270; KEGG:
FT                   set:SEN3290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84186"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/TrEMBL:C6C841"
FT                   /inference="protein motif:PFAM:PF06794"
FT                   /protein_id="ACS84186.1"
FT                   /translation="MIIPWQALAPDTLENLIESFVLREGTDYGEHERSLAEKVEDVHLQ
FT                   LQRGEVVLVWSELHETVNIMPRNALRSGVIHDG"
FT   gene            complement(420851..421843)
FT                   /locus_tag="Dd703_0373"
FT   CDS_pept        complement(420851..421843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0373"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: eca:ECA4060
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84187"
FT                   /db_xref="GOA:C6C842"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6C842"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACS84187.1"
FT                   /translation="MNTYPLHNSAFQPLGGMRNPHLQTLLPRLFRRRPSLTPVWQTLDT
FT                   PDGDFVELAWSEPPQPAAHKPRVVLFHGLEGNFRSPYAHGLMAACRERGWLAVIMHFRG
FT                   CSGVPNRRTRIYHSGETGDADYFLQWLEKTLGPAPTAAIGISLGGNMLACLLGRQGERC
FT                   SLNAAAVVSAPLLLEPCSRRIEQGFSRIYQSYLVNSLRQSALRKLAAYPGTIPVSPSRI
FT                   KQVRGLREFDDLITARLHGFHDAADYYRRCSAMPLLPQIRTPTLIIQAKDDPFMTPEVI
FT                   PDPSQLPPCVEYQLTEHGGHVGFVSGSWRHPEMWLEHRIPDWFTPYLEQ"
FT   gene            421929..422534
FT                   /locus_tag="Dd703_0374"
FT   CDS_pept        421929..422534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0374"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   eca:ECA4059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84188"
FT                   /db_xref="GOA:C6C843"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C6C843"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACS84188.1"
FT                   /translation="MDHVSLFLSMLGFLWVAAITPGPNNMLLTASAANFGFLRSLPLML
FT                   GIMIGMQSILLLVSLGLGSLILLYPPLHLALKVLGSAYLLWLSWKIASAAYERLDLDTA
FT                   PSAPMPLYQGGLLQFLNPKAWLMSLGAVAGFSLAGDGYTGSVLSISVAMALVNAVAGAV
FT                   WLAFGAAIGRLLRSPVAWKRFNISMGILTAACVLMIWH"
FT   gene            complement(422593..424506)
FT                   /locus_tag="Dd703_0375"
FT   CDS_pept        complement(422593..424506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0375"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA4058 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84189"
FT                   /db_xref="GOA:C6C844"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C6C844"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS84189.1"
FT                   /translation="MIVLSSLQIRRGTRVLLDNATATINPGQKVGLVGKNGCGKSTLLS
FT                   LLKGELSADGGNLTFPQNWSLAWVNQETPALDRSALDYVIDGDREYRQLEASLQQANAH
FT                   NDGNAIATLHGKLDAIHAWSINARAASLLNGLGFQQEQLQQPVSAFSGGWRMRLNLAQA
FT                   LICRSDLLLLDEPTNHLDLDAVIWLEKWLKNYPGTLILISHDRDFLDPIVNKILHIEQE
FT                   ILFEYTGNYTSFEQQRITRLAQQQALYEHQQERVSHLQSYIDRFRAKASKAKQAQSRIK
FT                   MLERMELIAPAHVDNPFRFSFRAPEALPNPLLRMEKVSAGYGERLILDSIKLNLVPGSR
FT                   IGLLGHNGAGKSTLIKLLAGELQPFSGEIGLAKGVRLGYFAQHQLEFLRADESPLQHLT
FT                   RLADRETEQQLRDYLGGFGFRGDKVTENTERFSGGEKARLVLALIVWQRPNLLLLDEPT
FT                   NHLDLDMRQALTEALIDFDGALVVVSHDRHLIRSTTDDLYLVHDGKVDPFDGDLEDYQR
FT                   WLLDAQKTQGNAADDTKDTNANNAQARKEQKRRDAELRAMTQPLRKEIARLEKQMETLQ
FT                   NTLAGVEARLSDNAIYEADRKNELTECLQTQSKTKAELEEVEMAWLDAQEQLEALSRST
FT                   ED"
FT   gene            424628..425179
FT                   /locus_tag="Dd703_0376"
FT   CDS_pept        424628..425179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0376"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   spe:Spro_4561 glutathione-regulated potassium-efflux system
FT                   ancillary protein KefG"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84190"
FT                   /db_xref="GOA:C6C845"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023947"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6C845"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ACS84190.1"
FT                   /translation="MLQPPKILLLFAHPESQDSIANKLLLQSARPLGHVTVHDLYAQYP
FT                   DFFIDVHYEQQLLREHQVIVFQHPLYTYSCPALLKEWFDRVLTRGFANGVGGNALAGKY
FT                   WRSVITTGEPESAYHPSGVNRFTLSEALVPFEMTAAMCHMHWLSPLVIYWARRLPRDVL
FT                   VEHARAYGDWLMSPLPQGDR"
FT   gene            425182..426990
FT                   /locus_tag="Dd703_0377"
FT   CDS_pept        425182..426990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0377"
FT                   /product="potassium efflux system protein"
FT                   /note="TIGRFAM: potassium efflux system protein; PFAM:
FT                   sodium/hydrogen exchanger; TrkA-N domain protein; KEGG:
FT                   eca:ECA4056 glutathione-regulated potassium-efflux system
FT                   protein KefB"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84191"
FT                   /db_xref="GOA:C6C846"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR020884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C6C846"
FT                   /inference="protein motif:TFAM:TIGR00932"
FT                   /protein_id="ACS84191.1"
FT                   /translation="MESSAVLSAIILFLFAAVLAVPVASRLGIGAVLGYLMAGIAIGPW
FT                   GLGFIRDVEAILHFSEMGVVFLMFIIGLELEPAKLWRLRRSIFGTGATQVALSAAVLGG
FT                   VLYVNQFSWQAALIGGIGLAMSSTAIALQLMREKSMHRGESGQLGFSVLLFQDLAVIPA
FT                   LALIPVLAGVQGELGDWRQIAFKVMAFAGMLVGGRYLVRPLFRFIAASGVREVFTAAAL
FT                   LLVLGSAMFMEALGLSMALGTFLAGVLLAESEYRHELEIAIEPFKGLLLGLFFISVGMS
FT                   LNLGVLYANILLVLTAVVILVVVKGAILYLLARMYGLRSSERMQFAGVLSQGGEFAFVL
FT                   FSAAAAHNVLKGNQLPLLLVTVTLSMMVTPLLMQVIDRILKRRFNHQEEHDDEAHYVED
FT                   DKPQVIVVGFGRFGQVVARLLMANKMRITVLDRDISAVRLMRAYGYKVYYGDATQLELL
FT                   RAAGAEQAESLVITCSDPEHLMTIVRLCQQHFPHLTILARARGRVEAHELLQAGVTQFT
FT                   RETFSSALELGRKTLISLGVHPHQAYRAQQHFRRLDMRMLRELMPQHMGDVSQISRVKE
FT                   ARRELEDIFEREMQRERWRPDDWDEY"
FT   sig_peptide     425182..425244
FT                   /locus_tag="Dd703_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.966 at
FT                   residue 21"
FT   gene            427046..427240
FT                   /locus_tag="Dd703_0378"
FT   CDS_pept        427046..427240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84192"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:C6C847"
FT                   /inference="similar to AA sequence:KEGG:ECA4055"
FT                   /protein_id="ACS84192.1"
FT                   /translation="MRKRFIAGAVCPQCHSQDTLAVGREDEQDVVVCVRCGYRQRQPEA
FT                   GQKPEEAASDRLIGIFRPQ"
FT   sig_peptide     427046..427096
FT                   /locus_tag="Dd703_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.906) with cleavage site probability 0.899 at
FT                   residue 17"
FT   gene            427346..427945
FT                   /locus_tag="Dd703_0379"
FT   CDS_pept        427346..427945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0379"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   ent:Ent638_3766 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84193"
FT                   /db_xref="GOA:C6C848"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C6C848"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ACS84193.1"
FT                   /translation="MKVAKDLVVSLAYQVRTEDGVLVDESPVSAPLDYLHGHGSLISGL
FT                   EKALEGRDVGERFDVSVGANDAYGEYDENMVQRVPKDVFMGVDELQVGMRFLAETDQGP
FT                   LPVEITEVQDEHVVVDGNHMLAGQNLKFNVEVVAIREATEEELAHGHVHGAHDHDHDGC
FT                   CGGHGDHDGCCGGHDHDHSHEHGKGGCGGNGGCGCH"
FT   gene            complement(428016..429383)
FT                   /locus_tag="Dd703_0380"
FT   CDS_pept        complement(428016..429383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0380"
FT                   /product="ethanolamine transproter"
FT                   /note="TIGRFAM: ethanolamine transproter; PFAM: amino acid
FT                   permease-associated region; KEGG: eta:ETA_25540 putative
FT                   ethanolamin permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84194"
FT                   /db_xref="GOA:C6C849"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:C6C849"
FT                   /inference="protein motif:TFAM:TIGR00908"
FT                   /protein_id="ACS84194.1"
FT                   /translation="MTMQLKPTLGTLHLWGIAVGLVISGEYFGWSYGWGVAGTLGFLIT
FT                   TLIIAAMYTCFIFSFTELTTAIPHAGGPFAYSRRAFGETGGLIAGMATLIEFVFAPPSI
FT                   AMAIGAYLNVQYSSLDPRYAAAGAYVIFMTLNILGVRLAAMFELFVTVLAVIELLVFMG
FT                   VVAPGFSISHFVANGWAGSDSFDSPAISGIFAAIPFAIWFFLAIEGAAMAAEEAKDPQR
FT                   TIPKAYISGIITLVVLALGVMIMAGGVGDWRTLSNINDPLPQAMKAVVGENSGWMHMLV
FT                   WIGLFGLIASFHGIILGYSRQFFALARAGYLPAGLAKLSRFQTPHRAILTGGVIGIATI
FT                   FSDSWINLQGLSLTAAMITMAVFGANVMYLMSMLSLFRLRRTEPGLHRTFYAPGYPIIP
FT                   AIALVLSVVCLLAMLWFNPVIGGLFIVLMLAGYSYFLMTRSQRDNAPQDAMLMGKE"
FT   gene            429719..430720
FT                   /locus_tag="Dd703_0381"
FT   CDS_pept        429719..430720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0381"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   eta:ETA_25530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84195"
FT                   /db_xref="GOA:C6C850"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6C850"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACS84195.1"
FT                   /translation="MAEQYDTLDNTTLDHLAGLAMKRYPPALQGKLTLLCRSENATYRL
FT                   AAGGKRYAMRIHRPGYHQREEIACELQWLTALREEGIMVPEPLRGLDGETVQRVTLADG
FT                   TQRNVVLFHWIDGEMPTTEVDAGAFEQLGMITARLHQHSRRWTQPAGFRRIIWDHDTMV
FT                   GRESHWGRWQDAPNLAVSDHGVIEETLQQVGDAVAVYGKDSQRYGLIHADLRLTNLLLH
FT                   RGETRVIDFDDCGFGWYLHDLAAAISFVEHHPSAPAWVEGWINGYQRVCSLNDADLAVI
FT                   PSLLIQRRIQLMAWAGSHRQTEQAVSLGAQWSAHTVRLCRRYLERRALPVGA"
FT   gene            430864..431907
FT                   /locus_tag="Dd703_0382"
FT   CDS_pept        430864..431907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0382"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: eta:ETA_25520 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84196"
FT                   /db_xref="GOA:C6C851"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:C6C851"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS84196.1"
FT                   /translation="METTSFRLPPMADLSIGHRGILAAAASGLAGFIGEKGGDADRILG
FT                   VSGVDPELLACPTLSLGLVNYCRVLEEAARYSDCDNFGLHYGRQFKPQALGLIGYVGLC
FT                   SATLEQALHNVVNAFPLHQHDTLIRLVDKGDCWRFDYQVRHGAILHCRQDAELTLGMIL
FT                   NLIRHAAGKSWAPREVHFEHPRPEQWHEHCKVFDAPVYFDQPFNSLLIPKRDLLRTMPD
FT                   HDPLLQLLVQDALRQLNGDVHQQSVVDMARARLRQILPQGEPSLDEVAENIGLSSWSLQ
FT                   RRLKEEGINFTQLVEKVRCEMATHYLQQRQLSISEMAFLLGYSEVSAFSRAFRRWFGIS
FT                   PRQWRKA"
FT   gene            complement(431932..432150)
FT                   /locus_tag="Dd703_0383"
FT   CDS_pept        complement(431932..432150)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0383"
FT                   /product="SlyX family protein"
FT                   /note="PFAM: SlyX family protein; KEGG: eta:ETA_31750 host
FT                   factor for lysis of phiX174 infection SlyX"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84197"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:C6C852"
FT                   /inference="protein motif:PFAM:PF04102"
FT                   /protein_id="ACS84197.1"
FT                   /translation="MSQQQLEQRIELLESRLAFQELTIDELNQTVVQHELEMTRLREQL
FT                   RMLVEKLQAASTSMIASQSEETPPPHY"
FT   gene            432356..433192
FT                   /locus_tag="Dd703_0384"
FT   CDS_pept        432356..433192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0384"
FT                   /product="FKBP-type peptidyl-prolyl isomerase domain
FT                   protein"
FT                   /note="PFAM: FKBP-type peptidyl-prolyl isomerase domain
FT                   protein; peptidylprolyl isomerase FKBP-type; KEGG:
FT                   spe:Spro_4556 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84198"
FT                   /db_xref="GOA:C6C853"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:C6C853"
FT                   /inference="protein motif:PFAM:PF01346"
FT                   /protein_id="ACS84198.1"
FT                   /translation="MKSLFKVTLLATAMTLALNTGAMAEEAAKPVAAATDAAKAPAAQF
FT                   KSDEEAAAYALGASLGRYMDNSLKEQEKLGIKLDKQLLIQGVQDAFADKSKLSDEDIEK
FT                   TLQSFEGRVKEAAQAKMKQDAKDNADKGTKFRDEFAKDKGVKKTESGLLYQVDKEGTGA
FT                   APKDSDTVVVNYKGTLVDGTEFDNSYKRGEPLSFRLDGVIPGWTEGLKHVKKGGKIKLV
FT                   IPPSLAYGESGVPGIPANSTLVFDVELLDIKSDTANKAADAKGEKPADAKAKKSAQ"
FT   sig_peptide     432356..432430
FT                   /locus_tag="Dd703_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(433377..434735)
FT                   /locus_tag="Dd703_0385"
FT   CDS_pept        complement(433377..434735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0385"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   rlt:Rleg2_5225 transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84199"
FT                   /db_xref="GOA:C6C854"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C854"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACS84199.1"
FT                   /translation="MTNTLDSAWLAEQIDDASTKGIAQITATLIREGRIPIGTQLPAVR
FT                   ELAERLGVSPATISAAWGQLKRQKTIAGKGRSGVWVCGDHATPRPVRFEKIGNYGCGIQ
FT                   ADLAMACPDPQLLPDLQEAMQQGVRSGKLNSYQRDLITPTLRQALAPRWPFQAQAFMAT
FT                   DGGFDAMNLIIQTLVSPGDKVMIEDPTATRLLDMLDNVGAELLPLACDEQGPQPEILEM
FT                   QLKKSPVMFIYQPRTHSAAGHTVSESRSAELARLLADSATLVVEDDGIGELSAWPVWSL
FT                   GRYYPERTLHVRSFSKAYGPDLRLAVLSGPESLVKRLQSFRNFGASWTSRILQDAVAWM
FT                   LTDPATQRKLQRARDCYADRRRQLLNALAQRGMPLPDRDGLSIYLPVASEQFAMITLAA
FT                   RGIAVLPGERCRCGSAQFIRVSTSMLNKEQVESIADALVLAAGMEIGGHHADL"
FT   gene            434881..435843
FT                   /locus_tag="Dd703_0386"
FT   CDS_pept        434881..435843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0386"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_2840 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84200"
FT                   /db_xref="UniProtKB/TrEMBL:C6C855"
FT                   /inference="similar to AA sequence:KEGG:Veis_2840"
FT                   /protein_id="ACS84200.1"
FT                   /translation="MITIRLAVRDWDYFTPLALGDVRSERFHIEVHRVNTLVDDLATSE
FT                   HYDAGEVSFSRYAQARAKGDTSLLGVPHFLMRGFRQRCIITTAENPVTSLEQLKGGRIG
FT                   VTGWQDSGNTWTRALLREVGVGIEDVHWYAGRLTEDHPIVDRLGRFGRPGRIEAAPGER
FT                   PLIELLHAGELDAVFTPFMPQGFFLPASGLRQVQADFRQAELAYFRRVGYVPGIHMLGI
FT                   KPALVESLPWLPGELSQLIEQSAQVWQQKREKYADTTPWLLDDLRRTAQDLPANWNDNG
FT                   FDANRNMIADFARELYEQEITATLLTPEVIFPAFASQGA"
FT   gene            435847..436641
FT                   /locus_tag="Dd703_0387"
FT   CDS_pept        435847..436641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0387"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: eta:ETA_23610 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84201"
FT                   /db_xref="GOA:C6C856"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C6C856"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACS84201.1"
FT                   /translation="MKVAMGQFAVSREWQENADICLSLMARSLEAGADLLVMPEGVLAR
FT                   DIADPDLVLKAAQPLDGPFVSQLLAASRGNKLTTMMSVHVPTENQRALNVLIAIRDGEI
FT                   VARYDKLHLYDAFSMQESQRVTPGDVVPPLVDVAGMKVGLMTCYDVRFPELARRLVLDG
FT                   ADVLVLPAAWVKGPLKEMHWDVLVTARALENTCYMVAVGECGPRNIGNSMVVDPLGVSI
FT                   AKAAEGSALVMAELDPARIASARDALPVLKNRRFARPELNTQ"
FT   gene            436659..437549
FT                   /locus_tag="Dd703_0388"
FT   CDS_pept        436659..437549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0388"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   ara:Arad_8818 amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84202"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C6C857"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS84202.1"
FT                   /translation="MMKKSAYALALALGMVTGVGYAAESIPVQKVDQALHDRLPDDIKQ
FT                   AGKIVAVNNGSFPPYEIVKSPTEMDGASADLAEAVGQLLGVKIEHATVSGLSGVLAGIK
FT                   SGRYQMAIGPVGDYPDRQKENDFIDYVQEFVVFAVQKGNPQKINGLDDTCGKSIAVMAG
FT                   GSAEQVIRQQSKVCTDAGKPAVTVQSFTDQPSSILAVRSKRSDAFFSSQAPLVYFVDQA
FT                   NGQLELTAVGKKNGFGDIFQGSVVPKDSQLGKVLLDTYKELFKNGTYAAIMKKWKLDNN
FT                   TIAEPGVNLAKGAAK"
FT   sig_peptide     436659..436727
FT                   /locus_tag="Dd703_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 23"
FT   gene            437546..438526
FT                   /locus_tag="Dd703_0389"
FT   CDS_pept        437546..438526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0389"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: ara:Arad_8820 amino
FT                   acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84203"
FT                   /db_xref="GOA:C6C858"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C858"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS84203.1"
FT                   /translation="MIDDATDSRTSENADVKARDVAFAHSAPRYGRLVSWIVVSLVAAD
FT                   FFWLVATNPNFEWQVVVQWFTEGSVMKGLEVTLGLTVIAMLLGVALGLLLAVARLSDNR
FT                   LLSGLSGLYIWFFRGTPLLVQLIFWYNLSTLFPTISLAIPITGPTFISWKTNDLITPLT
FT                   AAIAGLALNEAAYMAEIIRAGLLSVDQGQIETTQAFGMSRVRALRRIIIPQAMRAIIPP
FT                   TGNQLISMIKATSLVSVIAMGDLLYSVQAIYNRTFEIIPMLMVAVIWYLLITSILNVGQ
FT                   SAIERYYARGSRRTVSVGKRRQTSGQEQERVSAVAGQPWMKKEEA"
FT   gene            438523..439293
FT                   /locus_tag="Dd703_0390"
FT   CDS_pept        438523..439293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0390"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ara:Arad_8821 amino acid ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84204"
FT                   /db_xref="GOA:C6C859"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6C859"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS84204.1"
FT                   /translation="MSDITPLVRARNVQKSYGDNDVLKGIDLDVYPGEVVVILGPSGSG
FT                   KSTFLRCINHLEDMDAGSIMVGEEQIGYELKHGRLHRLSPRRIARQRQEIGMVFQQFNL
FT                   YPHMTVLQNIIEAPIGVHKQPREEAVRYAKELLTTVGLSDKIDAWPRHLSGGQQQRVAI
FT                   ARALAVKPRLMLFDEPTSALDPELVGEVLATMRTLAEQGLTMIVVTHEIGFAREAADRV
FT                   VFMDGGVVVEQGSAEAVLSNPRHPRTQAFLSRFI"
FT   gene            complement(439431..440516)
FT                   /locus_tag="Dd703_0391"
FT   CDS_pept        complement(439431..440516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0391"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   eca:ECA4045 sensor protein BasS/PmrB"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84205"
FT                   /db_xref="GOA:C6C860"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6C860"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS84205.1"
FT                   /translation="MTPVPEGQTASIRTRLILTLGSILLVCQVLSVVWLWHESEEHIQL
FT                   LVEQTLTAKDLNHDIQFEINEAIASLTIPSLVMIIAALVMSTHAINRITQPLLTLQDEL
FT                   QQRSSENLEPLKQRSDVTEIAAVITSMNQLFVRFSESLRRDRQFASNVAHELRTPLAGV
FT                   RLSLELHEQLHHIDCQPLIKRVDYLTKVIEQLLLLARVGNALAAGHYDNVSLVNDVITP
FT                   KQEELLEMAALRHQQLDWQWDTAAGTVPGNTTLLQLLLRNLVENAYRYSPESSTIRVRI
FT                   IHLDDDSCELRVEDEGPGIDEAQVGELTKAFVRMDTRYGGIGLGLSIVTRIVQLHHGEF
FT                   FLENRKDCSGTCARVVLPTHL"
FT   gene            complement(440513..441181)
FT                   /locus_tag="Dd703_0392"
FT   CDS_pept        complement(440513..441181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0392"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: eca:ECA4044 DNA-binding transcriptional
FT                   regulator BasR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84206"
FT                   /db_xref="GOA:C6C861"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6C861"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS84206.1"
FT                   /translation="MKLLIVEDDALLQEGLLQAMRNEGYTCDCATTAKEADALINSAHY
FT                   SLIVLDLGLPDGDGLTLLTRWRNNQHSQPVLILTARDTVDERVTGLNIGADDYMIKPFA
FT                   LSELLARIRALIRRHQGSSENLIQVDNITLDLNSQQVMLDSKPVILTPKEFAILSRLIL
FT                   KAGSQVHREVLHQDIYNWDDDPSSNSLEVHIHNLRQKIGKNRIKTLRGFGYLLTKDDQQ
FT                   "
FT   gene            complement(441178..442831)
FT                   /pseudo
FT                   /locus_tag="Dd703_0393"
FT   gene            442984..443733
FT                   /locus_tag="Dd703_0394"
FT   CDS_pept        442984..443733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0394"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: eca:ECA4042
FT                   putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84207"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:C6C862"
FT                   /inference="protein motif:PFAM:PF08348"
FT                   /protein_id="ACS84207.1"
FT                   /translation="MMTLRVVSAMSTSLVNGESGDLDMLDERPFTQTDYEILKSYEAVV
FT                   DGLAMLIGDHCEIVLHSLDDLKCSAIRIANGEHTGRKIGSPITDLALRMLHDMAGEDSS
FT                   VSKAYFTRAKSGVLMKSVTIAIRNREQRVIGLLCINMNLDVPFSQIMQTFMPPEIKEVA
FT                   SSVNFASSVDDLVAQTLEFTIEEVNADRNVSNNAKNRQIVLNLYEKGIFDIKDAINQVA
FT                   DRLNISKHTVYLYIRQFKSGDFSGHDR"
FT   gene            443733..444122
FT                   /locus_tag="Dd703_0395"
FT   CDS_pept        443733..444122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0395"
FT                   /product="sulfur relay protein TusD/DsrE"
FT                   /note="TIGRFAM: sulfur relay protein TusD/DsrE; PFAM: DsrE
FT                   family protein; KEGG: eca:ECA4041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84208"
FT                   /db_xref="GOA:C6C863"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C6C863"
FT                   /inference="protein motif:TFAM:TIGR03012"
FT                   /protein_id="ACS84208.1"
FT                   /translation="MLSYCLLVTGPAYGTQQASSAFQFAQALLASGHALQSVFFYQEGV
FT                   LNANQLTSPANDEFDLVRAWRQLASEHSVTLNVCVAAALRRGVTDRQQADQLRLPADNL
FT                   QPGFVLSGLGELSQSVLTCDRVVQF"
FT   gene            444143..444502
FT                   /locus_tag="Dd703_0396"
FT   CDS_pept        444143..444502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0396"
FT                   /product="sulfur relay protein TusC/DsrF"
FT                   /note="TIGRFAM: sulfur relay protein TusC/DsrF; PFAM: DsrE
FT                   family protein; KEGG: eca:ECA4040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84209"
FT                   /db_xref="GOA:C6C864"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR037450"
FT                   /db_xref="UniProtKB/TrEMBL:C6C864"
FT                   /inference="protein motif:TFAM:TIGR03010"
FT                   /protein_id="ACS84209.1"
FT                   /translation="MKRVAFVFTQPPHGSAAGREGLDALLAMSALTDEIGVFFISDGVL
FT                   QLLPHQQPDLILMRNYIATFGVLPLYDVERCYLCRSSLQRRGIPENTNWVLDVELLTPD
FT                   AWRSALNTYDAVLTF"
FT   gene            444512..444799
FT                   /locus_tag="Dd703_0397"
FT   CDS_pept        444512..444799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0397"
FT                   /product="sulfur relay protein TusB/DsrH"
FT                   /note="TIGRFAM: sulfur relay protein TusB/DsrH; PFAM: DsrH
FT                   family protein; KEGG: eca:ECA4039 putative intracellular
FT                   sulfur oxidation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84210"
FT                   /db_xref="GOA:C6C865"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR023526"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C6C865"
FT                   /inference="protein motif:TFAM:TIGR03011"
FT                   /protein_id="ACS84210.1"
FT                   /translation="MLHTFSHSPYQTDIDALLDSLGVGDAVLLLQDGVIAALGAASVLS
FT                   RLQQSGVRVYALRSDVDARGLGNQISTEIQLIDYTEFVQLTVKHARQLAW"
FT   gene            444935..445309
FT                   /locus_tag="Dd703_0398"
FT   CDS_pept        444935..445309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0398"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: kpn:KPN_03727 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84211"
FT                   /db_xref="GOA:C6C866"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6C866"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ACS84211.1"
FT                   /translation="MATINQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
FT                   SGVKDRKQSRSKYGVKKPKA"
FT   gene            445406..445876
FT                   /locus_tag="Dd703_0399"
FT   CDS_pept        445406..445876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0399"
FT                   /product="ribosomal protein S7"
FT                   /note="TIGRFAM: ribosomal protein S7; PFAM: ribosomal
FT                   protein S7; KEGG: eca:ECA4037 30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84212"
FT                   /db_xref="GOA:C6C867"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:C6C867"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ACS84212.1"
FT                   /translation="MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAETIVYT
FT                   ALETLAQRSGKDHLEAFEAALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWI
FT                   VEAARKRGDKSMALRLANELSDAADNKGTAVKKREDVHRMAEANKAFAHYRW"
FT   gene            445969..448083
FT                   /locus_tag="Dd703_0400"
FT   CDS_pept        445969..448083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0400"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: eca:ECA4036 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84213"
FT                   /db_xref="GOA:C6C868"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C6C868"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ACS84213.1"
FT                   /translation="MARTTPIARYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWSGMAKQYEPHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRMGANFLKVVDQIKVRLG
FT                   ANPVPLQLAIGAEEHFTGVVDLVKMKAINWNEADQGVTFTYEDIPADMQDLAAEWHQNL
FT                   IESAAEASEELMEKYLGGEELTEAEIKGALRQRVLNNEIILVTCGSAFKNKGVQAMLDA
FT                   VIDYLPAPTDVPAINGMLDDGKDTPAERHASDDEPFSALAFKIATDPFVGNLTFFRVYS
FT                   GVVNSGDTVLNSVKSERERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVITGDTLCD
FT                   PDNPIILERMEFPEPVISIAVEPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTII
FT                   AGMGELHLDIIVDRMKREFNVEANVGKPQVAYREAIRAKVTDIEGKHAKQSGGRGQYGH
FT                   VVIDMYPLEPGSNPKGYEFVNDIKGGVIPGEYIPAVDKGIQEQLKAGPLAGFPVVDLGV
FT                   RLHFGSYHDVDSSELAFKLAASLAFKAAFSKANPVLLEPIMKVEVETPEENTGDVIGDL
FT                   SRRRGMLRGQESNVTGVVIHAEVPLSEMFGYATQLRSLTKGRASYSMEFLKYDDAPNNV
FT                   AQAVIEARGK"
FT   gene            448155..449339
FT                   /locus_tag="Dd703_0401"
FT   CDS_pept        448155..449339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0401"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: sgl:SG2283
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84214"
FT                   /db_xref="GOA:C6C4T6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C6C4T6"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACS84214.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGQAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPVIRGSALKALEGDAEWEAKIIELAEALDSYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIKVGEEVEIVGIKETTKTTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   TKRDEVERGQVLAKPGSIKPHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIA"
FT   gene            449468..449662
FT                   /locus_tag="Dd703_0402"
FT   CDS_pept        449468..449662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0402"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: eca:ECA4034 bacterioferritin-associated
FT                   ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84215"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C6C870"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="ACS84215.1"
FT                   /translation="MYVCLCNAVSDKVIRQIARQYHPQSLKQLKLFVPIGSECGKCIRQ
FT                   ARLILEEETAKNAKLNKVA"
FT   gene            449737..450210
FT                   /locus_tag="Dd703_0403"
FT   CDS_pept        449737..450210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0403"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Ferritin Dps family
FT                   protein; KEGG: eca:ECA4033 bacterioferritin, iron storage
FT                   and detoxification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84216"
FT                   /db_xref="GOA:C6C871"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C6C871"
FT                   /inference="protein motif:TFAM:TIGR00754"
FT                   /protein_id="ACS84216.1"
FT                   /translation="MKGDKNVITHLNKLLGNELVAINQYFLHARMFKNWGFKRLNDREY
FT                   HESIDEMKHADRYIERILFLEGIPNLQDLGKLNIGEDVEEMLRSDLVLELEGAKDLRDG
FT                   IAYADSARDYVSRDLMIAVLADEEEHIDWLETELELIARLGIQNYLQTQLKEE"
FT   gene            450510..450821
FT                   /locus_tag="Dd703_0404"
FT   CDS_pept        450510..450821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0404"
FT                   /product="ribosomal protein S10"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: plu:plu4727 30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84217"
FT                   /db_xref="GOA:C6C872"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C6C872"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ACS84217.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            450854..451483
FT                   /locus_tag="Dd703_0405"
FT   CDS_pept        450854..451483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0405"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: eca:ECA4031 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84218"
FT                   /db_xref="GOA:C6C873"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:C6C873"
FT                   /inference="protein motif:PFAM:PF00297"
FT                   /protein_id="ACS84218.1"
FT                   /translation="MIGLVGKKVGMTRIFTEDGVSIPVTVIEIEANRVTQVKTLENDGY
FT                   RAVQVTTGAKKANRVNKPEAGHFAKAGVEAGRTLREFRLAEGEDFAVGQNISVEIFADV
FT                   KKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAG
FT                   QLGNERVTVQSLDVVRVDAERNLLLVKGAVPGATGSDLIVKPAVKA"
FT   gene            451494..452099
FT                   /locus_tag="Dd703_0406"
FT   CDS_pept        451494..452099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0406"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: spe:Spro_4543
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84219"
FT                   /db_xref="GOA:C6C874"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:C6C874"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ACS84219.1"
FT                   /translation="MELVLKDAQSALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRA
FT                   QKTRAEVTGSGKKPWRQKGTGRARSGSIKSPIWRSGGVTFAAKPQDHSQKVNKKMYRGA
FT                   LKSILSELVRQDRLIVVEKFSVEAPKTKLLAQKLKELALDDVLIITGELDENLFLAARN
FT                   LYKVDVRDVAGIDPVSLIAFDKVVMTADAVKQVEEMLA"
FT   gene            452096..452398
FT                   /locus_tag="Dd703_0407"
FT   CDS_pept        452096..452398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0407"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: sgl:SG2276
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84220"
FT                   /db_xref="GOA:C6C875"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:C6C875"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ACS84220.1"
FT                   /translation="MIREERLLKVLRAPHVSEKASTAMEKNNTIVLKVAKDATKAEIKA
FT                   AVQKLFEVEVDDVRTLIVKGKVKRHGQRIGRRSDWKKAYVTLKEGQNLDFVGGAE"
FT   gene            452416..453237
FT                   /locus_tag="Dd703_0408"
FT   CDS_pept        452416..453237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0408"
FT                   /product="ribosomal protein L2"
FT                   /note="TIGRFAM: ribosomal protein L2; PFAM: ribosomal
FT                   protein L2; KEGG: eum:ECUMN_3790 50S ribosomal subunit
FT                   protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84221"
FT                   /db_xref="GOA:C6C876"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:C6C876"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ACS84221.1"
FT                   /translation="MAVVKCKPTSPGRRHVVKVVNPELHKGKPFAPLLEKNSKTGGRNN
FT                   NGRITTRHIGGGHKQQYRIVDFKRNKDGIPAVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLKAGDQIQSGVDAAIKPGNTLPMRNIPVGSTVHNVEMKPGKGGQLARSAGAYVQ
FT                   IVAREGSYVTLRLRSGEMRKVEADCRATLGEVGNAEHMLRVLGKAGAARWRGVRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRRTK"
FT   gene            453254..453532
FT                   /locus_tag="Dd703_0409"
FT   CDS_pept        453254..453532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0409"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: kpn:KPN_03715 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84222"
FT                   /db_xref="GOA:C6C877"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:C6C877"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ACS84222.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMI
FT                   GLTIAVHNGRQHVPVFISDEMVGHKLGEFAPTRTYRGHAADKKAKKK"
FT   gene            453547..453879
FT                   /locus_tag="Dd703_0410"
FT   CDS_pept        453547..453879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0410"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: eum:ECUMN_3788 50S ribosomal subunit
FT                   protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84223"
FT                   /db_xref="GOA:C6C878"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:C6C878"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ACS84223.1"
FT                   /translation="METIAKHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAG
FT                   LVKKVLESAIANAEHNDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
FT   gene            453897..454598
FT                   /locus_tag="Dd703_0411"
FT   CDS_pept        453897..454598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0411"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: esa:ESA_00011 30S ribosomal protein S3;
FT                   TIGRFAM: ribosomal protein S3; PFAM: ribosomal protein S3-
FT                   domain protein; KH type 2 domain protein; Ribosomal protein
FT                   S3 domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84224"
FT                   /db_xref="GOA:C6C879"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:C6C879"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ACS84224.1"
FT                   /translation="MGQKVHPNGIRLGIVKTWNSTWYANTKEFADNLDSDFKVRQYLNK
FT                   ELEKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKGVADIAGVPAQINIA
FT                   EVRKPELDAKLVADSISSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAA
FT                   QPKKQQRKGRK"
FT   gene            454611..455021
FT                   /locus_tag="Dd703_0412"
FT   CDS_pept        454611..455021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0412"
FT                   /product="ribosomal protein L16"
FT                   /note="TIGRFAM: ribosomal protein L16; PFAM: ribosomal
FT                   protein L16; KEGG: eca:ECA4024 50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84225"
FT                   /db_xref="GOA:C6C880"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:C6C880"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ACS84225.1"
FT                   /translation="MLQPKRTKFRKIHKGRNRGLAAGTDVSFGTFGLKAVGRGRLTARQ
FT                   IEAARRAMTRAVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYE
FT                   MDGVPEELAREAFELAAAKLPIKTTFVTKTVM"
FT   gene            455021..455212
FT                   /locus_tag="Dd703_0413"
FT   CDS_pept        455021..455212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0413"
FT                   /product="ribosomal protein L29"
FT                   /note="TIGRFAM: ribosomal protein L29; PFAM: ribosomal
FT                   protein L29; KEGG: ypi:YpsIP31758_3907 50S ribosomal
FT                   protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84226"
FT                   /db_xref="GOA:C6C881"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:C6C881"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ACS84226.1"
FT                   /translation="MKAKELREKSVEELNTELLGLLREQFNLRMQAASGQLQQTHLLKQ
FT                   VRRNVARVKTLLTEKAGA"
FT   gene            455212..455466
FT                   /locus_tag="Dd703_0414"
FT   CDS_pept        455212..455466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0414"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: eum:ECUMN_3784
FT                   30S ribosomal subunit protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84227"
FT                   /db_xref="GOA:C6C882"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:C6C882"
FT                   /inference="protein motif:PFAM:PF00366"
FT                   /protein_id="ACS84227.1"
FT                   /translation="MTDKIRTLQGRVVSDKMQKSAVVAIERFVKHPIYGKFIKRTTKLH
FT                   VHDENNECGIGDVVEIRECRPISKTKSWTLVRVVEKAIL"
FT   gene            455636..456007
FT                   /locus_tag="Dd703_0415"
FT   CDS_pept        455636..456007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0415"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: esa:ESA_00015 50S ribosomal
FT                   protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84228"
FT                   /db_xref="GOA:C6C883"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:C6C883"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ACS84228.1"
FT                   /translation="MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVVRFDGNACVLLNNNSEQPIGTRIFGPVT
FT                   RELRSEKFMKIISLAPEVL"
FT   gene            456018..456332
FT                   /locus_tag="Dd703_0416"
FT   CDS_pept        456018..456332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0416"
FT                   /product="ribosomal protein L24"
FT                   /note="KEGG: eum:ECUMN_3782 50S ribosomal subunit protein
FT                   L24; TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; SMART: KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84229"
FT                   /db_xref="GOA:C6C884"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:C6C884"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ACS84229.1"
FT                   /translation="MAAKIRRDDEVIVLTGKDKGKRGKVKNVLSSGKVIVEGINLVKKH
FT                   QKPVPALNQPGGIVEKEAAIQVSNVAIFNAATGKADRVGFRFEDGKKVRFFKSNSETIK
FT                   "
FT   gene            456347..456886
FT                   /locus_tag="Dd703_0417"
FT   CDS_pept        456347..456886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0417"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: eca:ECA4019 50S
FT                   ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84230"
FT                   /db_xref="GOA:C6C885"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:C6C885"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ACS84230.1"
FT                   /translation="MAKLHDYYKDEVVSKLMSQFNYHSVMQVPRVEKITLNMGVGEAIA
FT                   DKKLLDNAAADLTAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFLERLI
FT                   SIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKTD
FT                   DEGRALLAAFNFPFRK"
FT   gene            456899..457204
FT                   /locus_tag="Dd703_0418"
FT   CDS_pept        456899..457204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0418"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: sgl:SG2265 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84231"
FT                   /db_xref="GOA:C6C886"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:C6C886"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ACS84231.1"
FT                   /translation="MAKQSMKAREVKRVKLANKFFAKRAELKAIISDVNASDEERWDAV
FT                   LKLQTLPRDSSPSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW"
FT   gene            457238..457630
FT                   /locus_tag="Dd703_0419"
FT   CDS_pept        457238..457630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0419"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: pmr:PMI3269 30S
FT                   ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84232"
FT                   /db_xref="GOA:C6C887"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:C6C887"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ACS84232.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVAVTMPSSKLKVAIANVLKEEGY
FT                   IEDYKIEGDAKPELEVTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVV
FT                   STSRGVMTDRAARQAGLGGEIICYVA"
FT   gene            457644..458177
FT                   /locus_tag="Dd703_0420"
FT   CDS_pept        457644..458177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0420"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: spe:Spro_4529 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84233"
FT                   /db_xref="GOA:C6C888"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:C6C888"
FT                   /inference="protein motif:PFAM:PF00347"
FT                   /protein_id="ACS84233.1"
FT                   /translation="MSRVAKAPVVIPAGVEVKLNGQVISIKGKNGELTRQVHEAVEVKQ
FT                   ADNVLTFAPREGFASGWAQAGTTRALLNSMVVGVTEGFTRKLLLVGVGYRAAVKGNVVN
FT                   LALGFSHPIDHELPAGITAECPSQTEIVLKGADKQLIGQVAADLRAYRRPEPYKGKGVR
FT                   YADEVVRIKEAKKK"
FT   gene            458187..458540
FT                   /locus_tag="Dd703_0421"
FT   CDS_pept        458187..458540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0421"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: kpe:KPK_0414 ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84234"
FT                   /db_xref="GOA:C6C889"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:C6C889"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ACS84234.1"
FT                   /translation="MDKKSARIRRATRARRKLQELGATRLVVHRTPRHIYAQVIAPNGS
FT                   EVLVAASTVEKAISEQLKYTGNKDAAAAVGKAVAERALEKGIKEVAFDRSGFQYHGRVQ
FT                   ALADAAREAGLQF"
FT   gene            458555..459055
FT                   /locus_tag="Dd703_0422"
FT   CDS_pept        458555..459055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0422"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   esa:ESA_00024 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84235"
FT                   /db_xref="GOA:C6C890"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C6C890"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ACS84235.1"
FT                   /translation="MAHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRNMINVALNSGTLQHPVKGAHTGSRVFMQPASEGTG
FT                   IIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLANMKSPEMVAAKRGKSVEE
FT                   ILG"
FT   gene            459062..459241
FT                   /locus_tag="Dd703_0423"
FT   CDS_pept        459062..459241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0423"
FT                   /product="ribosomal protein L30"
FT                   /note="TIGRFAM: ribosomal protein L30; PFAM: ribosomal
FT                   protein L30; KEGG: eca:ECA4013 50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84236"
FT                   /db_xref="GOA:C6C891"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:C6C891"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ACS84236.1"
FT                   /translation="MAKTIKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAIR
FT                   GMVNAVSYMVKVEE"
FT   gene            459245..459679
FT                   /locus_tag="Dd703_0424"
FT   CDS_pept        459245..459679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0424"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; PFAM: ribosomal
FT                   protein L15; KEGG: eca:ECA4012 50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84237"
FT                   /db_xref="GOA:C6C892"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C6C892"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ACS84237.1"
FT                   /translation="MRLNTLSPAEGAKHAPKRLGRGIGSGLGKTGGRGVKGQKSRSGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSRKAMITAEVRLSDLARVEGDVVDLSTLKAANVIGVQ
FT                   IEFAKVILSGEVARPVTIRGLRVTKGARAAIEAAGGKIEE"
FT   gene            459687..461018
FT                   /locus_tag="Dd703_0425"
FT   CDS_pept        459687..461018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0425"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: eca:ECA4011 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84238"
FT                   /db_xref="GOA:C6C893"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C6C893"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ACS84238.1"
FT                   /translation="MAKQPGLDFQSAKGGVGELKRRLLFVIGALIVFRIGSFIPIPGID
FT                   ATVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPALAE
FT                   IKKEGEAGRRKISQYTRYGTLVLAVFQSIGIATGLPNMPGMQGLVINPGFAFYFTAVVS
FT                   LVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIGHTIEQARQGDLHFLLLLL
FT                   VAVLVFAVTFFVVFMERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFAS
FT                   SIILFPATIASWFGGGTGWNWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPR
FT                   ETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLVGAMYITFICLIPEFMRDAMKVPF
FT                   YFGGTSLLIVVVVIMDFMAQVQTLLMSSQYESALKKANLKGYNR"
FT   gene            461053..461169
FT                   /locus_tag="Dd703_0426"
FT   CDS_pept        461053..461169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0426"
FT                   /product="ribosomal protein L36"
FT                   /note="TIGRFAM: ribosomal protein L36; PFAM: ribosomal
FT                   protein L36; KEGG: yps:YPTB3677 50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84239"
FT                   /db_xref="GOA:C6C894"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C6C894"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ACS84239.1"
FT                   /translation="MKVRASVKKLCRNCKIIKRNGIVRVICSAEPKHKQRQG"
FT   gene            461316..461672
FT                   /locus_tag="Dd703_0427"
FT   CDS_pept        461316..461672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0427"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: ent:Ent638_3729
FT                   30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84240"
FT                   /db_xref="GOA:C6C895"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:C6C895"
FT                   /inference="protein motif:PFAM:PF00416"
FT                   /protein_id="ACS84240.1"
FT                   /translation="MARIAGINIPDQKHAVIALTSIYGVGKTRSKAICAAAGIAEDVKI
FT                   SELSEEQIETLREEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            461689..462078
FT                   /locus_tag="Dd703_0428"
FT   CDS_pept        461689..462078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0428"
FT                   /product="ribosomal protein S11"
FT                   /note="PFAM: ribosomal protein S11; KEGG: eca:ECA4008 30S
FT                   ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84241"
FT                   /db_xref="GOA:C6C896"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:C6C896"
FT                   /inference="protein motif:PFAM:PF00411"
FT                   /protein_id="ACS84241.1"
FT                   /translation="MAKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEAVKEYGIKNLEVMVKGPGPGRESTIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   gene            462109..462729
FT                   /locus_tag="Dd703_0429"
FT   CDS_pept        462109..462729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0429"
FT                   /product="ribosomal protein S4"
FT                   /note="KEGG: eca:ECA4007 30S ribosomal protein S4; TIGRFAM:
FT                   ribosomal protein S4; PFAM: ribosomal protein S4;
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84242"
FT                   /db_xref="GOA:C6C897"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6C897"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ACS84242.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKIEQAPGQHGARK
FT                   PRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGANLLQLLEGRLDNVVYR
FT                   MGFGATRAEARQLVGHKAVMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALELAE
FT                   QREKPTWLEVDAAKMEGVFKRIPERTDLSADINEHLIVELYSK"
FT   gene            462755..463744
FT                   /locus_tag="Dd703_0430"
FT   CDS_pept        462755..463744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0430"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: ypb:YPTS_3865 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase insert; RNA polymerase alpha
FT                   subunit domain protein; RNA polymerase dimerisation; SMART:
FT                   RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84243"
FT                   /db_xref="GOA:C6C898"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C6C898"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ACS84243.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQISSTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNK
FT                   SGIGPVTAADITHDGDVEIVKPQHVICHLTDENASINMRIKVQRGRGYVPASARIHTEE
FT                   DERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAAT
FT                   ILAEQLEAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE"
FT   gene            463785..464177
FT                   /locus_tag="Dd703_0431"
FT   CDS_pept        463785..464177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0431"
FT                   /product="ribosomal protein L17"
FT                   /note="TIGRFAM: ribosomal protein L17; PFAM: ribosomal
FT                   protein L17; KEGG: eca:ECA4005 50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84244"
FT                   /db_xref="GOA:C6C899"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:C6C899"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ACS84244.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDSVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRAASQTEEASAAE"
FT   gene            464304..464697
FT                   /pseudo
FT                   /locus_tag="Dd703_0432"
FT   gene            464744..464944
FT                   /locus_tag="Dd703_0433"
FT   CDS_pept        464744..464944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0433"
FT                   /product="protein of unknown function DUF331"
FT                   /note="PFAM: protein of unknown function DUF331; KEGG:
FT                   set:SEN3239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84245"
FT                   /db_xref="GOA:C6C8A0"
FT                   /db_xref="InterPro:IPR005589"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8A0"
FT                   /inference="protein motif:PFAM:PF03889"
FT                   /protein_id="ACS84245.1"
FT                   /translation="MSNYGHKKGAIKDNAIEALLHDPLFRQRVELNAKGKGSYRRKGKH
FT                   RNVQKENWEASGKIHFLPLVF"
FT   gene            complement(465025..466065)
FT                   /locus_tag="Dd703_0434"
FT   CDS_pept        complement(465025..466065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0434"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: son:SO_A0151
FT                   ISSod13, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84246"
FT                   /db_xref="GOA:C6C8A1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8A1"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACS84246.1"
FT                   /translation="MLHTNNPVIKHKAGLLNLAEELGNVSKACKVMGVSRDTFYRYREL
FT                   AEQGGVDALINRSRRSPNLKNRTDAATEQAVIDYAVEFPAHGQHRTSNELRKKGVFISG
FT                   SGVRSIWVRHSLENFKKRLKALEEKVAREGIELTDAQIVALERKAHDDEASGEIETAHP
FT                   GYLGSQDTFYVGNLKGVGRIYQQTFVDTYSKVAHCKLYVSKTPITAADLLNDRVLPFYE
FT                   SQGLPMLRILTDRGTEYCGRIEHHDYQLYLAINDIDHTKTKAMSPQTNGICERFHKTIL
FT                   QEFYQMTFRKKLYGDIDTLQSDLDEWLHYYNNERTHQGKMCCGRTPMETLLDGKRIWAE
FT                   KNLSQM"
FT   gene            complement(466187..466594)
FT                   /locus_tag="Dd703_0435"
FT   CDS_pept        complement(466187..466594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0435"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: eca:ECA4003 large-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84247"
FT                   /db_xref="GOA:C6C8A2"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8A2"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ACS84247.1"
FT                   /translation="MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVSDIIMPPL
FT                   GLLIGGIDFKQFHWVLREAQGNIPAVIMNYGSFIQNVFDFIIVAFAIFIAIKLMNKLRR
FT                   GENEKLDTPPKTSAEEKLLTEIRDLLKQQPK"
FT   gene            complement(466685..468061)
FT                   /locus_tag="Dd703_0436"
FT   CDS_pept        complement(466685..468061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0436"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: eca:ECA4002 potassium transporter peripheral membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84248"
FT                   /db_xref="GOA:C6C8A3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8A3"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACS84248.1"
FT                   /translation="MKIIILGAGQVGGTLAENLSGENNDITVVDTNTARLRQLQDKFDL
FT                   RVVTGYASHPRILREAGAEDADMLIAVTNSDETNMIACQIAYSLFNTPNRIARIRSAEY
FT                   IREEEHLFHTEAVPVDHLISPEQLVIDNIYKLIEYPGALQVVNFAQGKVSIAAVNAYYG
FT                   GPLVGNAIATMREHMPHIETRVAAIFRHDRPIRPQGSTVIEAGDEVFFVAASQHIRAVM
FT                   SEMQRLEKPYKRIMIVGGGNVGSGLALKLEKDYSIKLIERDPQRAADLAERLQNTIVFH
FT                   GDASDQELLAQEHIEQIDVFIAITNDDEANIMSAMLAKRMGAKKVMVLIQRRAYVDLVQ
FT                   GGAIDVAISPQQATISALLSHVRKADIVNVSSLRRGVAEAIEAIAHGDEGTSKVVGRMI
FT                   EDIKLPPGTIIGAIVRGEDVIIANRNTQIEQGDHVVMFLTDKKYVSDVERLFQPSPFFL
FT                   "
FT   gene            complement(468110..469405)
FT                   /locus_tag="Dd703_0437"
FT   CDS_pept        complement(468110..469405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0437"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: spe:Spro_4513 16S rRNA
FT                   methyltransferase B"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84249"
FT                   /db_xref="GOA:C6C8A4"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023541"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8A4"
FT                   /inference="protein motif:TFAM:TIGR00563"
FT                   /protein_id="ACS84249.1"
FT                   /translation="MKSKYNLRSIAAAVIAQVLDHGQSLSQSLPAVQRDIAEKDRALLQ
FT                   ELCFGVLRVLPQLDWCIGQLMAKPLTGKQRVLHYLLMVGLYQLLYTRIPPHATLAETVE
FT                   GATALKRPQLKGLINGVLRQFQRQQEELVQKMQKTSALHAHPEWLLTRLKKAYPETWQD
FT                   IIDANNQHPPMWLRVNRQHNERDGYIALLQEQGIPASKHPDYQDAIKLDTPSPVTSLPG
FT                   FEQGWITVQDASAQGCAYWLDPQNNEDILDLCAAPGGKTTHILEIAPKARVLAVDVDEH
FT                   RLARVKENLQRLRQHADVRQGDGRVPEEWCGDSQFDRILLDAPCSATGVIRRHPDIKWL
FT                   RRDSDIVELANLQREILDAIWPRLKIGGTLVYATCSILPEENQQQIISFLQRHADAVLR
FT                   ETGSPEKPGVQKLPSPQDGDGFFYAKLIKIEH"
FT   gene            complement(469466..470407)
FT                   /locus_tag="Dd703_0438"
FT   CDS_pept        complement(469466..470407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0438"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: sdy:SDY_3464
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84250"
FT                   /db_xref="GOA:C6C8A5"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8A5"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ACS84250.1"
FT                   /translation="MALRIIFAGTPDFAARHLDALLTSRHEIVGVFTQPDRPAGRGNKL
FT                   TPSPVKVLAECKGIPVFQPKSLRPEENQQLIAALQADVMVVVAYGLILPQTVLDIPRLG
FT                   CINVHGSLLPKWRGAAPIQRSLWAGDAETGITIMQMDAGLDTGDMLYKMECPILPDDTS
FT                   ATLYDKLAELGPQGLLITLEQLASAQTKPEPQNNALATYAEKLSKEEARLDWQLSAAQL
FT                   ERCIRAFNPWPMSYFTVDDQPLKVWKAEALDIKHNKHPGTIIDANKHGIQVATTDGVLN
FT                   MQMLQPSGKKAMPAQDLLNSRREWFESGKVLA"
FT   gene            complement(470437..470949)
FT                   /locus_tag="Dd703_0439"
FT   CDS_pept        complement(470437..470949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0439"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: eca:ECA3999 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84251"
FT                   /db_xref="GOA:C6C8N0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8N0"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACS84251.1"
FT                   /translation="MSVLQVLHFPDERLRITAKPVKEVNADIQRIVDDMFDTMYAEEGI
FT                   GLAATQVNIHQRIIVIDVSEERDQRLVLINPELLEKSGDTGIEEGCLSIPETRALVPRA
FT                   ERVKIRALDKDGKPFELETDGLLAICIQHEMDHLVGKLFVDYLSPLKRQRIRQKLEKLD
FT                   RQNNRIQ"
FT   gene            471061..472194
FT                   /locus_tag="Dd703_0440"
FT   CDS_pept        471061..472194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0440"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: eca:ECA3998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84252"
FT                   /db_xref="GOA:C6C8N1"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8N1"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ACS84252.1"
FT                   /translation="MTDTEIWLRVASIKGLSAHKVVGLVKRIMRERDSAVDFLRASGLD
FT                   DRQTARFIAFDRRQSDDVERWLEDSHCHFVTYGSESYPPLLASISSPPPFIFVRGDDCT
FT                   LSSAQIAVVGSRDNSNYGEQWGRFFSRELAANRLIITSGLAVGIDGIAHQAALDAGGKT
FT                   IAVLGSGLRQIYPKKHAALADAIVENGGAIVSEFLLKTPPIAANFPRRNRIISGLCLGV
FT                   LVIEASMRSGSLVTARYALEQNRDIFALPGPVGNPMTEGTHWLIQQGAYLVTHPKDVLE
FT                   QLHNGLQWLPDISSENDEEIICSPEAELELPFADVLANVGDEVTPVDVVAERAGQPVPE
FT                   VVSKLLDLELAGWIAAVPGGYVRIRRACHVRRTHVLV"
FT   gene            472166..472636
FT                   /locus_tag="Dd703_0441"
FT   CDS_pept        472166..472636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0441"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   eca:ECA3997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84253"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8N2"
FT                   /inference="protein motif:PFAM:PF04361"
FT                   /protein_id="ACS84253.1"
FT                   /translation="MFDVLMYLFETYIHNETEMRVDQDTLTDDLTKAGFDREDIYSALE
FT                   WLEKLADLQDGQAPLNLANDPRALRIYTAEEVQRLDTECRGFLLFLEQIQVLNLETREM
FT                   VIDRVMALETLEFDLEDLKWVILMVLFNVPGCENAYQQMEDLLFEPNEGYLQ"
FT   gene            472657..473214
FT                   /locus_tag="Dd703_0442"
FT   CDS_pept        472657..473214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0442"
FT                   /product="DNA topoisomerase type IA zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase type IA zn finger domain
FT                   protein; KEGG: spe:Spro_4508 DNA topoisomerase type IA Zn
FT                   finger domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84254"
FT                   /db_xref="GOA:C6C8N3"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8N3"
FT                   /inference="protein motif:PFAM:PF01396"
FT                   /protein_id="ACS84254.1"
FT                   /translation="MIKTMSFAERQQDCPQCGAALVIRNGSHGAFLGCSAYPGCDYIRP
FT                   LKAYADGHIVKVLDGQICPECGATLVLRQGRYGMFVGCGNYPECDHTEMIDRPDETTLT
FT                   CPQCRKGRLLQRKSRYGKTFHSCERYPECQFTLNYRPVAGVCEYCHYPLLIEKKTAQGV
FT                   KRCCASKLCGKPVMVSEKHQDE"
FT   gene            473207..473776
FT                   /locus_tag="Dd703_0443"
FT   CDS_pept        473207..473776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0443"
FT                   /product="SUA5/yciO/yrdC domain protein"
FT                   /note="PFAM: SUA5/yciO/yrdC domain; KEGG: eca:ECA3996
FT                   putative DNA topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84255"
FT                   /db_xref="GOA:C6C8N4"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8N4"
FT                   /inference="protein motif:PFAM:PF01300"
FT                   /protein_id="ACS84255.1"
FT                   /translation="MSELVSKQLSELLKKLREEQVIAYPTEAVFGLGCDPDSEVAVNRL
FT                   LQLKQRPWEKGLILIAADFAQVEPYIDVSALSYIQQQRMFSTWPGPVTWVIPAKAQTPK
FT                   WLTGQFSSLAVRVSDHPLVKQLCLAFGKPLVSTSANLSGEAPCRTAEDVLSQFGKNFPV
FT                   LSGKVGGRLNPSEIRDALTGAQLRRG"
FT   gene            473799..474626
FT                   /locus_tag="Dd703_0444"
FT   CDS_pept        473799..474626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0444"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM: Shikimate
FT                   dehydrogenase substrate binding domain protein;
FT                   Shikimate/quinate 5-dehydrogenase; KEGG: eca:ECA3995
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84256"
FT                   /db_xref="GOA:C6C8N5"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8N5"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ACS84256.1"
FT                   /translation="MSEYQSFAVFGNPIAHSKSPRIHTLFAEQSGILLNYERLQAPVDE
FT                   FELYLHAYFQSGAAGANITAPFKERACVVVDSLSPRAAEACAVNVVKKMADGTLFGDNT
FT                   DGIGLLSDLQQNGLIQPGDRVLLVGAGGAARGVIQPLLAYGCSLIVTNRTLDKAEMLAS
FT                   HFSEQGNIRALPQSSLTSEMFDLIINATSSGVYGNIPDLPPSLINAHVRCYDMFYLPEP
FT                   TPFLQWCTQQGADKCVDGLGMLVWQAAHAFNLWHGVMPQTEPVIRQLKLEFMS"
FT   gene            474623..474880
FT                   /locus_tag="Dd703_0445"
FT   CDS_pept        474623..474880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0445"
FT                   /product="protein of unknown function DUF1488"
FT                   /note="PFAM: protein of unknown function DUF1488; KEGG:
FT                   sed:SeD_A3767 putative periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84257"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8N6"
FT                   /inference="protein motif:PFAM:PF07369"
FT                   /protein_id="ACS84257.1"
FT                   /translation="MNQTIHFPDRDEWDEASDSVIFPVLINGFQAQCVMYASGLKARYG
FT                   GEYAEQWIALFREHRWEIEELFERQILNEQDDETGRFVVY"
FT   gene            complement(474874..475410)
FT                   /locus_tag="Dd703_0446"
FT   CDS_pept        complement(474874..475410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0446"
FT                   /product="putative transferase"
FT                   /note="KEGG: eca:ECA3993 putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84258"
FT                   /db_xref="GOA:C6C8N7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8N7"
FT                   /inference="similar to AA sequence:KEGG:ECA3993"
FT                   /protein_id="ACS84258.1"
FT                   /translation="MADIFRSIQGKRPITGERVMVDSSSIIIGDVALADDVSIWPLVVI
FT                   RGDVNFIRIGERSNIQDGSVLHVTHRSEKNPNGNPLIIGKDVTVGHKVMLHGCTIGNRV
FT                   LVGMGSILLDGVIIEDDVIIGAGSLVSQGKTLEKGHLYLGSPAKKIRPLTEEEREGLIY
FT                   SSDNYVLWKDNYLNQ"
FT   gene            475883..477413
FT                   /locus_tag="Dd703_R0005"
FT   rRNA            475883..477413
FT                   /locus_tag="Dd703_R0005"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            477490..477566
FT                   /locus_tag="Dd703_R0006"
FT                   /note="tRNA-Ile1"
FT   tRNA            477490..477566
FT                   /locus_tag="Dd703_R0006"
FT                   /product="tRNA-Ile"
FT   gene            477678..477753
FT                   /locus_tag="Dd703_R0007"
FT                   /note="tRNA-Ala1"
FT   tRNA            477678..477753
FT                   /locus_tag="Dd703_R0007"
FT                   /product="tRNA-Ala"
FT   gene            477921..480827
FT                   /locus_tag="Dd703_R0008"
FT   rRNA            477921..480827
FT                   /locus_tag="Dd703_R0008"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            480915..481029
FT                   /locus_tag="Dd703_R0009"
FT   rRNA            480915..481029
FT                   /locus_tag="Dd703_R0009"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            481044..481119
FT                   /locus_tag="Dd703_R0010"
FT                   /note="tRNA-Thr1"
FT   tRNA            481044..481119
FT                   /locus_tag="Dd703_R0010"
FT                   /product="tRNA-Thr"
FT   gene            481165..481279
FT                   /locus_tag="Dd703_R0011"
FT   rRNA            481165..481279
FT                   /locus_tag="Dd703_R0011"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            481382..481708
FT                   /locus_tag="Dd703_0447"
FT   CDS_pept        481382..481708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0447"
FT                   /product="putative cytoplasmic protein"
FT                   /note="KEGG: stm:STM0948 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84259"
FT                   /db_xref="GOA:C6C8N8"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8N8"
FT                   /inference="similar to AA sequence:KEGG:STM0948"
FT                   /protein_id="ACS84259.1"
FT                   /translation="MMTEFKRTQRDYPLSFKIAVVEQVEKGEMTYKQAQQRYGIQGRST
FT                   VLVWLRKYGRLDWSPGLPNLVKRKLLVAQTNTPLTPSKESKSLKNSLSWRTRRLSFLSR
FT                   LSMS"
FT   gene            481778..482613
FT                   /pseudo
FT                   /locus_tag="Dd703_0448"
FT   gene            482814..483743
FT                   /locus_tag="Dd703_0449"
FT   CDS_pept        482814..483743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0449"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="KEGG: eca:ECA3992 homoserine O-succinyltransferase;
FT                   TIGRFAM: homoserine O-succinyltransferase; PFAM: homoserine
FT                   O-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84260"
FT                   /db_xref="GOA:C6C8N9"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8N9"
FT                   /inference="protein motif:TFAM:TIGR01001"
FT                   /protein_id="ACS84260.1"
FT                   /translation="MPIRVPDELPAVSFLRNENVFVMTSSRARTQEIRPLKVLILNLMP
FT                   KKIETENQFLRLLSNSPLQIDIQLLRIDSRESKNTPTEHLNNFYCDFEDIEQENFDGLI
FT                   VTGAPLGLVDFCDVVYWPQIERVVTWAKEHVTSTLFVCWAVQAALNVLYGIPKLTREVK
FT                   LSGVYSHQTLQPHALLTRGFDETFLAPHSRYADFPSEVIREHTDLDILVESGEAGAYLL
FT                   ASKDKRQVFVTGHPEYDALTLASEYFRDVDANLDPMIPVNYFPNNDPQRTPKAAWRSHG
FT                   HLLFSNWLNYYVYQITPYDLRRMNPTLD"
FT   gene            484045..485643
FT                   /locus_tag="Dd703_0450"
FT   CDS_pept        484045..485643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0450"
FT                   /product="malate synthase A"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: eca:ECA3991 malate synthase; TIGRFAM: malate
FT                   synthase A; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84261"
FT                   /db_xref="GOA:C6C8P0"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8P0"
FT                   /inference="protein motif:TFAM:TIGR01344"
FT                   /protein_id="ACS84261.1"
FT                   /translation="MTQQTMNRGLAFSQRFGEAERQILTDEAIDFLTDLVERFTLSRNR
FT                   LLAERREVQRRIDEGVLPDFISETISIRNSEWKIRGIPDDLLDRRVEITGPVERKMVIN
FT                   ALNANVKVFMADFEDSLAPSWQKIIEGHINLRDAVRGAITYTNEDGKIYQLKPHPAVLI
FT                   CRVRGLHLPEKHVVWQQEPIPGSLFDFALYFFHNYRQLLSKGSGPYFYLPKLQSYQEAA
FT                   WWAEVFSHTEDRFGLPRGTIKATVLIETLPAVFQMDEILYYLSDHIVGLNCGRWDYIFS
FT                   YIKTLKHHSDRVLPDRQSVTMDKPFLSAYSRLLIKTCHRRGAFAMGGMSAFIPSKDKER
FT                   NDWVQEKVRQDKELEARNGHDGTWVAHPGLADTVMPVFDRVLAGRQNQLDVLREEDAPV
FT                   TADDLLAPCPGERTEAGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIW
FT                   QWIHHGKALSDGRVVTKALFQQMLEEEMQVVRQEIGDIRFQAGRFSEAARLMERITTQG
FT                   ELIDFLTLPGYDLLD"
FT   gene            485667..486977
FT                   /locus_tag="Dd703_0451"
FT   CDS_pept        485667..486977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0451"
FT                   /product="isocitrate lyase"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: eca:ECA3990 isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84262"
FT                   /db_xref="GOA:C6C8P1"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8P1"
FT                   /inference="protein motif:TFAM:TIGR01346"
FT                   /protein_id="ACS84262.1"
FT                   /translation="MSITSRTQQIRQLEQEWKTPRWEGIVRPYRTEDVINLRGSVNPAC
FT                   TLAQRGAEKLWALLHGESRKGYINCLGALTGGQALQQAKAGLEAVYLSGWQVAADANLA
FT                   ANMYPDQSLYPANSVPAVVQRINGTFRRADQIQWANGIEPGDPRFIDYFLPIVADAEAG
FT                   FGGVLNAFELMKSMIEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAA
FT                   DVLGVPTLLVARTDADAADLLTSDCDSYDQDFVTGERTVEGFFRTRAGVEQAISRGLAY
FT                   APYADLVWCETSTPDLALARRFAEAIHARFPGKLLAYNCSPSFNWKKNLDDRAIARFQD
FT                   ELSEMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQREFAAISEGYTFS
FT                   SHQQEVGTGYFDKVTTIIQGGSSSVTALTGSTEEQQF"
FT   gene            487050..488807
FT                   /locus_tag="Dd703_0452"
FT   CDS_pept        487050..488807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0452"
FT                   /product="(Isocitrate dehydrogenase (NADP(+))) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /note="PFAM: Isocitrate dehydrogenase kinasephosphatase;
FT                   KEGG: eca:ECA3989 bifunctional isocitrate dehydrogenase
FT                   kinase/phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84263"
FT                   /db_xref="GOA:C6C8P2"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8P2"
FT                   /inference="protein motif:PRIAM:2.7.11.5"
FT                   /protein_id="ACS84263.1"
FT                   /translation="MRMIRDREHLVAQTILQGFDAQYGRFLEVTAGAQRRFEQADWLAV
FT                   QQAMKQRIHLYDHHVGLVVEQLRCITEQCYDADFVARVKQIYTGLLPDYPRFEIAESFF
FT                   NSVYCRLFNHRALTPDKLFVFSSQPSARFHEIPRPLSRLYQPDDNWDGMLHRILTALPL
FT                   RLPWEDLARDIGYVVRMLRESFPKMSLTRASLQVANELFYRNKAAWLVGKLILPQGVFP
FT                   FLLPIHRSEQGELFIDTCLTRHDEASIVFGFARSYFMVYAPQPSAMVAWLREILPAKTT
FT                   AELYLAIGCQKHSKTEYYREYLNFLAHSQEQFVIAPGVKGMVMLVFTLPSFDRVFKVIK
FT                   DRFAPQKEVNEAQVRACYQMVKEHDRVGRMADTQEYENFVLEKSRISPALLAELWREVP
FT                   DKLEDLGDRLVIRHLYMERRMTPLNLYLDQVNGQALRDAIEEYGNAIRQLAAANVFPGD
FT                   MLFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRDPADELAAEPWYSVGSHDVFPE
FT                   EFRQFLCSDRRLLPLFEELHGDLFRADYWRALQQRIRSGHVEDVFAYRKRQRFCQRYGA
FT                   QASATAKIA"
FT   gene            complement(488815..489648)
FT                   /locus_tag="Dd703_0453"
FT   CDS_pept        complement(488815..489648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0453"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Transcriptional regulator IclR; regulatory
FT                   protein IclR; SMART: regulatory protein IclR; KEGG:
FT                   eca:ECA3988 transcriptional repressor IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84264"
FT                   /db_xref="GOA:C6C8P3"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8P3"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ACS84264.1"
FT                   /translation="MTPPEPAKRGKKPRAANTVAAAQPAGQVQSLTRGLTLLEYIAHAN
FT                   GSIALTDLAQRAGLPNSTTHRLLTTMQQQGFVRQVGDLGFWSIGTQAFIVGSSFLQSRN
FT                   LLAMVHPMLRKLMENSGETVNLAVLDQTDYQAIIIDQVQCTALMRMSAPIGGKLPMHAS
FT                   GAGKAFLATLPDDKVTQLLHRNGLHSYTPRTLNAQTLKENLAQIRRQGYSYDDEEHALG
FT                   LRCVAACILDEHHEAVAALSISGPVSRITDDRVIELGALVIRAAKEITIAYGGAR"
FT   gene            489872..493558
FT                   /locus_tag="Dd703_0454"
FT   CDS_pept        489872..493558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0454"
FT                   /product="methionine synthase"
FT                   /note="TIGRFAM: methionine synthase; PFAM: homocysteine
FT                   S-methyltransferase; Methionine synthase B12-binding module
FT                   cap domain protein; cobalamin B12-binding domain protein;
FT                   dihydropteroate synthase DHPS; Vitamin B12 dependent
FT                   methionine synthase activation region; KEGG: eca:ECA3987
FT                   B12-dependent methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84265"
FT                   /db_xref="GOA:C6C8P4"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8P4"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ACS84265.1"
FT                   /translation="MAKNRQQELQQQLDQRIMILDGGMGTMIQGYRLQEADYRGARFAD
FT                   WHSDLKGNNDLLVLTKPDVIAAIHHDYLAAGADILETNTFNATRIAMADYDMEALSAEI
FT                   NTVAARLARTCADEWTARTPERPRYVAGVLGPTNRTASISPDVNDPAYRNVSFDQLVDA
FT                   YRESTRALIEGGVDLILIETIFDTLNAKAAVYAVECEFEALGITLPVMISGTITDASGR
FT                   TLSGQTTEAFYNSLRHARPLSFGLNCALGPDELRQYVAELARISECYVSAHPNAGLPNA
FT                   FGEYDLDAREMAQQVGEWAQSGFLNIIGGCCGTTPAHIAAMAQAVDGVPPRKLPQTPVA
FT                   CRLSGLEPLNIGADTLFVNVGERTNVTGSAKFKRLIKEEKYNEALDVARQQVENGAQII
FT                   DINMDEGMLDAEAAMVRFLNLIAGEPDIARVPIMIDSSKWDVVEAGLKCIQGKGIVNSI
FT                   SMKEGVDIFIEHAKKVRRYGAAVVVMAFDEVGQADTRERKIDICRRAYRILTEEVGFPP
FT                   EDIIFDPNIFAVATGIEEHNNYAVDFIGACDDIKTQLPHALISGGVSNVSFSFRGNEPV
FT                   REAIHAVFLYYAIRNGMDMGIVNAGQLAIYDDLPAELRDAVEDVVLNRRTDGTERLLAI
FT                   AEKYRGSKSDDDSNKGEAEWRGWPVKKRLEYALVKGITEFIEADTEEARAQAARPIEVI
FT                   EGPLMDGMNVVGDLFGAGKMFLPQVVKSARVMKQAVAYLEPFIQASKEAGSSAGKILLA
FT                   TVKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPSDKILKTAREEKVDIIGLSGLITPSL
FT                   DEMVNVAKEMERQGFTLPLLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRSVSVVSSL
FT                   LSATQHDEFVARIRREYETVRIQHARKKPRTPPVSLDAARENAQSFDWESYTPPAAHRL
FT                   GVHPVSAGIDTLRHYIDWTPFFMTWSLAGKYPNILEDEVVGEEAKRLFADANAMLDQLS
FT                   ADGTLNPRGVVGLFPANRVGDDIEIYTDERRDTVSALSCHLRQQTEKTDFPNYCLADFV
FT                   APKSSGKPDYIGAFAVTGGLEEDELAAQWEAQHDDYNKIMLKALADRLAEAFAEYLHER
FT                   VRKVYWGYAPNENLGNDELIRENYQGIRPAPGYPACPDHTEKAILWQLLDVDNTVGMKL
FT                   TESYAMWPGASVSGWYFSHPDSKYFAVAQIQRDQVDDYAARKHMPVADVERWLAPNLGY
FT                   DAD"
FT   gene            493595..494953
FT                   /locus_tag="Dd703_0455"
FT   CDS_pept        493595..494953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA5917 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84266"
FT                   /db_xref="GOA:C6C8P5"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8P5"
FT                   /inference="similar to AA sequence:KEGG:ebA5917"
FT                   /protein_id="ACS84266.1"
FT                   /translation="MIHELRLANVGPASTMHLTFGNRLNLLTGDNGLGKSFLLDIVWWA
FT                   LTRRWPAEVNPKLAAGKKALPAFDLTGEEASIAFSFAGKVKTERYESHYESTYARREQS
FT                   WTGRAGRPANPGLVLYAMADGSFAVWDPHRNYWRMQDGIDVQERVPAYVLNPTEVWDGL
FT                   SGDERSWLCNGLIRDIASWQKEKGAAFRHINAVLKVLSPSTTEVLSLGELTRISLDDVR
FT                   EIPTLRMPYQKDVPVLHASSGMRRILALAYFLVWAWEEHQRAARLLGEDVSPQITFLID
FT                   EVESHLHPSWQRSIVPALLRVMGKLNAKAQVQLITTTHSPLVMTSVEPLFDAKRDAWFD
FT                   LDFLNGAVVLARREFEKHGDVTNWLTSEAFDLKSGRPLEYERLVEDAATLLNQSDVSEK
FT                   DLDAMYQQFLAALDAKDEFLFRWRFIRGKKVTPEKNDNKIKKGRKNDSGGVTG"
FT   gene            494928..495554
FT                   /locus_tag="Dd703_0456"
FT   CDS_pept        494928..495554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA5228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84267"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8P6"
FT                   /inference="similar to AA sequence:KEGG:ebA5228"
FT                   /protein_id="ACS84267.1"
FT                   /translation="MIPVVLQAEPDDFDVEVRQKGHNWLIKKSISLNAPPPKASDLPNY
FT                   WTHSNYSLWESYGGVCAYLAIYFEWVTGASSTDHFIAKSRNAGDAYEWNNYRLSSLGPN
FT                   RNKNDFDDVLDPISLQPDTFVINFLSGEISPNYARYSQGSPYATQAESTITRLQLDSQE
FT                   HRRMRTRHFDQYITGKWSLDGLHDESPFVYAEIMRQGLSDRSLLD"
FT   gene            495684..496679
FT                   /locus_tag="Dd703_0457"
FT   CDS_pept        495684..496679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0457"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: eca:ECA3986 AraC family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84268"
FT                   /db_xref="GOA:C6C8P7"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8P7"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS84268.1"
FT                   /translation="MINLSSPAPSARRFSIEDFLDFGERYGIDYRFPAVGASGERHCEK
FT                   QTVVQGDVEEMVLPSGICLTNSSIEVLQPYDTTSLLSSPLYTLVVLEGRVNIRLNTQEF
FT                   VVCSGMAFSTRLGEQWVMKASHRIERSLRTLSLGIHPERVEPTRAVSSLLQRWEHIQAP
FT                   AFVWPVPDYLLMGLQHILYQPMAALPRQLMLEGALLQLLGGVFCRVDELPGCQVTRAVS
FT                   SSSERCRLENIRQRLRQSPEKPYTLPALAQDAAMSVTSFRNKFRQQYGISVFDYLRECR
FT                   LSLAHRYLALGYPVQQAAWLSGYQHATNFATAFRRRYGIAPSEVRFSIQG"
FT   gene            496818..498935
FT                   /locus_tag="Dd703_0458"
FT   CDS_pept        496818..498935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0458"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: eca:ECA3985 ferrioxamine B receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84269"
FT                   /db_xref="GOA:C6C8P8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8P8"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ACS84269.1"
FT                   /translation="MFRKTRLALMVGYLTGGFAASAMAADAVKSASSAEQPQNETIVVT
FT                   APTQSGATKLATPDIETPQSVSIVTREQAQEQGATSVRQAVSYTPGVYSNQIGASNRYD
FT                   YMVLRGFSDGSLDNVYLDGLKLMGDTNSYSSLVIDPWFLDSIEVVRGPASVLYGRASPG
FT                   GIVALNSRQPSFERSGQIRLSAGNNGQRSAAFDVTGPVDDNERLAFRLDGLVREADTQF
FT                   GPLKEKRYALAPSLTWRVSDRTRLELMAYFQHDPDGGSHSGLPYEGTVVEHNGQKISNT
FT                   FYEGEENDEKFDRRQTMLGYNLEHRFDNSWSVRQKLRYLNSHVTLNQVYAYGWSSGNTL
FT                   NRYYSGGEESLSAVTLDNQLDGSFDTGPLGHRVLVGIDYQQRDNDVTWYSGTFPAIDAF
FT                   NPVYGASSTYMGLSSLGTHKLRQTGAYLQDQMSWDNWRFTLGGRYDTVRLESIDKLNGA
FT                   DDAMDRNHFSSRAALLYLFNNGIAPYVSYSTAFTPTSFTDADGKLLEPMKGQQWETGLK
FT                   FQPEGSKSQYSASVFRINQKNIATKVQPTDPYTSIGEIESQGVELEAVGHITDSLRVQT
FT                   AYTYTDIRYKKSSLTEQGKQAVYAPRNQVSTWASYDVHRGPLDGLTIGAGVRYVNGITT
FT                   DRANTYRLPSYTLVDMAIGYDLSKVGLKGLSTQLNVNNLTDKRYIAACNSLEFCYFGAE
FT                   RSIVASMSYAF"
FT   sig_peptide     496818..496892
FT                   /locus_tag="Dd703_0458"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            complement(499109..500002)
FT                   /locus_tag="Dd703_0459"
FT   CDS_pept        complement(499109..500002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0459"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: pfl:PFL_2915 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84270"
FT                   /db_xref="GOA:C6C8P9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8P9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS84270.1"
FT                   /translation="MNGIESLSGMMAFVKAVESGSFASASARLGISASAVGKSVARLES
FT                   TLGVRLLNRSTRQLSLTDEGQLFYERARRIAVDLEETQFALAQLTGNPAGRLRISLPAI
FT                   GYRMLLPCLPQFVSHYPDIELDLDFTDRLVDVIGEGVDVAIRSGTLEDSQLRSRRLGSY
FT                   RLLLVAAPDYLQRYGAPTTPQQLSQHRCLHYRFSRTGQLMQWDIPGVAMAALSEKLVFS
FT                   NLEAQLSATIQGLGIAYVPDFAVRQELQDGRLTALLTAHTTTGGHFSLLWPDNRHMLPK
FT                   LRAFIDFLCEHHPLGP"
FT   gene            500106..501635
FT                   /locus_tag="Dd703_0460"
FT   CDS_pept        500106..501635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0460"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pfl:PFL_2916 major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84271"
FT                   /db_xref="GOA:C6C8Q0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Q0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS84271.1"
FT                   /translation="MKVGSQVRFSRAGSLVAVCLASSILPLNFTGGVLAIPAIAHEMGG
FT                   PPQALNWVSNAFMLAFGSLLMTMGSLADNHGRRRLFIAGVVVFTCASLLIGFSPNILIL
FT                   DLWRAVQGAAGAAMLAGGAAALADAFEGAARLRAFGMQGTSFGIGLSCGPVLAGYLVEQ
FT                   GGWRSVFLLSVLIGGLATLAGKRWMRESSAARPNPLDLPGILLFSMALALMTWGILQVA
FT                   SSGWGAPLVRLLLGGSLCCWAAFVVMARRSPFPMLDLSLFRYPAFIGVQLLPVATCYCF
FT                   VVLLALLPARFMGAEGLDSMTTGLFMVALSGPMLVVPGLAVYLTRWAAPARLCCLGLVL
FT                   AAAGLYALSVSERHVMILLSMLTIGIGTGLPWGLMDALSVSVVPRDRAGMATGIFSTVR
FT                   VAGEGIALAMVSTCLVALMSGQLTNPNDAALADIRYLVSGNASLLQHMPLAYWRTIYLH
FT                   AFNQLMVLLSAVTLLSALLIHVCLNRRSSSIHSPVVSAADVVSPAEDDAPC"
FT   sig_peptide     500106..500213
FT                   /locus_tag="Dd703_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.876) with cleavage site probability 0.592 at
FT                   residue 36"
FT   gene            501864..503510
FT                   /locus_tag="Dd703_0461"
FT   CDS_pept        501864..503510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0461"
FT                   /product="sodium-dependent inorganic phosphate (Pi)
FT                   transporter"
FT                   /note="TIGRFAM: sodium-dependent inorganic phosphate (Pi)
FT                   transporter; Na/Pi-cotransporter II-related protein; PFAM:
FT                   Na+/Picotransporter; PhoU family protein; KEGG: eca:ECA3983
FT                   putative sodium/phosphate cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84272"
FT                   /db_xref="GOA:C6C8Q1"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Q1"
FT                   /inference="protein motif:TFAM:TIGR01013"
FT                   /protein_id="ACS84272.1"
FT                   /translation="MLTLLHLLSAIALLVWGTHIARTGIMRVYGARLRRAISASVSHKP
FT                   LAFLAGLGVTALVQSSNATALLTTSFVSQGLIALTPALVILLGADVGTALMVRVMTFDL
FT                   SWLSPLLIFLGVVLFLSRKQMPAGQIGRAAIGFGLILLALELIVQAATPITQAAGVKVM
FT                   FSTLTGDILLDALLGALFAIVSYSSLAAVLLTATLTASHVISLEVALCLVIGANLGSGI
FT                   LAMINTSAQGAAARRVALGSMLFKLIGSLPALPAMGYLADGLAITGLPDSELVIYFHLS
FT                   YNLIRCLLLLPFAESMSKLCSHLIAMEQELDLRVRPKHLDNSALETPALALANAARETL
FT                   RMGDIVEQMLLRFQGALHGSHQQMQGIRRLNEDLDVLYNAIKLYLAQIDRVGIPDHESQ
FT                   RWAEVIETAMDMEQSGDIIERIIDDINNDSLGVRRSFSLAGMNELNELYALLVENLRLS
FT                   MSVFLSGDSVVARRLRRSKHRFRILSRRYSHSHVERLHQQNVQSLETSSLHLSMLGDMN
FT                   RLNSLFCSVAYSVLMASEDEDNEREGSTLSL"
FT   gene            complement(503601..504968)
FT                   /locus_tag="Dd703_0462"
FT   CDS_pept        complement(503601..504968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0462"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: eca:ECA3981 aspartate kinase III; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class;
FT                   PFAM: aspartate/glutamate/uridylate kinase; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84273"
FT                   /db_xref="GOA:C6C8Q2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041745"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Q2"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACS84273.1"
FT                   /translation="MPATTENTLIIAKFGGTSVADFDAMNRSADIVLTDPNVRIVVLSA
FT                   SAGVTNLLVALAEGLAPAERTANLDKIRQIQYAIVNRLTNPDVIREEIDRMLDNVARLS
FT                   EATALATSNALTDELVSHGELMSTLLFVEILRERNVPSEWFDVRKIMRTNDRFGRAEPD
FT                   CDALGELTQSQLQPRLAQGNLIITQGFIGSEAKGRTTTLGRGGSDYTAALLGEALRVNR
FT                   IDIWTDVPGIYTTDPRVVPAAKRIDLITFEEAAEMATFGAKVLHPATLLPAVRSDIPVF
FT                   VGSSKDPAAGGTLVCNQTENPPLFRALALRRKQTLLTLHSLNMLHARGFLAEVFSILAR
FT                   HNISVDLITTSEVNVALTLDTTGSTSTGDSLLSSALLTELSSLCRVEVEENLSLVALIG
FT                   NQLSQACGVGKEVFGVLEPFNIRLICYGASTHNLCFLVPSSDAEQVVQTLHRNLFE"
FT   gene            505460..507112
FT                   /locus_tag="Dd703_0463"
FT   CDS_pept        505460..507112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0463"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   eca:ECA3979 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84274"
FT                   /db_xref="GOA:C6C8Q3"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Q3"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ACS84274.1"
FT                   /translation="MKNINPTQTAAWQALQQHFAAMKEVTISDLFAKDTNRFAHFSATF
FT                   DDLMLVDYSKNRITAETLEKLQALARETDLSGAIRSMFSGEKINRTEDRAVLHVALRNR
FT                   SNTPIVVDGQDVMPAVNAVLQKMKAFSERVIGGDWKGYTGKAITDVVNIGIGGSDLGPY
FT                   MVTEALRPYKNHLVMHFVSNVDGTHIAETLKRVDPETTLFLVASKTFTTQETMTNAHSA
FT                   RDWFLKAAGDEKHVAKHFAALSTNGKAVSEFGIDIDNMFEFWDWVGGRYSLWSAIGLSI
FT                   ILSIGFDHFEQLLSGAHAMDQHFATVPAEKNLPVLLALIGIWYNNFFGAETEAILPYDQ
FT                   YMHRFAAYFQQGNMESNGKYVDRNGQAVNYQTGPIIWGEPGTNGQHAFYQLIHQGTKLV
FT                   PCDFIAPALTHNALSDHHSKLLSNFFAQTEALAFGKSRAEVEAEFAAAGKSAKDVEHVA
FT                   PFKVFEGNRPTNSILLREITPYSLGALIALYEHKIFTQGAILNIFTFDQWGVELGKQLA
FT                   NRILPELQDESAVSSHDSSTNGLINRFKQWRAH"
FT   gene            507341..507685
FT                   /locus_tag="Dd703_0464"
FT   CDS_pept        507341..507685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spe:Spro_0410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84275"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Q4"
FT                   /inference="similar to AA sequence:KEGG:Spro_0410"
FT                   /protein_id="ACS84275.1"
FT                   /translation="MRIRVLMGFSAAMLLAGCSTTNELSAAGQAVRFTDTKPGSECQLL
FT                   GSVTGTQSNWLSGSGNEGSAMRGAANDLRNKAAAMGGNVIFGISSPSQTFLSSFAPLDS
FT                   KMQGQVFKCP"
FT   sig_peptide     507341..507421
FT                   /locus_tag="Dd703_0464"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.527 at
FT                   residue 27"
FT   gene            complement(507709..508755)
FT                   /locus_tag="Dd703_0465"
FT   CDS_pept        complement(507709..508755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0465"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="KEGG: eca:ECA3977 hypothetical protein; TIGRFAM:
FT                   lysine 2,3-aminomutase YodO family protein; PFAM: Radical
FT                   SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84276"
FT                   /db_xref="GOA:C6C8Q5"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Q5"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ACS84276.1"
FT                   /translation="MAHIITRKPAAGEDWLQQLADVITDPGELLQLLALSDHPLLSQGH
FT                   EARKLFPLRVPRAFAARMQPGDPDDPLLKQVITSKAEFLLTPGFTNDPLDEQRSVVPGL
FT                   LHKYHNRALLLVKGGCAVNCRYCFRRHFPYQENQGSKANWRQALDYIRQHPELDEIIFS
FT                   GGDPLMAKDHELDGLLTGLEEITHLKRLRIHSRLPVVIPARITEALSLRLAQSRLQILL
FT                   VTHINHANEIDAELAQGLHRLRRAGVTLLNQSVLLRGVNDSADELANLSHALFDAGVMP
FT                   YYLHVLDKVQGAAHFLVPDDKATALIKTLMTQVSGYLVPRLVREIGGEASKTPLDLGMR
FT                   QHQTLPLD"
FT   gene            508791..509357
FT                   /locus_tag="Dd703_0466"
FT   CDS_pept        508791..509357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0466"
FT                   /product="translation elongation factor P"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P; Elongation factor P/YeiP protein;
FT                   Elongation factor KOW domain protein; KEGG: sgl:SG0309
FT                   elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84277"
FT                   /db_xref="GOA:C6C8Q6"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Q6"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ACS84277.1"
FT                   /translation="MASYSTNEFRSGLKIMQDGEPCAIVENEFVKPGKGQAFNRVKIRK
FT                   LISGKVLEKTFKSGDSVEAADVMDMNLTYLYNDGEFWHFMNNETFEQLAADAKAVGDNA
FT                   KWLVEQAECVLTLWNGQPIAVTPPNFVELEITETDPGLKGDTAGTGGKPATLTTGAVVK
FT                   VPLFVQIGEVIKVDTRSGEYVSRVK"
FT   gene            509499..509852
FT                   /locus_tag="Dd703_0467"
FT   CDS_pept        509499..509852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0467"
FT                   /product="protein of unknown function DUF486"
FT                   /note="PFAM: protein of unknown function DUF486; KEGG:
FT                   eca:ECA3974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84278"
FT                   /db_xref="GOA:C6C8Q7"
FT                   /db_xref="InterPro:IPR007437"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Q7"
FT                   /inference="protein motif:PFAM:PF04342"
FT                   /protein_id="ACS84278.1"
FT                   /translation="MSPLIITVCMLSLSNLFMTFAWYGHLRYFSGRTWIVAALVSWGIA
FT                   LFEYLLQVPANRIGYQVASAGQLKILQEVISLSVFIPFSIVILKEPFRTDYIWAGLCLL
FT                   GAVFFMFRDKILG"
FT   gene            complement(510392..510748)
FT                   /locus_tag="Dd703_0468"
FT   CDS_pept        complement(510392..510748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0468"
FT                   /product="fumarate reductase D subunit"
FT                   /note="PFAM: fumarate reductase D subunit; KEGG:
FT                   eca:ECA3972 fumarate reductase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84279"
FT                   /db_xref="GOA:C6C8Q8"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Q8"
FT                   /inference="protein motif:PFAM:PF02313"
FT                   /protein_id="ACS84279.1"
FT                   /translation="MINQKPKRSDEPPFWGLFGAGGMWSAIFSPVIILLIGLLLPLGLF
FT                   PGALAYERIAAFSHSFIGRAFLLLMIVLPLWCGLHRMHHAMHDLKIHIPAGKWVFYGLA
FT                   AILTVVTLISIVTL"
FT   gene            complement(510763..511158)
FT                   /locus_tag="Dd703_0469"
FT   CDS_pept        complement(510763..511158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0469"
FT                   /product="fumarate reductase subunit C"
FT                   /note="PFAM: fumarate reductase subunit C; KEGG:
FT                   eca:ECA3971 fumarate reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84280"
FT                   /db_xref="GOA:C6C8Q9"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Q9"
FT                   /inference="protein motif:PFAM:PF02300"
FT                   /protein_id="ACS84280.1"
FT                   /translation="MTTKRKAYVRGMTPTWWQKLGFYRFYMLREGTAVLAVWFSIVLLY
FT                   GVSSLKGGPEGWSHFVSFLQSPLVLLINLVALLAAVLHTKTWFDLAPKASIIIVDDEKM
FT                   APEPIIKGLWAVTVVVTLAVLAIALLF"
FT   gene            complement(511176..511910)
FT                   /locus_tag="Dd703_0470"
FT   CDS_pept        complement(511176..511910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0470"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /note="KEGG: yen:YE0363 fumarate reductase iron-sulfur
FT                   subunit; TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84281"
FT                   /db_xref="GOA:C6C8R0"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8R0"
FT                   /inference="protein motif:TFAM:TIGR00384"
FT                   /protein_id="ACS84281.1"
FT                   /translation="MAELQTLKMEVMRYNPEQDNAPHFETYSVPYSRETSLLDALGYIK
FT                   DNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYADGMKIEALGNFPIERDLV
FT                   VDMTHFIESLEAIKPYVIGNDRKPEQGTNKQTPAQMAKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDSRDHGKKERMPMLNGDNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQGKVESAKDFMIAMLKPQ"
FT   gene            complement(511903..513699)
FT                   /locus_tag="Dd703_0471"
FT   CDS_pept        complement(511903..513699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0471"
FT                   /product="fumarate reductase, flavoprotein subunit"
FT                   /note="TIGRFAM: fumarate reductase, flavoprotein subunit;
FT                   succinate dehydrogenase or fumarate reductase, flavoprotein
FT                   subunit; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: eca:ECA3969 fumarate
FT                   reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84282"
FT                   /db_xref="GOA:C6C8R1"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8R1"
FT                   /inference="protein motif:TFAM:TIGR01176"
FT                   /protein_id="ACS84282.1"
FT                   /translation="MQTFNADLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVAQDHDSFDFHFHDTVAGGDWLCEQDVVEHFVQNCPHEMTLMEQWGCPW
FT                   SRKPDGSINVRRFGGMKIERTWFAADKTGFHMLHTLFQTSIKYPQIQRFDEHFVLDILV
FT                   DDGHARGLVAINMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMAFRHGI
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGIMVNKDGYRYLQDYGLGPETPLGEPKNK
FT                   YMELGPRDKVSQAFWHEWRAGRTISTPLGDVVYLDLRHLGEKKLKERLPFICELAKAYV
FT                   GVDPVKEPIPIRPTAHYTMGGIETDQQCETRIKGLFAAGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRVAGEKAVERSREATPANSSALDAQARDVEQRLHTLMKQEGTESWAKIRDEMGL
FT                   SMEEGCGIYRTTELMQKTVDKLAELKERFKRVKITDHSSVFNTDLLYTIELGHSLDVAE
FT                   CMAHSAINRRESRGAHQRLDEGCTKRDDVNFLKHTLAYYNPEGAPRLEYSDVKITKLPP
FT                   AERVYGAEAEAQEKNKKEQANG"
FT   sig_peptide     complement(513628..513699)
FT                   /locus_tag="Dd703_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.895) with cleavage site probability 0.362 at
FT                   residue 24"
FT   gene            514403..515380
FT                   /locus_tag="Dd703_0472"
FT   CDS_pept        514403..515380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0472"
FT                   /product="lysyl-tRNA synthetase-related protein GenX"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase-related protein GenX;
FT                   PFAM: tRNA synthetase class II (D K and N); KEGG:
FT                   eta:ETA_29770 putative lysyl-tRNA synthetase (lysine-tRNA
FT                   ligase)"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84283"
FT                   /db_xref="GOA:C6C8R2"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8R2"
FT                   /inference="protein motif:TFAM:TIGR00462"
FT                   /protein_id="ACS84283.1"
FT                   /translation="MSETVSWQPSAPIANLLKRASIMKEIRRFFSDRGMLEVETPALSQ
FT                   ATVTDIHLFPFQTRFVGPGAADGIELYMMTSPEYHMKRLLAAGSGPIYQLCRSFRNEES
FT                   GRFHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLECDSAEMLSYQQAFQRHLAVDPLS
FT                   ADKAQLRDVAEKLGVGDVASQEEDRDTLLQLLFTVGIEPHIGRDKPAFVYHFPATQAAL
FT                   AEISTEDHRVAERFEAYFKGIELANGFCELTDSHEQRQRFEQDNRKRAARGLPVQPIDE
FT                   HLLSALSAGIPPCSGVALGVDRLIMLALNAESIGDVIAFTVERA"
FT   gene            complement(515513..518827)
FT                   /locus_tag="Dd703_0473"
FT   CDS_pept        complement(515513..518827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0473"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   eca:ECA3967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84284"
FT                   /db_xref="GOA:C6C8R3"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8R3"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACS84284.1"
FT                   /translation="MRLILIFLLGCLLSTTSLAASEPGEAQLQQELQQAQANKDAPGQA
FT                   DIVRELQSALRLLDERRETRQRADQYQRIIDDFPRLMQDLRQQLMAEENKPPSLPKTQS
FT                   VNELEQLIVQFGSQLLEQSRQLQQEQDRLREISDSLTQLPQQQTEANRALSDVERRVQA
FT                   LGSPTTALGQAQAAALQTELSLRKSRVNELELEQLSASNRQELSRLRADLYKKRRDRLD
FT                   NQLQALRSTLNTLRQKEAEQALERTELLAEQEGELPEAISRQLQLNRELSVALNQQAQR
FT                   IDQIAAQQRQTTAQTLQVRQALGTLREQAQWLGASPALGETLRAQVARLPEMPKSQRLD
FT                   GEMAQLRAQRLHYEDLLNRQSQDAPASADGNAALSAAQQKIFNDQRRTQRDLLTSLMSG
FT                   CDTQILELTKLKVASNQLEDALNEIRDAAHRYLFWVADVDPVGFAYPLELLHDLSRLLS
FT                   LDTLTQLSGALLMMFTSSGSLLPLLGALLLVGLSISSRRHYHAFLERASSRVGKVTLDY
FT                   FMLTLRTVFWSVMVAIPLPVLWAALGYGLQNAWPYPVAVAIGDSVTATVPLMWVVMISA
FT                   SFAHRQGLFIVHFGWPPRQVARAMRYYRLSIGFIVPLIMALITFDNLNDREFSGSLGRL
FT                   CFVLLCMALSLVTTGLKRAGIPLYLDKEGSGENPINRAMWNLLICIPLFAALAACLGYL
FT                   TTSQALLARLETSVAIWFFLLVVYHIIRRWMLIQRRRIAFDRARQRRAEILAARARGEE
FT                   DQTAYESGVDNIEEPVVDLDAISARSLKLVRSILTLMALVSVIVLWSEIHSAFAFMENI
FT                   SLWNVTSSVKGVDSIQPITLGALLIATLIFIITAQLVRNLPALLELAVLQHIELSPGTG
FT                   YAIITVSKYLLILVGGLMGFSMIGIEWSKLQWLVAALGVGLGFGLQEIFANFISGLIIL
FT                   FEKPIRIGDTVTIRDLTGSVMRINTRATTISDWDRKEIIVPNKAFITEQFINWSLSDSV
FT                   TRVVLTIPAPADANTQDVTALLLNAVQRCSLVLDNPPPEVFLVDLRQGIQIFELRIFAA
FT                   EMGHRMPLRHELHQLILESYRQHNLVMPFPPFQVQMDSVQIVGRNAATSTRTAGGL"
FT   sig_peptide     complement(518768..518827)
FT                   /locus_tag="Dd703_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.932 at
FT                   residue 20"
FT   gene            complement(518859..519773)
FT                   /locus_tag="Dd703_0474"
FT   CDS_pept        complement(518859..519773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0474"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: eca:ECA3966 phosphatidylserine decarboxylase;
FT                   TIGRFAM: phosphatidylserine decarboxylase; PFAM:
FT                   phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84285"
FT                   /db_xref="GOA:C6C8R4"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8R4"
FT                   /inference="protein motif:TFAM:TIGR00163"
FT                   /protein_id="ACS84285.1"
FT                   /translation="MLDSIKIALHHALPKVGLTRLAGWAADKQAGRLTKLVIDLFVRCY
FT                   KVNMQEAQQPDTAAYRTFNEFFVRPLKPGIRPVDPLPQHLVMPADGMISQLGVIDDDRI
FT                   LQAKQHDYSLEALLAGNYIIADLFRDGLFVTTYLSPRDYHRVHMPCDGVLRDMIYVPGD
FT                   LFSVNPLTAENVPNLFARNERVICLFDTPFGPMVQILVGATIVGSIETVWAGVVTPPRE
FT                   GIIKRWAYPPEGEDAVVLEKGDEMGRFRLGSTVINLFSPGHVQLMPGLASQSVTRMGEA
FT                   LAEALTPADSSPINGSDYRQHTP"
FT   gene            complement(519842..520891)
FT                   /locus_tag="Dd703_0475"
FT   CDS_pept        complement(519842..520891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0475"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: eca:ECA3965 ribosome-associated
FT                   GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84286"
FT                   /db_xref="GOA:C6C8R5"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8R5"
FT                   /inference="protein motif:TFAM:TIGR00157"
FT                   /protein_id="ACS84286.1"
FT                   /translation="MSKKKLSKGQQRRVSANHQRRLKHADHSVEWDDNQLGEPQEGVII
FT                   SRFGMHADIEAPDGALHRCNIRRTINSLVTGDRVVWRAGNETLSGISGIVEAVHPRQSV
FT                   LTRPDYYDGLKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEIEPLIVLNKIDLL
FT                   DEEAREFVEEVMDIYRRLNYRVLMVSSKTQSGIAELEAALTHRISIFAGQSGVGKSSLL
FT                   NALLYPGETRIQINDVSDGSGLGQHTTTAARLYHFPHGGDMIDSPGVREFGLWHLEPEQ
FT                   VTRGFIEFRDYLGSCKFRDCKHDTDPGCAIREALERGEIAPERFDNYHRILESMTQVKT
FT                   RKSFSGSDN"
FT   gene            521024..521566
FT                   /locus_tag="Dd703_0476"
FT   CDS_pept        521024..521566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0476"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: eum:ECUMN_4696 oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84287"
FT                   /db_xref="GOA:C6C8R6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8R6"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ACS84287.1"
FT                   /translation="MVNENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNVLAEGPTL
FT                   AVHQSDSQLALMDDWNVRTHTASGLVDRVKASTFDDRAAELATLRFLEQWVPAGKSPIC
FT                   GNSIGQDRRFLFRYMPELEAYFHYRYLDVSTLKELARRWKPEMLAGFKKRNTHQAMDDI
FT                   RESVAELAYYREHFIQL"
FT   gene            521771..521846
FT                   /locus_tag="Dd703_R0012"
FT                   /note="tRNA-Gly1"
FT   tRNA            521771..521846
FT                   /locus_tag="Dd703_R0012"
FT                   /product="tRNA-Gly"
FT   gene            522107..522913
FT                   /locus_tag="Dd703_0477"
FT   CDS_pept        522107..522913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84288"
FT                   /db_xref="GOA:C6C8R7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8R7"
FT                   /inference="similar to AA sequence:KEGG:PSEEN0738"
FT                   /protein_id="ACS84288.1"
FT                   /translation="MTSFNYPRARRVAGGLVCVLALACGAQVRADDPLLAVPTSQTPSP
FT                   APADNPTRGILVAIDQATLSSDLAGRIVEMPFREGESFKKGDLLVRFDCAIYQAQLAAS
FT                   QAAARAAEAELSQNQQLAQMKSVGRHAVALSAARFAQAQAESQVYQIQVNRCRIPAPFD
FT                   GQVVKRRAQEHESVGLGMPVLDIVNNRRLEINLLVPSRGLSVLKPGLAFTFTPDETGKP
FT                   LRARVARLGARIDESSQTLNLIGIIETQDSSLMAGMSGTAHFPESL"
FT   sig_peptide     522107..522199
FT                   /locus_tag="Dd703_0477"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 31"
FT   gene            522910..524220
FT                   /locus_tag="Dd703_0478"
FT   CDS_pept        522910..524220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_0146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84289"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8R8"
FT                   /inference="similar to AA sequence:KEGG:Pfl01_0146"
FT                   /protein_id="ACS84289.1"
FT                   /translation="MSTTPPVSTERVFARFLDLEHQARSAKTVEELAYCIVNDSQTLFG
FT                   FRHAALVINGRVRAVTGVTQPAPNAPFVAFVERACAQLPQDGRCAQVIAASLDQQTRND
FT                   WQTLSAPEALWAPLNDRHGRPFGGIWYAREQPWQNAEQLLAERLSHAFAHAWLALEPLS
FT                   SWRRARWRWKFAIPCLLIAACLLIPVRQSVLAPAEVIPFNGRVVAAPLDGVIQSFAVQP
FT                   NQSVRKGDPLVRFDDTTLKAQADVAERALNVAEAEYRASSQRAFQDADSKARLDFLAAQ
FT                   VAQKRAERDYANALLGRAEIRAERDGIAVFADAERWSGKPVRTGERLMDLADPTQVALR
FT                   IELDVGDAIRLAPDAPITLFLDSDPVTPHDARLDRIAYESEPTPAGNLAYRLDARFTGE
FT                   PPRIGLRGTAKVSGEYVPLAVYLFRRPLAVLRQSVGI"
FT   gene            524217..526322
FT                   /locus_tag="Dd703_0479"
FT   CDS_pept        524217..526322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0479"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: pfo:Pfl01_0147 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84290"
FT                   /db_xref="GOA:C6C8R9"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8R9"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ACS84290.1"
FT                   /translation="MSEFLPALRADLQLVASAAGLDGAPQWVLSDPATGRYFTLTPSAI
FT                   RLLRHWSLRELQSVLAAANTEPGLLLQRSDLEQLLRFLRNHDLIAASDPVQRQAYAIKA
FT                   GAMRTSLWKSLLHQYLFFRIPLWRPDPWLSRCWPGLQRYGRPFLRVGLPLILLLGGFLV
FT                   SRDWVRYTHAFPHLFSLQGMATFGVALFCAKFVHELGHAFMAKRAGCRVQNMGVAFIVL
FT                   FPLFYTDVSDAWKLKDHRARLLISAGGILAELLLAGIALLVWALLPDGPVRSAVFMLSS
FT                   ATWITTLVVNLNPLMRFDGYFLLSDFWRVENLQERAYALCRWRLREALFGYGRPAPQTW
FT                   SPAMQRKLLIWGYASWVWRFFLFTGIALVVYHFFIKLVGIGLMLVEIGWFVALPIVKEM
FT                   SVWWSMRNAAHPANLLRSVLAGALILIFLLFPWRGSIRIPAVLEAENVSVLYAPIPAQV
FT                   KALHVVDGQSVKAGDVLLELTSADVDYRIAIERLQIAVLQQRLQRGAARQETASETQVI
FT                   DRQLAESLARYRGLVAQQQRLSIVAPQAGLVRDVTRDMTAGRWLTADMPLLRVVDAGAG
FT                   RVQGYLPEDALKRAQTGAQGTFIADEPAYPRLTVRLNDIAPTGVAYLQREMLASDRHGP
FT                   IAVRRDRDHNPLPVQAQYSIRFRVEDDRLLPPQPLRGSVILEGDKESILGAVWRRVAAL
FT                   GIRESGF"
FT   gene            526593..527525
FT                   /locus_tag="Dd703_0480"
FT   CDS_pept        526593..527525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0480"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG:
FT                   shn:Shewana3_0167 phage tail collar domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84291"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8S0"
FT                   /inference="protein motif:PFAM:PF07484"
FT                   /protein_id="ACS84291.1"
FT                   /translation="MKRVQRVFVKSAIAVVLSGGVFLPQAVAGCSADSPYIGGICYMAG
FT                   TYCPADDYLPADGRTLNISDYQVLYAVIGTLYGGNASTNFMLPDLRGRTAIGAGPLNGS
FT                   SPTYNPIPGQKIGQEVSNVVGTGSVTLTASQVPPHTHPATLTLNGVSGTTPVASGAVSL
FT                   TSLSGSITNLPFSAVASLGVTGIAKIGSSTTTGRSVSLTDKALLTSVGGPSAQIYAPSG
FT                   TNDRQVGPDGSVTGTASGTVSGTANGGQLSGTVSGNVSLPVVGAVTVGANATVPAPVTV
FT                   PVAVSVPVRDPSLVMTACIAVRGIYPTRP"
FT   sig_peptide     526593..526682
FT                   /locus_tag="Dd703_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.493 at
FT                   residue 30"
FT   gene            527910..528836
FT                   /locus_tag="Dd703_0481"
FT   CDS_pept        527910..528836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0481"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG:
FT                   shw:Sputw3181_3688 phage tail collar domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84292"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8S1"
FT                   /inference="protein motif:PFAM:PF07484"
FT                   /protein_id="ACS84292.1"
FT                   /translation="MKHVRHLFVKSTIAVALSAGVLLPQTAAACSADGDYIGSVCYMAG
FT                   TYCPADDYLPANGQTLNVSEYQALYALIGNIYGGTQNKTFALPDLRGRTAIGSGPLSGT
FT                   TSVYTPGQKIGQEVSNVVGTGSVTLTASQVPPHTHPATLTLNGVSGTTPVASGAVSLTS
FT                   LSGSITNLPFSAVASLGVTGIAKIGSSTTTGRSVSLTDKALLTSVGGPSAQIYAPSGTN
FT                   DRQVGPDGSVTGTASGTVSGTANGGQLSGTASGNISLPVVGAVTVGANATVPAPVTVPV
FT                   AVSVPVRDPSLVMTACIAVKGYYPLHP"
FT   sig_peptide     527910..527999
FT                   /locus_tag="Dd703_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.912 at
FT                   residue 30"
FT   gene            529088..535486
FT                   /locus_tag="Dd703_0482"
FT   CDS_pept        529088..535486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0482"
FT                   /product="Ig family protein"
FT                   /note="PFAM: Ig family protein; SMART: Dystroglycan-type
FT                   cadherin domain protein; KEGG: hch:HCH_03194 outer membrane
FT                   protein domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84293"
FT                   /db_xref="GOA:C6C8S2"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8S2"
FT                   /inference="protein motif:PFAM:PF05345"
FT                   /protein_id="ACS84293.1"
FT                   /translation="MLWRHLFRKKGSHPACPVASVSEIPLGYALEARMLFDGAIAATVD
FT                   QTAETQPTTTQTASAETATQTDGSHAEGTTDHTDSSSSGTSTQSTTSDSSEAVAVAGET
FT                   THKEVVFVDTSVADYQTLVSQIPAGMDVVLLDSSQDELTQMAEWAQTHSGYDAIHIISH
FT                   GAEGRIYLGGLTLDTATAAARQSDLSALGAALTETGDILLYGCSVASGEGVSFIEEIAS
FT                   ATGADVAASSDLTGSAEKGGDWTLEKSVGTDAIQATALSFDNYNELLTIVTFDQTDYDS
FT                   GSGLYTKTVSSVSFTFNGTDFFSFNNNHDAGYMVYPDSATGDTATKVTIAVASGYTFDL
FT                   TSFSYYTTNADIITVTFTYADNSTVTGTLTATSDTDITLSDFSVFKDASNNALPTLAND
FT                   VISVVIASSNSAGTYDFGTNNYDISDVKTITPKDTTSTVTAGAASEATTFSTTATSVAS
FT                   ATSLLDFTITDTGASDGVATTVSALSVDVTGTATSSELSEMTFLLSGPDATNVVGTYSS
FT                   STGKITFSGLNLSIADGDHETYTIKAYYSDNTSSNDITDHHTVILSVNASNFTTGSGSS
FT                   TFTSGQSSVTNGSGASIDVAATKLIYSQSPSTSVVSGINFTTQPTVIAVDDRGNIDTDF
FT                   SGTVTLSENGSGSLTGTTSVTASNGIATFSGVKYTSASDADANFTLTAASGSLVSATSA
FT                   SIDPDVVATKLVFSTQPVPTTVQDGQSTSFTTVPVVQAVDANGMVDQDYTTNIVLSVTD
FT                   PNDGTVDGTVNSLTVTSGDQDASSTTVTLTPSGGIATYTGLIIQYTNSGSTNTLALRAT
FT                   SGSLTAVNSSSLTSTSNTAPVFSNLNGGATFTENGSAVVIDNDVTVADTELNSQGNYNG
FT                   ASITIARNGGASSNDIFGNSELLGALMQGQNFTYNGTTVGSVTANASGTLTLTFNSNAT
FT                   SAIVNAVLQSLTYTNSSDDPPASVTLNWTFNDGSLNSTGTNQAVISITPVNDAPTLSSG
FT                   ALVTLTSTTEDATSSSTTVSSLLSAAGYADVDSGALSGIALTALSGNGTWQYSTDSGTN
FT                   WYSVGTVSSTSALLLSSTAQLRYVPDGATVETAAFNFSAWDQTSGTATTGATKGLADTS
FT                   TTGGSSAFSSNSALASLTVSDVNDAPTLSSGASLTLTSTTENVTSSSTTVSSLLSAAGY
FT                   ADVDSGALSGIALTALSGNGTWQYSTDSGTNWYSVGTVSSTSALLLSSTARIRYVPDGA
FT                   NGETAAFNFNAWDQTSGTATTGATKGLADTSTTGGSSAFSSNSALASLTVSDVNDAPTL
FT                   SSGASLTLTSTTEDATSSSTTVSSLLSAAGYADVDSGALSGIALTALSGNGTWQYSTDS
FT                   GTNWYSVGTVSSTSALLLSSTARIRYVPDGANGETAAFNFNAWDQTSGTATTGATKGLA
FT                   DTSTTGGGSAFSTNSAQASLSVSDVNDAPTLSSGASVTLTSTTENVTSSSTTVSSLLSA
FT                   AGYADVDSGALSGIALTALSGNGTWQYSTDSGTNWYSVGTVSSTSALLLSSTAQLRYVP
FT                   DGANGETAAFNFSAWDQTSGTATTGATRGLADTSTTGGSSAFSTNSAQASLSVSDVNDA
FT                   PTLSSGASVTLTSTTENVTSSSTTVSSLLSAAGYADVDSGALSGIALTALSGNGTWQYS
FT                   TDSGTNWYSVGTVSSTSALLLSSTAQLRYVPDGANGETAAFNFSAWDQTSGTATTGATR
FT                   GLADTSTTGGSSAFSTNSAQASLSVSDVNDAPTIGSTISGQTATKGTAFSFTLPNSTFV
FT                   DVDTSDTLTLSATLADGSPLPSWLAFNAANGTFSGTPGNGNVGNLSIRVTATDSSNASI
FT                   STTFDLAVNDNNQSPVVNGTLAAQTATQDSSFSLVVPASLFTDPDSGDALTLSAAQADG
FT                   SALPGWLTFNPVTRTLSGTPGSGDVGSLTIRVTATDSSSVSVSVTFGLSVTSSAQDGVD
FT                   PEFKMNGGTTAPQLSSTPTVAVSVASNAPVTLGSLFSSSSLGAISTGVTAESATVTASI
FT                   FQSSQQKASTTTTPVSQISNAFVVGATGGVSHFDSALGSFPSFNTGGALGGSSSLAGLF
FT                   SGINLPSLSTMSVFSGGSWRDINTNTGSGGGFTASSPGGSAMNFTPSLEQQLQQLGDNE
FT                   WQRLAAIEQALLAMGQQQEQQG"
FT   gene            535548..537056
FT                   /locus_tag="Dd703_0483"
FT   CDS_pept        535548..537056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0483"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   ppw:PputW619_0676 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84294"
FT                   /db_xref="GOA:C6C8S3"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8S3"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACS84294.1"
FT                   /translation="MSKGRKFFSLSLMVMAMSGCAVTSQPISKQQSEQRIQQDKVVMFG
FT                   KQEPVTAPITLYDAMARALKYNLEARLKVMEQALSQQQLELARYDMLPQMAMAAGYVGR
FT                   SNTSASSSRSVETGRQSLEPSTSLDRDRQVADLTMVWNVLDFGVSYVGAKQKADQGWIA
FT                   EERKRKVVHTILQDVRSAYWRAVAAERLLGRIDGLIGRVNQAREASEHMSTQQVGDPIE
FT                   ALSYRRALIDAVRQLEEQRRALSLAKTELATLMNLPLDTPYTLALPAGKDMVTPQLTVD
FT                   FNTLEQAALVSRPELREQDYQVRIHAAETRKSLLRMLPGIEVSAGGHYDSNSFMVNQSW
FT                   ADVGVKVTWNLFNLLSGPAAHKAAQANETVSEMQRQAMSLAVMAQLYIARANFNEALRQ
FT                   YKTSTELRDLDGQIAEQLQNRYKANSIGELQLIQGELNALNASLRQDLAYAELRNTYGQ
FT                   ILSTVGLDLLPKKLPSDRLADISQALRQSEANWQQGNIGSLQSF"
FT   sig_peptide     535548..535619
FT                   /locus_tag="Dd703_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.699 at
FT                   residue 24"
FT   gene            537662..538882
FT                   /locus_tag="Dd703_0484"
FT   CDS_pept        537662..538882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0484"
FT                   /product="succinylornithine transaminase family"
FT                   /note="TIGRFAM: succinylornithine transaminase family;
FT                   acetylornithine and succinylornithine aminotransferase;
FT                   PFAM: aminotransferase class-III; aminotransferase class I
FT                   and II; KEGG: spe:Spro_2844 bifunctional succinylornithine
FT                   transaminase/acetylornithine transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84295"
FT                   /db_xref="GOA:C6C8S4"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8S4"
FT                   /inference="protein motif:TFAM:TIGR03246"
FT                   /protein_id="ACS84295.1"
FT                   /translation="MEYPESVSRRDFDDRMVPVYAPAAFIPVRGAGSRVWDQAGKEYID
FT                   FAGGIAVNALGHAHPAAQAALVEQAGKLWHMGNGYTNEPVLRLAKQLIDATFAERAFFC
FT                   NSGAEANEAALKLARKVGHDSGIADKNRIVAFGNAFHGRTLFTVSAGGQPKYSQDFAPL
FT                   PGGIFHVPFNDLSAAEVAVNERTCAVIVEPIQGEGGVLPADPAFLQGLRALCDRHGALL
FT                   IFDEVQTGVGRTGSLYAYMDYGVVPDVLTTAKALGGGFPIAAMLTTEKLAQSLSVGSHG
FT                   TTYGGNPLAAAVAGTVFGLINTPEVLAGVAARHRRLVAGLDALNQRYPVFSCVRGKGLL
FT                   LGAVLKEAFAGQAKKLLRLAGEEGAIMLMAGPDVVRFTPSLIIPEADIDEGVSRLARAL
FT                   ARFCAEC"
FT   gene            538904..539938
FT                   /locus_tag="Dd703_0485"
FT   CDS_pept        538904..539938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0485"
FT                   /product="arginine N-succinyltransferase"
FT                   /EC_number="2.3.1.109"
FT                   /note="KEGG: spe:Spro_2843 arginine succinyltransferase;
FT                   TIGRFAM: arginine N-succinyltransferase; arginine/ornithine
FT                   succinyltransferase subunit; PFAM: arginine
FT                   N-succinyltransferase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84296"
FT                   /db_xref="GOA:C6C8S5"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017650"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8S5"
FT                   /inference="protein motif:TFAM:TIGR03244"
FT                   /protein_id="ACS84296.1"
FT                   /translation="MMIIRHVQEHDLADLLTLAGKTGVGLTSLPCNEAILSARIERMVK
FT                   TRQGSASRGEQGYLFVLEDTDAGRVVGVSALEAAVGLEEPWYNFRVGTQVHASKTLNVY
FT                   RAVPTLFLSNDHTGYSELCTLFLDPDYRHSLNGKLLSKIRFLFMSAFRSHFADKVFAEM
FT                   RGYADDDGRSPFWEGVGKHFFAMDFATADYLSGTGQKAFIAELMPRHPLYVDFLPEDAR
FT                   AAIAKVHPHTVPARRVLESEGLRYQGYIDIFDGGPTLEAALDELRAVKESRRVSVALGE
FT                   QPTSPDAPVYLAANDDYLNYRALLVQGGVGHDTLNVDAAQAAALGVQAGSPVRILPLTT
FT                   AENR"
FT   gene            539938..541407
FT                   /locus_tag="Dd703_0486"
FT   CDS_pept        539938..541407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0486"
FT                   /product="succinylglutamic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinylglutamic semialdehyde
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   abm:ABSDF0357 succinylglutamic semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84297"
FT                   /db_xref="GOA:C6C8S6"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017649"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8S6"
FT                   /inference="protein motif:TFAM:TIGR03240"
FT                   /protein_id="ACS84297.1"
FT                   /translation="MSHASLFIDGVWRPGRGGVVTKTDPLDNHVLWQAAGADEHDVAHA
FT                   CEAARRAFPAWARRSLAERIAVLERFAVLLEQHKTALAETISRETSKPRWETLTEVQAM
FT                   IGKIAISLKAYQQRTGESSTPMADGAATLRHRPHGVLAVFGPYNFPGHLPNGHIVPALL
FT                   AGNCVVFKPSELTPLTAEETVTLWQQAGLPQGVLNLVQGGRDTGAALAASPEIDGLLFT
FT                   GSAGTGYHLHRQWAGQPDKMLALEMGGNNALIVDEATDIDAAVNLTIQSAFISAGQRCT
FT                   CARRLLVRDGEQGDAFLRRLVEVAARLRVGRWNDEPQPFMGGVISAAAADRMMTAQRQL
FT                   LALGAKPFLPMTRPQADNGLLTPGILDVTGVAGVPDEEYFGPLTCVTRYRSFDEALRLA
FT                   NSTRYGLAVGLVSPERERFERLLLEARAGIVNWNRPLTGASSAAPFGGVGASGNHRASA
FT                   FYAADYCAWPMASLESETLTLPAALSPGLLL"
FT   gene            541433..542782
FT                   /locus_tag="Dd703_0487"
FT   CDS_pept        541433..542782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0487"
FT                   /product="succinylarginine dihydrolase"
FT                   /EC_number="3.5.3.23"
FT                   /note="KEGG: spe:Spro_2841 succinylarginine dihydrolase;
FT                   TIGRFAM: succinylarginine dihydrolase; PFAM:
FT                   Succinylarginine dihydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84298"
FT                   /db_xref="GOA:C6C8S7"
FT                   /db_xref="InterPro:IPR007079"
FT                   /db_xref="InterPro:IPR037031"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8S7"
FT                   /inference="protein motif:TFAM:TIGR03241"
FT                   /protein_id="ACS84298.1"
FT                   /translation="MSGFEMNMDGLVGPTHHYAGLSFGNEASTRHRDVVANPQLAARQG
FT                   LLKMKALTDLGLTQAVLPPQERPHLPMLRRLGFSGSDEAVLAQAMRRSPRLLSTLSSAS
FT                   SMWTANAATVSPSADSTDGRVHFTAANLNNKFHRSIEAETTSAVLRAIFRDDRHFAHHQ
FT                   ALPQSALFGDEGAANHNRLGGDYARRGVQVFVYGVQQFDGEPGPQRYPARQTREASEAI
FT                   ARLHQLDPAHTVFVQQHPAVIDQGVFHNDVIAVSNQQVLFCHQLAFLHQPQALDEIRRK
FT                   LATLEQTLHVIEVAAARVSVADAVGTYLFNSQLLTRPDGGMTIVVPEECRQHAGVWEML
FT                   SEMAASGGPVDDIRVFDLRESMRNGGGPACLRLRVALNDAERRAMNPGVLMNDALFVTL
FT                   NQWVDRHYRDRLTQDDLADPQLLRESRAALDELTRILGLGSVYPFQQSSR"
FT   gene            542800..543822
FT                   /locus_tag="Dd703_0488"
FT   CDS_pept        542800..543822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0488"
FT                   /product="succinylglutamate desuccinylase"
FT                   /EC_number="3.5.1.96"
FT                   /note="KEGG: spe:Spro_2840 succinylglutamate desuccinylase;
FT                   TIGRFAM: succinylglutamate desuccinylase; PFAM:
FT                   Succinylglutamate desuccinylase/aspartoacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84299"
FT                   /db_xref="GOA:C6C8S8"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016681"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8S8"
FT                   /inference="protein motif:TFAM:TIGR03242"
FT                   /protein_id="ACS84299.1"
FT                   /translation="MNDFLAQTLRGEMSTPSCGEQGGLRWRWLGEGGLELTPTAGYQRA
FT                   VALSAGIHGNETAPIELLDRLAGDLLTGRLPLTVRLLLVLGNPAAIRAGKRYLHSDINR
FT                   MFGGRHSRFPLSGETVRAHWLEQALTAFFAADVLTGGVERYHYDLHTAIRDSLLPRFGL
FT                   LPFQERPYNLLLLESLTAAELDALVVHREPGGTFSHFSSEQLMAASCTLELGKARPLGE
FT                   NDLSQFDAIDQALRALVSGTSMPVRRVAPMRLFSVVRSLMKRSEAFQLHVAGDAPNFTP
FT                   FARGTLLCEQPGEAYRVAHEREWILFPNPSVAQGLRAGMVLTEIAPGELAGGVLSQPAD
FT                   "
FT   gene            complement(544120..544602)
FT                   /locus_tag="Dd703_0489"
FT   CDS_pept        complement(544120..544602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0489"
FT                   /product="P-18 protein"
FT                   /note="KEGG: sew:SeSA_A4796 P-18 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84300"
FT                   /db_xref="InterPro:IPR019637"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8S9"
FT                   /inference="similar to AA sequence:KEGG:SeSA_A4796"
FT                   /protein_id="ACS84300.1"
FT                   /translation="MKSIKHAMNTVGLTLLLAAGSVQAAGWQDTLSSAASQLNQNNAAS
FT                   PSQGNLVSLLNGGTQSLSAGTMNNAAGILQFCIKQKLIAATNTDNIKNQLLNKLGLSTQ
FT                   QEQQKQTDYLQGLSGMLNTGDGKQLNLNNIGSTPLAEKVKTKACDLVLKQGVKFIS"
FT   sig_peptide     complement(544528..544602)
FT                   /locus_tag="Dd703_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.983 at
FT                   residue 25"
FT   gene            complement(545209..548721)
FT                   /locus_tag="Dd703_0490"
FT   CDS_pept        complement(545209..548721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0490"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="TIGRFAM: pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase; PFAM: pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain protein; pyruvate
FT                   ferredoxin/flavodoxin oxidoreductase; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: eca:ECA2957
FT                   pyruvate-flavodoxin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84301"
FT                   /db_xref="GOA:C6C8T0"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8T0"
FT                   /inference="protein motif:TFAM:TIGR02176"
FT                   /protein_id="ACS84301.1"
FT                   /translation="MARKMKTMDGNAAAAYISYAFTDVAAIYPITPSTPMAENVDEWAA
FT                   QGKKNLFGQPVRLIEMQSEAGAAGAVHGSLQAGALTTTYTASQGLLLMIPNLYKIAGEL
FT                   LPGVFHVSARALATNSLNIFGDHQDVMAVRQAGCAMLAESSVQQVMDLAAVAHLAAIKS
FT                   RVPFINFFDGFRTSHEIQKIELLEYDELEPLLDRHALDRFRRNALNPDHPVIRGTAQNP
FT                   DIYFQERESVNPFYDALPHIVEDYMARISQLTGREYHLFNYHGAPDADRMIVAMGSVCE
FT                   TITETVDYLNQHGEKVGLLTVHLYRPFSLAHFFSAIPDSVQRIAVLDRTKEPGAQAEPL
FT                   YQDVKTAYYNHDTRPLIVGGRYALGGKDILPAHVASVFDNLLQPVPKDGFTVGIVDDVT
FT                   HTSLPQPSVHIDTAPAGTTACKFWGLGSDGTVGANKSAVKIIGDQTPMYAQAYFSYDSK
FT                   KSGGITVSHLRFGQRPITSPYLIHSADFISCSQQSYVDKYDLLAGLKTGGTFLLNCTWS
FT                   AAELEAKLPVAMKRYLARQQIRFFTLNAVQIAQQLGLGGRFNMIMQAAFFKLTGIIAEA
FT                   TAADYLKSAVVKSYGSKGQNVVDMNCAAIDQGMQALVNVAIPAHWATLPDDTADAARPV
FT                   PAFIRQILEPMNRQEGDLLPVSAFAGMEDGTFPPGTAAFEKRGIAIQVPAWQPEGCTQC
FT                   NQCAFICPHAAIRPALLSEDERQQAPVALQSKAANGAKGYHYHLAVSPLDCSGCGNCVD
FT                   ICPSRGKSLTMQPLESQQAQIPLWEHALALAPKANPFSKTTVKGSQFETPLLEFSGACA
FT                   GCGETPYARLLTQLFGDRMLIANATGCSSIWGASAPSIPYTTNHKGQGPAWANSLFEDN
FT                   AEFGLGMLLGSRAVREQLAGDVAAALAQPLSPALSEAFSLWLELKDRGENTRERADRLT
FT                   ALLEREKGEDPQLNRIYQNRDYFAKPSQWIFGGDGWAYDIGYGGLDHVLASGEDINVLV
FT                   FDTEVYSNTGGQSSKSTPVAAIAKFAAEGKRTRKKDLGMMAMSYGHVYVAQIAMGADKA
FT                   QTLKAIAEAEAWPGPSLIIAYAACINHGLKAGMGCSQREAKKAVDAGYWHLYRFDPNRQ
FT                   TQGKNPFILDSEEPEEDFQAFLMGEVRYASLKRQRPDIATELFAQTEQDAKARFERYQR
FT                   LADG"
FT   gene            549280..550161
FT                   /locus_tag="Dd703_0491"
FT   CDS_pept        549280..550161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0491"
FT                   /product="nitrogenase iron protein"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: kpe:KPK_1714 nitrogenase iron protein;
FT                   TIGRFAM: nitrogenase iron protein; PFAM: NifH/frxC-family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84302"
FT                   /db_xref="GOA:C6C8T1"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8T1"
FT                   /inference="protein motif:TFAM:TIGR01287"
FT                   /protein_id="ACS84302.1"
FT                   /translation="MAMRQCAIYGKGGIGKSTTTQNLVAALAEMGKKVMIVGCDPKADS
FT                   TRLILHAKAQNTIMEMAAEVGSVEDLELEDVLQIGYGNVRCAESGGPEPGVGCAGRGVI
FT                   TAINFLEEEGAYEEDLDFVFYDVLGDVVCGGFAMPIRENKAQEIYIVCSGEMMAMYAAN
FT                   NISKGIVKYAKSGKVRLGGLICNSRQTDREDELIIALAEKLGTQMIHFVPRDNIVQRAE
FT                   IRRMTVIEYDPKCKQANEYRTLAGKIVNNTKMVVPTPVTMDELEALLMEFGIMEEEDTS
FT                   IIGKTAAEENAA"
FT   gene            550226..551674
FT                   /locus_tag="Dd703_0492"
FT   CDS_pept        550226..551674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0492"
FT                   /product="nitrogenase molybdenum-iron protein alpha chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: eca:ECA2955 nitrogenase molybdenum-iron
FT                   protein alpha chain; TIGRFAM: nitrogenase molybdenum-iron
FT                   protein alpha chain; nitrogenase component I, alpha chain;
FT                   PFAM: oxidoreductase/nitrogenase component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84303"
FT                   /db_xref="GOA:C6C8T2"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005972"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8T2"
FT                   /inference="protein motif:TFAM:TIGR01282"
FT                   /protein_id="ACS84303.1"
FT                   /translation="MTNATRERNQALIQEVLEVFPEKTRKERKKHVMVTEESMESVGKC
FT                   IVSNRKSQPGVMTVRGCAYAGSKGVVFGPIKDMAHISHGPIGCGQYSRAGRRNYYTGLS
FT                   GINSFGTLNFTSDFQEKDIVFGGDKKLTKLIEELEQLFPLTKGISIQSECPVGLIGDDI
FT                   EAVANSSRKAIGKPVVPVRCEGFRGVSQSLGHHIANDVIRDWVLDNRDGKPFESTPYDV
FT                   AIIGDYNIGGDAWASRILLEEMGLRVVAQWSGDGTLVEMENTPNVKLNLVHCYRSMNYI
FT                   SRHMEEKHGIPWMEYNFFGPTKIAESLRKIAAQFDETIQKNAEAVIARYQAQTDAVIAK
FT                   YRPRLEGRKVLLYLGGLRPRHIIGAYEDLGMEIIGTGYEFGHNDDYDRTLPELKDGTLL
FT                   FDDVSSYELEAFVKALKPDLIGSGIKEKYIFQKMGVPFRQMHSWDYSGPYHGYDGFAIF
FT                   ARDMDMTLNNPSWSELTAPWLKSA"
FT   gene            551745..553313
FT                   /locus_tag="Dd703_0493"
FT   CDS_pept        551745..553313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0493"
FT                   /product="nitrogenase molybdenum-iron protein beta chain"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: eca:ECA2954 nitrogenase molybdenum-iron
FT                   protein beta chain; TIGRFAM: nitrogenase molybdenum-iron
FT                   protein beta chain; PFAM: oxidoreductase/nitrogenase
FT                   component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84304"
FT                   /db_xref="GOA:C6C8T3"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005976"
FT                   /db_xref="InterPro:IPR024564"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8T3"
FT                   /inference="protein motif:TFAM:TIGR01286"
FT                   /protein_id="ACS84304.1"
FT                   /translation="MSQTAEKTEPCFPLFEQDEYQTLFRNKRGMEEAHDEQRVREVFEW
FT                   TTTEEYKELNFKREALTIDPAKACQPLGAVLCALGFANTLPYVHGSQGCVAYFRTYFNR
FT                   HFKEPVACVSDSMTEDAAVFGGNNNMNSGLQNASALYKPEVIAVSTTCMAEVIGDDLQA
FT                   FIANAKKDGFVDAEMPIPYAHTPSFIGSHTTGWDNMFEGFARTFTGGGDNHYQPGSLQR
FT                   LNLVTGFETYLGNYRVIKRMMAQMEVPVSLLSDPSEVLDTPADGHYRMYAGGTSQQAMR
FT                   EAPNAIDTLLLQPWHLIKTKKVVQDAWQQPATDVPVPMGLAATDQLLMTVSELTGKPIP
FT                   DVLTLERGRLVDMMLDSHTWLHGKRFGLYGDPDFVMGLTQFLLELGCEPTVILCHNGNK
FT                   RWQKAMKKMLDASPYGQDSEVYINCDLWHFRSLMFTNKPDFMIGNSYGKFIQRDTLAKG
FT                   EQFEVPLIRLGFPLFDRHHLHRQTTWGYEGAMAILTTLVNAVLEKLDHDTMKLGKTDYN
FT                   FDLIR"
FT   gene            553531..553749
FT                   /locus_tag="Dd703_0494"
FT   CDS_pept        553531..553749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0494"
FT                   /product="nitrogen fixation protein FixT"
FT                   /note="TIGRFAM: nitrogen fixation protein FixT; PFAM:
FT                   NifT/FixU family protein; KEGG: eca:ECA2953 nitrogen
FT                   fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84305"
FT                   /db_xref="GOA:C6C8T4"
FT                   /db_xref="InterPro:IPR009727"
FT                   /db_xref="InterPro:IPR024044"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8T4"
FT                   /inference="protein motif:TFAM:TIGR02934"
FT                   /protein_id="ACS84305.1"
FT                   /translation="MPVVIFRERNAQLYCYIAKLDLEAKVTDVEFDQPERWGGRVALEG
FT                   GKCYYINPQEAKPVFPVSLRATRSELG"
FT   gene            553763..554425
FT                   /locus_tag="Dd703_0495"
FT   CDS_pept        553763..554425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0495"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: eca:ECA2952 nitrogen fixation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84306"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR034169"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8T5"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ACS84306.1"
FT                   /translation="MSDDDVLFWRLFALIQCLPELSPPQLLNWLSQDNGETLDLARLAS
FT                   FTQPVLAARFPVAPENMTRSRWQQVLAYLRGNLPEHLTVATPPGRQPQLLAAFSSQDGI
FT                   TINGHFGQCRLFFIYGFDEVGSWLCDLRRYPAEPGDQEGNEVRAALLNGCHLLFCEAIG
FT                   GPAAARIIRHNIHPMKVAPGTTIQSQRDALQAMLADRLPPWLAKRLEKGNPLEDRVF"
FT   gene            complement(554464..556056)
FT                   /locus_tag="Dd703_0496"
FT   CDS_pept        complement(554464..556056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0496"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; KEGG: spe:Spro_0463 methyl-accepting
FT                   chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84307"
FT                   /db_xref="GOA:C6C8T6"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8T6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS84307.1"
FT                   /translation="MLEKIKIKNGLYSVISVFVVLLLSICAFSLYSSAQSNISIIKVND
FT                   IEGRQVIPLYSAYSEMLNARLAGINVALAITEKKDNATVQAGLERLNGYIASANATMAE
FT                   LRHIKAVTPEGQALRDEIDATFNDYMNNAVAPMQATLRERNVDQFYNRLVPDALEKGAT
FT                   FRLKLNQFVNVAKNVGSEEINHAEAFYRYTVKILITALMIVVLLSLFTLKFIRTVVISP
FT                   MQQVRTYFGMMEHGVLTLDIPPQHNTEMGRLMASLKDMQQAFRNIVLNVRDSSSSVAAG
FT                   AEQISAANKDFAARTEAQAASVEQTAASMEQITVSVQENTANTGRAMTLTASVAELAEK
FT                   NASNFGQLTDRIRHIADSSNKINDIISIMDSIAFQTNILALNAAVEAARAGEAGKGFAV
FT                   VASEVRNLAQRSAGSAREIKELIEKTASEIAQGEKVASLSIQDMAQLTDQIKKVNEFMV
FT                   DISMATSEQAKGIEQVHTAITLLEQASQQNAALVEESASASASLHEQAKNLDDTMTFFN
FT                   LNDNNSLAIAAPR"
FT   sig_peptide     complement(555952..556056)
FT                   /locus_tag="Dd703_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 35"
FT   gene            556433..557806
FT                   /locus_tag="Dd703_0497"
FT   CDS_pept        556433..557806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0497"
FT                   /product="nitrogenase MoFe cofactor biosynthesis protein
FT                   NifE"
FT                   /note="TIGRFAM: nitrogenase MoFe cofactor biosynthesis
FT                   protein NifE; PFAM: oxidoreductase/nitrogenase component 1;
FT                   KEGG: eca:ECA2949 nitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84308"
FT                   /db_xref="GOA:C6C8T7"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005973"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8T7"
FT                   /inference="protein motif:TFAM:TIGR01283"
FT                   /protein_id="ACS84308.1"
FT                   /translation="MKGNEILALLDEPACEHNHKQKSGCSAPKPGATAGGCAFDGAQIT
FT                   LLPLADVAHLVHGPIGCTGSSWDNRGSQSSGPTINRLGFTTDLNEQDVIMGRGERRLFH
FT                   AVRHIVSRYHPAAVFIYNTCVPAMEGDDIDAVCRAASVAAGVPVIAVDAAGFYGSKNLG
FT                   NRLAGEVMVKQVIGSREPAPWPDDTPFAPTHRHDIGLIGEFNIAGEFWHVQPLLDELGI
FT                   RVLGSLSGDGRFAEIQTMHRAQANMLVCSRALINVARALEQRYGTPWFEGSFYGVRAMS
FT                   EALRQLAALLDDDDLMQRTEQVIAREEAAAERALAPYRERLRGRKALLYTGGVKSWSVV
FT                   SALQDLGMTVVATGTRKSTEEDKQRIRELMGDDAIMLDEGNARTLLDVAYRYGADMMIA
FT                   GGRNMYTAYKARLPFLDINQEREHAFAGYRGIVTLAQQICLTLESPIWAQTHQRAPWQ"
FT   gene            557823..559208
FT                   /locus_tag="Dd703_0498"
FT   CDS_pept        557823..559208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0498"
FT                   /product="nitrogenase molybdenum-iron cofactor biosynthesis
FT                   protein NifN"
FT                   /EC_number="1.18.6.1"
FT                   /note="KEGG: eca:ECA2948 nitrogenase iron-molybdenum
FT                   cofactor biosynthesis protein; TIGRFAM: nitrogenase
FT                   molybdenum-iron cofactor biosynthesis protein NifN; PFAM:
FT                   oxidoreductase/nitrogenase component 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84309"
FT                   /db_xref="GOA:C6C8T8"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005975"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8T8"
FT                   /inference="protein motif:TFAM:TIGR01285"
FT                   /protein_id="ACS84309.1"
FT                   /translation="MAQVIRSKKPLATSPIKSGQPLGAILASQGIEQSIPLVHGAQGCS
FT                   AFAKVFFIQHFHDPIPLQSTAMDPTTTVMGSDDNIFTALATLCQRNAPKAIVLMSTGLS
FT                   EAQGSDLSRAVKQFREDYPRFRTVAILTVNTPDFYGSLENGFSAVVESVIQQWVPEKPP
FT                   AGMRNRRVNLLLSHLLNPGDVELIRSYVEAFGLQPVILPDLSQSLDGHLASGDFHPVTQ
FT                   GGSALRSIEQMGQSLSTICIGASFSRAASLMAMRSRGLALNLPHLMTLEMVDRLIHHLQ
FT                   QLAGRDVPAWIERQRGQLQDAMIDCHMWVQGARLALAAEGDLLVAWCDFALSQGLLPGP
FT                   VVAPVSQPGLLTLPVDEVLIGDLEDMQDRLCVTPADLLVSNSHAADLAEQFGIPLIRAG
FT                   FPIFDRLGEFRRPRQGYAGIRDTLFELANLMQERHHHMAAYHSPLRQRFAPQSAPEVND
FT                   AAC"
FT   gene            559195..559662
FT                   /locus_tag="Dd703_0499"
FT   CDS_pept        559195..559662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0499"
FT                   /product="Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein"
FT                   /note="PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; KEGG: eca:ECA2947 nitrogen fixation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84310"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR034169"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8T9"
FT                   /inference="protein motif:PFAM:PF02579"
FT                   /protein_id="ACS84310.1"
FT                   /translation="MPHVNRHLSTISSAVWSMKVAFASSDYHHVDQHFGATPRLVIYGV
FT                   KQHEVTLLHVVDFNVQYGHQEDKLACRIDALEDCVTLYCVAIGDTVFRQLLQVGVRAVR
FT                   VPVDTPIALLLQQIQQFWADTEQRVVRRQRDPDRFARLIAEREWSEGDDRL"
FT   sig_peptide     559195..559266
FT                   /locus_tag="Dd703_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.795) with cleavage site probability 0.795 at
FT                   residue 24"
FT   gene            560039..560716
FT                   /locus_tag="Dd703_0500"
FT   CDS_pept        560039..560716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84311"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8U0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS84311.1"
FT                   /translation="MKDEILHSIEWNMTKINGFLEKIVTAPPPVELKRLKFYHGVYLES
FT                   LFSLIDYMDEMDESISREIKYIMRNLGDDSLYYFRELHYAITHRGFDISTHSNIVENNV
FT                   RLMTPECVLNRDGLPCPSPKENILLKSLLIFDMATRVAVLLKLSQLGCRYEKDREEDEY
FT                   FESFLANINNAAIPGFVKGFIFDHRREVKEKIDSRELESSLIIRVKELLFPESMLNILK
FT                   ILY"
FT   gene            561038..561580
FT                   /locus_tag="Dd703_0501"
FT   CDS_pept        561038..561580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84312"
FT                   /db_xref="GOA:C6C8U1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8U1"
FT                   /inference="similar to AA sequence:KEGG:Rfer_1069"
FT                   /protein_id="ACS84312.1"
FT                   /translation="MEVNIKDITGNWDRGVVLDKHSRYSVLTGQNQWGHNIYDTTRTDV
FT                   GEAVYQLKYRSDWNQVQPLAQCLYDEAYPLFQKVGFILPMAASNVRVRQPVTEVARALA
FT                   QLAGVPCFDNLLLKAPGGVSLKNLHTKQEKVDAIGDSFSVSPVISNEGRWNVLVIDDLF
FT                   HTGASMEAACAVLRGYK"
FT   gene            561623..562186
FT                   /locus_tag="Dd703_0502"
FT   CDS_pept        561623..562186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84313"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8U2"
FT                   /inference="similar to AA sequence:KEGG:Rfer_1070"
FT                   /protein_id="ACS84313.1"
FT                   /translation="MTTIFVAGSITIKELDPLIVERLKKIVDQKFNVVVGDANGVDSSV
FT                   QQELLQMGCRTTTVFSSSPKPRNNLGSWPVNFVKTDHPRGTRAFFTAKDIQMADKADCG
FT                   LMVWDAKSTGTLSNVIELLARKKYSVVFINKKKEFVIIKSPDDIEILIKNMSAAAYSKA
FT                   EEKIKISEKLASLKNHQMNMFAVS"
FT   gene            563328..564161
FT                   /locus_tag="Dd703_0503"
FT   CDS_pept        563328..564161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0503"
FT                   /product="Fe-S cluster assembly protein NifU"
FT                   /note="TIGRFAM: Fe-S cluster assembly protein NifU; PFAM:
FT                   nitrogen-fixing NifU domain protein; BFD domain protein
FT                   [2Fe-2S]-binding domain protein; KEGG: eca:ECA2946 nitrogen
FT                   fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84314"
FT                   /db_xref="GOA:C6C8U3"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR010238"
FT                   /db_xref="InterPro:IPR016217"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8U3"
FT                   /inference="protein motif:TFAM:TIGR02000"
FT                   /protein_id="ACS84314.1"
FT                   /translation="MWNYSEKVKDHFFNPRNAKVVEEANAVGDVGSLSCGDALRLMLRV
FT                   DPTTETILDAGFQTFGCGSAIASSSALTELIIGRTLSEAGQVTNQQIADYLDGLPPEKM
FT                   HCSVMGQEALRAAIAHYRGESLEDDHEEGALICKCFAVDEGQIRRAVLTNGLTTLQDVI
FT                   HYTKAGGGCTACHEKIELALAAILSEQASQPDAVAATIAVRDPQWQLVAEAVAELRPHI
FT                   QADGGDMSLLNVSGHQVTVSLSGSCSGCMMTDMTLAWLQQKLVERTGRYMEVVAA"
FT   gene            564201..565409
FT                   /locus_tag="Dd703_0504"
FT   CDS_pept        564201..565409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0504"
FT                   /product="cysteine desulfurase NifS"
FT                   /EC_number="2.8.1.7"
FT                   /note="KEGG: eca:ECA2945 cysteine desulfurase; TIGRFAM:
FT                   cysteine desulfurase NifS; PFAM: aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84315"
FT                   /db_xref="GOA:C6C8U4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8U4"
FT                   /inference="protein motif:TFAM:TIGR03402"
FT                   /protein_id="ACS84315.1"
FT                   /translation="MKNVYLDNNATTRLDPMVLEAMLPFLTDFYGNPSSIHDFGTPCRG
FT                   ALERARQQVASLLGARYDSEIIFTSCATEATSTAIHSATELMPERREIITTAVEHPATL
FT                   AVCEHLERQGYLIHRLRVSPEGELDLAQYRQLLSDRVALVSVMWANNETGVQFPVREMA
FT                   ALAHEYGALFHCDAVQAVGKIPVVLSATEIDMLSCSAHKIHGPKGVGCLYLRRGTRFRP
FT                   LLRGGHQERGRRAGTENIAGIVGMGSACELAEVHLPMMTASVATLRDKLQAGLEQAIPS
FT                   VMVMGGNQPRTPNTLNMAFEFIEGEAILLLLNHAGIAASSGSACTSGSLEPSHVMRAMN
FT                   IPYTAAHGSIRFSLSRYTREKEIDYVIAQLPPIIARLRTLSPYWQQGKPLAASGADFTP
FT                   TYG"
FT   gene            565422..566567
FT                   /locus_tag="Dd703_0505"
FT   CDS_pept        565422..566567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0505"
FT                   /product="homocitrate synthase"
FT                   /note="TIGRFAM: homocitrate synthase; PFAM: pyruvate
FT                   carboxyltransferase; KEGG: eca:ECA2944 homocitrate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84316"
FT                   /db_xref="GOA:C6C8U5"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013477"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8U5"
FT                   /inference="protein motif:TFAM:TIGR02660"
FT                   /protein_id="ACS84316.1"
FT                   /translation="MVDVIINDTTLRDGEQSPGVAFRASEKLAIAEALAEAGVPALEIG
FT                   TPAMGGEERARIAVVRRRLPATVMMTWCRMNELEIRQSADLGMDWVDISIPASDRLRQQ
FT                   KLHQPLAALLPRLSALIALARERGMRVCIGCEDASRAQDDTLRQLAEAAGAAGAERLRF
FT                   ADTIGLLDPFATFERISTLRQYWSGEIEMHAHNDLGLATANTLAAVRAGATHVNTTVLG
FT                   LGERAGNAALETVALALQRCLGKECGIRFERLPDLCRQVAQAAQRAIDIQQPLVGDQVF
FT                   THESGVHVAALLQDRSSYQGIDPALMGRDFRLVLGKHSGRQAVGGIFAQLGYLLDAPQT
FT                   DMLLMAVRRFAEHWKRNPRDYELVAIYQDLYGSDTLRCQGG"
FT   gene            566571..566828
FT                   /locus_tag="Dd703_0506"
FT   CDS_pept        566571..566828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0506"
FT                   /product="nitrogenase stabilizing/protective protein"
FT                   /note="KEGG: eca:ECA2943 nitrogenase stabilizing/protective
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84317"
FT                   /db_xref="GOA:C6C8U6"
FT                   /db_xref="InterPro:IPR004893"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8U6"
FT                   /inference="similar to AA sequence:KEGG:ECA2943"
FT                   /protein_id="ACS84317.1"
FT                   /translation="MEWFYRLPGVSSLDSAEAFFTFFSVPYDPATLSARCLPVLSEFHR
FT                   RLRTAVPLRNSLECDTNADWQLARRLLAESYRSLTAEAAS"
FT   gene            566825..567265
FT                   /locus_tag="Dd703_0507"
FT   CDS_pept        566825..567265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0507"
FT                   /product="NifZ family protein"
FT                   /note="PFAM: NifZ family protein; KEGG: eca:ECA2942
FT                   nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84318"
FT                   /db_xref="GOA:C6C8U7"
FT                   /db_xref="InterPro:IPR007415"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8U7"
FT                   /inference="protein motif:PFAM:PF04319"
FT                   /protein_id="ACS84318.1"
FT                   /translation="MRPRFNFGAAVRVVRTIRNDGTMAGMRRGDLLVRRGSVGYVREWG
FT                   VFLQDQVIYQVHFLDTDRTVGCREQELIAADAPWSAGDFQYGDWIYSAHALSIAGEVVV
FT                   DAGQSGQIQATGQGPQGDCYTVMFGERWFQVPASALALAEDA"
FT   gene            567262..568101
FT                   /locus_tag="Dd703_0508"
FT   CDS_pept        567262..568101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0508"
FT                   /product="nitrogen fixation protein NifM"
FT                   /note="TIGRFAM: nitrogen fixation protein NifM; PFAM:
FT                   PpiC-type peptidyl-prolyl cis-trans isomerase; KEGG:
FT                   eca:ECA2941 nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84319"
FT                   /db_xref="GOA:C6C8U8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR014282"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8U8"
FT                   /inference="protein motif:TFAM:TIGR02933"
FT                   /protein_id="ACS84319.1"
FT                   /translation="MMAASAWRRFSRFRLAQARFHCVPDALPPQHQDDFQRQLARQCRL
FT                   EQAVVEAALCQSLTVTDDVLQLIEQQLAEPLAQAGFAPEERQAVIRHHALMELQLTWVA
FT                   AQAAAPTGQDVALWYRQHADRFLRPEQRLTHHLLLTAEDERTAALVRAQIRGFHRTLCR
FT                   EPAQFERLARRYSHCPSALEGGLLGWVSRGLLFSELEQSLFMLREGQVSEPVETEIGWH
FT                   LLWCEAIRPEAPLPESEALPKVSDYLLRQRQRQQQRQWLATLLADESPVGGETPAPE"
FT   gene            complement(568205..568621)
FT                   /locus_tag="Dd703_0509"
FT   CDS_pept        complement(568205..568621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0509"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   cps:CPS_3129 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84320"
FT                   /db_xref="GOA:C6C8U9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8U9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS84320.1"
FT                   /translation="MTTAIRTITIDDCLWLRHKILWPQHEPSYSRVEGDEQAQHYGAYR
FT                   DDTLVSCLSVFEVSDGVCQIRKFATDHDDQRQGYGSLLMAHVLESVRERGIRRVTLNAR
FT                   LSASPFYARFGFAAAGPVTLKADIEYVVMQVTLA"
FT   gene            complement(568737..569267)
FT                   /locus_tag="Dd703_0510"
FT   CDS_pept        complement(568737..569267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0510"
FT                   /product="flavodoxin"
FT                   /note="TIGRFAM: flavodoxin; PFAM: flavodoxin/nitric oxide
FT                   synthase; KEGG: eca:ECA2940 flavodoxin FldA"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84321"
FT                   /db_xref="GOA:C6C8V0"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010086"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8V0"
FT                   /inference="protein motif:TFAM:TIGR01752"
FT                   /protein_id="ACS84321.1"
FT                   /translation="MANIGIFFGTDTGKTRKIAKMIHQKLGDMADAPVNINRTTLEAFL
FT                   SYPVLLLGTPTLGDGQLPGFEAGCESESWQEFMDTLASADLGDKTVALFGLGDQRGYPD
FT                   NFASGLKPLYDVVTDCGARVIGAWPNSGYEFNTSAALVDDQFVGLVLDQDNQFDLTEER
FT                   VENWLAQIKPAIV"
FT   gene            569647..571134
FT                   /locus_tag="Dd703_0511"
FT   CDS_pept        569647..571134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0511"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: eca:ECA2939 nitrogen fixation regulatory
FT                   protein; TIGRFAM: nitrogen fixation negative regulator
FT                   NifL; PAS sensor protein; PFAM: PAS fold domain protein;
FT                   PAS fold-4 domain protein; PAS fold-3 domain protein;
FT                   SMART: PAC repeat-containing protein; PAS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84322"
FT                   /db_xref="GOA:C6C8V1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR014285"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8V1"
FT                   /inference="protein motif:TFAM:TIGR02938"
FT                   /protein_id="ACS84322.1"
FT                   /translation="MTMNLMTESFPLGEIASHLSRQHPSLFSTVVEQSSVAISLTDPQA
FT                   RIVYTNPAFCRLTGYNLPQLLGQNHRILASQQTPVEVYQEMWQMLLSGRAWRGQLINRR
FT                   RDGSLYLAEIDITPIVNSHGELEHYLAMHKDISASYALEQRLRNHMTLITAVLNNIPAA
FT                   VVVVDGKDKVIMDNLAYKTLCADCGGKELLAVLDYPNNKAQLQGGLPMPVMMRGAVRWL
FT                   TLGYWALPGVSEEASRYFTDAALPRTLIVITDCTELQQQQQQGRLDRLKQQMTNGKLLA
FT                   AIRESLDAALIQLNCPLNMLAAARRLNGEDRSNVALESAWREGEEAVARLQACRPSLEF
FT                   EAAGYWPMQALLDDLSALYHTRLTTNDRLCCEMAEPELMGFGQRTQVLACLSLWLDRTL
FT                   SLAAEIQPFHLDIQLYVREENDWLMLYLEDNVPLAQVRYVAPPSALHTPGKGMELRLIQ
FT                   TLVAHHQGAIDLTSRPGGGTCLTLRFPLFLSLTGGSK"
FT   gene            571131..572705
FT                   /locus_tag="Dd703_0512"
FT   CDS_pept        571131..572705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0512"
FT                   /product="transcriptional regulator, NifA, Fis Family"
FT                   /note="KEGG: eca:ECA2938 nif-specific regulatory protein;
FT                   TIGRFAM: Nif-specific regulatory protein; PFAM: sigma-54
FT                   factor interaction domain-containing protein;
FT                   helix-turn-helix Fis-type; GAF domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   GAF domain protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84323"
FT                   /db_xref="GOA:C6C8V2"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010113"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8V2"
FT                   /inference="protein motif:TFAM:TIGR01817"
FT                   /protein_id="ACS84323.1"
FT                   /translation="MTHLPEAGKVVWRFDLSQQFTAVQRISAALGRSTEVRQALQAVLR
FT                   VLHDDAFMQHGMICLYDKQRGALTVEALHTEDEQATASGSQIRYRPGEGLVGTVMAQCQ
FT                   PLVLPRVADDQRFLDRLGLYDYNLPFIAVPLMGLDPHPIGVLAAQPMARYEERLPSCTR
FT                   FLETVANLVAQTVRLMQPIRREADTPVPAARPVACKMPRPFGFENMVGKSPAMRQTMEI
FT                   IRQVSRWDTTVLVRGESGTGKELVANAIHYNSPRTDAPFVKFNCAALPDNLLESELFGH
FT                   EKGAFTGAVRQRKGRFELADGGTLFLDEIGESSASFQAKLLRILQEGEMERVGGDETIR
FT                   VDVRIVAATNRNLEEEVRAGHFREDLYYRLNVMPVSLPPLRERQEDIAELAHFLVRKIA
FT                   LHQGRQLRISDGAIRMLMSYNWPGNVRELENCLERSAVMSESGLIDRDVILFNHHETTP
FT                   KISKSVVPTPSQEEGWLDQNLDERQRLIAALEKTGWVQAKAARLLGMTPRQVAYRIQIM
FT                   DINVHRL"
FT   gene            572964..574370
FT                   /locus_tag="Dd703_0513"
FT   CDS_pept        572964..574370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0513"
FT                   /product="nitrogenase cofactor biosynthesis protein NifB"
FT                   /note="TIGRFAM: nitrogenase cofactor biosynthesis protein
FT                   NifB; PFAM: Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis protein; Radical SAM domain protein; KEGG:
FT                   eca:ECA2937 femo cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84324"
FT                   /db_xref="GOA:C6C8V3"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034165"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8V3"
FT                   /inference="protein motif:TFAM:TIGR01290"
FT                   /protein_id="ACS84324.1"
FT                   /translation="MTSCSSAGGAARCRATHTEQFTSLQASKVAHHPCYSASGHHHYAR
FT                   MHLAVAPACNLQCNYCNRKYDCSNESRPGVVSELLMPEQAAAKARQVAAAIPQLSVVGI
FT                   AGPGDPLANMGRTFNTLELLRNQLPDLKLCLSTNGLMLPDAVDRLLDVGVDHVTVTLNT
FT                   LDPDEAARIYAWLWLDGERYTGREAGEMLLARQQEGIRRLTEKGVLVKINSVLIPGIND
FT                   RSLLQVSEKAREWGAFLHNIMPLIARPEHGTVFGLNGQPEPDADFLAEVRGRCAVAMPQ
FT                   MSHCQQCRADAIGMLGEDRSQQFPLSALPAQPQPYLPLLHQRARLHASIASRGESDEPQ
FT                   ACLVAVASSRGDVIDCHFGHVERFQIYSLSAAGVVLVNERFTPKYCHGSDDCAPADGDD
FT                   RMAEMLALLSDVKAVFCARIGYAPWQKLEQHGIQPCVEGAWQSVHDVLSRWWQQHRQQM
FT                   ASDDREKGVA"
FT   gene            574370..574882
FT                   /locus_tag="Dd703_0514"
FT   CDS_pept        574370..574882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0514"
FT                   /product="NifQ family protein"
FT                   /note="PFAM: NifQ family protein; KEGG: eca:ECA2936
FT                   nitrogen fixation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84325"
FT                   /db_xref="GOA:C6C8V4"
FT                   /db_xref="InterPro:IPR006975"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8V4"
FT                   /inference="protein motif:PFAM:PF04891"
FT                   /protein_id="ACS84325.1"
FT                   /translation="MGETERWLRRLLTLHEAGAACFPRQMGLATSDWRDLLWRLDWPPP
FT                   ADAVRDQRQMLMSELQAGRQEEREQLAGWLLQHMAASAAPMHLIIASASLGFNHLWQDL
FT                   GLDSRAELRDLMTDCFPALVAMNSQNMRWKKFFYRQRCLHTDGELVCRSPSCDDCCEWS
FT                   HCFAPEV"
FT   gene            complement(574936..575832)
FT                   /locus_tag="Dd703_0515"
FT   CDS_pept        complement(574936..575832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0515"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: spe:Spro_4199 putative DNA-binding
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84326"
FT                   /db_xref="GOA:C6C8V5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8V5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS84326.1"
FT                   /translation="MASNIKLHQLQSFVAVARHGSIRAASRTLNVSQPALTKSIKELEA
FT                   CLGARLFLRHSHGVVLTDCGEAYFRHASLILEELRVAQEDIQQRLGQASGRVNIGIGAS
FT                   IAHTVMPEIVTRFHRLYPQVKLRITEGQLVAMIHELRQGELDFTINTYTGSSFDNELLY
FT                   EKLMEKEYCVVARRDHPMRHARTLEDLIDCEWTMPTPRSSYYKYLYDIFATMPHAPQVS
FT                   VTCETLTSCISLVIKTDFLCALSRDVLNASVLGSHLVEIELEQQLPKASFYLIQRKGTM
FT                   LSPMGEQLARLFRQYCR"
FT   gene            576006..577331
FT                   /locus_tag="Dd703_0516"
FT   CDS_pept        576006..577331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0516"
FT                   /product="amidohydrolase"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; KEGG: spe:Spro_4200
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84327"
FT                   /db_xref="GOA:C6C8V6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR033845"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8V6"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACS84327.1"
FT                   /translation="MHSDAIYSALSQQIEPLIPELTAFRRDLHKFAESGWLEFRTSTLV
FT                   AERLHRLGYDLKLGREVIATDARMGLPSEAVLKAQEQRALEQGALPQWLPYFSGGFTGI
FT                   VATLATGRPGPVLGYRVDMDALDLNEQLDSEHRPFRDGFASCNAGMMHACGHDGHTTIG
FT                   LGLAAVLMAMREQLCGTIKILFQPAEEGTRGGKSMAEAGVVDDVDYFTAIHIGTGIPAG
FT                   QLVCGNDTFMATTKIDVTYRGVASHAGGRPEEGRNALLAAAQATLGLHAIPRHSGGSSR
FT                   INVGVLQAGTGRNVVPSNAMMKVETRGSTNEVNEFIYQQALQVINGAAAMHGVSVDIKL
FT                   MGAAQSSQPSPEWVAFIHRQAEQVPELNSIIDRKDGAAGSEDATYLMERVKAHGGLASY
FT                   AIFGTDLSAGHHNEKFDFNESVIPVAVKTLALLALNIQQYGA"
FT   gene            577334..578785
FT                   /locus_tag="Dd703_0517"
FT   CDS_pept        577334..578785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0517"
FT                   /product="amidohydrolase"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; KEGG: spe:Spro_4201
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84328"
FT                   /db_xref="GOA:C6C8V7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8V7"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACS84328.1"
FT                   /translation="MTQPIVDFVNDAVDGVQPLLAAIADDIWDHPETRFTEHYSVERLA
FT                   GCLAAEGFDVQRGIAGMETAFVASFGAGKPVIALLGEFDALAGLSQQAGCAVQAPTQPG
FT                   GHGHGCGHNLLGTAGLGGVLAVKAWLERHPQAGTIRFYGCPGEEGGSGKTFMAREGVFD
FT                   DVDAALTWHPETFSGMFCTPTLANIQAAFRFKGVAAHAAAAPHLGRSALDAVTLMNTGA
FT                   NFLREHIIPEARLHYAVTDTGGHSPNVVQADAEVLYLVRAPQVDQAQSIYERVVRIAQG
FT                   AALMTDTQLTVRFEKACSNYVPNLTLERAMYGYVQAFGVPAYSEQEQAFAQEIYRTLSA
FT                   EDIASNMASIERIGGAAGKAFSQSLAGKALIDAVAPYAPTSAILPGSTDVGDVSWRVPT
FT                   AQCFSPCYALGTPLHTWQAVSQGRTSLAHKGMALAARVMSATALALFTDDALLEACRQE
FT                   WRAQRQAVPYRCPIPDGVAPSPLKG"
FT   gene            578929..580452
FT                   /locus_tag="Dd703_0518"
FT   CDS_pept        578929..580452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0518"
FT                   /product="AbgT transporter family"
FT                   /note="TIGRFAM: AbgT transporter family; PFAM: AbgT
FT                   putative transporter; KEGG: spe:Spro_4202 putative
FT                   aminobenzoyl-glutamate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84329"
FT                   /db_xref="GOA:C6C8V8"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="InterPro:IPR011540"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8V8"
FT                   /inference="protein motif:TFAM:TIGR00819"
FT                   /protein_id="ACS84329.1"
FT                   /translation="MSVTAESSHSQPGKLFQWVECVGNKIPNPFLLFVYLIIALMLASA
FT                   LFSWLGIKAINPANGEVVKVKNLLSVEGMQWILPNVIKNFSAFTPLGAILALVLGAGLA
FT                   ERVGLLQALMYKMASRVSARYASYMVLFIAFFSHISSDAALVVMPPLGALIFLAVGRHP
FT                   VAGLLAAIAGVGSGFTANLLIVTTDVLLSGLSTEAAKAINPAIHVSVIDNWFFMATSVV
FT                   VLTIVGAQLTDRFIEPRLAPWSGESNEHLSKLTAEQNRGLRASGIAALVFIAVVAALVV
FT                   PEWGPLRDPVKHTVMPSPFIQGIVPLIILFFFVISIPYGMVTGQIKSQNDLPQLMVDPM
FT                   KGMAGFIVMVFPLSQFVAFFNWSNMGKFMAIGLTNLLESLGMTGVPAFVGLVFLSAFLC
FT                   MFIASGSAIWSILAPIFVPMFMLLGFHPAFAQIVFRVADSSVIPLAPVSPFVPLFLGFL
FT                   QRYYKDARLGTYYSLVLPYPIVFFVVWLLLLVAWYLVGLPIGPGIYPHL"
FT   gene            580606..581079
FT                   /locus_tag="Dd703_0519"
FT   CDS_pept        580606..581079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0519"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: eca:ECA3168 transcriptional regulator
FT                   of organic hydroperoxide resistance gene ohr"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84330"
FT                   /db_xref="GOA:C6C8V9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8V9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACS84330.1"
FT                   /translation="MNTKDTQTSPASLGDEAYRLDGQLCFALYSANLAMNKLYRRLLSS
FT                   LNLTYPQYLVMLVLWERDGLTVSELGERLFLDSATLTPLLKRLQSAGLVVRQRGTEDER
FT                   QVMIYLTDAGRALQQQARAVPEGVFCASECSVEQLRAIKQELEILRARLFMHT"
FT   gene            581221..581646
FT                   /locus_tag="Dd703_0520"
FT   CDS_pept        581221..581646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0520"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: eca:ECA3167 organic
FT                   hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84331"
FT                   /db_xref="GOA:C6C8W0"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8W0"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACS84331.1"
FT                   /translation="MSIEKVLYVAHAQANGGRDGRAVSSDSQLDVRLTTPRELGGAGGE
FT                   GTNPEQLFAAGYSACFLGALKFVAARDKVAIPADTAINGSVGIGVIPNGFGIEVELKIS
FT                   LPGLDRAVAEDLVQKAHIVCPYSNATRGNIDVTLTLI"
FT   gene            complement(581777..582595)
FT                   /locus_tag="Dd703_0521"
FT   CDS_pept        complement(581777..582595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0521"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA2153 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84332"
FT                   /db_xref="GOA:C6C8W1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8W1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS84332.1"
FT                   /translation="MSEAIDLYANPHTDDRSAPARGLIEIQGVSKWFGAHQALDNINLT
FT                   LAPGSVTVIIGPSGSGKSTLLRTINHLERVDVGTIRIDGDYIGYRRRGNTLYELKEPDI
FT                   LRQRLGVGYVFQNFNLFPHLTVLENLLEAPLAHRLYPRAQAEQRALELLDRVGLRHKAG
FT                   AYPRHLSGGQQQRIAIARALALNPNVLLFDEPTSALDPELVGEVLDVIKTLAQSGATLV
FT                   IVTHEIGFAREVADRVVFMVDGKVVESGDARQVLSHPRHPRTASFLNKVL"
FT   gene            complement(582613..583533)
FT                   /locus_tag="Dd703_0522"
FT   CDS_pept        complement(582613..583533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0522"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: eca:ECA2154
FT                   putative ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84333"
FT                   /db_xref="GOA:C6C8W2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8W2"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACS84333.1"
FT                   /translation="MTPYIHSTDSDAPPQLRVVPARHPLRLAGALFALLVFAGLAESIA
FT                   FNTRWEWPVFAGYFFNPVILEGLGRTLLLTLSGTLFSIIVGTGLALARLSSSWLLRTLA
FT                   WLYIWLFRSLPLILVLIILYNFSYLYDTLSLGIPFTGITILSASTIDVLGPFSVAVIGL
FT                   TLVQSAYTAEIIRGGILGVDAGQFEAAAALGLPGYRRTWRIILPQALRAILPTGFNEII
FT                   SLAKGTSVVYVLALPELFYTVQVIYNRTQQVIPLLMVATLWYLAITSVLSVLQYHVERY
FT                   VARGAVRETPSSLFARLLTPQARRR"
FT   gene            complement(583530..584090)
FT                   /locus_tag="Dd703_0523"
FT   CDS_pept        complement(583530..584090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0523"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   eca:ECA2155 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84334"
FT                   /db_xref="GOA:C6C8W3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8W3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS84334.1"
FT                   /translation="MSAERFIISRPDDPRIVPIIDDLFNEYRQRYGDYFGQREPDPVTL
FT                   YLQPDGIFVVLLHHHRPIATGAFKRYDATTAELKRIWTDKTQRRQGLARRVLRELEHHA
FT                   RRLGYCDLFLTTGFRQPEAVGLYLSEGYQPQFDPSIDPEYYSQPPHDGRLPFRKPLYPF
FT                   TPVPDAASVNVHAAAITDTGDAS"
FT   gene            complement(584104..585051)
FT                   /locus_tag="Dd703_0524"
FT   CDS_pept        complement(584104..585051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0524"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   eca:ECA2156 ABC transporter, substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84335"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8W4"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS84335.1"
FT                   /translation="MQNKTPRPLYRLGAILLGSWLLLGNALASGIDLKANQQPIHAPTN
FT                   PQATALIPPGFAFAVPGKLTVAVASLRASPPLVLLGDDNKTLYGSEPDIARLVADSLGL
FT                   ELNIVPTSWEDWPLGVASGKYDIAVTNITVTKARKERFDFATYRADTLGFYVKSASPIK
FT                   TIDSAKDIAGLKVIVGSGTNQEAILLEWDKQNRAQGLPPVAPIYSTDDAAATLSIQSGR
FT                   ADATFGPNVTGAYKASLAGNTRLVGIVNGGWPQAAHIAVTTRKGNGLVNAVNAALNGVI
FT                   EGGQYDQVLNRWGESVERIARSEINPPGLGDDQP"
FT   sig_peptide     complement(584965..585051)
FT                   /locus_tag="Dd703_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.950 at
FT                   residue 29"
FT   gene            complement(585106..586023)
FT                   /locus_tag="Dd703_0525"
FT   CDS_pept        complement(585106..586023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0525"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   eca:ECA2157 ABC transporter, substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84336"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8W5"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACS84336.1"
FT                   /translation="MKRPFIPTLLLLPALLSAGVQAENTVGRIDLNANQLPIHAPRNPQ
FT                   AVSQIPAGFRFATPGTLTVAVSTLSSPPLSVLADDNKTRIGSDPDIARLIADSLGLTLK
FT                   LVPTAWEDWPLGIATGRYDIAIINIAVTKARKERFDFATYRIDTLGFYVKNSSHIKAIR
FT                   GPEDIAGLKVIVGSGTNQENILLEWDRQNRARGLPPVAPIYVTDDAAATLSLLSGRVDA
FT                   FFGPHSIGAYKAALTGQTRMVGRGPTTAWVAVTTQKGNGLIEPISTALNGVIQSGQYAQ
FT                   VLDRWGENDEKVTRSVVNPPGLGE"
FT   sig_peptide     complement(585955..586023)
FT                   /locus_tag="Dd703_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            complement(586020..587375)
FT                   /locus_tag="Dd703_0526"
FT   CDS_pept        complement(586020..587375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA2158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84337"
FT                   /db_xref="GOA:C6C8W6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8W6"
FT                   /inference="similar to AA sequence:KEGG:ECA2158"
FT                   /protein_id="ACS84337.1"
FT                   /translation="MSEKNTSTRRQLRLGVILQGAAGNMSAWRHQSVVSDASINFEFVK
FT                   NIVNKAESGKFDFAFVADGLYINDKSIPHFLNRFEPLTLLSALASITRHIGLVGTLSTS
FT                   YSEPFTTARQFASLDHLSNGRAGWNVVTSPLEGSAKNFSRQQHPAHSLRYRIADEFLRV
FT                   VKGLWDSWEDDAFVRDKASGRFFEPEKLHTLNHQGEFFSVQGPLNIGRTPQGRPIVFQA
FT                   GASEDGKKLAASHADAIFTHQHTLPEAQEFYRDVKRQLEANGRRADQLHIFQGVSVIVG
FT                   DNAADVERQYQETARLVTISDALNYLGRYFEHYDFSQHPLDEPFPDIGDLGKNSFRSTT
FT                   DEIKRNAQERGLTLRQAALEAATPRPLFSGTPEQVADGLQTWFEQQAADGFIIQGGTPD
FT                   TFARFVDRVVPLLQQRGLFRHEYPGVTLRESFALDYPANQFASPRELQEAVQ"
FT   gene            587958..588986
FT                   /locus_tag="Dd703_0527"
FT   CDS_pept        587958..588986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0527"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   eca:ECA2161 putative luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84338"
FT                   /db_xref="GOA:C6C8W7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8W7"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACS84338.1"
FT                   /translation="MNYRLSLLDQSPIAAGATAAAALAQTTSLARLAEAAGYHRFWVSE
FT                   HHNSATLAGSAPEILAAWLLAHTRTIRIGSGGVMLQHYSPYKVAENFHLLSALAPDRVD
FT                   LGVGKAPGGLPLSTRALQQEVDASRQLSFEDKLRQLNDFLVADAALPAVADDAVLQATP
FT                   LPTVEPQRFLLGASPESARLAASLGWHFAFAGFIQSSETLLADALRAWHRERPAQAQTL
FT                   LSLSVIVARTHEEARSLAQEQHNYRVYIDDRNPVNVLTQEMADAFVRQSGGGRHRIEKQ
FT                   ARQVIYGTSDEVHRQLQAYHQRYGIDEFIIHTPVVDPKARLTSISELGCGIRSVTLSGA
FT                   LS"
FT   sig_peptide     587958..588032
FT                   /locus_tag="Dd703_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.566 at
FT                   residue 25"
FT   gene            589181..589256
FT                   /locus_tag="Dd703_R0013"
FT                   /note="tRNA-Gly2"
FT   tRNA            589181..589256
FT                   /locus_tag="Dd703_R0013"
FT                   /product="tRNA-Gly"
FT   gene            589386..590312
FT                   /locus_tag="Dd703_0528"
FT   CDS_pept        589386..590312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0528"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: eca:ECA3947 putative D-isomer specific
FT                   2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84339"
FT                   /db_xref="GOA:C6C8W8"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8W8"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACS84339.1"
FT                   /translation="MTPVLLLDARADEIRDPLHALMPDLPLVIGSGDPQEAAGCDIWIG
FT                   EPDKAAVLLAQGVKPRWLQSTWAGYKPLLAEAFPRDYRLSRAVGVFGQAIAEYVLAYLL
FT                   QHEHRLPARWQHQQAGVWEKSLPGSLYGRRVLIVGTGDIGREVAAFLQPFGVVLTGIAS
FT                   TPRSLSAFERVDALDRLKEAVRDADYVINILPDTPATTDVYHADVFSAMKPAALFINVG
FT                   RGSAVVDEDLCAALRAGQIAGAVLDVFRQEPLPPAHPFWHTPNLFITTHIAGPLVPARL
FT                   ARLFLENLPRFQANQPLVGEVDFSRSY"
FT   gene            590523..590598
FT                   /locus_tag="Dd703_R0014"
FT                   /note="tRNA-Gly3"
FT   tRNA            590523..590598
FT                   /locus_tag="Dd703_R0014"
FT                   /product="tRNA-Gly"
FT   gene            complement(590887..592026)
FT                   /locus_tag="Dd703_0529"
FT   CDS_pept        complement(590887..592026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0529"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="TIGRFAM: iron-sulfur cluster binding protein; PFAM:
FT                   domain of unknown function DUF1730; KEGG: eca:ECA3940
FT                   putative 4Fe-4S binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84340"
FT                   /db_xref="GOA:C6C8W9"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8W9"
FT                   /inference="protein motif:TFAM:TIGR00276"
FT                   /protein_id="ACS84340.1"
FT                   /translation="MTYPYDLNELAQLIKQWGQELGFQQVGICDTDLSHEEPRLQAWLD
FT                   KQYHGEMAWMARHGMMRARPHELLPGTLRVISVRMNYLPAKAAFASTLKNPLLGYVSRY
FT                   ALGRDYHKLLRQRLKKLGDRIQTHCGELQFRPFVDSAPIMERPLAAKAGLGWVGKHSLV
FT                   MNRNAGSWFFLGELLIDLPLPTDAPVEEGCGKCVACMTTCPTGAIVAPYTIDARRCVSY
FT                   LTIELEGAIPIELRPLMGNRIYGCDDCQLICPWNRFSSLTDEPDFSPRAALHTPELLEL
FT                   FQWNEVRFLQVTEGSAIRRIGHLRWLRNIAVALGNAPYEDHIVLALQARLGEHPLLDEH
FT                   IDWALSQQWEKRSQQTIDVQPAQKKRLIRAIEKGLPRDA"
FT   gene            592043..593554
FT                   /locus_tag="Dd703_0530"
FT   CDS_pept        592043..593554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0530"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: protein of unknown function UPF0031; YjeF-family
FT                   domain protein; KEGG: eca:ECA3939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84341"
FT                   /db_xref="GOA:C6C8X0"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8X0"
FT                   /inference="protein motif:TFAM:TIGR00196"
FT                   /protein_id="ACS84341.1"
FT                   /translation="MQFSSILPHSIFRADWLRREEANAARNAGVSLYTLMERAGHAAFN
FT                   LIRACYPQAGRWLVLAGHGNNGGDAYVVALLARLAGITVTVIACTSSKPLPEEAAQAQQ
FT                   QWRAAGGEVLTPDAAWPQEVDVIVDGLLGIGLAAAPRAPYDGLIDAANAYPAPVVALDI
FT                   PSGLNAETGHAEGAVIRAEHTMTFITLKPGLLTGRARDCTGRLHHDDLGLTAWVARQSA
FT                   PLQRLTAECLTTWLKPRRPGAHKGEHGRLLIVGGDEGTGGAIFMAGDAALRSGAGLVRV
FT                   LTHKNYLAAILVSRPELMVQELTPESVRQGLEWANVVVIGPGLGQREWGRTALRIAENC
FT                   NKSMLWDADALNLLAISPYKRQNRVLTPHPGEAARLLNCRIADIESDRLLAAAKLVKRY
FT                   GGVVVLKGAGTVIASEQGAMSIADVGNPGMATGGMGDVLSGIIGALLAQGLPLYDAACA
FT                   GCVVHGASADWLAHQQGTRGMLATDLMAILPKYVNPERIPLEKTE"
FT   gene            593551..594024
FT                   /locus_tag="Dd703_0531"
FT   CDS_pept        593551..594024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0531"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   spe:Spro_0427 putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84342"
FT                   /db_xref="GOA:C6C8X1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8X1"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ACS84342.1"
FT                   /translation="MSTLLLPLPDEAATTALGALLARACDRASIIYLFGDLGAGKTTLS
FT                   RGFLQALGHQGNVKSPTYTLVEPYALSPRPVYHFDLYRLADPEELEFMGIRDYLSQDAI
FT                   CLIEWPQQGAGVLPTADVELHLNYDGRARQAEIHAVSAYGARIVEQLAGQAMS"
FT   gene            594036..595727
FT                   /locus_tag="Dd703_0532"
FT   CDS_pept        594036..595727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0532"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: cell wall hydrolase/autolysin;
FT                   Peptidoglycan-binding LysM; SMART: cell wall
FT                   hydrolase/autolysin; Peptidoglycan-binding LysM; KEGG:
FT                   eca:ECA3937 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84343"
FT                   /db_xref="GOA:C6C8X2"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8X2"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ACS84343.1"
FT                   /translation="MKALLGGLLLLAWPLWAATLTDIRVNNASTEAVVTLSFSGPPVYE
FT                   FSSLSNPNRVVIDISQSGMVQGLPLEFNGQNIISRIRSSKAREPGNLRLVLDLTQKAQT
FT                   RAQKEKSGGGYNVVLNVMGERKPVAKPPVSTSSRSAVTTGRNPLTGKTADVSSSRVAVE
FT                   PVKASARGGRGERVTVAIDAGHGGQDPGATGPNGLYEKTVTIAIARKLKALMSSDPDFK
FT                   PVLTRDGDYFISVMGRSEVARKQGANLLVSIHADAAPNRGATGASVWVLSNRRANSEMA
FT                   NWLEQHEKQSELLGGAGDLLANSAADPYLSQAVLDLQFGHSQRVGYDVAVKVLRELQRV
FT                   GSLHKRRPEHASLGVLRSPDIPSLLVETGFISNPSEERLLGSSEYQEKIANAIYQGLRS
FT                   YFQSHPLQNVPKQENRPQKQENRPQASSVVNAPASAPVKSATPAVRNDAVTQRHTVARG
FT                   ETLSGIAAQYGVSMSTLRDLNSLKNDVVWVGQRLKIPGKASTPGVTKTPPAPKKSTVVI
FT                   KHKVMRGDTLSAIAVRYGVSMKEIQQVNNMTSGTVQLGQTLVIPST"
FT   sig_peptide     594036..594089
FT                   /locus_tag="Dd703_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.995 at
FT                   residue 18"
FT   gene            595768..597657
FT                   /locus_tag="Dd703_0533"
FT   CDS_pept        595768..597657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0533"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM: DNA
FT                   mismatch repair protein domain protein; ATP-binding region
FT                   ATPase domain protein; MutL dimerisation; KEGG: eca:ECA3936
FT                   DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84344"
FT                   /db_xref="GOA:C6C8X3"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8X3"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ACS84344.1"
FT                   /translation="MPIQVLPPQLANQIAAGEVVERPSSVVKELVENSLDAGATKIDIE
FT                   IERGGARLIRIRDNGSGIGKADLTLALARHATSKIATLDDLEAIVSLGFRGEALASISS
FT                   VSRLTLTSRTADQAEAWQAYAEGREMAVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRT
FT                   EKTEFMHIDEVVRRIALARFDVAFNLHHNGKLVRQYRAATDPSQQERRLGSICGAAFLQ
FT                   HALAVSWQHGDLNIHGWVADPAGSRQLPEMQYCYVNQRMMRDRLLNHAIRQAYQDQLHG
FT                   EQQPAYVLYLDVDPHQVDVNVHPAKHEVRFHQARLVHDFIYQAVMSVLQQASSPSLNSG
FT                   SSALSEGHWQQENRQAAGENHFARPAAASLNGRSPSGNAKEPQAFSWQQDGGYQKRQGE
FT                   LYQQLLRPAAPPREAGHASSVQLTGPSSSSAPETLPLPVSEPLEGHALGLGRVLAIHNG
FT                   RYALVEHRQGIALLSLTAAERYVHQAQLTPSEEGLRPQPLLIPQRLSLEKAERDELRRQ
FT                   QPLLTRFGIEVALEPTSATLKAVPLPLRQQNLQNLISDLLGYLTDYGHAEPDTIAAWIA
FT                   SRLQVERADWSIAQAVQLLAEVERLCPVLVKTPPSELLYVIDMSPAIRALQHD"
FT   gene            597650..598591
FT                   /locus_tag="Dd703_0534"
FT   CDS_pept        597650..598591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0534"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="KEGG: eca:ECA3935 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   tRNA isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84345"
FT                   /db_xref="GOA:C6C8X4"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8X4"
FT                   /inference="protein motif:TFAM:TIGR00174"
FT                   /protein_id="ACS84345.1"
FT                   /translation="MTEYKTAGNPPAIFIMGPTASGKTALAMALRQHLPVELISVDSAL
FT                   IYRGMDIGTAKPTVAELARAPHRLIDIIDPAESYSAADFRRDALQAMSEITAAGRIPLL
FT                   VGGTMLYFKALLEGLSPLPSANPDIRREIEERAKTEGWEALHRQLQEIDPVAATRIHPN
FT                   DPQRLSRALEVFFVSGNTLTELTKTSGDALPYHVHQFAIAPATRELLHERIALRFRQML
FT                   AAGFETEARVLFARADLHPALPSIRCVGYRQMWSYLSGEIGYDEMVYRGICATRQLAKR
FT                   QMTWLRGWEGVCWLDSDSPSDSLHRVVEVVSA"
FT   gene            598703..599002
FT                   /locus_tag="Dd703_0535"
FT   CDS_pept        598703..599002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0535"
FT                   /product="RNA chaperone Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein core; KEGG: yen:YE0377 RNA-binding
FT                   protein Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84346"
FT                   /db_xref="GOA:C6C8X5"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8X5"
FT                   /inference="protein motif:TFAM:TIGR02383"
FT                   /protein_id="ACS84346.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSNNPGTNNYHGNNQAAQQQPQQDSDDAE"
FT   gene            599094..600374
FT                   /locus_tag="Dd703_0536"
FT   CDS_pept        599094..600374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0536"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: GTP-binding proten HflX; PFAM: GTP-binding
FT                   protein HSR1-related; KEGG: eca:ECA3933 putative GTPase
FT                   HflX"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84347"
FT                   /db_xref="GOA:C6C8X6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8X6"
FT                   /inference="protein motif:TFAM:TIGR03156"
FT                   /protein_id="ACS84347.1"
FT                   /translation="MFDRYEAGERAILVHIYFSQEKDTEDLQEFESLVSSAGIEALQVI
FT                   TGSRKAPHPKYFVGEGKAEEIAQAVKATGAFVVLFDHALTPAQERNLERLCECRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRNRISQILSRLEKVEKQREQGRRARTRADVPTVSLVGYTNAGKSTLFNNMTAAGV
FT                   YAADQLFATLDPTLRRIEVEDVGDTVLADTVGFIRQLPHDLVAAFKATLQETREATLLL
FT                   HIVDAADSRASDNIQAVNDVLAEIEADKIPVLLIMNKIDMLDQFEPRIDRNEDNLPIRV
FT                   WLSAQTGEGIPLLFQALCERLAGEIAHYSLHLPPQAGRLRSRFYQLQAIEKEWIEEDGS
FT                   VGLVVRMPIIDWRRLCKQEQELQDYIV"
FT   gene            600447..601703
FT                   /locus_tag="Dd703_0537"
FT   CDS_pept        600447..601703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0537"
FT                   /product="HflK protein"
FT                   /note="KEGG: eca:ECA3932 FtsH protease regulator HflK;
FT                   TIGRFAM: HflK protein; PFAM: band 7 protein; SMART: band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84348"
FT                   /db_xref="GOA:C6C8X7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8X7"
FT                   /inference="protein motif:TFAM:TIGR01933"
FT                   /protein_id="ACS84348.1"
FT                   /translation="MAWNQPGNNGQNRDPWGSSNNNSGNSGGNNNKGGKDQGPPDLDDI
FT                   FRKLSKKLGEIGGNRPSGGSGQAGGNSGRVAGLVIAALVVIWGVTGFYTIKEAERGVVT
FT                   RFGKFSRIVEPGLNWKPTFIDSVRAVNVEAVRELATSGVMLTSDENVVRVEMNVQYRVT
FT                   QPDRYLFSVTNADDSLRQATDSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETIRPY
FT                   DMGITLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRI
FT                   LEESRAYKERTILEAQGEVSRFARLLPEYKAAPEITRQRLYIETMERVLSHTSKVLVSD
FT                   KGNNLMVLPLDQILRGQNIASGASTGSNVGTATPLRQPSGLSGGNVGTTYTPRTSNGSI
FT                   MDQRRANAQRDESTRSGRE"
FT   gene            601706..602701
FT                   /locus_tag="Dd703_0538"
FT   CDS_pept        601706..602701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0538"
FT                   /product="HflC protein"
FT                   /note="KEGG: eca:ECA3931 FtsH protease regulator HflC;
FT                   TIGRFAM: HflC protein; PFAM: band 7 protein; SMART: band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84349"
FT                   /db_xref="GOA:C6C8X8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8X8"
FT                   /inference="protein motif:TFAM:TIGR01932"
FT                   /protein_id="ACS84349.1"
FT                   /translation="MRKPILFILVPLLLVVYASLFVVQEGQRGIVMRFGKVLRDDNNKP
FT                   LIYAPGLHMKIPFLESVKTLDARIQTMENQADRFITREQKDLIVDSYIKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLDVKGIVTDSRGQLMSDVREALNTGTGETS
FT                   EADNAIASAAARVASETSGDMPRVNPNSMAALGIEVIDVRIKQINLPTEVSDAIFQRMR
FT                   AEREAVARRHRSQGQEQAEKIKATADYEVTRTLAEAERQGRILRGEGDAEVAKLFASAF
FT                   SQDPDFYSFIRSLRAYQNSFNSSNQDVLVLSPDSDFFRYMKAPEKTMPSR"
FT   sig_peptide     601706..601780
FT                   /locus_tag="Dd703_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.958) with cleavage site probability 0.366 at
FT                   residue 25"
FT   gene            602760..602960
FT                   /locus_tag="Dd703_0539"
FT   CDS_pept        602760..602960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0539"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA3930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84350"
FT                   /db_xref="GOA:C6C8X9"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8X9"
FT                   /inference="similar to AA sequence:KEGG:ECA3930"
FT                   /protein_id="ACS84350.1"
FT                   /translation="MSATIWLALGLVMIMEGLGPLLFPRIWRRMILAMAQLPDNILRRF
FT                   GGGIVVAGVVIYYMLRSRTGG"
FT   gene            603061..604359
FT                   /locus_tag="Dd703_0540"
FT   CDS_pept        603061..604359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0540"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: eca:ECA3929 adenylosuccinate synthetase;
FT                   TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84351"
FT                   /db_xref="GOA:C6C8Y0"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Y0"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ACS84351.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVISIIGNGVVLAPDAFMKEMTALEARGVPVRERLLISEAC
FT                   PLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKESFAAKLK
FT                   DILDYHNFQLVHYYKVEAVDYQKTLDDVLAVADILTSMVIDVSDLLYKAHERGDRVMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGGGPFPT
FT                   ELFDDVGEYLSQKGNEFGATTGRRRRTGWLDAVAVRRAVQINSLSGFCMTKLDVLDGLK
FT                   EVKICVAYRTADGKTIDVTPLAAEGWEGLEPVYESLPGWSESTFGVKDYNQLPQAARNY
FT                   IKRVEEVTGVPVDIISTGPDREETMILRDPFDA"
FT   gene            complement(604428..605810)
FT                   /locus_tag="Dd703_0541"
FT   CDS_pept        complement(604428..605810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0541"
FT                   /product="UDP-N-acetylmuramate"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase middle
FT                   domain protein; KEGG: eca:ECA3928
FT                   UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-me
FT                   so-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84352"
FT                   /db_xref="GOA:C6C8Y1"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Y1"
FT                   /inference="protein motif:TFAM:TIGR01081"
FT                   /protein_id="ACS84352.1"
FT                   /translation="MRIHILGICGTFMGGLALLARSLGHEVTGSDANVYPPMSTLLEEQ
FT                   GITLIQGYDPAQLDPAPDLVIVGNAMTRGNPCVEAVLERNIPYVSGPQWLHDHVLRDRW
FT                   VIAVAGTHGKTTTAGMVTWILEACGYQPGFVIGGVPGNFTVSARLGQSPFFVVEADEYD
FT                   CAFFDKRSKFVHYSPRTLILNNLEFDHADIFDDLKAIQKQFHHLVRLVPGSGRIIIPAN
FT                   DLHLKQVMTMGCWSEQELVGEEGIWKAKKVASDASVFQVYLDNELVGEVSWKLVGEHNM
FT                   HNGLMAIAAARHVGVMPGDACQTLGEFINAHRRLELRGTADGVSVYDDFAHHPTAILAT
FT                   LAALRSKVGGTARILAVLEPRSNTMKMGHCKNELAPALGRADGVFLFQPQHIPWQVAEV
FT                   ADACVQPAHWSADVDTLVDMIVKTAQPGDHILVMSNGGFGNIHSKLLDALHHRETLHTG
FT                   QD"
FT   sig_peptide     complement(605736..605810)
FT                   /locus_tag="Dd703_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.601 at
FT                   residue 25"
FT   gene            605981..606985
FT                   /locus_tag="Dd703_0542"
FT   CDS_pept        605981..606985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0542"
FT                   /product="Fructose-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: eca:ECA3927
FT                   fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84353"
FT                   /db_xref="GOA:C6C8Y2"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Y2"
FT                   /inference="protein motif:PRIAM:3.1.3.11"
FT                   /protein_id="ACS84353.1"
FT                   /translation="MKTLGEFIVEKQHDFSHATGELTALLSAIKLGAKIIHRDINKAGL
FT                   VDILGTSGVSNVQGEVQMKLDLYANEKLKAALKARGEVAGIASEEEDNIVIFEGESAEN
FT                   AKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRITPLGMPVTEADFLQPGHKQVAAGYIVY
FT                   GSSTMLVYTTGHGVHAFTYDPSLGVFCLSHEKVRFPEKGNMYSINEGNYIKFPLGVKKY
FT                   IKYCQEQDEATQRPYTTRYIGSLVADFHRNLLKGGIYLYPSTASYPEGKLRLLYECNPM
FT                   AFLAEQAGGKASDGKNRILDIIPQKLHQRAPFFVGTQSMVEDLEGFLRDYPDA"
FT   gene            complement(607078..607497)
FT                   /locus_tag="Dd703_0543"
FT   CDS_pept        complement(607078..607497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0543"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: eca:ECA3926
FT                   Holliday junction resolvase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84354"
FT                   /db_xref="GOA:C6C8Y3"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Y3"
FT                   /inference="protein motif:PFAM:PF03652"
FT                   /protein_id="ACS84354.1"
FT                   /translation="MSNRTVMAFDFGTRSIGVAIGQEITGTARPLLSLKAQDGTPDWQK
FT                   IEALLNEWQPDLVIVGLPLNMDGTEQPITARARKFAQRLHGRFGVAIQLHDERLSTVEA
FT                   RADLFERGGFRALDKGSVDAASAVIILESWFEQQS"
FT   gene            complement(607497..608090)
FT                   /locus_tag="Dd703_0544"
FT   CDS_pept        complement(607497..608090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0544"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   eca:ECA3925 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84355"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Y4"
FT                   /inference="protein motif:PFAM:PF02622"
FT                   /protein_id="ACS84355.1"
FT                   /translation="MTTEIRQTTTMNLQHHFLIAMPGLQDPVFKRTVIYICEHNEDGAM
FT                   GLVINKPMEQFTVETILKKLKIEPTPRDPAIRLDKPVFMGGPLADDRGFILHTPCEGFA
FT                   SSISISDETMITTSKDVLETLGTPDQPQNTLVTLGYSAWESGQLENELLENAWLTAPAD
FT                   SQILFCTPIAERWRAAAKKLGVDIHTIPSEAGHA"
FT   gene            complement(608151..609104)
FT                   /locus_tag="Dd703_0545"
FT   CDS_pept        complement(608151..609104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0545"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: eca:ECA3924 glutathione synthetase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase
FT                   ATP-binding; RimK domain protein ATP-grasp; glutathione
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84356"
FT                   /db_xref="GOA:C6C8Y5"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Y5"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ACS84356.1"
FT                   /translation="MIKLGIVMDPIAAINIKKDTSFAMLLEAQRRGWELYYMEMGDLYL
FT                   HAGEARATVRTLSVRYDYNDWYQFEDTQDIALHELDAILMRKDPPFDTEFVYATYILER
FT                   AEEKGTLIVNKPQSLRDCNEKLFTAWFPELTPDTLVTRNADRLRAFHQQHSDVILKPLD
FT                   GMGGASIFRLKPDDANVSVIIETLTEHGGRYCMAQNYLPAIKDGDKRVLVVDGEPVPYC
FT                   LARIPKSGETRGNLAAGGRGEARPLSESDWRIARAVAPVLKQKGLIFVGLDVIGDRLTE
FT                   INVTSPTCVREIEAAYPDVSITGMLMDAIERYLAPR"
FT   gene            complement(609116..609850)
FT                   /locus_tag="Dd703_0546"
FT   CDS_pept        complement(609116..609850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0546"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   eca:ECA3923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84357"
FT                   /db_xref="GOA:C6C8Y6"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Y6"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACS84357.1"
FT                   /translation="MRIPRIFHPELLALHGGETDLSEDAANHVGRVLRMTAGQALQLFD
FT                   GSNQVFDAEILQTGKKSVCVRYAAGRVEDCESPLHLHLGQVMSRGEKMEFTIQKSIELG
FT                   VSVITPLFSERCGVKLDGDRLDKKIAQWQNIAISACEQCGRNRIPEIRPAMTLESWCAE
FT                   SDNGLKLNLHPRATQSINTLSLPISRIRLLIGPEGGLSSGEIAMTAAQGFTDILLGPRV
FT                   LRTETTALTAITALQVRFGDLG"
FT   gene            complement(609963..610661)
FT                   /locus_tag="Dd703_0547"
FT   CDS_pept        complement(609963..610661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0547"
FT                   /product="Deoxyribonuclease I"
FT                   /EC_number="3.1.21.1"
FT                   /note="PFAM: Endonuclease I; KEGG: esa:ESA_00397
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84358"
FT                   /db_xref="GOA:C6C8Y7"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Y7"
FT                   /inference="protein motif:PRIAM:3.1.21.1"
FT                   /protein_id="ACS84358.1"
FT                   /translation="MLRKIAITLTLSVGLATLSVAAQGINNFTQAKAAAAQIHRDAPGT
FT                   FYCGCKITWQGKKGTPDLASCGYQVRKDANRASRIEWEHVVPAWQFGHQRQCWQDGGRK
FT                   NCTRDDVYRQIEVDLHNLQPAIGEVNGDRGNFMYAQWNGGERQYGQCEMKVDFQNQQAE
FT                   PPERARGAIARTYFYMRDRYGLNLSRQQTQLFEAWNKRYPVTPWECTRERRIAEVQGNH
FT                   NPYVQQACQP"
FT   sig_peptide     complement(610593..610661)
FT                   /locus_tag="Dd703_0547"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.665 at
FT                   residue 23"
FT   gene            complement(610762..611274)
FT                   /locus_tag="Dd703_0548"
FT   CDS_pept        complement(610762..611274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0548"
FT                   /product="protein of unknown function DUF335 SprT"
FT                   /note="PFAM: protein of unknown function DUF335 SprT;
FT                   SMART: protein of unknown function SprT; KEGG: eca:ECA3921
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84359"
FT                   /db_xref="GOA:C6C8Y8"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023483"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Y8"
FT                   /inference="protein motif:PFAM:PF03926"
FT                   /protein_id="ACS84359.1"
FT                   /translation="MNTSRLPIALHQAVMRCLRDKLRQANTALGSDYPEPSVSYRQRGA
FT                   TAGSAWLKNWEIRINPVLLQENQQTFIDEVVPHELAHLLVYARFGQTAPHGREWRWMME
FT                   NVLQVPARRTHRFETASVQGKTFPYRCACRLHDLTLRRHNRVVRGEAEYRCRHCGALLQ
FT                   PVITSSV"
FT   gene            complement(611547..612701)
FT                   /locus_tag="Dd703_0549"
FT   CDS_pept        complement(611547..612701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0549"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="KEGG: ypg:YpAngola_A3347 S-adenosylmethionine
FT                   synthetase; TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84360"
FT                   /db_xref="GOA:C6C8Y9"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Y9"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ACS84360.1"
FT                   /translation="MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETY
FT                   VKTGMVLVGGEITTSAWVDIEEITRRTVRDIGYIHSDMGFDANSCAVLSAIGKQSPDIN
FT                   QGVDRSNPLEQGAGDQGLMFGYATNETEVLMPAPITYAHRLVQRQSEVRKNGTLPWLRP
FT                   DAKSQITFAYDNNKIVGIDAVVLSTQHSEDIQQKDLHAAVMEEIIKPVLPAEWLSAHTK
FT                   YFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARY
FT                   VAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKIASDRLEALVRQFFDLRPYG
FT                   LIQMLDLLHPIYQQTAAYGHFGREHFPWEKTDKAELLRDAAGLK"
FT   gene            613400..615373
FT                   /locus_tag="Dd703_0550"
FT   CDS_pept        613400..615373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0550"
FT                   /product="arginine decarboxylase"
FT                   /note="TIGRFAM: arginine decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; KEGG: eca:ECA3918 arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84361"
FT                   /db_xref="GOA:C6C8Z0"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Z0"
FT                   /inference="protein motif:TFAM:TIGR01273"
FT                   /protein_id="ACS84361.1"
FT                   /translation="MSDDMIHCSSMAGKYDTSRSMQEVAMNDRDASEMLRTYNIAWWGN
FT                   NYYDVNELGHISVCPDPDVPEARVDLAELVKERQQDNQRLPALFCFPQILQHRLRSINA
FT                   AFRRARESFGYEGGYFLVYPIKVNQHRRVIEALVNSGEPLGLEAGSKAELMAVLAHAGM
FT                   TRTVIVCNGYKDREYIRLALIGEKIGHKVYLVIEKMTEIKLVLEEAERLNVVPRLGVRA
FT                   RLASQGSGKWQSSGGEKSKFGLAAAQVLHLVELLRQANRLDSLQLLHFHLGSQLANIRD
FT                   IATGVRESARFYVELHKLGVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNVIW
FT                   GIGEACNEYDLPHPTVITESGRAVTAHHTVLVSNIIGVERNEFSEPEAPSEDAPRALES
FT                   LWGTWQEVNQPGNRRSLREWLHDSQMDLYDIHMQYTHGMLDLTQRAQAEQLYLNICQRL
FT                   QQQLDPSNRAHRPIIDELQERMADKLYVNFSLFQSMPDAWGIDQLFPVLPLEGLDKPPQ
FT                   RRAVLLDITCDSDGAIDHYVDGDGVATTMPMPPYDPENPPLLGFFMVGAYQEILGNMHN
FT                   LFGDTSTVDVFVFQDGSVELEESDEGNTVADMLEYVQLDPEVLMSRFRDQVKETDLAPE
FT                   LQAQFLEEFETGLYGYTYLEDE"
FT   gene            615789..616985
FT                   /locus_tag="Dd703_0551"
FT   CDS_pept        615789..616985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0551"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   spe:Spro_4593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84362"
FT                   /db_xref="GOA:C6C8Z1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Z1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS84362.1"
FT                   /translation="MVDLNRQRLFFTSCFSYALTGALVIVTGMVMGDIAQYFNVPITSM
FT                   SNTFTFLNAGILISIFLNVWLMDVFSLKKQLIFGFILILLSIVGLFLADTLTIFSVCMF
FT                   TLGVVSGITMSIGTFLITQLYEGRQRGARLLFTDSFFSMAGTLFPILAAALLSRHFGWY
FT                   WVYACIGLLYVVILVLTLPSEFPSIGAADTTRKETQTAQEKWGANVLVLSIAALCYILG
FT                   QLAFIQWVPEYVTKTFGMSLGDAGGLVGSFWTAYMIGMWVFSYVLKFFDLQRVVTVLAL
FT                   LATASMYLFVSSGNPELLKYFILFLGFISSAIYTTLITLGSQQTRMPSPKLVNFILTCG
FT                   TVGTMLTFIVTGPIVSAFNVHAALVTANGLYFVVFVMCFLLGFVTKHRNHDHTGNGHS"
FT   sig_peptide     615789..615887
FT                   /locus_tag="Dd703_0551"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.823) with cleavage site probability 0.814 at
FT                   residue 33"
FT   gene            617593..619587
FT                   /locus_tag="Dd703_0552"
FT   CDS_pept        617593..619587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0552"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase central
FT                   region; Transketolase domain protein; KEGG: eca:ECA0861
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84363"
FT                   /db_xref="GOA:C6C8Z2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Z2"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ACS84363.1"
FT                   /translation="MSSRKELANAIRALSMDGVQKAKSGHPGAPMGMADIAEVLWRDYL
FT                   NHNPGNPSWVNRDRFVLSNGHASMLIYSLLHLTGYDLPIEELKNFRQLHSRTPGHPEVG
FT                   YTPGVETTTGPLGQGIANAVGMAIAERTLAAQFNRPGHDIVDHHTYAFLGDGCMMEGIS
FT                   HEVCSLAGTLKLGKLIAFYDDNGISIDGHVDGWFTDDTAARFESYGWQVIRGIDGHDAD
FT                   AIHQAIAQAQRVTDKPSLLMCKTVIGFGSPNKAGTHDSHGAPLGDAEVAATREQLGWKY
FT                   DPFEIPAEIYAAWDAREAGKRKEAAWQQAFNAYASAYPELAAEFTRRSSGELPANWQQE
FT                   STKVIEQLQANAAKIASRKASQNALEAYGKLLPEFLGGSADLAPSNLTIWSGSKALNED
FT                   PAGNYIHYGVREFGMTAIANGIALHGGFVPYTATFLMFVEYARNAVRMAALMKVRSIYV
FT                   YTHDSIGLGEDGPTHQPVEQLASLRVTPNMSTWRPADQVETAVAWKYAIERKDGPTALI
FT                   LSRQNLAQQERTAQQLADVVKGAYVLKDSNGQPDVILIATGSEVKLAVSAWQTLTDEGI
FT                   KARVVSMPSTDAFDKQTSAYREAVLPSSVSARVAIEASIADFWYKYVGLNGAIVGMERF
FT                   GESAPAEKLFEAFGFTTDNVVAKAKALLK"
FT   gene            619893..620909
FT                   /locus_tag="Dd703_0553"
FT   CDS_pept        619893..620909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0553"
FT                   /product="D-erythrose-4-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.72"
FT                   /note="KEGG: eca:ECA3913 erythrose 4-phosphate
FT                   dehydrogenase; TIGRFAM: D-erythrose-4-phosphate
FT                   dehydrogenase; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84364"
FT                   /db_xref="GOA:C6C8Z3"
FT                   /db_xref="InterPro:IPR006422"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Z3"
FT                   /inference="protein motif:TFAM:TIGR01532"
FT                   /protein_id="ACS84364.1"
FT                   /translation="MAIRIAINGFGRIGRSVLRALYESGRRAEMAVVAINELASAEGIA
FT                   HLLKYDSSHGRFSWDVRQECDRLSVGDDTIRLLHQADIHALPWKELGVDVVLDCSGVYG
FT                   SRADGEAHLAAGAKKVLFSHPGAPDLDATVVYGVNHADLLSTHRLVSNASCTTNCIIPI
FT                   IKLLDDSFDIESGTVTTIHASMNDQPVIDAYHHDLRRTRAASQSIIPVDTKLAVGITRF
FT                   FPKFADRFEAISVRVPTINVTAIDLSVSVKKAVNVNEINTLFRQSAQDAFRGIVDYTEL
FT                   PLVSADFNHDPHSAIVDGTQTRVSGQHLVKTLVWCDNEWGFANRMLDTTQAMAACGF"
FT   gene            620977..622140
FT                   /locus_tag="Dd703_0554"
FT   CDS_pept        620977..622140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0554"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: eca:ECA3912
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84365"
FT                   /db_xref="GOA:C6C8Z4"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Z4"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ACS84365.1"
FT                   /translation="MAVIKMTDLDLAGKRVLIRADLNVPVKDGKVTSDARIRASLPTIE
FT                   IALKQGARVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDHLSSPVRLAKDYLDGVDVAEG
FT                   ELVVLENVRFNKGEKKDDEALSKKYAALCDVFVMDAFGTAHRAQASTHGVGKFAPIACA
FT                   GPLLFDELEALGKALSNPARPMVAIVGGSKVSTKLTVLDSLSRIADQLIVGGGIANTFV
FT                   AAQGHNVGKSLYEAELIPEAKKLLETCDIPVPSDVRVATEFSETATATLKSVTAIKDDE
FT                   QILDLGDVSAERLADILKNAKTILWNGPVGVFEFPNFRKGTEIIAQAIADSDAFSIAGG
FT                   GDTLAAIDLFGIADKISYISTGGGAFLEFVEGKKLPAVVMLEERARQ"
FT   gene            622259..623335
FT                   /locus_tag="Dd703_0555"
FT   CDS_pept        622259..623335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0555"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="TIGRFAM: fructose-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II; KEGG: plu:plu0957 fructose-bisphosphate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84366"
FT                   /db_xref="GOA:C6C8Z5"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6C8Z5"
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /protein_id="ACS84366.1"
FT                   /translation="MSKIFDFVKPGVITGDDVQKVFAIAKENKFALPAVNCVGTDSINA
FT                   VLEAAAKVRAPVIVQFSNGGAAFTAGKGLKAEGQQAAILGAISGAHHVHQMAEHYGIPV
FT                   ILHTDHCAKKLLPWLDGLLDAGEKHYAATGKPLFSSHMIDLSEESLEENIEICSKYLAR
FT                   MAKLDMTLEIELGCTGGEEDGVDNSHLDNSALYTQPEDVAYAYEKLNAISPRFTIAASF
FT                   GNVHGVYKPGNVQLTPKILRNSQEFVSKKFNLPHNSLDFVFHGGSGSTAEEIAEAVSYG
FT                   VVKMNIDTDTQWATWEGILNYYKKNEGYLQGQLGNPEGDDKPNKKYYDPRVWLRAGQAS
FT                   MVARLEKAFNELNAVDVL"
FT   gene            623459..624340
FT                   /locus_tag="Dd703_0556"
FT   CDS_pept        623459..624340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd703_0556"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; Conserved
FT                   TM helix repeat-containing protein; KEGG: eca:ECA3910
FT                   putative mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Dd703_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACS84367"
FT                   /db_xref="GOA:C6C9B6"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db