(data stored in ACNUC7421 zone)

EMBL: CP001655

ID   CP001655; SV 1; circular; genomic DNA; STD; PRO; 4813854 BP.
XX
AC   CP001655;
XX
PR   Project:PRJNA31295;
XX
DT   03-JUL-2009 (Rel. 101, Created)
DT   28-OCT-2017 (Rel. 134, Last updated, Version 7)
XX
DE   Dickeya chrysanthemi Ech1591 chromosome, complete genome.
XX
KW   .
XX
OS   Dickeya chrysanthemi Ech1591
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Pectobacteriaceae; Dickeya.
XX
RN   [1]
RP   1-4813854
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Balakrishnan V., Glasner J., Perna N.T.;
RT   "Complete sequence of Dickeya zeae Ech1591";
RL   Unpublished.
XX
RN   [2]
RP   1-4813854
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Balakrishnan V., Glasner J., Perna N.T.;
RT   ;
RL   Submitted (29-JUN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; e70c948281d9b3092ca820640782beeb.
DR   BioSample; SAMN02598480.
DR   EnsemblGenomes-Gn; Dd1591_R0001.
DR   EnsemblGenomes-Gn; Dd1591_R0002.
DR   EnsemblGenomes-Gn; Dd1591_R0003.
DR   EnsemblGenomes-Gn; Dd1591_R0004.
DR   EnsemblGenomes-Gn; Dd1591_R0005.
DR   EnsemblGenomes-Gn; Dd1591_R0006.
DR   EnsemblGenomes-Gn; Dd1591_R0007.
DR   EnsemblGenomes-Gn; Dd1591_R0008.
DR   EnsemblGenomes-Gn; Dd1591_R0009.
DR   EnsemblGenomes-Gn; Dd1591_R0010.
DR   EnsemblGenomes-Gn; Dd1591_R0011.
DR   EnsemblGenomes-Gn; Dd1591_R0012.
DR   EnsemblGenomes-Gn; Dd1591_R0013.
DR   EnsemblGenomes-Gn; Dd1591_R0014.
DR   EnsemblGenomes-Gn; Dd1591_R0015.
DR   EnsemblGenomes-Gn; Dd1591_R0016.
DR   EnsemblGenomes-Gn; Dd1591_R0017.
DR   EnsemblGenomes-Gn; Dd1591_R0018.
DR   EnsemblGenomes-Gn; Dd1591_R0019.
DR   EnsemblGenomes-Gn; Dd1591_R0020.
DR   EnsemblGenomes-Gn; Dd1591_R0021.
DR   EnsemblGenomes-Gn; Dd1591_R0022.
DR   EnsemblGenomes-Gn; Dd1591_R0023.
DR   EnsemblGenomes-Gn; Dd1591_R0024.
DR   EnsemblGenomes-Gn; Dd1591_R0025.
DR   EnsemblGenomes-Gn; Dd1591_R0026.
DR   EnsemblGenomes-Gn; Dd1591_R0027.
DR   EnsemblGenomes-Gn; Dd1591_R0028.
DR   EnsemblGenomes-Gn; Dd1591_R0029.
DR   EnsemblGenomes-Gn; Dd1591_R0030.
DR   EnsemblGenomes-Gn; Dd1591_R0031.
DR   EnsemblGenomes-Gn; Dd1591_R0032.
DR   EnsemblGenomes-Gn; Dd1591_R0033.
DR   EnsemblGenomes-Gn; Dd1591_R0034.
DR   EnsemblGenomes-Gn; Dd1591_R0035.
DR   EnsemblGenomes-Gn; Dd1591_R0036.
DR   EnsemblGenomes-Gn; Dd1591_R0037.
DR   EnsemblGenomes-Gn; Dd1591_R0038.
DR   EnsemblGenomes-Gn; Dd1591_R0039.
DR   EnsemblGenomes-Gn; Dd1591_R0040.
DR   EnsemblGenomes-Gn; Dd1591_R0041.
DR   EnsemblGenomes-Gn; Dd1591_R0042.
DR   EnsemblGenomes-Gn; Dd1591_R0043.
DR   EnsemblGenomes-Gn; Dd1591_R0044.
DR   EnsemblGenomes-Gn; Dd1591_R0045.
DR   EnsemblGenomes-Gn; Dd1591_R0046.
DR   EnsemblGenomes-Gn; Dd1591_R0047.
DR   EnsemblGenomes-Gn; Dd1591_R0048.
DR   EnsemblGenomes-Gn; Dd1591_R0049.
DR   EnsemblGenomes-Gn; Dd1591_R0050.
DR   EnsemblGenomes-Gn; Dd1591_R0051.
DR   EnsemblGenomes-Gn; Dd1591_R0052.
DR   EnsemblGenomes-Gn; Dd1591_R0053.
DR   EnsemblGenomes-Gn; Dd1591_R0054.
DR   EnsemblGenomes-Gn; Dd1591_R0055.
DR   EnsemblGenomes-Gn; Dd1591_R0056.
DR   EnsemblGenomes-Gn; Dd1591_R0057.
DR   EnsemblGenomes-Gn; Dd1591_R0058.
DR   EnsemblGenomes-Gn; Dd1591_R0059.
DR   EnsemblGenomes-Gn; Dd1591_R0060.
DR   EnsemblGenomes-Gn; Dd1591_R0061.
DR   EnsemblGenomes-Gn; Dd1591_R0062.
DR   EnsemblGenomes-Gn; Dd1591_R0063.
DR   EnsemblGenomes-Gn; Dd1591_R0064.
DR   EnsemblGenomes-Gn; Dd1591_R0065.
DR   EnsemblGenomes-Gn; Dd1591_R0066.
DR   EnsemblGenomes-Gn; Dd1591_R0067.
DR   EnsemblGenomes-Gn; Dd1591_R0068.
DR   EnsemblGenomes-Gn; Dd1591_R0069.
DR   EnsemblGenomes-Gn; Dd1591_R0070.
DR   EnsemblGenomes-Gn; Dd1591_R0071.
DR   EnsemblGenomes-Gn; Dd1591_R0072.
DR   EnsemblGenomes-Gn; Dd1591_R0073.
DR   EnsemblGenomes-Gn; Dd1591_R0074.
DR   EnsemblGenomes-Gn; Dd1591_R0075.
DR   EnsemblGenomes-Gn; Dd1591_R0076.
DR   EnsemblGenomes-Gn; Dd1591_R0077.
DR   EnsemblGenomes-Gn; Dd1591_R0078.
DR   EnsemblGenomes-Gn; Dd1591_R0079.
DR   EnsemblGenomes-Gn; Dd1591_R0080.
DR   EnsemblGenomes-Gn; Dd1591_R0081.
DR   EnsemblGenomes-Gn; Dd1591_R0082.
DR   EnsemblGenomes-Gn; Dd1591_R0083.
DR   EnsemblGenomes-Gn; Dd1591_R0084.
DR   EnsemblGenomes-Gn; Dd1591_R0085.
DR   EnsemblGenomes-Gn; Dd1591_R0086.
DR   EnsemblGenomes-Gn; Dd1591_R0087.
DR   EnsemblGenomes-Gn; Dd1591_R0088.
DR   EnsemblGenomes-Gn; Dd1591_R0089.
DR   EnsemblGenomes-Gn; Dd1591_R0090.
DR   EnsemblGenomes-Gn; Dd1591_R0091.
DR   EnsemblGenomes-Gn; Dd1591_R0092.
DR   EnsemblGenomes-Gn; Dd1591_R0093.
DR   EnsemblGenomes-Gn; Dd1591_R0094.
DR   EnsemblGenomes-Gn; Dd1591_R0095.
DR   EnsemblGenomes-Gn; Dd1591_R0096.
DR   EnsemblGenomes-Gn; Dd1591_R0097.
DR   EnsemblGenomes-Gn; Dd1591_R0098.
DR   EnsemblGenomes-Gn; Dd1591_R0099.
DR   EnsemblGenomes-Gn; Dd1591_R0100.
DR   EnsemblGenomes-Gn; EBG00001061161.
DR   EnsemblGenomes-Gn; EBG00001061162.
DR   EnsemblGenomes-Gn; EBG00001061163.
DR   EnsemblGenomes-Gn; EBG00001061164.
DR   EnsemblGenomes-Gn; EBG00001061165.
DR   EnsemblGenomes-Gn; EBG00001061166.
DR   EnsemblGenomes-Gn; EBG00001061167.
DR   EnsemblGenomes-Gn; EBG00001061168.
DR   EnsemblGenomes-Gn; EBG00001061169.
DR   EnsemblGenomes-Gn; EBG00001061170.
DR   EnsemblGenomes-Gn; EBG00001061171.
DR   EnsemblGenomes-Gn; EBG00001061172.
DR   EnsemblGenomes-Gn; EBG00001061173.
DR   EnsemblGenomes-Gn; EBG00001061174.
DR   EnsemblGenomes-Gn; EBG00001061175.
DR   EnsemblGenomes-Gn; EBG00001061176.
DR   EnsemblGenomes-Gn; EBG00001061177.
DR   EnsemblGenomes-Gn; EBG00001061178.
DR   EnsemblGenomes-Gn; EBG00001061179.
DR   EnsemblGenomes-Gn; EBG00001061180.
DR   EnsemblGenomes-Gn; EBG00001061181.
DR   EnsemblGenomes-Gn; EBG00001061182.
DR   EnsemblGenomes-Gn; EBG00001061183.
DR   EnsemblGenomes-Gn; EBG00001061184.
DR   EnsemblGenomes-Gn; EBG00001061185.
DR   EnsemblGenomes-Gn; EBG00001061186.
DR   EnsemblGenomes-Gn; EBG00001061187.
DR   EnsemblGenomes-Gn; EBG00001061188.
DR   EnsemblGenomes-Gn; EBG00001061189.
DR   EnsemblGenomes-Gn; EBG00001061190.
DR   EnsemblGenomes-Gn; EBG00001061191.
DR   EnsemblGenomes-Gn; EBG00001061192.
DR   EnsemblGenomes-Gn; EBG00001061193.
DR   EnsemblGenomes-Gn; EBG00001061194.
DR   EnsemblGenomes-Gn; EBG00001061195.
DR   EnsemblGenomes-Gn; EBG00001061196.
DR   EnsemblGenomes-Gn; EBG00001061197.
DR   EnsemblGenomes-Gn; EBG00001061198.
DR   EnsemblGenomes-Gn; EBG00001061199.
DR   EnsemblGenomes-Gn; EBG00001061200.
DR   EnsemblGenomes-Gn; EBG00001061201.
DR   EnsemblGenomes-Gn; EBG00001061202.
DR   EnsemblGenomes-Gn; EBG00001061203.
DR   EnsemblGenomes-Gn; EBG00001061204.
DR   EnsemblGenomes-Gn; EBG00001061205.
DR   EnsemblGenomes-Gn; EBG00001061206.
DR   EnsemblGenomes-Gn; EBG00001061207.
DR   EnsemblGenomes-Gn; EBG00001061208.
DR   EnsemblGenomes-Gn; EBG00001061209.
DR   EnsemblGenomes-Gn; EBG00001061210.
DR   EnsemblGenomes-Gn; EBG00001061211.
DR   EnsemblGenomes-Gn; EBG00001061212.
DR   EnsemblGenomes-Gn; EBG00001061213.
DR   EnsemblGenomes-Gn; EBG00001061214.
DR   EnsemblGenomes-Gn; EBG00001061215.
DR   EnsemblGenomes-Gn; EBG00001061216.
DR   EnsemblGenomes-Gn; EBG00001061217.
DR   EnsemblGenomes-Gn; EBG00001061218.
DR   EnsemblGenomes-Gn; EBG00001061219.
DR   EnsemblGenomes-Gn; EBG00001061220.
DR   EnsemblGenomes-Gn; EBG00001061221.
DR   EnsemblGenomes-Gn; EBG00001061222.
DR   EnsemblGenomes-Gn; EBG00001061223.
DR   EnsemblGenomes-Gn; EBG00001061224.
DR   EnsemblGenomes-Gn; EBG00001061225.
DR   EnsemblGenomes-Gn; EBG00001061226.
DR   EnsemblGenomes-Gn; EBG00001061227.
DR   EnsemblGenomes-Gn; EBG00001061228.
DR   EnsemblGenomes-Gn; EBG00001061229.
DR   EnsemblGenomes-Gn; EBG00001061230.
DR   EnsemblGenomes-Gn; EBG00001061231.
DR   EnsemblGenomes-Gn; EBG00001061232.
DR   EnsemblGenomes-Gn; EBG00001061233.
DR   EnsemblGenomes-Gn; EBG00001061234.
DR   EnsemblGenomes-Gn; EBG00001061235.
DR   EnsemblGenomes-Gn; EBG00001061236.
DR   EnsemblGenomes-Gn; EBG00001061237.
DR   EnsemblGenomes-Gn; EBG00001061238.
DR   EnsemblGenomes-Gn; EBG00001061239.
DR   EnsemblGenomes-Gn; EBG00001061240.
DR   EnsemblGenomes-Gn; EBG00001061241.
DR   EnsemblGenomes-Gn; EBG00001061242.
DR   EnsemblGenomes-Gn; EBG00001061243.
DR   EnsemblGenomes-Gn; EBG00001061244.
DR   EnsemblGenomes-Gn; EBG00001061245.
DR   EnsemblGenomes-Gn; EBG00001061246.
DR   EnsemblGenomes-Gn; EBG00001061247.
DR   EnsemblGenomes-Gn; EBG00001061248.
DR   EnsemblGenomes-Gn; EBG00001061249.
DR   EnsemblGenomes-Gn; EBG00001061250.
DR   EnsemblGenomes-Gn; EBG00001061251.
DR   EnsemblGenomes-Gn; EBG00001061252.
DR   EnsemblGenomes-Gn; EBG00001061253.
DR   EnsemblGenomes-Gn; EBG00001061254.
DR   EnsemblGenomes-Gn; EBG00001061255.
DR   EnsemblGenomes-Gn; EBG00001061256.
DR   EnsemblGenomes-Gn; EBG00001061257.
DR   EnsemblGenomes-Gn; EBG00001061258.
DR   EnsemblGenomes-Gn; EBG00001061259.
DR   EnsemblGenomes-Gn; EBG00001061260.
DR   EnsemblGenomes-Gn; EBG00001061261.
DR   EnsemblGenomes-Gn; EBG00001061262.
DR   EnsemblGenomes-Gn; EBG00001061263.
DR   EnsemblGenomes-Gn; EBG00001061264.
DR   EnsemblGenomes-Gn; EBG00001061265.
DR   EnsemblGenomes-Gn; EBG00001061266.
DR   EnsemblGenomes-Gn; EBG00001061267.
DR   EnsemblGenomes-Gn; EBG00001061268.
DR   EnsemblGenomes-Gn; EBG00001061269.
DR   EnsemblGenomes-Gn; EBG00001061270.
DR   EnsemblGenomes-Gn; EBG00001061271.
DR   EnsemblGenomes-Gn; EBG00001061272.
DR   EnsemblGenomes-Gn; EBG00001061273.
DR   EnsemblGenomes-Gn; EBG00001061274.
DR   EnsemblGenomes-Gn; EBG00001061275.
DR   EnsemblGenomes-Gn; EBG00001061276.
DR   EnsemblGenomes-Gn; EBG00001061277.
DR   EnsemblGenomes-Gn; EBG00001061278.
DR   EnsemblGenomes-Gn; EBG00001061279.
DR   EnsemblGenomes-Gn; EBG00001061280.
DR   EnsemblGenomes-Gn; EBG00001061281.
DR   EnsemblGenomes-Gn; EBG00001061282.
DR   EnsemblGenomes-Gn; EBG00001061283.
DR   EnsemblGenomes-Gn; EBG00001061284.
DR   EnsemblGenomes-Gn; EBG00001061285.
DR   EnsemblGenomes-Gn; EBG00001061286.
DR   EnsemblGenomes-Gn; EBG00001061287.
DR   EnsemblGenomes-Gn; EBG00001061288.
DR   EnsemblGenomes-Gn; EBG00001061289.
DR   EnsemblGenomes-Gn; EBG00001061290.
DR   EnsemblGenomes-Gn; EBG00001061291.
DR   EnsemblGenomes-Gn; EBG00001061292.
DR   EnsemblGenomes-Gn; EBG00001061293.
DR   EnsemblGenomes-Gn; EBG00001061294.
DR   EnsemblGenomes-Gn; EBG00001061295.
DR   EnsemblGenomes-Gn; EBG00001061296.
DR   EnsemblGenomes-Gn; EBG00001061297.
DR   EnsemblGenomes-Gn; EBG00001061298.
DR   EnsemblGenomes-Gn; EBG00001061299.
DR   EnsemblGenomes-Gn; EBG00001061300.
DR   EnsemblGenomes-Gn; EBG00001061301.
DR   EnsemblGenomes-Gn; EBG00001061302.
DR   EnsemblGenomes-Gn; EBG00001061303.
DR   EnsemblGenomes-Gn; EBG00001061304.
DR   EnsemblGenomes-Gn; EBG00001061305.
DR   EnsemblGenomes-Gn; EBG00001061306.
DR   EnsemblGenomes-Gn; EBG00001061307.
DR   EnsemblGenomes-Gn; EBG00001061308.
DR   EnsemblGenomes-Gn; EBG00001061309.
DR   EnsemblGenomes-Gn; EBG00001061310.
DR   EnsemblGenomes-Gn; EBG00001061311.
DR   EnsemblGenomes-Gn; EBG00001061312.
DR   EnsemblGenomes-Gn; EBG00001061313.
DR   EnsemblGenomes-Gn; EBG00001061314.
DR   EnsemblGenomes-Gn; EBG00001061315.
DR   EnsemblGenomes-Gn; EBG00001061316.
DR   EnsemblGenomes-Gn; EBG00001061317.
DR   EnsemblGenomes-Gn; EBG00001061318.
DR   EnsemblGenomes-Gn; EBG00001061319.
DR   EnsemblGenomes-Gn; EBG00001061320.
DR   EnsemblGenomes-Gn; EBG00001061321.
DR   EnsemblGenomes-Gn; EBG00001061322.
DR   EnsemblGenomes-Gn; EBG00001061323.
DR   EnsemblGenomes-Gn; EBG00001061324.
DR   EnsemblGenomes-Gn; EBG00001061325.
DR   EnsemblGenomes-Gn; EBG00001061326.
DR   EnsemblGenomes-Gn; EBG00001061327.
DR   EnsemblGenomes-Gn; EBG00001061328.
DR   EnsemblGenomes-Gn; EBG00001061329.
DR   EnsemblGenomes-Gn; EBG00001061330.
DR   EnsemblGenomes-Gn; EBG00001061331.
DR   EnsemblGenomes-Gn; EBG00001061332.
DR   EnsemblGenomes-Gn; EBG00001061333.
DR   EnsemblGenomes-Gn; EBG00001061334.
DR   EnsemblGenomes-Gn; EBG00001061335.
DR   EnsemblGenomes-Gn; EBG00001061336.
DR   EnsemblGenomes-Gn; EBG00001061337.
DR   EnsemblGenomes-Gn; EBG00001061338.
DR   EnsemblGenomes-Gn; EBG00001061339.
DR   EnsemblGenomes-Gn; EBG00001061340.
DR   EnsemblGenomes-Gn; EBG00001061341.
DR   EnsemblGenomes-Gn; EBG00001061342.
DR   EnsemblGenomes-Gn; EBG00001061343.
DR   EnsemblGenomes-Gn; EBG00001061344.
DR   EnsemblGenomes-Gn; EBG00001061345.
DR   EnsemblGenomes-Gn; EBG00001061346.
DR   EnsemblGenomes-Gn; EBG00001061347.
DR   EnsemblGenomes-Gn; EBG00001061348.
DR   EnsemblGenomes-Gn; EBG00001061349.
DR   EnsemblGenomes-Gn; EBG00001061350.
DR   EnsemblGenomes-Gn; EBG00001061351.
DR   EnsemblGenomes-Gn; EBG00001061352.
DR   EnsemblGenomes-Gn; EBG00001061353.
DR   EnsemblGenomes-Gn; EBG00001061354.
DR   EnsemblGenomes-Gn; EBG00001061355.
DR   EnsemblGenomes-Gn; EBG00001061356.
DR   EnsemblGenomes-Gn; EBG00001061357.
DR   EnsemblGenomes-Gn; EBG00001061358.
DR   EnsemblGenomes-Gn; EBG00001061359.
DR   EnsemblGenomes-Gn; EBG00001061360.
DR   EnsemblGenomes-Gn; EBG00001061361.
DR   EnsemblGenomes-Gn; EBG00001061362.
DR   EnsemblGenomes-Gn; EBG00001061363.
DR   EnsemblGenomes-Gn; EBG00001061364.
DR   EnsemblGenomes-Gn; EBG00001061365.
DR   EnsemblGenomes-Gn; EBG00001061366.
DR   EnsemblGenomes-Gn; EBG00001061367.
DR   EnsemblGenomes-Gn; EBG00001061368.
DR   EnsemblGenomes-Gn; EBG00001061369.
DR   EnsemblGenomes-Gn; EBG00001061370.
DR   EnsemblGenomes-Gn; EBG00001061371.
DR   EnsemblGenomes-Gn; EBG00001061372.
DR   EnsemblGenomes-Gn; EBG00001061373.
DR   EnsemblGenomes-Gn; EBG00001061374.
DR   EnsemblGenomes-Gn; EBG00001061375.
DR   EnsemblGenomes-Gn; EBG00001061376.
DR   EnsemblGenomes-Gn; EBG00001061377.
DR   EnsemblGenomes-Gn; EBG00001061378.
DR   EnsemblGenomes-Gn; EBG00001061379.
DR   EnsemblGenomes-Gn; EBG00001061380.
DR   EnsemblGenomes-Gn; EBG00001061381.
DR   EnsemblGenomes-Gn; EBG00001061382.
DR   EnsemblGenomes-Gn; EBG00001061383.
DR   EnsemblGenomes-Gn; EBG00001061384.
DR   EnsemblGenomes-Gn; EBG00001061385.
DR   EnsemblGenomes-Gn; EBG00001061386.
DR   EnsemblGenomes-Gn; EBG00001061387.
DR   EnsemblGenomes-Gn; EBG00001061388.
DR   EnsemblGenomes-Gn; EBG00001061389.
DR   EnsemblGenomes-Gn; EBG00001061390.
DR   EnsemblGenomes-Gn; EBG00001061391.
DR   EnsemblGenomes-Tr; Dd1591_R0001-1.
DR   EnsemblGenomes-Tr; Dd1591_R0002-1.
DR   EnsemblGenomes-Tr; Dd1591_R0003-1.
DR   EnsemblGenomes-Tr; Dd1591_R0004-1.
DR   EnsemblGenomes-Tr; Dd1591_R0005-1.
DR   EnsemblGenomes-Tr; Dd1591_R0006-1.
DR   EnsemblGenomes-Tr; Dd1591_R0007-1.
DR   EnsemblGenomes-Tr; Dd1591_R0008-1.
DR   EnsemblGenomes-Tr; Dd1591_R0009-1.
DR   EnsemblGenomes-Tr; Dd1591_R0010-1.
DR   EnsemblGenomes-Tr; Dd1591_R0011-1.
DR   EnsemblGenomes-Tr; Dd1591_R0012-1.
DR   EnsemblGenomes-Tr; Dd1591_R0013-1.
DR   EnsemblGenomes-Tr; Dd1591_R0014-1.
DR   EnsemblGenomes-Tr; Dd1591_R0015-1.
DR   EnsemblGenomes-Tr; Dd1591_R0016-1.
DR   EnsemblGenomes-Tr; Dd1591_R0017-1.
DR   EnsemblGenomes-Tr; Dd1591_R0018-1.
DR   EnsemblGenomes-Tr; Dd1591_R0019-1.
DR   EnsemblGenomes-Tr; Dd1591_R0020-1.
DR   EnsemblGenomes-Tr; Dd1591_R0021-1.
DR   EnsemblGenomes-Tr; Dd1591_R0022-1.
DR   EnsemblGenomes-Tr; Dd1591_R0023-1.
DR   EnsemblGenomes-Tr; Dd1591_R0024-1.
DR   EnsemblGenomes-Tr; Dd1591_R0025-1.
DR   EnsemblGenomes-Tr; Dd1591_R0026-1.
DR   EnsemblGenomes-Tr; Dd1591_R0027-1.
DR   EnsemblGenomes-Tr; Dd1591_R0028-1.
DR   EnsemblGenomes-Tr; Dd1591_R0029-1.
DR   EnsemblGenomes-Tr; Dd1591_R0030-1.
DR   EnsemblGenomes-Tr; Dd1591_R0031-1.
DR   EnsemblGenomes-Tr; Dd1591_R0032-1.
DR   EnsemblGenomes-Tr; Dd1591_R0033-1.
DR   EnsemblGenomes-Tr; Dd1591_R0034-1.
DR   EnsemblGenomes-Tr; Dd1591_R0035-1.
DR   EnsemblGenomes-Tr; Dd1591_R0036-1.
DR   EnsemblGenomes-Tr; Dd1591_R0037-1.
DR   EnsemblGenomes-Tr; Dd1591_R0038-1.
DR   EnsemblGenomes-Tr; Dd1591_R0039-1.
DR   EnsemblGenomes-Tr; Dd1591_R0040-1.
DR   EnsemblGenomes-Tr; Dd1591_R0041-1.
DR   EnsemblGenomes-Tr; Dd1591_R0042-1.
DR   EnsemblGenomes-Tr; Dd1591_R0043-1.
DR   EnsemblGenomes-Tr; Dd1591_R0044-1.
DR   EnsemblGenomes-Tr; Dd1591_R0045-1.
DR   EnsemblGenomes-Tr; Dd1591_R0046-1.
DR   EnsemblGenomes-Tr; Dd1591_R0047-1.
DR   EnsemblGenomes-Tr; Dd1591_R0048-1.
DR   EnsemblGenomes-Tr; Dd1591_R0049-1.
DR   EnsemblGenomes-Tr; Dd1591_R0050-1.
DR   EnsemblGenomes-Tr; Dd1591_R0051-1.
DR   EnsemblGenomes-Tr; Dd1591_R0052-1.
DR   EnsemblGenomes-Tr; Dd1591_R0053-1.
DR   EnsemblGenomes-Tr; Dd1591_R0054-1.
DR   EnsemblGenomes-Tr; Dd1591_R0055-1.
DR   EnsemblGenomes-Tr; Dd1591_R0056-1.
DR   EnsemblGenomes-Tr; Dd1591_R0057-1.
DR   EnsemblGenomes-Tr; Dd1591_R0058-1.
DR   EnsemblGenomes-Tr; Dd1591_R0059-1.
DR   EnsemblGenomes-Tr; Dd1591_R0060-1.
DR   EnsemblGenomes-Tr; Dd1591_R0061-1.
DR   EnsemblGenomes-Tr; Dd1591_R0062-1.
DR   EnsemblGenomes-Tr; Dd1591_R0063-1.
DR   EnsemblGenomes-Tr; Dd1591_R0064-1.
DR   EnsemblGenomes-Tr; Dd1591_R0065-1.
DR   EnsemblGenomes-Tr; Dd1591_R0066-1.
DR   EnsemblGenomes-Tr; Dd1591_R0067-1.
DR   EnsemblGenomes-Tr; Dd1591_R0068-1.
DR   EnsemblGenomes-Tr; Dd1591_R0069-1.
DR   EnsemblGenomes-Tr; Dd1591_R0070-1.
DR   EnsemblGenomes-Tr; Dd1591_R0071-1.
DR   EnsemblGenomes-Tr; Dd1591_R0072-1.
DR   EnsemblGenomes-Tr; Dd1591_R0073-1.
DR   EnsemblGenomes-Tr; Dd1591_R0074-1.
DR   EnsemblGenomes-Tr; Dd1591_R0075-1.
DR   EnsemblGenomes-Tr; Dd1591_R0076-1.
DR   EnsemblGenomes-Tr; Dd1591_R0077-1.
DR   EnsemblGenomes-Tr; Dd1591_R0078-1.
DR   EnsemblGenomes-Tr; Dd1591_R0079-1.
DR   EnsemblGenomes-Tr; Dd1591_R0080-1.
DR   EnsemblGenomes-Tr; Dd1591_R0081-1.
DR   EnsemblGenomes-Tr; Dd1591_R0082-1.
DR   EnsemblGenomes-Tr; Dd1591_R0083-1.
DR   EnsemblGenomes-Tr; Dd1591_R0084-1.
DR   EnsemblGenomes-Tr; Dd1591_R0085-1.
DR   EnsemblGenomes-Tr; Dd1591_R0086-1.
DR   EnsemblGenomes-Tr; Dd1591_R0087-1.
DR   EnsemblGenomes-Tr; Dd1591_R0088-1.
DR   EnsemblGenomes-Tr; Dd1591_R0089-1.
DR   EnsemblGenomes-Tr; Dd1591_R0090-1.
DR   EnsemblGenomes-Tr; Dd1591_R0091-1.
DR   EnsemblGenomes-Tr; Dd1591_R0092-1.
DR   EnsemblGenomes-Tr; Dd1591_R0093-1.
DR   EnsemblGenomes-Tr; Dd1591_R0094-1.
DR   EnsemblGenomes-Tr; Dd1591_R0095-1.
DR   EnsemblGenomes-Tr; Dd1591_R0096-1.
DR   EnsemblGenomes-Tr; Dd1591_R0097-1.
DR   EnsemblGenomes-Tr; Dd1591_R0098-1.
DR   EnsemblGenomes-Tr; Dd1591_R0099-1.
DR   EnsemblGenomes-Tr; Dd1591_R0100-1.
DR   EnsemblGenomes-Tr; EBT00001663701.
DR   EnsemblGenomes-Tr; EBT00001663702.
DR   EnsemblGenomes-Tr; EBT00001663703.
DR   EnsemblGenomes-Tr; EBT00001663704.
DR   EnsemblGenomes-Tr; EBT00001663705.
DR   EnsemblGenomes-Tr; EBT00001663707.
DR   EnsemblGenomes-Tr; EBT00001663708.
DR   EnsemblGenomes-Tr; EBT00001663710.
DR   EnsemblGenomes-Tr; EBT00001663712.
DR   EnsemblGenomes-Tr; EBT00001663714.
DR   EnsemblGenomes-Tr; EBT00001663716.
DR   EnsemblGenomes-Tr; EBT00001663717.
DR   EnsemblGenomes-Tr; EBT00001663718.
DR   EnsemblGenomes-Tr; EBT00001663720.
DR   EnsemblGenomes-Tr; EBT00001663722.
DR   EnsemblGenomes-Tr; EBT00001663723.
DR   EnsemblGenomes-Tr; EBT00001663724.
DR   EnsemblGenomes-Tr; EBT00001663726.
DR   EnsemblGenomes-Tr; EBT00001663727.
DR   EnsemblGenomes-Tr; EBT00001663729.
DR   EnsemblGenomes-Tr; EBT00001663730.
DR   EnsemblGenomes-Tr; EBT00001663732.
DR   EnsemblGenomes-Tr; EBT00001663734.
DR   EnsemblGenomes-Tr; EBT00001663735.
DR   EnsemblGenomes-Tr; EBT00001663736.
DR   EnsemblGenomes-Tr; EBT00001663738.
DR   EnsemblGenomes-Tr; EBT00001663739.
DR   EnsemblGenomes-Tr; EBT00001663741.
DR   EnsemblGenomes-Tr; EBT00001663742.
DR   EnsemblGenomes-Tr; EBT00001663743.
DR   EnsemblGenomes-Tr; EBT00001663745.
DR   EnsemblGenomes-Tr; EBT00001663747.
DR   EnsemblGenomes-Tr; EBT00001663748.
DR   EnsemblGenomes-Tr; EBT00001663749.
DR   EnsemblGenomes-Tr; EBT00001663751.
DR   EnsemblGenomes-Tr; EBT00001663753.
DR   EnsemblGenomes-Tr; EBT00001663754.
DR   EnsemblGenomes-Tr; EBT00001663756.
DR   EnsemblGenomes-Tr; EBT00001663757.
DR   EnsemblGenomes-Tr; EBT00001663759.
DR   EnsemblGenomes-Tr; EBT00001663760.
DR   EnsemblGenomes-Tr; EBT00001663762.
DR   EnsemblGenomes-Tr; EBT00001663763.
DR   EnsemblGenomes-Tr; EBT00001663765.
DR   EnsemblGenomes-Tr; EBT00001663766.
DR   EnsemblGenomes-Tr; EBT00001663768.
DR   EnsemblGenomes-Tr; EBT00001663769.
DR   EnsemblGenomes-Tr; EBT00001663771.
DR   EnsemblGenomes-Tr; EBT00001663772.
DR   EnsemblGenomes-Tr; EBT00001663774.
DR   EnsemblGenomes-Tr; EBT00001663775.
DR   EnsemblGenomes-Tr; EBT00001663776.
DR   EnsemblGenomes-Tr; EBT00001663778.
DR   EnsemblGenomes-Tr; EBT00001663779.
DR   EnsemblGenomes-Tr; EBT00001663781.
DR   EnsemblGenomes-Tr; EBT00001663783.
DR   EnsemblGenomes-Tr; EBT00001663784.
DR   EnsemblGenomes-Tr; EBT00001663786.
DR   EnsemblGenomes-Tr; EBT00001663788.
DR   EnsemblGenomes-Tr; EBT00001663789.
DR   EnsemblGenomes-Tr; EBT00001663791.
DR   EnsemblGenomes-Tr; EBT00001663793.
DR   EnsemblGenomes-Tr; EBT00001663794.
DR   EnsemblGenomes-Tr; EBT00001663796.
DR   EnsemblGenomes-Tr; EBT00001663797.
DR   EnsemblGenomes-Tr; EBT00001663799.
DR   EnsemblGenomes-Tr; EBT00001663800.
DR   EnsemblGenomes-Tr; EBT00001663802.
DR   EnsemblGenomes-Tr; EBT00001663803.
DR   EnsemblGenomes-Tr; EBT00001663804.
DR   EnsemblGenomes-Tr; EBT00001663806.
DR   EnsemblGenomes-Tr; EBT00001663807.
DR   EnsemblGenomes-Tr; EBT00001663808.
DR   EnsemblGenomes-Tr; EBT00001663809.
DR   EnsemblGenomes-Tr; EBT00001663811.
DR   EnsemblGenomes-Tr; EBT00001663812.
DR   EnsemblGenomes-Tr; EBT00001663814.
DR   EnsemblGenomes-Tr; EBT00001663815.
DR   EnsemblGenomes-Tr; EBT00001663817.
DR   EnsemblGenomes-Tr; EBT00001663818.
DR   EnsemblGenomes-Tr; EBT00001663820.
DR   EnsemblGenomes-Tr; EBT00001663821.
DR   EnsemblGenomes-Tr; EBT00001663822.
DR   EnsemblGenomes-Tr; EBT00001663824.
DR   EnsemblGenomes-Tr; EBT00001663825.
DR   EnsemblGenomes-Tr; EBT00001663827.
DR   EnsemblGenomes-Tr; EBT00001663829.
DR   EnsemblGenomes-Tr; EBT00001663830.
DR   EnsemblGenomes-Tr; EBT00001663831.
DR   EnsemblGenomes-Tr; EBT00001663833.
DR   EnsemblGenomes-Tr; EBT00001663834.
DR   EnsemblGenomes-Tr; EBT00001663836.
DR   EnsemblGenomes-Tr; EBT00001663837.
DR   EnsemblGenomes-Tr; EBT00001663838.
DR   EnsemblGenomes-Tr; EBT00001663840.
DR   EnsemblGenomes-Tr; EBT00001663841.
DR   EnsemblGenomes-Tr; EBT00001663842.
DR   EnsemblGenomes-Tr; EBT00001663844.
DR   EnsemblGenomes-Tr; EBT00001663847.
DR   EnsemblGenomes-Tr; EBT00001663849.
DR   EnsemblGenomes-Tr; EBT00001663852.
DR   EnsemblGenomes-Tr; EBT00001663854.
DR   EnsemblGenomes-Tr; EBT00001663856.
DR   EnsemblGenomes-Tr; EBT00001663859.
DR   EnsemblGenomes-Tr; EBT00001663861.
DR   EnsemblGenomes-Tr; EBT00001663863.
DR   EnsemblGenomes-Tr; EBT00001663866.
DR   EnsemblGenomes-Tr; EBT00001663867.
DR   EnsemblGenomes-Tr; EBT00001663869.
DR   EnsemblGenomes-Tr; EBT00001663872.
DR   EnsemblGenomes-Tr; EBT00001663874.
DR   EnsemblGenomes-Tr; EBT00001663876.
DR   EnsemblGenomes-Tr; EBT00001663879.
DR   EnsemblGenomes-Tr; EBT00001663882.
DR   EnsemblGenomes-Tr; EBT00001663883.
DR   EnsemblGenomes-Tr; EBT00001663885.
DR   EnsemblGenomes-Tr; EBT00001663888.
DR   EnsemblGenomes-Tr; EBT00001663891.
DR   EnsemblGenomes-Tr; EBT00001663893.
DR   EnsemblGenomes-Tr; EBT00001663896.
DR   EnsemblGenomes-Tr; EBT00001663898.
DR   EnsemblGenomes-Tr; EBT00001663900.
DR   EnsemblGenomes-Tr; EBT00001663904.
DR   EnsemblGenomes-Tr; EBT00001663905.
DR   EnsemblGenomes-Tr; EBT00001663906.
DR   EnsemblGenomes-Tr; EBT00001663909.
DR   EnsemblGenomes-Tr; EBT00001663911.
DR   EnsemblGenomes-Tr; EBT00001663913.
DR   EnsemblGenomes-Tr; EBT00001663916.
DR   EnsemblGenomes-Tr; EBT00001663917.
DR   EnsemblGenomes-Tr; EBT00001663920.
DR   EnsemblGenomes-Tr; EBT00001663922.
DR   EnsemblGenomes-Tr; EBT00001663924.
DR   EnsemblGenomes-Tr; EBT00001663926.
DR   EnsemblGenomes-Tr; EBT00001663928.
DR   EnsemblGenomes-Tr; EBT00001663931.
DR   EnsemblGenomes-Tr; EBT00001663933.
DR   EnsemblGenomes-Tr; EBT00001663936.
DR   EnsemblGenomes-Tr; EBT00001663939.
DR   EnsemblGenomes-Tr; EBT00001663940.
DR   EnsemblGenomes-Tr; EBT00001663944.
DR   EnsemblGenomes-Tr; EBT00001663945.
DR   EnsemblGenomes-Tr; EBT00001663947.
DR   EnsemblGenomes-Tr; EBT00001663949.
DR   EnsemblGenomes-Tr; EBT00001663951.
DR   EnsemblGenomes-Tr; EBT00001663953.
DR   EnsemblGenomes-Tr; EBT00001663956.
DR   EnsemblGenomes-Tr; EBT00001663958.
DR   EnsemblGenomes-Tr; EBT00001663960.
DR   EnsemblGenomes-Tr; EBT00001663963.
DR   EnsemblGenomes-Tr; EBT00001663966.
DR   EnsemblGenomes-Tr; EBT00001663968.
DR   EnsemblGenomes-Tr; EBT00001663969.
DR   EnsemblGenomes-Tr; EBT00001663972.
DR   EnsemblGenomes-Tr; EBT00001663974.
DR   EnsemblGenomes-Tr; EBT00001663976.
DR   EnsemblGenomes-Tr; EBT00001663978.
DR   EnsemblGenomes-Tr; EBT00001663980.
DR   EnsemblGenomes-Tr; EBT00001663981.
DR   EnsemblGenomes-Tr; EBT00001663983.
DR   EnsemblGenomes-Tr; EBT00001663985.
DR   EnsemblGenomes-Tr; EBT00001663986.
DR   EnsemblGenomes-Tr; EBT00001663987.
DR   EnsemblGenomes-Tr; EBT00001663989.
DR   EnsemblGenomes-Tr; EBT00001663991.
DR   EnsemblGenomes-Tr; EBT00001663992.
DR   EnsemblGenomes-Tr; EBT00001663994.
DR   EnsemblGenomes-Tr; EBT00001663996.
DR   EnsemblGenomes-Tr; EBT00001663997.
DR   EnsemblGenomes-Tr; EBT00001663999.
DR   EnsemblGenomes-Tr; EBT00001664001.
DR   EnsemblGenomes-Tr; EBT00001664003.
DR   EnsemblGenomes-Tr; EBT00001664005.
DR   EnsemblGenomes-Tr; EBT00001664007.
DR   EnsemblGenomes-Tr; EBT00001664009.
DR   EnsemblGenomes-Tr; EBT00001664010.
DR   EnsemblGenomes-Tr; EBT00001664012.
DR   EnsemblGenomes-Tr; EBT00001664014.
DR   EnsemblGenomes-Tr; EBT00001664016.
DR   EnsemblGenomes-Tr; EBT00001664018.
DR   EnsemblGenomes-Tr; EBT00001664020.
DR   EnsemblGenomes-Tr; EBT00001664021.
DR   EnsemblGenomes-Tr; EBT00001664022.
DR   EnsemblGenomes-Tr; EBT00001664023.
DR   EnsemblGenomes-Tr; EBT00001664024.
DR   EnsemblGenomes-Tr; EBT00001664025.
DR   EnsemblGenomes-Tr; EBT00001664026.
DR   EnsemblGenomes-Tr; EBT00001664027.
DR   EnsemblGenomes-Tr; EBT00001664028.
DR   EnsemblGenomes-Tr; EBT00001664029.
DR   EnsemblGenomes-Tr; EBT00001664030.
DR   EnsemblGenomes-Tr; EBT00001664031.
DR   EnsemblGenomes-Tr; EBT00001664032.
DR   EnsemblGenomes-Tr; EBT00001664033.
DR   EnsemblGenomes-Tr; EBT00001664034.
DR   EnsemblGenomes-Tr; EBT00001664035.
DR   EnsemblGenomes-Tr; EBT00001664036.
DR   EnsemblGenomes-Tr; EBT00001664037.
DR   EnsemblGenomes-Tr; EBT00001664038.
DR   EnsemblGenomes-Tr; EBT00001664039.
DR   EnsemblGenomes-Tr; EBT00001664040.
DR   EnsemblGenomes-Tr; EBT00001664041.
DR   EnsemblGenomes-Tr; EBT00001664042.
DR   EnsemblGenomes-Tr; EBT00001664043.
DR   EnsemblGenomes-Tr; EBT00001664044.
DR   EnsemblGenomes-Tr; EBT00001664045.
DR   EnsemblGenomes-Tr; EBT00001664046.
DR   EnsemblGenomes-Tr; EBT00001664047.
DR   EnsemblGenomes-Tr; EBT00001664048.
DR   EnsemblGenomes-Tr; EBT00001664049.
DR   EnsemblGenomes-Tr; EBT00001664050.
DR   EnsemblGenomes-Tr; EBT00001664051.
DR   EnsemblGenomes-Tr; EBT00001664052.
DR   EnsemblGenomes-Tr; EBT00001664053.
DR   EnsemblGenomes-Tr; EBT00001664054.
DR   EnsemblGenomes-Tr; EBT00001664055.
DR   EnsemblGenomes-Tr; EBT00001664056.
DR   EnsemblGenomes-Tr; EBT00001664057.
DR   EnsemblGenomes-Tr; EBT00001664058.
DR   EnsemblGenomes-Tr; EBT00001664059.
DR   EnsemblGenomes-Tr; EBT00001664060.
DR   EnsemblGenomes-Tr; EBT00001664061.
DR   EnsemblGenomes-Tr; EBT00001664062.
DR   EnsemblGenomes-Tr; EBT00001664063.
DR   EnsemblGenomes-Tr; EBT00001664064.
DR   EnsemblGenomes-Tr; EBT00001664065.
DR   EnsemblGenomes-Tr; EBT00001664066.
DR   EnsemblGenomes-Tr; EBT00001664067.
DR   EnsemblGenomes-Tr; EBT00001664068.
DR   EnsemblGenomes-Tr; EBT00001664069.
DR   EnsemblGenomes-Tr; EBT00001664070.
DR   EuropePMC; PMC3126425; 21378044.
DR   EuropePMC; PMC4028081; 24735398.
DR   EuropePMC; PMC4522980; 26239726.
DR   EuropePMC; PMC5010141; 27322404.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00369; sroC.
DR   RFAM; RF00382; DnaX.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP001655.
DR   SILVA-SSU; CP001655.
XX
CC   CP001655 was submitted as Dickeya zeae Ech1591, but it is 99.9988%
CC   identical to the genome from Dickeya chrysanthemi NCPPB 3533 (WGS
CC   entry AOOJ00000000.1)
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085668
CC   Source DNA and bacteria available from Nicole T. Perna
CC   (ntperna@wisc.edu)
CC   Contacts: Nicole T. Perna (ntperna@wisc.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Dickeya zeae Ech1591
CC   GOLD Stamp ID         :: Gi03523
CC   Temperature Range     :: Mesophile
CC   Biotic Relationship   :: Free living
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4813854
FT                   /organism="Dickeya chrysanthemi Ech1591"
FT                   /strain="Ech1591"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:561229"
FT   gene            35..1429
FT                   /locus_tag="Dd1591_0001"
FT   CDS_pept        35..1429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: eca:ECA4441 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04895"
FT                   /db_xref="GOA:C6CFF4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFF4"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACT04895.1"
FT                   /translation="MSLSLWQQCLARLQDELPATEFSMWIRPLQAELSDNTLALYAPNR
FT                   FVLDWVRDKYINNINGLLNDFCGMDAPLLRFEVGSKPATPAAVSAGNGSHNAAVAAPQA
FT                   RVASPVRPSWETPVAPTEHTYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAYN
FT                   PLFLYGGTGLGKTHLLHAVGNGIMARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRY
FT                   YRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKS
FT                   RFGWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRV
FT                   IANANFTGRSITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRS
FT                   VARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNL
FT                   IRTLSS"
FT   gene            1434..2534
FT                   /locus_tag="Dd1591_0002"
FT   CDS_pept        1434..2534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: eca:ECA4440 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04896"
FT                   /db_xref="GOA:C6CFF5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFF5"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACT04896.1"
FT                   /translation="MKFIVEREHLLKPLQQVSSPLGGRPTLPILGNLLLQVSEGRLSLT
FT                   GTDLEMEMVAHLALTQPHEPGATTVPARKLFDICRGLPDGAEITVTLEGDRMLVRSGRS
FT                   RFSLSTLPATDFPNLDDWQSEVEFTLPQATLKRLIEATQFSMAHQDVRYYLNGMLFETG
FT                   GEELRTVATDGHRLAVCAMPVGQSLPSHSVIVPRKGVMELVRLLDGGDTPLQLQIGSNN
FT                   IRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEASCDLLRQAFSRAAILSNEKFRGV
FT                   RLYLNQNQLRITANNPEQEEAEEILDVEYGGTEMEIGFNVSYVLDVLNALKCEEVRMLL
FT                   TDSVSSVQLEDAASQAAAYVVMPMRL"
FT   gene            2675..3760
FT                   /locus_tag="Dd1591_0003"
FT   CDS_pept        2675..3760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: eca:ECA4439 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04897"
FT                   /db_xref="GOA:C6CFF6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFF6"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACT04897.1"
FT                   /translation="MALTRLLIRDFRNIESADLALIPGFNFLVGANGSGKTSVLEAIYT
FT                   LGHGRAFRSIQAARVIRHEQAEFILHGRIEGQERERSVGLSKNRDGDSTVRIDGSDGHK
FT                   VAELAQLLPIQLITPEGFTLLNGGPKYRRAFLDWGCFHNEPGFFSAWSNLKRLLRQRNA
FT                   ALRQVSHYGQLRAWDRELVPLAEGISRWRAEYSSAIAADIGSTCAQFLPEFSLSFSFQR
FT                   GWDKESDYAELLERHFERDRQLGYTALGPHKADFRIRAGGVAVEDMLSRGQLKLLMCAL
FT                   RLAQGEFLTRQNGLKCLYLIDDFASELDSTRRRLLAERLKATQAQVFVSAITAEQISDM
FT                   VGENGKMFRVEQGKITVQSQD"
FT   gene            3778..6189
FT                   /locus_tag="Dd1591_0004"
FT   CDS_pept        3778..6189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: spe:Spro_0035 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04898"
FT                   /db_xref="GOA:C6CFF7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFF7"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACT04898.1"
FT                   /translation="MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGYCKDIVVTIHADNSVSVQDDGRGIPTGIHEEEGVSAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLELVIRREGKIHRQEYKHGEPQAPLGVIGDADAT
FT                   GTTVRFWPSLETFTNVVEFEYDILAKRLRELSFLNSGVSIRLRDEREANKADHFHYEGG
FT                   IKAFVEYLNRNKTPIHPQVFYFSAEKDDIGVEIAMQWNDGFQENIYCFTNNIPQRDGGT
FT                   HLAGFRAAMTRTLNNYMDKEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFSSQTKDK
FT                   LVSSEVKSAVESLMNDRLVDYLMENPNDAKIVVGKIIDAARAREAARKAREMTRRKGAL
FT                   DLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFYR
FT                   QMPEIVERGHVFIAQPPLYKVKKGKQEQYIKDDEAMDQYQIMLALDGATLHTNAHAPAL
FT                   AGEPLEKLVAGHYGVQKLIDRMERRYPRALLNALIYQPSLTETMLNSQAEAQSWMEALI
FT                   QYLNEKEQHGSTYSFILRQVNERHEPVLRVRTHGVDSDYALDLAFVQGNEYRKINGLGE
FT                   KLRGLIEDGAFVERGERKQPVVSFEQALDWLVKESRRGLAVQRYKGLGEMNPEQLWETT
FT                   MDPESRRMLRVTVKDAIAADELFTTLMGDAVEPRRAFIEENALKAANIDI"
FT   gene            complement(6266..7450)
FT                   /locus_tag="Dd1591_0005"
FT   CDS_pept        complement(6266..7450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0005"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA4437 MFS efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04899"
FT                   /db_xref="GOA:C6CFF8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFF8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACT04899.1"
FT                   /translation="MKINKLPLLAQVSAAHWVSHFHMMVLPALMPLISAQRGISYVEMG
FT                   FALGVFNIVSALVQTPIGFAVDRIGPRRTLIAGLTLGSLCFLSLGFFTSYSWMLTAMAL
FT                   AGLANAVYHPSDYALLSRGIAENRMGRAFSVHTFSGFLGTAVAPAILLTAAAFTSIEFA
FT                   LVLSGLFGLLTVPMLLGEHEALPAATAHDKKAAAPKVAVFTLPILSLLVLFMLLNLSTN
FT                   SIQNFSVTALVNGYGMPLTEANLALTAFLFTSAFGVLAGGSLADKTRHHGLVATGSLVV
FT                   TAVLVAIVAASTLPSLATTLILGVAGFLSGIIAPSRDMLVRAASPAGAEGRVFGVVTTG
FT                   FNIGGAGGPVVFGWFLDQGHPSAIFWSAVIFMVITAVMALAQEWYSNRQRALTV"
FT   gene            complement(7640..8392)
FT                   /locus_tag="Dd1591_0006"
FT   CDS_pept        complement(7640..8392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0006"
FT                   /product="protein of unknown function DUF548"
FT                   /note="PFAM: protein of unknown function DUF548; KEGG:
FT                   eca:ECA0054 putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04900"
FT                   /db_xref="GOA:C6CFF9"
FT                   /db_xref="InterPro:IPR007536"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFF9"
FT                   /inference="protein motif:PFAM:PF04445"
FT                   /protein_id="ACT04900.1"
FT                   /translation="MKIALLTEAGADPEALAVLAQRWGLENDADAMLALVLTPERLELR
FT                   KCDEPKLGAICVDFVSGAMAHRRRFGGGRGEAVAKAVGIKKDYLPDVVDATAGLGRDAF
FT                   VLAALGCRVRMVERHPVVAALLDDGLQRGYQDPEIGGWLQQRLTLLHASSIDALSAITP
FT                   PPDVVYLDPMFPHRQKSALVKKEMRVFQSLVGADDDADALLEPARRLAKKRVVIKRPDY
FT                   APPLAGIPAQSALETKSHRFDFYLPMAQ"
FT   gene            complement(8389..10431)
FT                   /locus_tag="Dd1591_0007"
FT   CDS_pept        complement(8389..10431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0007"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: eca:ECA0055 oligopeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04901"
FT                   /db_xref="GOA:C6CFG0"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFG0"
FT                   /inference="protein motif:PRIAM:3.4.24.70"
FT                   /protein_id="ACT04901.1"
FT                   /translation="MTNPLLSAFTLPPFSQIQIEHILPAVQAALNDCRQTVERVVAQPG
FT                   PFTWDNLCQPLAESDDRLGRIFSPISHLNSVKNSPELRSAYEQCLPLLSEYGTWVGQHA
FT                   GLYRAYRELRDGEHYTNLSIAQKKAVDNALRDFELSGIALPPEQQKRYGDIASRLSELG
FT                   SQFSNNVLDATMGWTKLITDVSELEGLPESALAAAKALAEAKEQQGWLLTLDIPSYLPV
FT                   MTYCSNQALREEMYRAYVTRASEQGPNAGKWDNDEVMAETLALRHELAQLLGFTSFADK
FT                   SLATKMAENPQQVLDFLTDLAKRARPQGEQELAQLRAFAKQHFSVDELNPWDITYYAEQ
FT                   QKQHRYSISDEQLRPYFPEPRVLEGLFEVVKRIYGITAKERQGVDVWHPEVRFFDLFDE
FT                   NGELLGSFYLDLYAREHKRGGAWMDDCVGRLRKADGELQKPVAYLTCNFNRPVNGKPAL
FT                   FTHDEVTTLFHEFGHGLHHMLTRIDTAGVSGINGVPWDAVELPSQFMENWCWEPDALAF
FT                   ISGHYETGEPLPQDMLDKMLAAKNYQAALFILRQLELGLFDFRLHAGYNPATGARVLET
FT                   LAEIKAQVSVVKSPEWNRFPHSFSHIFAGGYAAGYYSYLWADVLAADAFSRFEEEGIFN
FT                   RDTGQSFLENILSRGGSEEPMELFKRFRGREPQLDAMLKHYGIQG"
FT   gene            complement(10557..10841)
FT                   /locus_tag="Dd1591_0008"
FT   CDS_pept        complement(10557..10841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04902"
FT                   /db_xref="InterPro:IPR022574"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFG1"
FT                   /inference="similar to AA sequence:KEGG:ECA0060"
FT                   /protein_id="ACT04902.1"
FT                   /translation="MKNHFGDGILAGLHASTPQSMSDIRHYCDDYRRGYVCGYAHQRAS
FT                   LRGRQQAAFEAGQLCRRYGLMRDIVAEFFSDVSNPSLIAWFYAGYDQPS"
FT   gene            11228..12070
FT                   /locus_tag="Dd1591_0009"
FT   CDS_pept        11228..12070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0009"
FT                   /product="protein of unknown function DUF519"
FT                   /note="PFAM: protein of unknown function DUF519; KEGG:
FT                   eca:ECA0061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04903"
FT                   /db_xref="GOA:C6CFG2"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFG2"
FT                   /inference="protein motif:PFAM:PF04378"
FT                   /protein_id="ACT04903.1"
FT                   /translation="MLSYRHSFHAGNHADVLKHTVQSLIINALKEKDKPFLYLDTHSGA
FT                   GRYQLQSEHAERTGEYLDGIGRIWQRDDIPAELEPYMQVVRSYNSGDKLRYYPGSPLIA
FT                   RQLLREYDKIHLTELHPSDFPLLRQEFLRDDRARVVREDGYQQLKAQLPPLSRRGLILI
FT                   DPPYELKTDYQAVVKGIQEGYRRFATGVFALWYPVVLRQHIKRLLKDLEDTGIRRILQI
FT                   ELAVLPDSDRHGMTASGMIVINPPWKLESQMKSVLPWLHQALVPAGTGHALVEWVVPE"
FT   gene            complement(12106..13020)
FT                   /locus_tag="Dd1591_0010"
FT   CDS_pept        complement(12106..13020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0010"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="KEGG: eta:ETA_33250 ribonuclease Z; TIGRFAM:
FT                   ribonuclease Z; PFAM: beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04904"
FT                   /db_xref="GOA:C6CFG3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFG3"
FT                   /inference="protein motif:TFAM:TIGR02651"
FT                   /protein_id="ACT04904.1"
FT                   /translation="MELIFLGTNAGVPTKERNVTSIALDLHGIRPAFWLFDCGEGTQHQ
FT                   ILRTPIKPGKLEKIFITHLHGDHLFGLPGLLCSRSMAGVETPLTLYGPAGLKTFVETAL
FT                   TLSGSWLTYPLEVVEVVPGTVFEDHQFRVTAHELSHTLYCVGYRIEERPKPGPLDVEKL
FT                   AAQGIKPGAYFQQLKRGETVTLDDGRVLNGWDYLGPGLPGKSLAIFGDTRPTPEALKLA
FT                   AGVDVMVHEATLEGAMAERANERGHSTTLQTAAAARDAGAKRLIITHFSARYGQADLER
FT                   LRQECQTLFPATEVATDLATFRV"
FT   gene            complement(13031..14620)
FT                   /locus_tag="Dd1591_0011"
FT   CDS_pept        complement(13031..14620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0011"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="PFAM: regulator of RNA terminal phosphate cyclase;
FT                   sigma-54 factor interaction domain-containing protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase; KEGG: esa:ESA_00062 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04905"
FT                   /db_xref="GOA:C6CFG4"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009715"
FT                   /db_xref="InterPro:IPR017183"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFG4"
FT                   /inference="protein motif:PFAM:PF06956"
FT                   /protein_id="ACT04905.1"
FT                   /translation="MKRRVMIGVLGTALDKRGKRQNRWNRWRPTIAACQQPDLPIDRLE
FT                   LLYQPRSLGLAQQVQEDISQISPSTTVNLHEVELADPWDFEEVYTTFLDFAAHYPFDTE
FT                   NEEYLVHITTGTHVVQICWFLLTEARYLPARLLQTSPSDHDDATPSPAGQYTVIDLDLS
FT                   RYTAITSRFLREQQASVSFLKAGIATRNATFNRIIDQIERVALRSSAPILLTGPTGAGK
FT                   SFLANRIYQLKASRHQVNGKFVAVNCATLRGDNAMSTLFGHVRGAFTGAQQSRAGLLRE
FT                   ADGGILFLDEIGELGPDEQAMLLKAIEEKRFLPFGSDKEVSSDFQLIAGTHRDMPHWVE
FT                   AGYFREDLYARINMWTFPLPGLAQRCEDIEPNLDFELHRFAQQQQIQVRFDKEARQRFL
FT                   AFACSEHASWRGNFRELGASVHRMATLSEQGRINTVLVDEEIQRLKQQWRSTTANTILP
FT                   AHLGELDIFEQCQLERVLEVCRQTHSLSEAGRTLFAVSRRQKKQPNDADRLRKYLARFG
FT                   LSWDDVKNTASI"
FT   gene            14875..15768
FT                   /locus_tag="Dd1591_0012"
FT   CDS_pept        14875..15768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0012"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: ect:ECIAI39_4422
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04906"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFG5"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACT04906.1"
FT                   /translation="MFKKITIRKGQLGLLSQNGNVRRVLETGAHIVLGWPRKRTVAFIE
FT                   QDGSRVETALAEHLRRFHPEWVARYCLSADMADDEIGLRYDREHLCEILPPGTRRLYWR
FT                   RDEQQAIERISVNETQVPARLLPAFMQPDLRGQVVAGEAGVLVAAVPTWHVGILHLNGQ
FT                   PSALLPPGNHGYWRFNRSVSVTMVDTRLQALDVEDIEVLTADRISVRLTLLANWRYSDV
FT                   LAAFTQLAQPEAHLCRALQVVLRDVVGMHTFDELLNRKHTVGAQVSEQLEQQLTGYGIA
FT                   LLSLAVMDTAGYNAAW"
FT   gene            15836..17059
FT                   /locus_tag="Dd1591_0013"
FT   CDS_pept        15836..17059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0013"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   plu:plu4307 protein RtcB"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04907"
FT                   /db_xref="GOA:C6CFG6"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFG6"
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /protein_id="ACT04907.1"
FT                   /translation="MHNDYQVLDAPHGVPVKMWTHGVPVEPEAREQLLNTAKMPFIFSH
FT                   LAVMPDVHVGKGSTIGSVIPTRGAIIPAAVGVDIGCGMMAVRTSLLAADLPDNLLGIRS
FT                   AIEQAVPHGRSVNRGGRDKGAWHQPPPRVDAHWRQLDAGFKRITEHYPSLLKTNNYHHL
FT                   GTLGTGNHFIELCLDEADRVWVMLHSGSRGIGNAIGNLFITLAQQDMRQHIANLPDRNL
FT                   AYFAEGSRHFDDYMYAVGWAQGYARHNREVMMEQVLQALAQAIPRPFTARQEAVDCHHN
FT                   YVQQETHFGEPVLVTRKGAVSAHRGQMGIIPGSMGAKSFIVRGLGNQESFCSCSHGAGR
FT                   TMSRTAAKKRFTVEDHIQATVHVECRKDHDVIDEIPMAYKDIDAVMAAQASLVEIVHTL
FT                   RQVVCVKG"
FT   gene            17448..18800
FT                   /locus_tag="Dd1591_0014"
FT   CDS_pept        17448..18800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0014"
FT                   /product="glutathione-disulfide reductase"
FT                   /note="TIGRFAM: glutathione-disulfide reductase; PFAM:
FT                   pyridine nucleotide-disulphide oxidoreductase dimerisation
FT                   region; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: eca:ECA0062 glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04908"
FT                   /db_xref="GOA:C6CFG7"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006322"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFG7"
FT                   /inference="protein motif:TFAM:TIGR01421"
FT                   /protein_id="ACT04908.1"
FT                   /translation="MTRHYDYLAIGGGSGGIASINRAAMYGKKCALIEAKHLGGTCVNV
FT                   GCVPKKVMWYAAQIAEAIHHYGPDYGFDVTVNRFNWDTLLKNRSAYIDRIHQSYNNVLG
FT                   KNQVDVIQGFARFVDAKTVEVNGERITADHILIATGGRPTRPDIPGAEYGIDSDGFFEL
FT                   TALPPRVAVVGAGYIAVEIAGVLNALGSDVHLFVRKHAPLRQFDPLIVETLVEVMNTEG
FT                   PALHTESIPKAVVKNADGSLTLQLESGHEHTVDCLIWAIGREPANDKVNLEAAGVALNN
FT                   KGYIVVDKFQNTTVPGIYAVGDNTGAVELTPVAVAAGRRLSERLFNNKPDEHLDYSNIP
FT                   TVVFSHPPIGTIGLTEPQAREQYGDDQVKVYKSAFTAMYTAVTQHRQPCRMKLVCVGPE
FT                   EKIVGVHGIGFGMDEILQGFAVAVKMGATKKDFDNTVAIHPTAAEEFVTMR"
FT   gene            19275..20690
FT                   /locus_tag="Dd1591_0015"
FT   CDS_pept        19275..20690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0015"
FT                   /product="membrane bound O-acyl transferase MBOAT family
FT                   protein"
FT                   /note="PFAM: membrane bound O-acyl transferase MBOAT family
FT                   protein; KEGG: esa:ESA_00303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04909"
FT                   /db_xref="GOA:C6CFG8"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="InterPro:IPR024194"
FT                   /db_xref="InterPro:IPR028362"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFG8"
FT                   /inference="protein motif:PFAM:PF03062"
FT                   /protein_id="ACT04909.1"
FT                   /translation="MVTLMNFLSVEFSFFFLVFFLIYWLVSPWVKVQNIILLVTSYGLV
FT                   LLSSWQSLTVLLLFSACTFFLLKLAANDEFRKISVYLLMFFTIIFFIMFKYYAGLRDDL
FT                   QAMLSEYHVAINLPVLNVLLPIGLSFYIFNAVSLIVSVAKGEIKQSNIFNTLLYLNFFP
FT                   TFLSGPINRATRLLPQIETKHRRQLKEWPRALFLITLAIAKLFLLNEWLDENYVSSVFI
FT                   DPGNYTGWQCLLATYAWAWQIYFNFSGYTNLVTGIAILLGFHIDINFSHPYVAGNIKDF
FT                   WHRWHISLSSFIRDYIYIPLGGSRQGWWHTQLNIFIAMVLSGIWHGTSITFLIWGGIHG
FT                   LGLIAYNFWVKYRQAKKIIPLPGVIARLLTLHFVCLAWIFFRAGTVHDALHMLRVISTA
FT                   DVAQLTVSDRWGIAGFIVLSIIYPSLITLRENIANTLRRLEWYVVPFVIFSFLSLVFFF
FT                   SPSGVPGFIYANF"
FT   gene            20677..21735
FT                   /locus_tag="Dd1591_0016"
FT   CDS_pept        20677..21735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: esa:ESA_00304 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04910"
FT                   /db_xref="GOA:C6CFG9"
FT                   /db_xref="InterPro:IPR007407"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFG9"
FT                   /inference="similar to AA sequence:KEGG:ESA_00304"
FT                   /protein_id="ACT04910.1"
FT                   /translation="MQTSEYRTMLAHVFKSLLVILSCMVGLIWLDQQSINSYWELHFHT
FT                   KSPWDGITSPSWVFGDRLMQASQAAKDSFVESLASGPDGSTQQSIPDDASVTPRPIAHR
FT                   EKPLPSAAVKEPANNVDSNSASGAASADSHVILKTGQAVLFIGDSMMEGVAPHVIKMLR
FT                   DRYSVAGIDLSKRSTGLTYPHFFNWPLILSRELEKRQDIGVLVVFLGSNDPWDMPSGNG
FT                   KNFLKFESPAWESAYRDRIRSILHSAREKRISVIWISPPNVENKKLNHGINYINDLFES
FT                   EVKAGNEISIRVNEIFGYQREVYSPDMEKNKAKVRIRTNDGVHFSLTGQKMIAERIFSK
FT                   INVKPSLNEINH"
FT   gene            21773..22951
FT                   /locus_tag="Dd1591_0017"
FT   CDS_pept        21773..22951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: esa:ESA_00305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04911"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFH0"
FT                   /inference="similar to AA sequence:KEGG:ESA_00305"
FT                   /protein_id="ACT04911.1"
FT                   /translation="MLMTLCLIQLTSCSRENNNVPQTTTFPMGGENGIQLIDYGDPGLQ
FT                   RLKRKLNHSDKEKIHILQLGDSHTASDFFSGQLRRHFKQQYGDGGVGFISPLAISGNRF
FT                   DNVLFSNANGWDMVTSRKTTNAGFTLGGNIATPRRDNNDAELVVRDTDPAFLMQALYRN
FT                   QANGKIQIQHQTIVLPCSQSRWVLSQPVTVQSPVRYSLAPSGGSQLAGWLLSSSHRGGV
FT                   MLSALGINGARVSMLDKWRDNWLSTLQMLKPDMVVMAYGTNEAFDQQLDIQRYQQNYSE
FT                   YVQAIRRVLPEAVILLVGPGSSISNKNGASCRQHQPVLLKPVIQAQREVAQSYHTLFWS
FT                   WFDYMGGDCAIERWQQQGIARPDLIHLTQQGYQRSADALWRQFVALLNATQE"
FT   gene            complement(22994..23641)
FT                   /locus_tag="Dd1591_0018"
FT   CDS_pept        complement(22994..23641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0018"
FT                   /product="protein of unknown function DUF161"
FT                   /note="PFAM: protein of unknown function DUF161; KEGG:
FT                   ppu:PP_0642 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04912"
FT                   /db_xref="GOA:C6CFH1"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFH1"
FT                   /inference="protein motif:PFAM:PF02588"
FT                   /protein_id="ACT04912.1"
FT                   /translation="MLKDSAALPNTAETSQKLALAHTLKDDVYGLILGVMFIAIGLNLL
FT                   KLSGMITGGIAGIALLLSYVVPLSIGVLFILTNIPFMIFCYFSMGRAFTLKTLIVNIAL
FT                   SLATQTVPGLLTIDYVHPLFSALVGGTFLGMGILSLARHNASVGGTGVLTLWLYKRFNI
FT                   NAGKSQMLLDVLVFAISMLTMPISLLLWSALSALAMNAMLMNWHKPGRYQGG"
FT   gene            23842..24312
FT                   /locus_tag="Dd1591_0019"
FT   CDS_pept        23842..24312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0019"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: reu:Reut_C6217
FT                   AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04913"
FT                   /db_xref="GOA:C6CFH2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFH2"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACT04913.1"
FT                   /translation="MKIDRIDAQILNELQQDARLKTTELAERVCLSATPCTRRLKQLED
FT                   AGMIDRYVTLLDQEKAGFPVNAYISLTLEPKSEATFRKFEQQIATFDEVMECHLMSGSH
FT                   DFMLRVVAASLSDFEKFLQKKLIKIEGLRDVQSSFSLRRLIHKTALPVKATV"
FT   gene            complement(24315..25436)
FT                   /locus_tag="Dd1591_0020"
FT   CDS_pept        complement(24315..25436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0020"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG: pzu:PHZ_c3273
FT                   phosphoserine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04914"
FT                   /db_xref="GOA:C6CFH3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFH3"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACT04914.1"
FT                   /translation="MAITLPEALIPADPRFGCGPSLIQLDDLTRLKDKGPHLLGTSHRK
FT                   EPVRALCREIQQGLQDYLSVPDDYSIVLGNGGATVLFDMVGLGLVRKRIIHHTCGEFSE
FT                   KWFKASRRIPWIQADNVTVEYGQANTAFVTEGADVVACTLNETSTGVMNTRLPEVGEDC
FT                   LLAVDATSGAGQIACDLSRVDVFFFSPQKVFASEGGLFIAILSPKAKARIAEIAADPSR
FT                   YIPAFADWRLALSNSEQQQTYNTPAVVTLFLFAEQVKRMKALGFAEVERQAAEKAELLY
FT                   QWAAERDYLSAYVADPACRSTTVAAIDVADSISVDKLTRYLDEQGLAHGIEGYRALGRN
FT                   QLRIALFHNIAFDDLKTLTALIDFLVASGEFAA"
FT   gene            25671..26108
FT                   /locus_tag="Dd1591_0021"
FT   CDS_pept        25671..26108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0021"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   spe:Spro_2129 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04915"
FT                   /db_xref="GOA:C6CFH4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFH4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACT04915.1"
FT                   /translation="MSAQWEQENYQVSTDPQRLDLDIIHGYLATSSWAEGIDRETVALS
FT                   IANSLCFGLYHQARQIGFARMVTDFATFGYLCDVFVLPNYQGAGLGRFLVECTVNHPRL
FT                   QRLRRQLLLTSTAPWLYQKVGYEPINRQDYTWTFLRKDIYI"
FT   gene            complement(26161..26601)
FT                   /locus_tag="Dd1591_0022"
FT   CDS_pept        complement(26161..26601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0022"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: dac:Daci_0312 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04916"
FT                   /db_xref="GOA:C6CFH5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFH5"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACT04916.1"
FT                   /translation="MHDTLDTQTFELLGEVIHGVKQRLQESDALTQTGLAPFQARTLGL
FT                   IAHHPGQSQHFLAQYMGRDKAQIARLLKELETLGLITRQPSPTDRRAQVVSLTKKGEDT
FT                   HRRFAQARTELLQRAFVDVTPEERRQFAQVLQKMKANLIASE"
FT   gene            26710..27000
FT                   /locus_tag="Dd1591_0023"
FT   CDS_pept        26710..27000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ypg:YpAngola_A3875 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04917"
FT                   /db_xref="InterPro:IPR024476"
FT                   /db_xref="InterPro:IPR038194"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFH6"
FT                   /inference="similar to AA sequence:KEGG:YpAngola_A3875"
FT                   /protein_id="ACT04917.1"
FT                   /translation="MPYHYRITLEKLTDNRDETPQNHALTFDATNHDDILEIIEKVRLK
FT                   GILPDSEVAAFCTGLKLFSEVMMTHRKEDLFRDLAPAFRDFMLRLKRGETA"
FT   gene            27141..28109
FT                   /locus_tag="Dd1591_0024"
FT   CDS_pept        27141..28109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0024"
FT                   /product="glucokinase"
FT                   /EC_number="2.7.1.2"
FT                   /note="KEGG: yen:YE1225 glucokinase; TIGRFAM: glucokinase;
FT                   PFAM: Glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04918"
FT                   /db_xref="GOA:C6CFH7"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFH7"
FT                   /inference="protein motif:TFAM:TIGR00749"
FT                   /protein_id="ACT04918.1"
FT                   /translation="MHQYALVGDVGGTNARLALCELANGKLSHSKQYAVQQHDSLEEAI
FT                   RLFLAEHAELTIKEACIAIACPVTDDWVEMTNHHWAFSIAAMRQSLGFERLAVINDFTA
FT                   VSMAIPALTQEDVIQLGGAAPVAGKPVAVYGAGTGLGVAHLLPVDGKWLSLPGEGGHVD
FT                   FAPNSEEEDILLQVLRQELGHVSAERVLSGPGLVNIYRAIVKADDRVPEALTPQIVSER
FT                   ALAHSDVDCLRALSLFCVLMGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFRNSGFRSA
FT                   FEDKGRFRDYLADIPVFMISHPQPGLLGAGAYLRQALGQTL"
FT   gene            complement(28518..29405)
FT                   /locus_tag="Dd1591_0025"
FT   CDS_pept        complement(28518..29405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0025"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: cak:Caul_0574 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04919"
FT                   /db_xref="GOA:C6CFT6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFT6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACT04919.1"
FT                   /translation="MKREDLPDLMAFLIIVQEGSFRKAAAKLHVSPSGLSHAMRRLEAR
FT                   LGFPLLLRTTRSMTPTSAGSDLAASLEIAFGEIDRELRELADRKGQVAGTVRINVHRTA
FT                   ADLFVLPKLSTLQERHPGVKVELVIDDGLTDIIAAGCHAGIRNGKLLANDMVAVRISGE
FT                   HRTAVVGSPAYLSRHPTPNTPEDLRDHRCIGYRFVTSRSLHRWRFLRGDQDLLTDFEPA
FT                   LIVDDIQVVVRAALQGLGLAYTLREAVAEHVENQTLVEVLKDWSTPVAADYLYYPSRGT
FT                   VSPELRAVIEHLRI"
FT   gene            29507..30526
FT                   /locus_tag="Dd1591_0026"
FT   CDS_pept        29507..30526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0026"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   nar:Saro_1864 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04920"
FT                   /db_xref="GOA:C6CFT7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFT7"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACT04920.1"
FT                   /translation="MKRWIVSAGSTYERGLVMQEVARPEPGVGEVLVRVDAVSLNARDQ
FT                   LLLRGTFVTLPRDFVPVSDGAGEIVAIGAGVNGWAVGDKVTGILRNWVDGPPIQGQGWG
FT                   LGSPDEDGMLAEYVVLRAERIALAPKTLTPEEAACLPCAALTAWTALNGDRPYRSPVSK
FT                   GDKVLATGTGAVALFSVLFATAVGAEAVVTTSRDGKSEQSRALGAIDVINYKTHSNWGS
FT                   MAFERFGGFQRVVNAGGGSELDQAIAALAPGGEIAYMGLYTHASAPPNFIALMIKGATI
FT                   RGISVGSAMAYRDMVDFIDTHEIKPPIAKTFAMSEAAAAYELAASGEPFGKVVIRVAG"
FT   gene            30538..30732
FT                   /pseudo
FT                   /locus_tag="Dd1591_0027"
FT   gene            complement(31185..32303)
FT                   /locus_tag="Dd1591_0028"
FT   CDS_pept        complement(31185..32303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0028"
FT                   /product="uncharacterized peroxidase-related enzyme"
FT                   /note="TIGRFAM: uncharacterized peroxidase-related enzyme;
FT                   alkylhydroperoxidase like protein, AhpD family; PFAM:
FT                   Carboxymuconolactone decarboxylase; KEGG: eca:ECA0070
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04921"
FT                   /db_xref="GOA:C6CFT8"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR023923"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFT8"
FT                   /inference="protein motif:TFAM:TIGR01926"
FT                   /protein_id="ACT04921.1"
FT                   /translation="MTQSTSDILDTLAEIAPNSPLAQARATRDAATRHTQGSYDALFSQ
FT                   TTGDALPLALRFFIAEQVSGWHQNTRLQQFYAQRLADFPPPAPGAALDRALEHAERLAY
FT                   QPVAAQPEQLQTLQQAGWAVDDIVTLSQLVAFVSFQSRLLHGYRLLAGHAEEPAPAAPA
FT                   AVAGRWHTQPLTHSGKTAPDAFTQGELGWEPWVPAKPLAAFTADEQAILARFGHTDSDY
FT                   FRLLGRNLPVLEQRTLTDKGIFYTSGGLPRKDRELAAAVVSKINGCIYCASVHARKASQ
FT                   LSKQDDAVQRLLDVPPGGDIAAGQDARWQAIIAFAARLSTTPSQVNAQDLARLREQGLD
FT                   TLDILDLIQSTAFFAWANRLMLTLGEPFWPLR"
FT   gene            complement(32300..33340)
FT                   /locus_tag="Dd1591_0029"
FT   CDS_pept        complement(32300..33340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0029"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   eca:ECA0071 putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04922"
FT                   /db_xref="GOA:C6CFT9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR024003"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFT9"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACT04922.1"
FT                   /translation="MTQKRLGFFTRLLDDVPAGQRYRLAAEQIIKAEQLGFDSAWVAQH
FT                   HFHADEGGLPSPLVFLAQVAAQTRRIRLGTGVITLPMEQPLRVAEDTAVLDLLSNGRLE
FT                   VGIGSGGTPSSFTAFGHNSEQRGEILSRYLAQVRAAWAGEPLSADGNQLYPAAPHLNRR
FT                   VWQATFSVEGAIRAGQAGDGLMLSRTQPRPDGFPDATLADLQNPMIDAYLEALPPGVTP
FT                   RIMGSRSVFVADDRALALQLAQTGLQRSAARLAQLGRPARNGSVEELIASFDSHVGTPD
FT                   DVIASLQADGSLARTTDLAFQVHSIDPPHAHILRSLELIAVRVAPALGWSPAKDKHISP
FT                   AGQEVA"
FT   gene            complement(33343..35019)
FT                   /locus_tag="Dd1591_0030"
FT   CDS_pept        complement(33343..35019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0030"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA0072 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04923"
FT                   /db_xref="GOA:C6CFU0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFU0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT04923.1"
FT                   /translation="MSLPLSLQSSTTIPVLELEDVAIAYRHDDGERTVVEGVSFAIQPG
FT                   EVVALVGESGSGKTTTAQAVIGLLADNGRLTRGAIRLNGTDISRWSQPRLDSIRGRVVS
FT                   LVPQDPGSSLNPVKTIGEQVDEILRLHQKADHRSLRRQTLTLLTRVGLTEPELRAGQYP
FT                   HELSGGMKQRVLIAIAIALKPALIIADEPTSALDVTVQKRILDLLDELRRENGTAILFV
FT                   THDLGVAAERADRLLVFQKGYIQEQGPTQQVLGAPQSQYARTLLANIPSLAPARRPSRA
FT                   AGQPAALAQPIVQVEQLVQEFPLTGNRKQPFRAVDAVSFSVAPGTTHAIVGESGSGKTT
FT                   TARMILGFQRPTAGRILIDGTDITQLRGEALRQFRQTIQLVYQNPFSSLDPSQRLFDIV
FT                   EEPLRNFNRHSRTERVNQVHEMFERVALPASLLQRRPLELSGGQRQRVAIARALVLEPK
FT                   VLVLDEAVSALDVTVQAQILRLLEELQTSLGLTYLFISHDLAVVRQIADTVSVLYHGKQ
FT                   VESGPVGQIFARPTERYTRELIDAIPGQRHVSQGTQPKPRI"
FT   gene            complement(35016..35876)
FT                   /locus_tag="Dd1591_0031"
FT   CDS_pept        complement(35016..35876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0031"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA0073 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04924"
FT                   /db_xref="GOA:C6CFU1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFU1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT04924.1"
FT                   /translation="MASIQLEKIAFPLLRKTPRLRRYVAQPGLALAWLVLLTVTLWALF
FT                   PGLFTHASPIEGVSGAQRLAPGGDYLLGTDQLGRDLYTRIVYGSAHSLSGAVIAVSLGL
FT                   VLGSLLGLLAGAVGGRLDTVVMRSVDVLLAIPGLLLALSVIILLGFGNLNAAIAVGVTS
FT                   VANFTRLVRAEVLRVRRSDYVEAAFGSGGTFFGVLWRHILPNSLTSVLAFAALQFGSAI
FT                   LALATLSFLGYGAPPPTPEWGLLIAEGRNYLATAWWLTTFPGLLVVAVVLATNRISQSI
FT                   RRSTR"
FT   sig_peptide     complement(35718..35876)
FT                   /locus_tag="Dd1591_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.670) with cleavage site probability 0.586 at
FT                   residue 53"
FT   gene            complement(35878..36819)
FT                   /locus_tag="Dd1591_0032"
FT   CDS_pept        complement(35878..36819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0032"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA0074 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04925"
FT                   /db_xref="GOA:C6CFU2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFU2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT04925.1"
FT                   /translation="MRISYLATRLGQALLVLWAAFTLSFILLQALPGDAVLIKFMSPEL
FT                   GLSASQVAELRLAYGADVPLLTQYAASLSRLLHGDFGLSLQAGLPISDLLATNLPPTLL
FT                   LAVLGFGAALLLAFALAFLSALTPFAWLRQLFQSAPSLLISIPTFWLGIVLIQVFSFRL
FT                   GWISVINPGEWEGLILPVLTLSVPIAAPIAQVLMHSIDQVLAQPFVAVARAKGLSRRGV
FT                   LWRHVARNAMLPALTLAGLLLGELIAGALVTETVFGRSGLGQLTQEAVNTQDASVLQAI
FT                   VLVSATAFVAVNLLVDLLYPLLDPRLKTTPEV"
FT   sig_peptide     complement(36727..36819)
FT                   /locus_tag="Dd1591_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.860) with cleavage site probability 0.550 at
FT                   residue 31"
FT   gene            complement(36844..38487)
FT                   /locus_tag="Dd1591_0033"
FT   CDS_pept        complement(36844..38487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0033"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: eca:ECA0075 ABC-type transporter, substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04926"
FT                   /db_xref="GOA:C6CFU3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023920"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFU3"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACT04926.1"
FT                   /translation="MSGFSNARQKRGMGLLVSLVLLGGSAQTQAADNAPKTGGTLIYLE
FT                   QQPHTNLYPPAGGFYPNGGILNQITDKLTYQNPETLNIEPWIAESWTINVDSTEYTFKL
FT                   RPGVTFSDGTPLDANAVAKNFDTYGLGNKELNQPVSEVINNYQRSEVIDPLTVKFYFKK
FT                   PSPGFLQGTAAIGSGLVSLSTLARNFNQLGDATRIIGSGPFVVSSEKPGRELKLTARKD
FT                   YHWAPATFTHQGRPYLDGITYLVTPEDSVRIGALVSGQADFIRQIQAYDEKRVQSEGIR
FT                   IYAAPTRGVNNSVNFRPDNPLVADIRVRQALRYATNPKEIIQTLYSDNYPQATSVLAKT
FT                   AAGYVNLSDKLTFDPAAAARLLDDAGWKAGAQGIRQKDGQSLVLTAYESQPQPQNKEML
FT                   QLVAQQWAKVGVKLNVLAGDAGTKTLDSLDPLKTGVSPGMVGRADPDVLKSQYYPTLRN
FT                   VLLQKGGASDKVKTFEDTHLNTLLDGIASATDRSKRLALVSEVQNYLIDQAYVIPIFEE
FT                   PQVFAGRATTKGIGFEAVGRPSFYNTWLDK"
FT   sig_peptide     complement(38395..38487)
FT                   /locus_tag="Dd1591_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 31"
FT   gene            38815..39066
FT                   /locus_tag="Dd1591_0034"
FT   CDS_pept        38815..39066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0034"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   plu:plu4502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04927"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFU4"
FT                   /inference="protein motif:PFAM:PF07338"
FT                   /protein_id="ACT04927.1"
FT                   /translation="MNAIKNIVAVIALATVSFVTFAATEVQHSANPSVGTVSAIASTLD
FT                   GLQSSLSEKANAAGAKSFRIISATGNDNQLRGVAEIYN"
FT   sig_peptide     38815..38883
FT                   /locus_tag="Dd1591_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            complement(39224..40480)
FT                   /locus_tag="Dd1591_0035"
FT   CDS_pept        complement(39224..40480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0035"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   eca:ECA4386 valine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04928"
FT                   /db_xref="GOA:C6CFU5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFU5"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACT04928.1"
FT                   /translation="MNFSRFGNKFTRHAGITQLMDDLNDGLRTPGAIMLGGGNPAHIPA
FT                   MDDYFQQLCRDLLDQGKLTDALCNYDGPQGKDVLLHSLSGLLREQFGWEIGPQNIALTN
FT                   GSQSAFFYLFNLFAGQTDDGQRRRVLFPLAPEYIGYADSGLDEDMFVSVRPQIELLPAG
FT                   QFKYHVDFEQLRITDDIGMICVSRPTNPTGNVLTDEELLHLDALAREHQIPLVIDNAYG
FT                   VPFPGIIFSDATPLWNPNIILCMSLSKLGLPGSRCGIVIGSEHVIEALGNMNGIVSLAP
FT                   GSIGPALAHEMIQRGDLLRLSNDVVRPFYRQRVEQTLAIIRRYLPPEVCLIHKPEGAIF
FT                   LWLWFKDLPITTEVLYQRLKQRGVLMVPGHYFFPGLEQEWPHAHQCLRMNYVPEPEKIE
FT                   QGVAILAEEVERARQEGGV"
FT   gene            40873..42081
FT                   /locus_tag="Dd1591_0036"
FT   CDS_pept        40873..42081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0036"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04929"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFU6"
FT                   /inference="similar to AA sequence:KEGG:ECA4385"
FT                   /protein_id="ACT04929.1"
FT                   /translation="MKNVLAISIALALVSWQASAQTFVLTDVESSTEKGNWQISSDALK
FT                   IKDQRFSIEQKVLHGGRQEGSKILTITSPNGLQITLSPTRGMDLLHVTGKNIRLGWDSP
FT                   VDEVVNPNTITLEGRNGLGWLEGFNEMMVRCGYEWTGHPVTSDGMIYTLHGRAGNTPAS
FT                   KVMVDVSDKAPYTITVRGLLKENSFKKSNLETWTELRYVPGSESFTIHDVLTNKSDYAR
FT                   DYQIIYHSNFGTPILEEGARFLAPVKEISPFNDYAKAGLKSWQTYKGPTKGFDEMVFNM
FT                   TPYADKDGKTLAALVNRAGDKGVSIAFDTHQLPLLTLWKNTDTLKQGYVTGIEPGTNYA
FT                   YPVTIERQQGRVKKLQPGQSTTFELTYSLLSSPTAVQQTEQKVKAIQGDRTTTLTEKPI
FT                   AVE"
FT   sig_peptide     40873..40935
FT                   /locus_tag="Dd1591_0036"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 21"
FT   gene            42201..42482
FT                   /locus_tag="Dd1591_0037"
FT   CDS_pept        42201..42482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0037"
FT                   /product="virulence-associated protein D (VapD) conserved
FT                   region"
FT                   /note="PFAM: virulence-associated protein D (VapD)
FT                   conserved region; KEGG: hsm:HSM_1448 virulence-associated
FT                   protein D (VapD) region"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04930"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFU7"
FT                   /inference="protein motif:PFAM:PF04605"
FT                   /protein_id="ACT04930.1"
FT                   /translation="MYAISFDLSVAMLEQHYTGNSYNNAYGDIKRFLGTKGFNRQQGSV
FT                   YFGDETVDAVKTVMAVNAMSREFPWLRMCVSDIRMLRIEENNDLSPAL"
FT   gene            complement(42542..43504)
FT                   /locus_tag="Dd1591_0038"
FT   CDS_pept        complement(42542..43504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0038"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: eca:ECA0078 2-hydroxyacid
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04931"
FT                   /db_xref="GOA:C6CFU8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR023756"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFU8"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACT04931.1"
FT                   /translation="MKPEVILYKKIPDDLCRKLAQHVTLSVFDGLPPADHPVLARAEGL
FT                   IGAGHTVSRDYLSHLPKLRAVSTVSVGYDNIDLGALNEKKALLMHTPTVLTETVADTVL
FT                   TLMLMTARRAMESAERVKAGEWTRNIGEEWFGIDVHHKTIGILGMGRIGLAVAQRAHFG
FT                   FGMPVIYHARRRHEAVDTRFNARHCDLDTLLAESDFLCITLPLTPETHHLIGKAQLAKM
FT                   KSSAILINIGRGPVVDEQALIEALTEGTLHAAGLDVFEKEPLSVDSPLLKLPNVVALPH
FT                   IGSATHETRYNMAACAVDNLIAALNGNVKENCVNPGVLK"
FT   gene            complement(44061..44516)
FT                   /locus_tag="Dd1591_0039"
FT   CDS_pept        complement(44061..44516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0039"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   eca:ECA0081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04932"
FT                   /db_xref="GOA:C6CFU9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFU9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACT04932.1"
FT                   /translation="MIRPYRPQDLEPLVRLWRESTTLAHPFIAPRYWQESEELVRSHYI
FT                   PHSQTWVYERSQGIGGFISVMDQRFIGALFVHHSLYGQGVGAALMQHIQHRFPMLSLEV
FT                   YQQNHRACAFYRKQGFTTVQENYQHETQSRLLIMHWQDQALLASVLS"
FT   gene            complement(44513..45073)
FT                   /locus_tag="Dd1591_0040"
FT   CDS_pept        complement(44513..45073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0040"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="KEGG: eca:ECA0082 DNA-3-methyladenine glycosylase I;
FT                   TIGRFAM: DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04933"
FT                   /db_xref="GOA:C6CFV0"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFV0"
FT                   /inference="protein motif:TFAM:TIGR00624"
FT                   /protein_id="ACT04933.1"
FT                   /translation="MTRCGWVTQDTLYQDYHDNEWGKPCTDSRALFELLCLEGQQAGLS
FT                   WITVLKKREHYRHCFHGFDPHRVAAMTDDDVNRLVLDPGIIRHRGKIEAVIRNARAWLT
FT                   MQQQGEDFAAFIWSFVNHQPVINHPASLADVPAKTAVSDAMSKALKKRGFTFIGSTICY
FT                   AFMQAAGLVNDHTTDCCRHPEAS"
FT   gene            45311..46117
FT                   /locus_tag="Dd1591_0041"
FT   CDS_pept        45311..46117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0041"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   eca:ECA0083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04934"
FT                   /db_xref="GOA:C6CFV1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFV1"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACT04934.1"
FT                   /translation="MGIEWMLAYLALGAVVGFMAGLLGIGGGGIMVPVLTALFAAQGVE
FT                   TAHLVHLALGTSMAAIVITAISSLRTHHQHQAVLWTVVWRITPAILVGTFAATWLAALL
FT                   PTRALAIFFSCFMAYVSLQMVLNIKPKPNRQLPGVPGMSLAGLTIGGISALVAIGGGSL
FT                   TVPFLTWCNVRIQQAIGTSAAVGLPIALSGALGYMINGWSATGLPAFSVGYVSLPAVAL
FT                   ISAVSFFTAPVGARLAHRLPVATLKKAFAGLLLLLSLKMLHTVFAG"
FT   gene            46262..47176
FT                   /locus_tag="Dd1591_0042"
FT   CDS_pept        46262..47176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0042"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: esa:ESA_04168 glycyl-tRNA synthetase subunit
FT                   alpha; TIGRFAM: glycyl-tRNA synthetase, alpha subunit;
FT                   PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04935"
FT                   /db_xref="GOA:C6CFV2"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFV2"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ACT04935.1"
FT                   /translation="MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMTC
FT                   LRALGPEPIAAAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDNIQELYLGSLKE
FT                   LGMDPTIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGEI
FT                   TYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDFLFTC
FT                   FEQYEKEAQQLLALEKPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRTLTK
FT                   AVAEAYYASREALGFPMCNRKQS"
FT   gene            47186..49270
FT                   /locus_tag="Dd1591_0043"
FT   CDS_pept        47186..49270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0043"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: eca:ECA0085 glycyl-tRNA synthetase subunit
FT                   beta; TIGRFAM: glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04936"
FT                   /db_xref="GOA:C6CFV3"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFV3"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ACT04936.1"
FT                   /translation="MTDKTFLVEIGTEELPPKALRTLAEAFAANFTAELDAAGLGYQSV
FT                   GWFAAPRRLALKVAGLSASQPDREVEKRGPAIAQAFDAEGKATKAAEGWARGCGITVEQ
FT                   AERLTTDKGEWLLFRAQVKGEAAQTLLPGMVSTALAKLPIPKLMRWGDNDTQFVRPVHT
FT                   VTLLLGDELISGTVLGIDSARVIRGHRFMGEPEFTIDNADQYPQILLERGKVLADYEAR
FT                   KAKIKADAEDAARKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEALVYTM
FT                   KGDQKYFPVYDNAGKLLPNFIFVANIESKDPQQIIAGNEKVVRPRLADAEFFFNTDRKK
FT                   RLEDHLPRLETVLFQQQLGTLRNKTDRIAALTGWVAEQIGADVNHAKRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPSSAVACALAIADKM
FT                   DTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKRLPLDLQTLTEEAVRLYGDKLST
FT                   INAGNANVVDDVIEFMLGRFRAWYQEEGHSVDTIQAVLARRPTRPADFDARVKAVSHFR
FT                   TLEQAEALAAANKRVSNILAKSTETLNDSVQAALLKENEEIQLATYVTALTSKLAPWFA
FT                   EGRYQEALAELAQLRESVDNFFDKVMVNADEAQVRINRLTLLNELRNLFLKVADISVLQ
FT                   "
FT   gene            complement(49378..50379)
FT                   /locus_tag="Dd1591_0044"
FT   CDS_pept        complement(49378..50379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: par:Psyc_1209 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04937"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFV4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT04937.1"
FT                   /translation="MRLLFICPDWANLATPIVTEMKRQGHDVIHIDHCDLSTFSYFDSR
FT                   HRIVAKIYKTITGKNYKRLVLDNQIKLGLHNFFIGREPFDAIIMTEPKLFNKQHLEILR
FT                   RHGKKLVATLWDGLKKAPSNGLHLSEFDHVLSFDSEDCEQFHFAKITNYLDPTWKSTMP
FT                   YQACEYDIFSIMSFTQERYRQVIHFLDKNPDIKSNIIFYVGDAGKPKYIKDNRIKTSEK
FT                   LLLGAELAHEINNSRAILDILQGQQTGLSFRAYESMAYQRKLITTNPHIIDYDFYNPQN
FT                   ICILDQDEYIQPEFLHTPYQPVPENIYQQYTLCTWVEKVIQEISNNAEQTHV"
FT   gene            complement(50811..54404)
FT                   /locus_tag="Dd1591_0045"
FT   CDS_pept        complement(50811..54404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0045"
FT                   /product="urea carboxylase"
FT                   /note="KEGG: cja:CJA_2723 UreA amidolyase homolog; TIGRFAM:
FT                   urea carboxylase; urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; Carbamoyl-phosphate
FT                   synthase L chain ATP-binding; biotin carboxylase domain
FT                   protein; Allophanate hydrolase subunit 1; biotin/lipoyl
FT                   attachment domain-containing protein; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; SMART: Allophanate
FT                   hydrolase subunit 2; Allophanate hydrolase subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04938"
FT                   /db_xref="GOA:C6CFV5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR014084"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFV5"
FT                   /inference="protein motif:TFAM:TIGR02712"
FT                   /protein_id="ACT04938.1"
FT                   /translation="MFERVLIANRGAIAVRIIRTLKKMGVKAIAVYAEADRHSQHVRQA
FT                   DEAWPLGDGPVRDTYLNQDKLLHIAAQCGAQAIHPGYGFLSENAGFVTRCEQVGLIFLG
FT                   PTVAQMTAFGLKHQARALAQHNDVPLLPGSGLLTSLDSACEQAQRIGYPVMLKSTAGGG
FT                   GIGMQRCNDEDQLIDAFTRVKRLAGNNFADDGVFLEKFIAQARHIEVQVFGDGQGNVIA
FT                   LGERDCSAQRRNQKVIEETPAPHLSDGVRAELQATAIRLCRAVNYRSAGTVEYVYDESS
FT                   KQFWFLEVNTRLQVEHGVTELVYGVDIVQWMVELGAGCLPPLDTLITPPRGHAIQVRLY
FT                   AEDPAKQFQPCAGLLSHVAFPDALPGLTLRIDHWLDSGSEVSPFYDPMLAKIIVHGDSR
FT                   DAALDGMAQALDATSLYGIETNLDWLRHLLTLPTVRRGEIITATLGGVVWQPATLDVLG
FT                   GGTLTTVQDAPGRTGYWHVGVPPSGPFDTRSFRLGNQLLGNAPDAAGLEITLRGPTLRF
FT                   NHDCAFVVTGAIIDIRLDNAPLDGGRIHYARTGQTLTLGDVQGAGCRSYLLLAGGLACP
FT                   AYLGSRSTFTLGKFGGHAGRALRAGDVLHLAAPALPATDVALPAPDWSAHWALRVIYGP
FT                   HGAPDYFTPQDIDTFFAADWQVHYNSSRTGIRLIGPKPQWARTDGGEAGMHPSNIHDNA
FT                   YAFGTVDFTGDMPVILGPDGPSLGGFVCPATVIHADLWKLGQLKAGDSVRFIPVTPEQA
FT                   DELARAAESAITAGLPVTEPTIEPHRPSPVLYQRPAQDERPSVTCLAAGDRFLLVEYGE
FT                   HRLDIALRFRVHALMQWLEQHPLPGVQELTPGIRSLQIHFDSLLCPRSALLAHLQQADD
FT                   ALGDLQHAAVPSRTVWLPLSWDDDACREAITRYTQSVRPGAPWCPSNIEFIRRINGLDS
FT                   VEQVKDIVFDARYLVMGLGDVYLGAPVATPLDPRHRLVTTKYNPARTWTAENSVGIGGA
FT                   YLCVYGMEGPGGYQFVGRTLQMWNRDRQTDAFRQPWLLRFFDQIRFYPVSAQELLTIRE
FT                   RFPWGDYPLRIEDGEFRLADYQRSLAEQQPAIDAFQQQRQQAFDEELARWRADGQFTFD
FT                   SSLQEIAPDDEVIPANGYGVESQVAGSVWQWLATPGDNVAAGQIVGILESMKMEIPITA
FT                   PVAGIIHKMYRQAGQQVQAGQLLMVIEPADA"
FT   gene            complement(54504..55139)
FT                   /locus_tag="Dd1591_0046"
FT   CDS_pept        complement(54504..55139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0046"
FT                   /product="urea carboxylase-associated protein 1"
FT                   /note="TIGRFAM: urea carboxylase-associated protein 1;
FT                   KEGG: abo:ABO_1891 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04939"
FT                   /db_xref="InterPro:IPR017791"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFV6"
FT                   /inference="protein motif:TFAM:TIGR03424"
FT                   /protein_id="ACT04939.1"
FT                   /translation="MIKTSQRDPATAVYRATVQAGDYWLHRLEAGQTLRITDLEGNQAA
FT                   DTLFYNADDTAERYSMSDTLRGQRNVFLTTGSVLRSNEDRPMLEIVADTCGRHDTLGGA
FT                   CATESNTVRYDLEKRHMHACRDSWMLAVAQHPEYRLTKRDITHNINFFMNVPVTPDGGL
FT                   TFADGISAPGKYVEMVAKMNVLVLISNCPQLNNPCNGYNPTPIDIAVW"
FT   gene            complement(55142..55861)
FT                   /locus_tag="Dd1591_0047"
FT   CDS_pept        complement(55142..55861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0047"
FT                   /product="urea carboxylase-associated protein 2"
FT                   /note="TIGRFAM: urea carboxylase-associated protein 2;
FT                   KEGG: sde:Sde_1125 5'-3' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04940"
FT                   /db_xref="InterPro:IPR017792"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFV7"
FT                   /inference="protein motif:TFAM:TIGR03425"
FT                   /protein_id="ACT04940.1"
FT                   /translation="MNDHYQTELPAGSHWSLVMRRGTALHLTDIEGGANVGMLFYNSEN
FT                   PLERYNAPDTLKCQHTFRLTAGHCLYSDMGRIFCGIETDGFGWHDTVCGTANAQQVARQ
FT                   FGELNYQQARNDRHQNGYDGFLVELAKYGLGKRDMAACVNFFAHVGSDDNGNLRLEQQG
FT                   KPGAGVTLRFAMDTLVILHTCPHPLSTAADYPRHPVRLTLDQQRAPLPDICLARPENRR
FT                   GLRNNTLYYLAEQPQGV"
FT   gene            complement(55879..56658)
FT                   /locus_tag="Dd1591_0048"
FT   CDS_pept        complement(55879..56658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0048"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bph:Bphy_3976 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04941"
FT                   /db_xref="GOA:C6CFV8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFV8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT04941.1"
FT                   /translation="MSLLTLKNLRKEYDGQVVLERLNISVEEGEFVSIVGASGCGKTTF
FT                   LKMLLGTESPSSGQLLLDGAPMPQEPDEHRGVVFQRYSVFPHLRVVENVMIGAEFAEAR
FT                   WFGRVWGTRRRALRDQAMAMLRQVGLEQSAQKYPHQLSGGMQQRLALAQALIKRPRILL
FT                   LDEPFGALDPGIRAEMHQLISQLWQENRLTIFMITHDLKEGFSLGSRLWVFDKLRQDPQ
FT                   APDAFGASITYDLPLDRAPAGVRASVGELIDGRRYVA"
FT   gene            complement(56686..57498)
FT                   /locus_tag="Dd1591_0049"
FT   CDS_pept        complement(56686..57498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0049"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cja:CJA_2719 ABC
FT                   transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04942"
FT                   /db_xref="GOA:C6CFV9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFV9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT04942.1"
FT                   /translation="MRKLINYQPLPLTRGMMGFLPLLALLLVYLMASDARLAVNAADKL
FT                   LPGLGAMAQAMHRMAFEPNERTGEYLLWVDTAASLLRLLTGVGLSAVLALVFGLLCGAL
FT                   PAVRAALSPLITLFALIPPLAVLPILFIVFGLGEVSKVVLIMVGITPFIVRDLQLYIQS
FT                   LPQEQLVKAQTLGGHSGQILWRVILPQLMPRLLDAVRLSLSSAWLFLIAAEAIAATEGL
FT                   GYRIFLMRRYLAMDVILPYVAWITALAFLLDVLLRVVSRRGWPWYYAK"
FT   sig_peptide     complement(57400..57498)
FT                   /locus_tag="Dd1591_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.757 at
FT                   residue 33"
FT   gene            complement(57515..58570)
FT                   /locus_tag="Dd1591_0050"
FT   CDS_pept        complement(57515..58570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0050"
FT                   /product="ABC transporter periplasmic binding protein, urea
FT                   carboxylase region"
FT                   /note="TIGRFAM: ABC transporter periplasmic binding
FT                   protein, urea carboxylase region; KEGG: cja:CJA_2718 ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04943"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR017793"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFW0"
FT                   /inference="protein motif:TFAM:TIGR03427"
FT                   /protein_id="ACT04943.1"
FT                   /translation="MKTILRLLLVCALALCSLGIQAADKPAFKLCWSIYAGWMPWDYAQ
FT                   QHGIIKKWADKYGIDIQFVQVNDYIESVNQYTSGGFDGCAMTNMDALTIPAVGGVDSTA
FT                   LIVGDYSNGNDGILLKGTNNLNALKGKPINLVQLSVSHYLLARALEKNGMSEKDIKVVN
FT                   TADADLVAAFGTPDVQAIVTWNPLLAEAKKQPGSQLAFSSAQIPGEILDLLVVNTATLK
FT                   KHPELGKALTGAWYETLQVMSGDSANARQARTFMGQAAGTDLAGFDEQLAATHLFATPK
FT                   QTLEFVQNAQLKTTMQSVAEFSFRHGLLGEGAPSADIVGVSTPTGVWGNTGNVKLRFSD
FT                   EFLKLAVDNKL"
FT   sig_peptide     complement(58502..58570)
FT                   /locus_tag="Dd1591_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            59268..59978
FT                   /locus_tag="Dd1591_0051"
FT   CDS_pept        59268..59978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0051"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04944"
FT                   /db_xref="InterPro:IPR021413"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFW1"
FT                   /inference="similar to AA sequence:KEGG:ECA0086"
FT                   /protein_id="ACT04944.1"
FT                   /translation="MMLADYRSRWLLPVVMLVMALQLSACGDKDKDARQAFITFLQGVS
FT                   QQEGRQLPALTEQQKQSFGRFTQDYAVMTGFNQQLDQALAASLTPVLDVVSRIRVPQDY
FT                   MTQRDNLRQALGGLNMLSPQVQNAKTQADNARKALKQSEELQSVYDKVYNRAVSLPANA
FT                   MVTVVPASTSFAQSVVQVGDYLQAQGNQAVFGNNGVQFHTQQQVDQYNSLMTDIANQQQ
FT                   KLFTTLKSQNFLPR"
FT   sig_peptide     59268..59345
FT                   /locus_tag="Dd1591_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.842) with cleavage site probability 0.796 at
FT                   residue 26"
FT   gene            60459..62366
FT                   /locus_tag="Dd1591_0052"
FT   CDS_pept        60459..62366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0052"
FT                   /product="PTS system, mannitol-specific IIC subunit"
FT                   /note="TIGRFAM: PTS system, mannitol-specific IIC subunit;
FT                   PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; phosphotransferase system
FT                   EIIC; phosphotransferase system lactose/cellobiose-specific
FT                   IIB subunit; KEGG: eca:ECA0087 PTS system,
FT                   mannitol-specific IIABC component"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04945"
FT                   /db_xref="GOA:C6CFW2"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004718"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFW2"
FT                   /inference="protein motif:TFAM:TIGR00851"
FT                   /protein_id="ACT04945.1"
FT                   /translation="MLSPDTKVKVQNFGRFLSNMVMPNIGAFIAWGIITALFIPTGWIP
FT                   NATLAKLVGPMITYLLPLLIGFTGGRLVGGERGGVVGAITTMGVVVGTDIPMFLGAMIA
FT                   GPLGGWAIKRFDAAVDGKIKSGFEMLVNNFSAGIIGMLLAVLSFLAIGPLVEALSRILA
FT                   AGVHLMVQNNLLPLASIFVEPAKILFLNNAINHGIFSPLGIQQATEAGKSIFFLIEANP
FT                   GPGMGVLMAYMLFGRGNAKQSAPGAAIIHFLGGIHEIYFPYVLMNPRLIIAVILGGMTG
FT                   VFTLGLLNGGLVSPASPGSILAVLAMTPKGAYFANITAIAAAFAVSFVVSAILLKSSKV
FT                   KDDDELEQATRRMQEMKSASKGQAVGGVSGDLGTVRKIIVACDAGMGSSAMGAGVLRKK
FT                   VQDAGLQTISVTNCAINNLPDDVDLVITHRDLTERAMRHAPQAQHISLTNFLDSHLYND
FT                   LVARLQAAQSDSVKPAQAAPAVEPAAAPQTLFQLTEKNVFLNLQAADKEQAIRFAGEQL
FT                   VKGGYVEPAYVDAMLEREKLTSTYLGESIAVPHGTIEAKDRVLKTGVVFCQYPQGVRFG
FT                   DDEDDVARLVIGIAARNNEHVQVITNLTSALDDESVIERLAQTENVQDVLDLLSGKSPA
FT                   "
FT   gene            62439..63590
FT                   /locus_tag="Dd1591_0053"
FT   CDS_pept        62439..63590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0053"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: eca:ECA0088
FT                   mannitol-1-phosphate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04946"
FT                   /db_xref="GOA:C6CFW3"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFW3"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ACT04946.1"
FT                   /translation="MMKALHFGAGNIGRGFIGKLLADAGIALTFADVNQPLLDAINQRG
FT                   CYPVRIVGEQQRVETVNQVNAVHSGSPQAVELIAEVDLVTTAVGPQILAKIAGAIAQGL
FT                   VKRQESGNTSPLNIIACENMVRGTSQLKQHVLAQLPENTQAWVAQHVGFVDSAVDRIVP
FT                   PAEAGESDPLAVTVETFSEWIVDKTQFTGEPPAIAGMELTDNLMAFVERKLFTLNTGHA
FT                   ITAYLGQRAGHGTIRDAILDPAVRQVVQGAMEESGAVLIRRYGFDADKHQAYIRKILTR
FT                   FENPWLHDEVERVGRQPLRKLSAGDRLIKPLLGTLEYRLPHDNLIQGIAAAMHYRSEQD
FT                   PQAQELAALIASEGLQAALAQISGLDADSEVVGKAVSVYNAMQ"
FT   gene            63676..64281
FT                   /locus_tag="Dd1591_0054"
FT   CDS_pept        63676..64281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0054"
FT                   /product="mannitol repressor, MtlR"
FT                   /note="PFAM: Mannitol repressor; KEGG: eca:ECA0089 mannitol
FT                   repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04947"
FT                   /db_xref="InterPro:IPR007761"
FT                   /db_xref="InterPro:IPR038026"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFW4"
FT                   /inference="protein motif:PFAM:PF05068"
FT                   /protein_id="ACT04947.1"
FT                   /translation="MPSWRQPLHRAGGNTVRRINVREATMDDTQAFENRVLESLNASKT
FT                   VRSFMLMAVELLAEAVSLLMLQAFRKDDYAVKYAVEPLLSGSGPLGELSVRLKLIYGLG
FT                   MISRKEYEDTELLMALGEELAHDEHAYRFTDDEILGPISELHCVSSLPPSPIPPSGVDP
FT                   DDALLAAMQQQRYQQMVRSTLVLSLTELIAGISLKKAF"
FT   gene            complement(64373..66259)
FT                   /locus_tag="Dd1591_0055"
FT   CDS_pept        complement(64373..66259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0055"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: eca:ECA0091 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04948"
FT                   /db_xref="GOA:C6CFW5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR032255"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFW5"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACT04948.1"
FT                   /translation="MAIKLENIKVGRKLGLGFSLILLLTVIIAAVSVRYIETLKGRFEK
FT                   VIFSNQINNEVSEARYYRLLYGTSYNPDSLKENSKHIDNIIGLISSIQGKNWRSDYDER
FT                   LDNINKLINQYKERRKNYTDAVAKKDDVRKSWNLSDSEKPLKQIEQQVAGNMPLQLQLT
FT                   SLHQKLVNVRYLVRGLLLSLNSDSEKPLISALDDAQKALGQFVQALTPEQQAIMAPVVS
FT                   TLSTYKTQVMAYLPAYQEEMAQGKLLGDTANLLIDNVNKMVAEETAATQNDIITAEWQI
FT                   AITSLITLILGALIAWYISRQITHPLNNTVAIAESIATGDLTVAIETTRRDELGMLFSA
FT                   MAKMKANLHNMIDDIRMGVSQITTAASEIVTGNNDLAARTESQAASVEETAASMEELTS
FT                   TVKQNAANAHQANKLVLDATHTAQEGGKLVADVVQTMSDIEGSSKRIAEITSVINGIAF
FT                   QTNILALNAAVEAARAGEQGRGFAVVANEVRNLAQRSSQAAKEIEGLISTSVGQVSKGA
FT                   NLVHSAGKTMQEIVTAVTHVHDIMGEITIASDEQSRGIAQVNQAIVEMDSTTQQNAALV
FT                   QQSSAAASSLEDQAMILSNTVSAFRLSSSHELAPASHGLPFAGHQQQLSYKH"
FT   sig_peptide     complement(66170..66259)
FT                   /locus_tag="Dd1591_0055"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.747) with cleavage site probability 0.445 at
FT                   residue 30"
FT   gene            complement(66717..67343)
FT                   /locus_tag="Dd1591_0056"
FT   CDS_pept        complement(66717..67343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0056"
FT                   /product="Superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="PFAM: manganese and iron superoxide dismutase; KEGG:
FT                   eca:ECA0092 superoxide dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04949"
FT                   /db_xref="GOA:C6CFW6"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFW6"
FT                   /inference="protein motif:PRIAM:1.15.1.1"
FT                   /protein_id="ACT04949.1"
FT                   /translation="MSYSLPSLPYAYDALEPHFDARTMEIHHSKHHQAYVNNANAALES
FT                   LPEFAGLSAEELITKLDQLPADKKGPLRNNAGGHANHSLFWKGLKLGTTLEGELKAAIE
FT                   RDFGSIDEFKTKFEQAAATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAISGASGY
FT                   PIIALDVWEHAYYLQYQNRRPDYIKAFWFVVNWDEAAKRFAEAKK"
FT   gene            complement(67614..68432)
FT                   /locus_tag="Dd1591_0057"
FT   CDS_pept        complement(67614..68432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0057"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: eca:ECA0093 formate dehydrogenase accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04950"
FT                   /db_xref="GOA:C6CFW7"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFW7"
FT                   /inference="protein motif:TFAM:TIGR00129"
FT                   /protein_id="ACT04950.1"
FT                   /translation="MNSDDSQGVAERSGACQHSVWRQGALDLPQQDWLAEEVPVALVYN
FT                   GISHVVMMASPKDLEPFALGFSLSEGIIESAQDIYGMDVVPACNGIEVQIELSSRRFAG
FT                   LKARRRAMDGRTGCGVCGVEQLAEIGKPVSPLPFTQHFSLSRLEPALQALKNVQQAGAL
FT                   TGATHAAAWLSPQGELLGGCEDVGRHVALDKLLGTRARQPWQHGAALVSSRASYEMVQK
FT                   SAMCGVEILFAVSAATSLAVEVAERCNLTLVGFCRPGRATIYTHPQRLQP"
FT   gene            68798..70333
FT                   /locus_tag="Dd1591_0058"
FT   CDS_pept        68798..70333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0058"
FT                   /product="Aldehyde dehydrogenase (NAD(+))"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: eca:ECA0094
FT                   aldehyde dehydrogenase B"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04951"
FT                   /db_xref="GOA:C6CFW8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFW8"
FT                   /inference="protein motif:PRIAM:1.2.1.3"
FT                   /protein_id="ACT04951.1"
FT                   /translation="MDIDNASRVQPGEYGPALTLKKRYDNFIGGAWVPPSGGEYYVNLT
FT                   PVTGQPLCEVASSSTRDVDHALDAAHKASAEWGALSTRERAQILNRIADRMEANLELLA
FT                   SAETWDNGKPIRETLNADVPLGIDHFRYFAACIRAQEGAISEIDHDMVAYHFHEPLGVV
FT                   GQIIPWNFPLLMACWKLAPALAAGNCIVLKPAKLTPLSVLLLMELIQDILPPGVLNVVN
FT                   GAGGQIGEYLATSPRIAKVAFTGSTEVGQQIMGYAAQNVIPVTLELGGKSPNIFFADVM
FT                   DQEDSFFDKVLEGFALFAFNQGEVCTCPSRALIQESIYERFMERAIKRVESIRVGNPLD
FT                   SQTMMGAQVSAGQLDTILNYIDIGKKEGAQVLTGGHRKVLPGDLAQGYYLEPTILFGQN
FT                   SMRVFQEEIFGPVLAVTTFKTPEEALAIANDTPYGLGAGVWSRNANIAYRMGRGIQAGR
FT                   VWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLEHYQQTKCLLVSYSEKPLGLF"
FT   gene            complement(70585..72045)
FT                   /locus_tag="Dd1591_0059"
FT   CDS_pept        complement(70585..72045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0059"
FT                   /product="xylulokinase"
FT                   /note="TIGRFAM: xylulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: eca:ECA0096 xylulose kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04952"
FT                   /db_xref="GOA:C6CFW9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR006000"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFW9"
FT                   /inference="protein motif:TFAM:TIGR01312"
FT                   /protein_id="ACT04952.1"
FT                   /translation="MYIGIDLGTSGVKAILLRENGDVAASHSAPLSVSRPHPLWSEQDP
FT                   EKWWQATDAALSGLAAQQTLQGVRAIGLTGQMHGATLLDAQQQVLRPAILWNDGRSAAQ
FT                   CLQLEQLVPDARRITGNLMMPGFTAPKLKWVQQHEPDIFRLIDKVLLPKDYLRWRLTGN
FT                   FASDMSDAAGTLWMDVARRDWNDDLLAACGLNRDQMPALFEGNQITGQLRADIAARWGM
FT                   PPVPVVAGGGDNAAGAIGVGLYQAGQAMLSLGTSGVYFAVSDGFLSNPQRAVHSFCHAL
FT                   PNSWHLMSVMLSAASCLDWAARLTHADSVASLLAEAEQAGAEETATPVWFLPYLSGERT
FT                   PHNNPQAKGAFWGLTHSHGRAALARAVLEGVGFALADGMDALHATGLEPRQVTLIGGGA
FT                   RSAYWRQMLADISGKTLEYRTGGDVGPALGAARLAQIALNPAIPLAQLLPALPLEQVHQ
FT                   PDPTRHAQYAQQRAVFRRLYQQLSPLMT"
FT   gene            complement(72167..73486)
FT                   /locus_tag="Dd1591_0060"
FT   CDS_pept        complement(72167..73486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0060"
FT                   /product="xylose isomerase"
FT                   /EC_number="5.3.1.5"
FT                   /note="KEGG: eca:ECA0097 xylose isomerase; TIGRFAM: xylose
FT                   isomerase; PFAM: Xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04953"
FT                   /db_xref="GOA:C6CFX0"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFX0"
FT                   /inference="protein motif:TFAM:TIGR02630"
FT                   /protein_id="ACT04953.1"
FT                   /translation="MHAYFDQIEKVRFEGQGSRNPFAFRHYNPDEVILGKRMADHLRFA
FT                   VCYWHTFCWNGSDMFGAGAFARPWQQPGDALALAKRKADIAFEFLHKLGAPYYCFHDVD
FT                   VAPEGSSLPEYLNNFAAMTEVLAAKQQETGVKLLWGTANCFTNPRYAAGAATNPDPDVF
FT                   AWAATQVFTAMNATKMLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHK
FT                   IGFNGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHTFHH
FT                   EIATAIALGIFGSVDTNRGDPQLGWDTDQFPNSVEENALVLYEILKAGGFTTGGLNFDA
FT                   KVRRQSTDRYDLFHAHIGAMDTMALSLKVAARMLEDGELNQQVANRYAGWNSELGQQIL
FT                   QGNASLEMLAGYAARHPLNPQHHSGQQERLENLVNRYLFG"
FT   gene            73978..74973
FT                   /locus_tag="Dd1591_0061"
FT   CDS_pept        73978..74973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0061"
FT                   /product="D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="TIGRFAM: D-xylose ABC transporter, periplasmic
FT                   substrate-binding protein; PFAM: periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: eca:ECA0098
FT                   D-xylose transporter subunit XylF"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04954"
FT                   /db_xref="GOA:C6CFX1"
FT                   /db_xref="InterPro:IPR013456"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFX1"
FT                   /inference="protein motif:TFAM:TIGR02634"
FT                   /protein_id="ACT04954.1"
FT                   /translation="MKIKHVLLSACAALVMLCQPGFAKEVKIGMAIDDLRLERWQKDRD
FT                   IFVKSAEEKGAKVFVQSANGNEGTQISQIENMINRGVDVLVIIPYNGQVLSNVIAEAKR
FT                   EGIKVLAYDRMINNADIDFYISFDNEKVGELQAQYLINKVPQGSYFLMGGSPVDNNAKL
FT                   FRQGQMKVLKPFIDSGKIKVAGDQWVDAWLPENALKIMENALTANNNNIDAVVASNDAT
FT                   AGGAIQALSAQGLAGKVAISGQDADLAAIKRIVSGTQTMTVYKPISKLAQDAANIAVLL
FT                   GQGKKPESNATLNNGKKEVPAFLLTPIPVDKANIDSTVVADGFHKKADIY"
FT   sig_peptide     73978..74049
FT                   /locus_tag="Dd1591_0061"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            75057..76598
FT                   /locus_tag="Dd1591_0062"
FT   CDS_pept        75057..76598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0062"
FT                   /product="D-xylose ABC transporter, ATPase subunit"
FT                   /note="KEGG: eca:ECA0099 xylose transporter ATP-binding
FT                   subunit; TIGRFAM: D-xylose ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04955"
FT                   /db_xref="GOA:C6CFX2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013455"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFX2"
FT                   /inference="protein motif:TFAM:TIGR02633"
FT                   /protein_id="ACT04955.1"
FT                   /translation="MPYLLEMKNITKAFGAVKAVDNVSLQLDAGQVLSLCGENGSGKST
FT                   LMKVLCAVYPYGSYEGSIRFAGDDLRAGHIRDTEQKGIAIIHQELALVKEMTVLENVFL
FT                   GNEWTYAGVMDYDAMYQRCQTMLAQVRLDIDPNTRVGELGLGQQQLVEIAKALNKQVRL
FT                   LILDEPTASLTERETGVLLDIVRDLRHHGIACIYISHKLNEVKAISDVICVIRDGRHIG
FT                   TCPADSLSEDQIIAMMVGRELTELYPNEPHDIGEEVLRVEHLTAWHPVNRHIRRVDDVS
FT                   FSLHRGEVLGIAGLVGAGRTETVQCLFGAYPGQWQGEIRVEGKPVIIRHCRQAMALGIA
FT                   MVPEDRKKDGIIPVMSVAQNITLAALDQFTGALSVLRDADEQHSLRESITHLKVKTASP
FT                   ELAIARLSGGNQQKAILAKCLLLRPKILILDEPTRGIDIGAKYEIYKLINQLVKQQIAV
FT                   IVISSELPEVLGLSDRVLVMHQGRLKADLPNRGLTQEQVMEAALRSEPHAENLAV"
FT   gene            76576..77760
FT                   /locus_tag="Dd1591_0063"
FT   CDS_pept        76576..77760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0063"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: eca:ECA0100
FT                   xylose transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04956"
FT                   /db_xref="GOA:C6CFX3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFX3"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACT04956.1"
FT                   /translation="MLKTWLSDRTPALATSSGGTSRRRSFNLQVLVMIAAIIAIMLFFT
FT                   VMTDGAYLSARNISNLLRQTAITGILAVGMVFVIISAEIDLSVGSMMGLLGGVAAILDV
FT                   WYGWPLPLTVAVTLLLGLLLGAWNGWWVAYRRVPSFIVTLAGMLAFRGVLIGITNGTTV
FT                   SPTSPAMSQIGQSYLPEGVGFLFGIVGLTLFVVWRWRQRLRRQRLGLPVAAASGDAARQ
FT                   SLMAVLVLGAIYLLNDYRGVPTPVLLLTLIMLGGMFMAMRTAFGRRIYAVGGNIDAARL
FT                   SGVNVERTKLAVFAINGLMVAVAGLVLSSRLGAGSPSAGNIAELDAIAACVIGGTSLAG
FT                   GVGSVAGAVMGAFIMASLDNGMSMLDVPTFWQYIVKGGILLLAVWMDTATKHKA"
FT   sig_peptide     76576..76722
FT                   /locus_tag="Dd1591_0063"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.762) with cleavage site probability 0.708 at
FT                   residue 49"
FT   gene            77949..79178
FT                   /locus_tag="Dd1591_0064"
FT   CDS_pept        77949..79178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0064"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: eca:ECA0101 xylose operon
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04957"
FT                   /db_xref="GOA:C6CFX4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFX4"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACT04957.1"
FT                   /translation="MFEKRYRITLLFNANKVYDRQVVEGVGEYLQASQCDWDIFIEEDF
FT                   RCRIDNIRDWLGDGVIADFDDPAIVALLSGVRVPLVGVGGSYHHPQDYPPVHYIATDNY
FT                   ALVESAFLHLKNKGLNRFAFYGLPISVGKRWAQEREQAFRQLVSAEQYQGVVYQGMETS
FT                   PDNWQYAQNRLADWIQTLPPQTGIIAVTDARARHLLQVCEHLNIAVPEKLCVIGIDNEE
FT                   LTRYLSRVALSSVAQGPRQMGYRAAKLLHQLLLAPYSLPLQRVLVPPLRVVERSSTDYR
FT                   SVRDPAVIQAMHFIRHHACKGIKVEQVLDAVGLSRSNLEKRFKDETGQTIHGIIHAEKL
FT                   ERARNLLVSTSLSINEISTMCGYPSLPYFYSVFRKDYDLTPREYRERYGEGGYDDSRYD
FT                   NVQASYRCYR"
FT   gene            complement(79299..79874)
FT                   /locus_tag="Dd1591_0065"
FT   CDS_pept        complement(79299..79874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0065"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: eca:ECA0102
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04958"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFX5"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACT04958.1"
FT                   /translation="MAKNVAILLAPGFEEAEAIMVIDVLHRTKLNVTLLSCHDRLELPS
FT                   YHNIRMFADALLERSMDQLFDAVVIPGGPQGTVNLAANPLVTEFIRRHDEAGKLICPLC
FT                   SAAARVLGGNHLLKGRRYVCSGDLWKDVTDGVYVDQKVVEDGNLISGKGLGVAFDFAFT
FT                   LASRLSNDKDDVNFQVEHIYYDYWRVPA"
FT   gene            complement(80132..80410)
FT                   /locus_tag="Dd1591_0066"
FT   CDS_pept        complement(80132..80410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0066"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   asa:ASA_0625 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04959"
FT                   /db_xref="GOA:C6CFX6"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFX6"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ACT04959.1"
FT                   /translation="MPHTVHEKKKLLTRVRRIKGQAEALEKALDGGGRSCLEILQQIAA
FT                   IRGAVNGLMGEVLEGHIRDHLMNEEADPAERATDLEAIVTVIRSYMK"
FT   gene            80510..81412
FT                   /locus_tag="Dd1591_0067"
FT   CDS_pept        80510..81412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0067"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   seh:SeHA_C3242 nickel/cobalt efflux system RcnA"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04960"
FT                   /db_xref="GOA:C6CFX7"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFX7"
FT                   /inference="protein motif:PFAM:PF03824"
FT                   /protein_id="ACT04960.1"
FT                   /translation="MTDFSLLLQQGVANAWLFIPSAVLLGALHGLEPGHSKTMMAAFIV
FT                   AIRGTVRQAVMLGVAATLSHTAVVWLIALGGMYLSRQFTAESAEPWLQFISGIIILGTA
FT                   IWMFWRTWRDEWAWKQHQHSHGHHHDHGHEHHHHDHEHAHHHEHAHHHHDVSHADHHSG
FT                   HQHDHAQPQGEYQDAHERAHADEIRQRFANREATNGQILLFGLTGGLIPCPAAITVLLL
FT                   CIQVKAFTLGAALVVCFSIGLALTLVAVGVGAALSVQHAGRRWPGFAALARRAPYFSSV
FT                   LIALVGMYMLLHGWVRLPL"
FT   gene            81706..83055
FT                   /locus_tag="Dd1591_0068"
FT   CDS_pept        81706..83055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0068"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="KEGG: ent:Ent638_3608 argininosuccinate synthase;
FT                   TIGRFAM: argininosuccinate synthase; PFAM:
FT                   argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04961"
FT                   /db_xref="GOA:C6CFX8"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFX8"
FT                   /inference="protein motif:TFAM:TIGR00032"
FT                   /protein_id="ACT04961.1"
FT                   /translation="MTTILKHLPVGQRIGIAFSGGLDTSAALLWMRQKGAVPYAYTANL
FT                   GQPDEDDYDAIPRRAKEYGAENARLIDCRKQLVAEGIAAIQCGAFHNTTGGMTYFNTTP
FT                   LGRAVTGTMLVAAMKEDGVNIWGDGSTYKGNDIERFYRYGLLTNAELKIYKPWLDTDFI
FT                   DELGGRQEMSEFMTKSGFDYKMSAEKAYSTDSNMLGATHEAKDLEFLNSSVKIVNPIMG
FT                   VKFWDENVRIPAEEVTVRFERGHPVALNGQTFSDDVELLLEANRIGGRHGLGMSDQIEN
FT                   RIIEAKSRGIYEAPGMALLHIAYERLVTGIHNEDTIEQYHAHGRQLGRLLYQGRWFDPQ
FT                   ALMLRDALQRWVASEITGEVTLELRRGNDYSILNTVSDNLTYKPERLTMEKGESVFSPD
FT                   DRIGQLTMRNLDITDTREKLFNYVESGLIYSGNAGLPQVATPSLQDKSAK"
FT   gene            complement(83151..83651)
FT                   /locus_tag="Dd1591_0069"
FT   CDS_pept        complement(83151..83651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0069"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: bmn:BMA10247_0906 MarR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04962"
FT                   /db_xref="GOA:C6CFX9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFX9"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACT04962.1"
FT                   /translation="MARYLEVSDIVQQWRNERPDLDVEPMLVIGTLSRASLLIDRALDK
FT                   VFSKYKLSAREFDILATLRRRGAPYAISPSQIVSALMINNSTLTSRLDRLEQAGWLRRM
FT                   PIEGDRRSVNIQLTDEGFALINRVVEEHVANERDILSPFSDDEKNQLRTLLGRVEKHLV
FT                   NNR"
FT   gene            84008..84874
FT                   /locus_tag="Dd1591_0070"
FT   CDS_pept        84008..84874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0070"
FT                   /product="carboxylate/amino acid/amine transporter"
FT                   /note="TIGRFAM: carboxylate/amino acid/amine transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   ecm:EcSMS35_A0154 drug/metabolite transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04963"
FT                   /db_xref="GOA:C6CFY0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004779"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFY0"
FT                   /inference="protein motif:TFAM:TIGR00950"
FT                   /protein_id="ACT04963.1"
FT                   /translation="MKLKDFAFYAPCVWGTTYFVTTQFLPADKPLLAALIRALPAGLVL
FT                   IFGKKLPPVSWLWRLFVLGALNIGVFFVMLFFAAYRLPGGVVALVGSLQPLVVILLSLL
FT                   LLTQPVLKKQIMAAVAGGIGIVLLISLPEESLNPAGLAASVLATVSMASGLVLTKKWGR
FT                   PAKMTMLTFTGWQLFCGGLVILPVQMFLEPLPDAITWTNLAGYFYLAIPGSLLAYFMWF
FT                   SGLEVNSPVIMSMLGFLSPMVALLVGFLFLHQGLSGPQWVGVVLIFSAIIIVQDISLFF
FT                   RRKNQCS"
FT   gene            85294..86244
FT                   /locus_tag="Dd1591_0071"
FT   CDS_pept        85294..86244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0071"
FT                   /product="Indigoidine synthase A family protein"
FT                   /note="PFAM: Indigoidine synthase A family protein; KEGG:
FT                   plu:plu2187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04964"
FT                   /db_xref="GOA:C6CFY1"
FT                   /db_xref="InterPro:IPR007342"
FT                   /db_xref="InterPro:IPR022830"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6CFY1"
FT                   /inference="protein motif:PFAM:PF04227"
FT                   /protein_id="ACT04964.1"
FT                   /translation="MSKTDFSHELLRFSDEVKDALHTGKPVVALESTVIAHGLPYPDNV
FT                   ATAQKIEAVVRAEGAIPATIGIENGRFLIGMSDADIERFGATNGIPKASSRDIPVILAQ
FT                   GGKGATTVASSLVAADLAGIPFFASAGIGGVHRGAEKSMDISADLVQFTRSRVAVVCAG
FT                   AKSILDLGLTLEYLETQCVPIISYQSDDFPAFYCRSSGFPSPHRLDDPAVVARSIEMHW
FT                   KLGNRSSVLITHPIHENDAIDKDEVESIIREAALQAEHEGIRGPGATPYLMRAVARATQ
FT                   GRTVKANMSVLISTAALAGKLACAHTDYLRQHNQA"
FT   gene            86256..86948
FT                   /locus_tag="Dd1591_0072"
FT   CDS_pept        86256..86948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0072"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: plu:plu2182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04965"
FT                   /db_xref="GOA:C6CFY2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFY2"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACT04965.1"
FT                   /translation="MKPLVIFDLDGTLVDTPSGIVSAFVATLRDLGLPFEDRRAIRATI
FT                   GLPLEKAFSQLLSLPVDDERVAAAIRRYQVVFREQVLPLAPGLVFPGVVDGLSLLQRQG
FT                   YALAVATSKVFVSAQALLEAAGLWPFFDLVLGADMVTHPKPHPEMGLLAMSRLGARAST
FT                   TAMVGDTTHDLLMAKQAGMVAIGVTWGIHHVEQLKSAEPQVIVDTFGEVVGAAHALLKL
FT                   SSSPVSYC"
FT   gene            87246..91565
FT                   /locus_tag="Dd1591_0073"
FT   CDS_pept        87246..91565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0073"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase; Thioesterase;
FT                   phosphopantetheine-binding; KEGG: plu:plu2186 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04966"
FT                   /db_xref="GOA:C6CFY3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFY3"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ACT04966.1"
FT                   /translation="MVVGFHLPPQEVSVWENNNHIHGDIIPLNIPLNSSTPICGFIQNI
FT                   TDWMTPETIQQNNDMNIRALTLGRQQAPHDVFDLEVTWRPLVDNEPVRALVCYVDSSEE
FT                   TFTLTLRSNPARFSSALVQKLPAVWRQIIEFAGKNGVETLRDIRLIDDDERDHVLHRFN
FT                   QTDHEWSGETSIVAQLEKRAQCQPEQTAVVFRDQQLSFRQLYQQAGALAHYLSAQSTAR
FT                   ERCVGLFVEPSLTLMTGVWGILLSGNAYLPLSPEYPEDRLAYMLENSQARIVVTQLHLR
FT                   ERLLALAPPGVQVVTPDDVDAFMRRQASALPEAPAVEIAPHHLAYVIYTSGSTGKPKGV
FT                   MIEHHSVLNQMNWLAQTFALNNETVILQKTPMSFDAAQWEILSPACGCRVVMGEPGVYR
FT                   NPEQLVEMLAEYQITTLQCVPTLLQALLDTERLTDCPALRQIFSGGEALQKHLAQACLE
FT                   TLPECELVNLYGPTECTINSSAFRVDLAGVRQGPDTLSIGAPVANTRYYILDNCLTPVA
FT                   VGQTGELYIGGDGVARGYLNRDDLTAERFIIDPFAPVGAGRRLYKTGDIASWNPDGTVQ
FT                   YAGRADNQVKLRGYRVELDEIRSAIETHEWVKAAAVIVKHDPFTGYQNLISFIELNARE
FT                   AALMDQGNHGSHHQSKANKAQVMLQLANKGCRDFPADGAFYTLDLPGKQPDEKQRITAF
FT                   SRKTYRFYDGGAVRRDDILSLLRQPLLTAVSRQPDELTLDELGHWLRYLGQFTSAERLL
FT                   PKYTYASPGALYATQVFLELNGVGGLAAGHYYYQPVHHQLIRVSECVCVAPGSLRLHFV
FT                   GKKSAIEPIYKNNIREVLQMEMGHIIGMLDNVLPGYGLGVELYDAAGLDPAPLAIGQDD
FT                   DYLGACDVLCGPRLPADDCLDIYVQTAGTRLADLPAGTYRYVHGDLQHLADGVIDKKHV
FT                   IAINQAVYERASFGISIASRTEGWAGYVHVGRYLQHLQMNDINIGLMSSGYSSETGNDL
FT                   PAARRFWQILGHRTGPYYFFIGGRISDEQKYSEGMKEDTVHMKGPAEMIRDDLAAFMPD
FT                   YMMPNKVLIVDEMPLTVNGKVDMKALANINVELKHKTIVAPRNPLEQQIMAVWQAKLKR
FT                   EAMSVDDNFFESGGNSLIAVSLINELNATLNANLPLQVLFQAPTVEKLAAWLSRARQEP
FT                   ISRLVQLQPKGRQAPIYCWPGLGGYCMNLRLLARQLGTERPFLGIQAHGINPDEVPYAT
FT                   ISEMAARDIELIRRHQPHGPYTLWGYSFGARVAFETAWQLEQAGEVVESLYLLAPGSPK
FT                   LRNDRVAAMHRSADFDNPGYLTILFSVFIGSITDPALARCLETVRDEESFVAFITELNP
FT                   ALDDGLVRRITRIVAQTFEFSYTFSELQQRQLNTPVTIIKAQGDDYSFIENHGGFSALP
FT                   PTVLDLTADHYSMLKEAGIAELTSVIQYQQTPPSQVG"
FT   gene            91841..92845
FT                   /locus_tag="Dd1591_0074"
FT   CDS_pept        91841..92845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0074"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; KEGG: plu:plu0753 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04967"
FT                   /db_xref="GOA:C6CFY4"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFY4"
FT                   /inference="protein motif:PFAM:PF08541"
FT                   /protein_id="ACT04967.1"
FT                   /translation="MMRLYYKPLCDMRMVTVRTSSETGMFCLNAIHHEAPERIRRFPLA
FT                   ELGDSHQLREGQRRMMEKLYQLKSVPMRSDSHEAMLESVVAGLIDDWPALPSQDGLLIY
FT                   AKTQTHNTFFDRHWLDDILLRQQLGHWDVTTLGLNHCAGALSALHLVRHSAVQRNRPVL
FT                   LLTGEKAFHPEINRFTVGVQGELPVAALFNAARSPWRVTFTAVRHLSRFYNNPDTMTRQ
FT                   EKAELNRCLLDELCLFIVDAVRDSGMSMDEMDYFVPCNLNFPLLRQMATRLNMGERLFS
FT                   QQVSDYGHLYCSDVLFNFSSLIKTTTGCAKNYFCFSMGMGVTLSCALIQQIDR"
FT   gene            92859..93125
FT                   /locus_tag="Dd1591_0075"
FT   CDS_pept        92859..93125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0075"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04968"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFY5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT04968.1"
FT                   /translation="MSALLLTIQQALRDVMENDDIEINEKTDFDHDLDLDSVMFVQFLL
FT                   TLEDNIDGLLFDPDQINMDAFTTVGSLIGWLNANVLAEVRHVG"
FT   gene            93115..93768
FT                   /locus_tag="Dd1591_0076"
FT   CDS_pept        93115..93768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04969"
FT                   /db_xref="GOA:C6CFY6"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT04969.1"
FT                   /translation="MSVERIRHVWEAFRDQPLSEALLVLLQPPPGEAQYLRPETHYLHP
FT                   EAHYLHPIGYQIQDISRLPDASQPQRLFDRVLNHLGLDAVRGTETIVLPASFPILVCAA
FT                   RLGVLARIQTMSWQHLSGRQSFGTKTTRHQLIKASFADIAGKASLLLEQQYQRLREGDF
FT                   AGLEDDHYQITQLNNEAEKMMGGHGFLLGNTHSLSYFSMMLYSIYGKASSLAAA"
FT   gene            93787..95145
FT                   /locus_tag="Dd1591_0077"
FT   CDS_pept        93787..95145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0077"
FT                   /product="Na+-driven multidrug efflux pump-like protein"
FT                   /note="KEGG: pfo:Pfl01_3541 multi anti extrusion protein
FT                   MatE"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04970"
FT                   /db_xref="GOA:C6CFY7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFY7"
FT                   /inference="protein motif:COG:COG0534"
FT                   /protein_id="ACT04970.1"
FT                   /translation="MMSLIARVVSRAAPAASGDIRQIMALAWPMMVTAVVVSLSQNMQI
FT                   AILGNGAESQTLLTLSFLQPFNFLFIAILECLAITNQVFSARSRHDWPRQRIRHSTLLL
FT                   GGIGILATALTALLCRVLALPLSNWMNSPDLALMQNAAPGYLLSMTPFLALEMCNAALR
FT                   GQGKTVPAMTLMCGYVLLSAAGCYLGFHVYQLGFDAVLLANSLPALVLLPLAVRSLRQV
FT                   ARPVPDERPHAFLPRLLALLTHAGLPVGFSMLVVFFSSMVIFPLVAALGAGFLPAFLIV
FT                   IKLRAFFIIPAVATGSAIAILLNQHRKTHSAPRQVSLLNNGVWLIVLAYLALTLGVCWA
FT                   RNGILAGFSNDELIRQSSQLLLLLLLPTFFLTSLVAALQTLLEQVDRGKRVLLFTLALE
FT                   LLMVAVALGAHRYFNDVQTIAGLIVAFSLAYAVVFLREYRLLACALGEQDAAV"
FT   gene            95132..96223
FT                   /locus_tag="Dd1591_0078"
FT   CDS_pept        95132..96223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0078"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pfl:PFL_0267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04971"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFY8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT04971.1"
FT                   /translation="MLLYNLCYPLMWLATLVQYNYYRVLVKLKRRPSLLLKVRIKPETH
FT                   YVRLCRVLRLADLWLLERCSLHLAARYLLSLFETTRYVAYKQVDHAYLAGFQQECVSFQ
FT                   HQTVYVFRWMPPAADTPTKTVLLVHGWEGRGIMFRPLCEALKAQGYGVVMPDLLAHGLS
FT                   EGKRVSNYELASLIIELGRRYGPFHAVVGHSSGGLVCSLALAQGLAAQRLVLLASPDNF
FT                   GKMIDQFLAGASVSASLAVPMKTIYAQRFGFHPDQIGEALYRSLDCPALICHDRQDARV
FT                   HPAVADEIHRALARSEIFYTRGLGHLGILRSPLVHQRILSFLSDAGTGTETPCTPLIHD
FT                   PAICHAPSAAAYGGPMQVVSKPM"
FT   gene            complement(96288..96851)
FT                   /locus_tag="Dd1591_0079"
FT   CDS_pept        complement(96288..96851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0079"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: dvl:Dvul_2703 transcription
FT                   activator, effector binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04972"
FT                   /db_xref="GOA:C6CFY9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFY9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACT04972.1"
FT                   /translation="MSLQNTFAHTLDNDIFNNNLIQDMYRRHPNLRKTLAASNKATSLA
FT                   GIIDYIIDNIGNNITLEDLEAVSGKSKFDICRLFNQVYNITPMRWIWRVRLTLAKEIIH
FT                   ISPNWSLTDICYACGFSSLPHFSRCFTKTYNIPPLKYRKSVSLERENESPRTLQNMSFD
FT                   IIFGKQRHLFSRHVLLDNIHNLCN"
FT   gene            97467..98174
FT                   /locus_tag="Dd1591_0080"
FT   CDS_pept        97467..98174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0080"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cps:CPS_2119 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04973"
FT                   /db_xref="GOA:C6CFZ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFZ0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT04973.1"
FT                   /translation="MTVLVQLDNVHKIFLTDEIETHALSKINLSIHTGEYVSIAGPSGC
FT                   GKSTLLSIMGLLDTPTEGQYRLNGTDVERISRREMARLRNREIGFIFQSFNLISDLTIA
FT                   ENVALPLTYRKELSRAEQKARVIQALEKVNMSHRVRHYPSQLSGGQQQRVAVARAIVGK
FT                   PSLLLADEPTGNLDSANAEAVMNILDELHQDGATICIVTHDPRSAMRAQRTIVLSDGQV
FT                   VADGENGQLRQAV"
FT   gene            98179..100611
FT                   /locus_tag="Dd1591_0081"
FT   CDS_pept        98179..100611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0081"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cps:CPS_2120 putative ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04974"
FT                   /db_xref="GOA:C6CFZ1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFZ1"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACT04974.1"
FT                   /translation="MNFWFDIRYALRLLLKSPGFSVLTITVMACGLGLALYMYSVINTI
FT                   MYKTLPYPKGEGMVMVTPNVGGVSLDDSGLNFLDYTELSHQLTKVDDVGYFYAEYLDLN
FT                   DGKNSVRYIGILSTPQMFNYTGTSPLMGRIFNDVDMLPGALPVTVISYDLWKSYFHGRN
FT                   DILNQSIQINGIRTFIVGVMPKGFAFPFFHDLWLPSKIKQQSFSVREQAPEVYVYAHLN
FT                   PRFSLDEANQEIASVMNVLADKYPESNKGVSAIALSFQVSFMGDDTAQVFLITLSAVAF
FT                   VLLLACCNVGNLLLARSHQRTREIAVRVALGSPMMRLIMQMLWESLIICILAGIVGVLL
FT                   AAWGLDLTNTIFPRFVPNRVPSWWYLSLDSNMILNAGILVVVTAVVTGALPAWKIANGQ
FT                   FFQALRDGSRGIPGYRTSKAGRSLVIVEVALSFSILCISILLLILVTKANNADYGVVTD
FT                   GYSVSRINLNKDVYPSAQSRRDFYLKLSRQLNDIPDITAESVTTSAPGEFTAAHQLIIE
FT                   NKDNGNNDEYDLMVNDVQVMPGGLVGMGATVIYGREFSTSDNEKSSPVAVISESLARQY
FT                   WSDEKSAIGKRIRFRNEEESGWYTIIGVVTHVVHGRPFSAFKNRATVYRSLLQRPTPIM
FT                   TIMLKSNRPSVLPDKLKSALYNVDSMLPVASPQTLNNILERNTLGVRFVANLFMLFGVI
FT                   AIVLSSSGIYAVTQNAISQRTQEIGIRQVLGATPNHLLKMLMLQGANQLILGLILGLPL
FT                   ALLAAPGINRALGDGKGHFVLLFVCVALFIMIIVALATWIPSRRVIMMKPGDAIRYE"
FT   gene            100793..102193
FT                   /locus_tag="Dd1591_0082"
FT   CDS_pept        100793..102193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0082"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; ATPase associated with various cellular
FT                   activities AAA_5; SMART: response regulator receiver; AAA
FT                   ATPase; KEGG: cps:CPS_2121 sigma-54 dependent DNA-binding
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04975"
FT                   /db_xref="GOA:C6CFZ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFZ2"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACT04975.1"
FT                   /translation="MADKQHILIVDDDAHILASLQMLLSMEGYQVTLCSAVEQVPVQLS
FT                   QHDFDLILMDMNYQRDTTSGQEGLVLLEEIKRYDEYLPVVAMTGWGSVDIAVSAMRAGA
FT                   VDFIQKPWDNERLLNVIRQQISFSLSQRSGKRLKEENKLLKLELEDNFNGEWVVESAPM
FT                   KQLMRMVEQVAATETNILILGENGTGKSLLARVIHQLSSRRDENMVSVNMGCINENLFE
FT                   SEMFGHVKGAFTDARESRVGRFELADKGTLFLDEVGNLPMTQQSKLLRILEERSFERVG
FT                   SSRTLKTNCRIIAATNADLSARVREGTFRQDLYYRLNTIELHVPSLAERRQDIMPLALN
FT                   FIDRYARKYNKPVPELSASGQAALYGYHWPGNIRELSHLLERAVLLCSSSRLNSEDIFP
FT                   SLPGAPQKMARAEPELACDATLADIEERLLCQRMAKFEGNAIKAARSLGLSRSAFYRRL
FT                   EKYKINHE"
FT   gene            102225..103505
FT                   /locus_tag="Dd1591_0083"
FT   CDS_pept        102225..103505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0083"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   cps:CPS_2122 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04976"
FT                   /db_xref="GOA:C6CFZ3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFZ3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACT04976.1"
FT                   /translation="MSFNVAAIAGLLGYFLLWLFPDQSVYLKILTVFIIFLCLIYSSFT
FT                   FSERLNGKIHVVSNLLEALEQENFSLRGVTKGKSAFDNLIRQINQLSGTMARSRQQQKE
FT                   TYYVLHKVISNINISVFALDAERRIIWCNDAAAALVNKPPSLLIGQPAAEFGLEGLLQQ
FT                   SSDAEPVDWRFPSSRGMFQIRHDSYIEDGRQNHLLFISDVSKLLRNEEQKTWQNLLRVI
FT                   SHEINNSLTPIASISQTLLQVFRKDNQHPSAPDLINGMEIINNRARELIAFVGSYRQLN
FT                   RLPPANKQPCDIAGLMMQMAMLFPQRKLVFSGETPQPAMIDANQIQQMLINLLKNADEA
FT                   MAPGKGEIVLRWKVIARQLHIEIIDQGKGVANIENLFVPFYTTKTHGSGIGLILCRQIV
FT                   EGHDGHLTLENRKDAEGCVVNIFLPLG"
FT   gene            103624..104211
FT                   /locus_tag="Dd1591_0084"
FT   CDS_pept        103624..104211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0084"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   cbc:CbuK_0411 4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04977"
FT                   /db_xref="GOA:C6CFZ4"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFZ4"
FT                   /inference="protein motif:PFAM:PF01648"
FT                   /protein_id="ACT04977.1"
FT                   /translation="MTSRQLAEGMLRTLLAPLCRQEAAALRFERNPHGKPFLPQHPAIQ
FT                   FNLSHTHSAFAFAFARHGAVGVDVESCQGQVNRKRAVAARFFHHDEVRWLDSLDDAGFL
FT                   PAFTRLWSRKEAYIKALGLGLHKSLASFSCLDDGQGAIQVVDSGQAIDGGLGEQWITGE
FT                   PSVALSYCLLPDGAARQDAWRVLLIQDDAQIS"
FT   gene            complement(104222..104869)
FT                   /locus_tag="Dd1591_0085"
FT   CDS_pept        complement(104222..104869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04978"
FT                   /db_xref="InterPro:IPR021255"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFZ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT04978.1"
FT                   /translation="MKALLCSALVLLPLTVACSPVNQQNVDVPSFTTLDVSRGLNVTLV
FT                   CGNGYRVETSARQDVLEKLVIRPQGQSLLIENHASDDSILRNHDATIRITVAAPINTVK
FT                   AQAGVKMAVPACAVSPDTFTVNGSMGADLNIAGTTHRLDLSLAMGAAFNSHEKAFSAQE
FT                   AVVNIAMGVDARLCHVRQLSGTVTTGARVRVAPDTHVQVDNGIASLIEHDGC"
FT   sig_peptide     complement(104798..104869)
FT                   /locus_tag="Dd1591_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.786 at
FT                   residue 24"
FT   gene            complement(105152..106102)
FT                   /locus_tag="Dd1591_0086"
FT   CDS_pept        complement(105152..106102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0086"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; KEGG: plu:plu0753 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04979"
FT                   /db_xref="GOA:C6CFZ6"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFZ6"
FT                   /inference="protein motif:PFAM:PF08541"
FT                   /protein_id="ACT04979.1"
FT                   /translation="MRLTHFVTWIPERRLNAGDIIHAAGASASEARVFSQLFGFQQVAA
FT                   LDSAIPPASVFSGLLTELQRQSPHPERPADALIYAHGMPVQAAEQSTWLTQLGREHPFI
FT                   HPQAPCYELDQQNCATLLWALGLAQRLLSQQRAERVVIIAGDTLSSYPIQERYFPGCTI
FT                   AGDAFAALLLEAEPGGLQLDPIFMTQRPEFHEGFYGSREQLKAFYLAHDDMVNTALWGA
FT                   LSRQTDAERRHLYLLPHNVNRLSWLNYSRRHHHPLENIALGLMPDIGHCYTVDPLLLLP
FT                   DALPAIRSGKPHIMLSVGLGAWIGSCRISYAGTPG"
FT   gene            complement(106102..106959)
FT                   /locus_tag="Dd1591_0087"
FT   CDS_pept        complement(106102..106959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04980"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT04980.1"
FT                   /translation="MPTYIDPRSILHRSFTPPASMSQQVISPAQEYYWHSYASRFFESN
FT                   GLDWHERLANLQHSRQTGDLTSFINMISQLLPVYQARNDLSHIDSVLMAHWTPDLHLGS
FT                   SVINYVIEELRLPACLALTISDRGPDAALFALSSIANCQREDNHDSLLLIADQSNLPYH
FT                   SSLLDSLTPENNACLFSVCCDERPLHYQGFCRHPQYTADTLTQSVDTLCRRFELQQERL
FT                   CVVADPLLLAELPPSMTGIATNPHRVCAAPFVALAENYQPGCDYLLLVHHQDTLSAVAL
FT                   QGLE"
FT   gene            complement(106943..108079)
FT                   /locus_tag="Dd1591_0088"
FT   CDS_pept        complement(106943..108079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0088"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   plu:plu0762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04981"
FT                   /db_xref="GOA:C6CFZ8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFZ8"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACT04981.1"
FT                   /translation="MKALTFRNVLTELDALGEKLRHAASQVESDRHRALSCLEDELLYT
FT                   IAYIGIPTEFIPFRQWDYQACHYSDHIDMLEYLSRFDASGLMMLPGASLSARAVTTLGT
FT                   PEQQAFFFSRFTHPPCWAFFAVTEPEVGSDTQSIASSLTPTDDGYVLHARKKFIGGAQL
FT                   ASVGLVFAREGHFQRLVMVEPEQAASHMTITPLQQFGLQGSNLTEIEITGLPVTPEHIL
FT                   GYDRKGLNQGLVALGHVFERHRPMVSAMALGTAYGLLKVLDNTALTPDQQRWRAQQWRT
FT                   YHLLRQQLSDIAERYQSGQSHYHTTSQLKRHCTLFVEMVAHRMPHLLSEQAWLEDAPLR
FT                   RRCRDALAFEYMEGTANIHLMNSFRCYTARGGVCAHVY"
FT   gene            complement(108180..109103)
FT                   /locus_tag="Dd1591_0089"
FT   CDS_pept        complement(108180..109103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0089"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; KEGG: plu:plu0753 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04982"
FT                   /db_xref="GOA:C6CFZ9"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C6CFZ9"
FT                   /inference="protein motif:PFAM:PF08541"
FT                   /protein_id="ACT04982.1"
FT                   /translation="MPGHLEAIEIAFPPETQSLEEVAQEVGLSRLDIRMFDRFYGLRRF
FT                   HGGPGTLDDLLTPVIDQMQHNRPQAFAAISHVVHCHTVPCVRVFETVSQKPAWLDRFSP
FT                   HTEFASLTMGHCATPLTAAEWLLKQLPPGRFGLMLIGEKAFHPRVKLIKDTTLMGEAAC
FT                   AVLLARQGNGPTILSRYTGQDGRFSIQKGADEHETSDFGQHYVDFTRQHLQAALDKADV
FT                   TMDRIDWIAPHNVNLSSWHRLAQLMNFPREKIFLENVPRYGHCFGADPFINLHQLQQQQ
FT                   RLQKGDTVLLVSVGLGATYSSLLLEI"
FT   gene            complement(109174..109704)
FT                   /locus_tag="Dd1591_0090"
FT   CDS_pept        complement(109174..109704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04983"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG00"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT04983.1"
FT                   /translation="MADPVLAPAGALIAQETGSLTVETRATPLTAGQRVLLSPWFALNR
FT                   VAPDTPWFLHEPVHRDESGLHADEVIALCRRFCARHTDSALLYEYQSAPLQFRTPLLQS
FT                   LLHAVPGFHHSLGIKAQGRPLAEYDLACTLLDRDGAVLYLSDPLRRISPCADAGPVVYH
FT                   YCRFTRASLNPSL"
FT   gene            complement(109706..110839)
FT                   /locus_tag="Dd1591_0091"
FT   CDS_pept        complement(109706..110839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0091"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   plu:plu0762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04984"
FT                   /db_xref="GOA:C6CG01"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG01"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACT04984.1"
FT                   /translation="MNDYALFLSPLKRLIEDTQSEGRHLGGQIDIAPEKARLTAQYSLA
FT                   PMLNTLGVPADYQPTCWLEEQGVALRTLPLPLRCEAYESFGYIDPNLLFAAPGPGMAAL
FT                   VVENMGSQEQREAFFSQFTRELTWSCFAMTEPEVGSDAQQIQTSAIKVDGGWLINGEKY
FT                   LIGNGVIADTGVLFARTASGPLGINVFTFSPRHQHGVFAERIPINGVPGCNVSHLTFRD
FT                   LFVPDSALLGQHLKPTERFARSAMVTFDSLRPCVGAIALGIARSSLDLALQQRWVTPRA
FT                   AWLMKARRQLQAAMAQVRMVCERFELGENCGRDAGLTKITATRVAEQVVMAVIHHAPPA
FT                   AMGEYPRLAKAWRDVKAFEYTEGTTFIHLINHGYRGA"
FT   gene            complement(110836..111267)
FT                   /locus_tag="Dd1591_0092"
FT   CDS_pept        complement(110836..111267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_4711 coronamic acid synthetase CmaC"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04985"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT04985.1"
FT                   /translation="MKFSHLGYIVRDSEATIAAMAAFFPHITVHRKKVSAQQIYVTLMN
FT                   TTRQDMQIELVEPLPENRLLSGMLDKERKDCLPYHICFEVDDFSKKYQQLRADGWLALT
FT                   RPFHAYPQGPLASHLYKPEAGIMEIMSGSTSLIAQGETA"
FT   gene            complement(111349..112881)
FT                   /locus_tag="Dd1591_0093"
FT   CDS_pept        complement(111349..112881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0093"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   baa:BA_1915 AMP-binding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04986"
FT                   /db_xref="GOA:C6CG03"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG03"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACT04986.1"
FT                   /translation="MFSSVLNPIQSGMREHPQRLAIINDGGSYTFAQLGYRVEGIRQAL
FT                   QQHKPHCVMIYGHKQLDAAAAMLACAFEAIPFTFVDIANPPARLERIAAMVQMDLVLLT
FT                   CEPKASFPSLSVPIILTASLQDSHHLSPVVIPTPEQLFYILTTSGSTGEPKGVKISYGN
FT                   FAAFSEWYMPALQTDEYPGGHVNHACLSFDMGVMDLFPSLAIGKPVFMLNHVNNIRPRQ
FT                   NLRLLTESAVQASSWFSTPSFLDIMCLDRQFNAGSLPELRIIFVGGEPVSPSLVQTLQT
FT                   RFPQAEIRHAYGPTETTCVTHALCLPPINAKTAGALPLGRPQGTNSVEIWDERGIPLPA
FT                   GHYGEVVILGPQVGAGYLPSNLAANKAFGYRNDKERYYRTGDTGYLDDDGRLFIKGRND
FT                   SQIKWHGNRIDLAEIEKAANRCDCVKQSAVLIKKSNNAVTDLVLCIHLSIDNTIYRNGL
FT                   RRDLAQRLPAYMVPRVIHFTGPFPLTLHGKTDRQALMRQVEADAALGNTSSK"
FT   gene            complement(112862..114421)
FT                   /locus_tag="Dd1591_0094"
FT   CDS_pept        complement(112862..114421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0094"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bsu:BSU38500 D-alanine--D-alanyl carrier protein ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04987"
FT                   /db_xref="GOA:C6CG04"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG04"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACT04987.1"
FT                   /translation="MIASWQYLTTLLARFDGVHTPACHHIEGSLTYHQLYLGALALADQ
FT                   LQARHIAGGRRQPAPVILFGHKHPACLIAWWACLLTGHPVVPVETDNTDERLRFIAVSI
FT                   QAGLLLNATDRTAPEIGIPSLTVTGADDIDPADNRPAARLAEHCHQMGLAFGRNAVSGI
FT                   AYIMFSSGTTGAPKGIQVSYANLAHFVRWAADAFPAPGPISGNIRYCFDVAQYELWLAW
FT                   HYRQPISVLDYRDVINTRKMIARHADTGVQTWVSTPSLTRSYLRDRAFRHDNLPQLNTF
FT                   IFCGEVLTKELVGALWRAFPGCRIVNTYGPTECTVAVTACDITPDMLDDDTPLPLGYVR
FT                   PGVILHIDAPADSERGEIVITGPAVSEGYLNASLAQASRFSIDPDGTRRYRTGDIGSLR
FT                   NNLLYFHGREDSELKIQGYRIALDDIENALREHPQVQDAIVTPWLLHNTPQGLQAFILS
FT                   SQPDILPALADYLRRYFPLYMVPKFWYPVDHAALNHNSKLDRRRVTQQALDKGKRYVFV
FT                   SS"
FT   gene            complement(114418..114726)
FT                   /locus_tag="Dd1591_0095"
FT   CDS_pept        complement(114418..114726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04988"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG05"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT04988.1"
FT                   /translation="MSHDTDYTPITGYDPDFYYRKIVTAIGMALETDDLSELHPHTDLE
FT                   RDLGFKSSIFIELMMYLEEMIEGFAINPVTLDSQQITTIDSLGRFIHSQLEPGVPCV"
FT   gene            complement(114732..116315)
FT                   /locus_tag="Dd1591_0096"
FT   CDS_pept        complement(114732..116315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0096"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mlo:mll6742 long chain acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04989"
FT                   /db_xref="GOA:C6CG06"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG06"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACT04989.1"
FT                   /translation="MTNITHLTAWLDRAAKEAANKTAIIDTDREVSWFMLRLQARQLAD
FT                   YLREKGVEKGDRVIVYLPNSLTFVLYFWALQYLGAIFIPLNPETKAAKLSWLVDNAGCR
FT                   LLITHHALADEINIAQASEHWQQYNRRTRICFSGDVMAVLADEPYRIAAECERKTTGID
FT                   LDLACILYTSGSTGHPKGVMLSRRNMITAASSVAGYLQLRNDDRIMSFIPMSFDYGLYQ
FT                   VIMSVLAQCTLIVEPDFRRPLLSLQRMVTLRATVLPLVPTMLRLIAPLASRYNFSAIRT
FT                   VTNTAAALHINDIDQLRHIFPQARLYSMYGLTECHRCTYLPPEYLATHPQSVGIAIPNT
FT                   ELWVVDDNGQRQTRNATGELVIRGATVMCGYWRNEEKSAEKLRPGLLPGEKVLYTGDIC
FT                   RLDEQGLLYFVGRQDEMLKSCGEKVAPKEVEAVLNRHPQVVQAAVIGVPHPIYGDEIIA
FT                   CLVTRGDLNEKALARWSKTQMESYMVPHRFRLMSQLPLTPNGKINRSLLQEQLMVGTTM
FT                   PASAQPGLME"
FT   gene            complement(116327..117247)
FT                   /locus_tag="Dd1591_0097"
FT   CDS_pept        complement(116327..117247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04990"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG07"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT04990.1"
FT                   /translation="MTLCIQPDDLVWRTFAPENDAVLPAPHPNQDLMADYLRAFFRSHG
FT                   EIEEPDNALLTRWLNSGRYSFSTMMQTLLPELQARGTLQQLDLVVFAHWTPDSDLGCAV
FT                   SNALIHACDARHAFGLSVSDRGLAAPLFALHTIDDYLACDDNRREALLMIADQDVAPYP
FT                   SEQLTQAHPQKNCCLIRMEKRPADEAIGLVFEGYYRQPYADQGDLAATLRQLLSRLPIT
FT                   DALPLTLLARPSLVTALQGAFPELRLANVPPSLLCAAPFVYLKQHAEPGQRYLLAVPER
FT                   RHLTVCVLRYQPHDARPRPLLPSCT"
FT   gene            complement(117244..118566)
FT                   /locus_tag="Dd1591_0098"
FT   CDS_pept        complement(117244..118566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0098"
FT                   /product="Orn/DAP/Arg decarboxylase 2"
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG:
FT                   mpo:Mpop_3620 Orn/DAP/Arg decarboxylase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04991"
FT                   /db_xref="GOA:C6CG08"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG08"
FT                   /inference="protein motif:PFAM:PF00278"
FT                   /protein_id="ACT04991.1"
FT                   /translation="MADAVHPLIQPEALFANGYIEEVSITDIADRIGTPFYVYSTRQLR
FT                   RQLQQLYQQLPADTAVYYSLKANPNLSVVKTLVEQGAGCEVCSPAELDTALAAGVLPQH
FT                   ILYVGPGKSVPALARAIDCGIRAIVVESVAELETINRLAAQAGTIQTVALRINPDFSSE
FT                   HARLVMSGKPTQFGMTLDTLQTVLPCLHRWPAVALRGFHVYLGTRILNAQAIADNTRNI
FT                   LQMALNLRDQHQLALDFIDVGGGFGVPYFPKETPLDLPSLGEAMAPVMADFRRQAATTQ
FT                   IIIELGRYLVAEAGLFVTRVNNLKTAGGKTFAICDGGANCHSAAAGLNSMLRKNFPLLR
FT                   VGDNQSRPLQPYQVSGPLCTPTDLLGDNVLLPMLEVNDLIGITHSGAYGLTASPGAFLS
FT                   FGYPAEAMVDGRRLIQIRQPETTAQWLARQQPVDLWHGDEP"
FT   gene            complement(118559..118870)
FT                   /locus_tag="Dd1591_0099"
FT   CDS_pept        complement(118559..118870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04992"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT04992.1"
FT                   /translation="MEYPVITHHDDETLHTLLREKLTAIGVDNGRITEIFQGASLFGEE
FT                   GLLDSINIVSLIAVLSDHCETTYHLTGDLFNLTDDRVFEAFQNLTSLTRYLRERLPHG"
FT   gene            119648..120400
FT                   /locus_tag="Dd1591_0100"
FT   CDS_pept        119648..120400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0100"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: Autoinducer-binding domain protein; regulatory
FT                   protein LuxR; SMART: regulatory protein LuxR; KEGG:
FT                   eca:ECA1561 quorum-sensing transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04993"
FT                   /db_xref="GOA:C6CG10"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG10"
FT                   /inference="protein motif:PFAM:PF03472"
FT                   /protein_id="ACT04993.1"
FT                   /translation="MSISFSNVDFINSTIQNFIDRKLKSYGDLKYAYLIMNKKKPTDVV
FT                   IISNYPPEWVDIYRSNNYQHIDPVILTAINKISPFSWDDDLVISSKLKFSRIFNLSKEY
FT                   DIVNGYTFVLHDPGNNLATLSFMVEEHRSSELEEIIQNNRDKLQMLLISAHEKLTSLHR
FT                   EMSRNRHNSKPQEADIFSQRENEILYWASMGKTYQEIALILGITTSTVKFHIGNVVKKL
FT                   GVLNAKHAIRLGVEMNLIKPVEPVKARS"
FT   gene            complement(120366..121004)
FT                   /locus_tag="Dd1591_0101"
FT   CDS_pept        complement(120366..121004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0101"
FT                   /product="Acyl-homoserine-lactone synthase"
FT                   /note="PFAM: autoinducer synthesis protein; KEGG:
FT                   eca:ECA0105 N-acylhomoserine lactone synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04994"
FT                   /db_xref="GOA:C6CG11"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG11"
FT                   /inference="protein motif:PRIAM:2.3.1.184"
FT                   /protein_id="ACT04994.1"
FT                   /translation="MLEIFDVSFSLMSNNKLDEVFTLRKDTFKDRLDWAVNCINGMEFD
FT                   EYDNEKTTYLLGIKEGKVICSVRFIEMQYPNMITGTFFSYFDNLKIPEGNYIESSRFFV
FT                   DRDRVRNLIGTRNPACLTLFLAMINYARKCRYDGILTIVSHPMLTLLKRSGWRISIIQQ
FT                   GLSEKQERIYLLHLPADDESRHALIERITQMTNAESEQLKTLPLLVPLA"
FT   gene            121713..121958
FT                   /locus_tag="Dd1591_0102"
FT   CDS_pept        121713..121958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0102"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   elf:LF82_0232 UPF0379 protein YcfR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04995"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG12"
FT                   /inference="protein motif:PFAM:PF07338"
FT                   /protein_id="ACT04995.1"
FT                   /translation="MNMKAIFTAIALSTLSVGAFAATEIQYPQGQEMGSVSASANTLDS
FT                   LQAKLAAKADAAGAKSFQITAVQGNDTLHGNAVLYK"
FT   sig_peptide     121713..121778
FT                   /locus_tag="Dd1591_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 22"
FT   gene            complement(122258..123028)
FT                   /locus_tag="Dd1591_0103"
FT   CDS_pept        complement(122258..123028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0103"
FT                   /product="triosephosphate isomerase"
FT                   /note="TIGRFAM: triosephosphate isomerase; PFAM:
FT                   triosephosphate isomerase; KEGG: eca:ECA4272
FT                   triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04996"
FT                   /db_xref="GOA:C6CG13"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG13"
FT                   /inference="protein motif:TFAM:TIGR00419"
FT                   /protein_id="ACT04996.1"
FT                   /translation="MRHPLVMGNWKLNGSTSMVHELIAGLRNELSTVTGCDVAIAPPAI
FT                   YLDQAKHLLAGSRIVLGAQNVDVNLAGAFTGETSAAMLKDIGAKYIIIGHSERRTYHHE
FT                   SDEFIAKKFAVLKETGLIPVLCIGETEAENEAGQTEAVCARQLDAVLNSLGAQAFENTV
FT                   IAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANAAELF
FT                   TQPDIDGALVGGASLKADAFAVIVKAAAEAKGQA"
FT   gene            complement(123170..123796)
FT                   /locus_tag="Dd1591_0104"
FT   CDS_pept        complement(123170..123796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0104"
FT                   /product="protein of unknown function DUF1454"
FT                   /note="PFAM: protein of unknown function DUF1454; KEGG:
FT                   eca:ECA4271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04997"
FT                   /db_xref="InterPro:IPR009918"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG14"
FT                   /inference="protein motif:PFAM:PF07305"
FT                   /protein_id="ACT04997.1"
FT                   /translation="MPTVSDDTNELMMKNALLIVCCLSGLLCPLLARSDSLFQPKNPTA
FT                   APYLLAGSPTFDMNIVQFRTHYNLSNPSLPISEYRVVDTGDDSPNLTRAASRINDHLYS
FT                   STALEKGTGKIKTMQITWIPKLKDPDQSGRRKQAISYMAALVRTFMPSLTNEQSLKKIE
FT                   TLLEKGKGQRFYQQTEGALRYVVADHGEKGLTFAVEPIKLTLSDS"
FT   gene            123909..124334
FT                   /locus_tag="Dd1591_0105"
FT   CDS_pept        123909..124334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0105"
FT                   /product="protein of unknown function DUF805"
FT                   /note="PFAM: protein of unknown function DUF805; KEGG:
FT                   eca:ECA4270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04998"
FT                   /db_xref="GOA:C6CG15"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG15"
FT                   /inference="protein motif:PFAM:PF05656"
FT                   /protein_id="ACT04998.1"
FT                   /translation="MTIQQWCFSFRGRVGRRDFWLGMVIVLALIVGLFVLAGTGWLETQ
FT                   KAAFMLVVLLWPLTAILVKRLHDRNKSGWWALALVLAWMLGNGNWAMLPPLGQWGVGRF
FT                   LPTLIAVMMLLDCGAFGGTTGANRFGPAAEPLRLRAS"
FT   sig_peptide     123909..124022
FT                   /locus_tag="Dd1591_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.815) with cleavage site probability 0.808 at
FT                   residue 38"
FT   gene            complement(124348..125094)
FT                   /locus_tag="Dd1591_0106"
FT   CDS_pept        complement(124348..125094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0106"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   esa:ESA_03881 ferredoxin-NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACT04999"
FT                   /db_xref="GOA:C6CG16"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG16"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACT04999.1"
FT                   /translation="MAEWVTGNVIQVEHWTENLFSLRLEAPVAPFTAGQFAKLALELDG
FT                   ERVQRAYSYVNAPSDNLLEFYLVNVPNGKLSPHLHRCQPGDEVLVTQEAAGFFVLDEIP
FT                   DCDTLWMLATGTAIGPYLSILQEGRGLERFKHIVLVHAARFASDLSYLPLMQQLEQRYD
FT                   GKLRIQTVVSREEPPGSLIGRVPALIENGTLEAAVGLPLDAATSHVMLCGNPQMVRDTQ
FT                   QLLKDTRQMSKHLRRRPGHMTSEHYW"
FT   gene            complement(125203..126213)
FT                   /locus_tag="Dd1591_0107"
FT   CDS_pept        complement(125203..126213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0107"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /note="KEGG: eca:ECA4268 fructose 1,6-bisphosphatase II;
FT                   TIGRFAM: fructose-1,6-bisphosphatase, class II; PFAM: GlpX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05000"
FT                   /db_xref="GOA:C6CG17"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG17"
FT                   /inference="protein motif:TFAM:TIGR00330"
FT                   /protein_id="ACT05000.1"
FT                   /translation="MKRELAIEFSRVTEAAALAGYKWLGRGDKNAADNAAVQAMRIMLN
FT                   QVDINGRIVIGEGEIDEAPMLYIGEQVGTGHGDAVDIAVDPIEGTRMTAMGQANALAVL
FT                   AVGEQGAFLHAPDMYMEKLIVGPQAKGVIDLDQPLEDNLKRIAQRLGKPLSELTVITLA
FT                   KPRHDQVITDMQQWGVKVFAIPDGDVAASILTCMPESEVDVLYGIGGAPEGVISAAVIR
FT                   ALDGDMQGRLLARHQVKEDNAENRRLGEQELARCHEMGIEAGKVLALGDMARNDNVIFS
FT                   ATGITKGDLLNGISRRGNIATTETLLIRGKSRTIRRISSTHYLDRKDQALHDFLL"
FT   gene            complement(126345..127856)
FT                   /locus_tag="Dd1591_0108"
FT   CDS_pept        complement(126345..127856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0108"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: eca:ECA4267 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05001"
FT                   /db_xref="GOA:C6CG18"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG18"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ACT05001.1"
FT                   /translation="MNQEKKYIVALDQGTTSSRAVVLDHDANIVSVSQREFTQIYPKAG
FT                   WVEHDPMEIWATQSSTLVEVLAKAGISSDEVAGIGITNQRETAVVWEKETGKPIYNAIV
FT                   WQCRRSADICEKLKKDGLEEYIRANTGLVVDPYFSGTKVKWILDHVEGSRERARRGELL
FT                   FGTIDTWLIWKMTQGRVHVTDYTNASRTMLFNIHKLDWDERMLDVLDIPRAMLPQVRPS
FT                   SEIYGQTNIGGKGGTRIPIAGIAGDQQAALYGQLCVQPGMAKNTYGTGCFLLMNTGTEA
FT                   VRSKHGLLTTIACGPRGEVNYALEGAVFIGGASIQWLRDELKLIGDAMDSEYFATKVKD
FT                   TNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGANANHIIRATLESIAYQTRDVLDAMQA
FT                   DADTRLQSLRVDGGAVANNFLMQFQSDILGTRVERPQVRESTALGAAFLAGLATGFWND
FT                   LDEVKSKATIEREFRPSIETVERNFRYRGWQKAVARARAWEDHDE"
FT   gene            complement(127884..128735)
FT                   /locus_tag="Dd1591_0109"
FT   CDS_pept        complement(127884..128735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0109"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel protein; PFAM: major
FT                   intrinsic protein; KEGG: eca:ECA4266 glycerol uptake
FT                   facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05002"
FT                   /db_xref="GOA:C6CG19"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG19"
FT                   /inference="protein motif:TFAM:TIGR00861"
FT                   /protein_id="ACT05002.1"
FT                   /translation="MSQSELSTLKGQCVAEFLGTGLLIFFGVGCVAALKLAGASLGLWE
FT                   ISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFDGRKVLPYIVSQVAGAFCSAA
FT                   LVYGLYHNLFDNIEQTHNMVRGSVESLDLAGVFSTYPNPHISVMQAFLVETVITAILMC
FT                   LILALTDDGNGIPRGPLAPLLIGILIAVIGASMGPLTGFAMNPARDAGPKLFAYLAGWG
FT                   KIALTGGRDIPYILIPIFGPIVGACLGAFGYRSLIGRNLPCDVCAIDADTDTTTSAQTR
FT                   KV"
FT   gene            129345..129587
FT                   /locus_tag="Dd1591_0110"
FT   CDS_pept        129345..129587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0110"
FT                   /product="protein of unknown function DUF904"
FT                   /note="PFAM: protein of unknown function DUF904; KEGG:
FT                   eca:ECA4265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05003"
FT                   /db_xref="GOA:C6CG20"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG20"
FT                   /inference="protein motif:PFAM:PF06005"
FT                   /protein_id="ACT05003.1"
FT                   /translation="MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEKNNSLSQEVESMA
FT                   GNRDALMSENEQLKQEQLVWQERLRALLGKMEDVQ"
FT   gene            complement(129652..130137)
FT                   /locus_tag="Dd1591_0111"
FT   CDS_pept        complement(129652..130137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0111"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="TIGRFAM: regulator of ribonuclease activity A; PFAM:
FT                   Dimethylmenaquinone methyltransferase; KEGG: eca:ECA4264
FT                   ribonuclease activity regulator protein RraA"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05004"
FT                   /db_xref="GOA:C6CG21"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG21"
FT                   /inference="protein motif:TFAM:TIGR01935"
FT                   /protein_id="ACT05004.1"
FT                   /translation="MKYDTSELCDIYHEEVNVVEPLFSNFGGRSSFGGKIITVKCFEDN
FT                   GLLFDVLEENGSGRVLLVDGGGSVRRALVDAELARLATQNEWEGIVVYGAVRQVDDLSE
FT                   LDIGIQAMAATPAGAASEGIGETDIRVNFGGVTFFSGDHLYADNTGIILSEDPLDLE"
FT   gene            complement(130286..131203)
FT                   /locus_tag="Dd1591_0112"
FT   CDS_pept        complement(130286..131203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0112"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   eca:ECA4263 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05005"
FT                   /db_xref="GOA:C6CG22"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG22"
FT                   /inference="protein motif:TFAM:TIGR00751"
FT                   /protein_id="ACT05005.1"
FT                   /translation="MTQLTHSSKTQAWLDSLRPKTLPLAFASIVTGNVIACWHSNFKPG
FT                   VALLTLITAGLLQILSNLANDYGDAVKGSDKEDRIGPLRGIQTGAITLSELRRALLITV
FT                   LLTAVSGSALVALACEKPVDIVVFLALGLLAILAAITYTVGNRPYGYIGLGDISVLIFF
FT                   GWLSVAGSYYLQTGYFDSSVILPATACGLLAVAVLNINNLRDIDSDRENGKNTLAVRLG
FT                   AHKARRYHMVLLMTAPVCLALFAMLYLHTLAGWLFILALPLLVKQGRYVMRETTAFSMR
FT                   PMLEKTVKGALLTNLLFAVGVLLS"
FT   gene            complement(131359..132690)
FT                   /locus_tag="Dd1591_0113"
FT   CDS_pept        complement(131359..132690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0113"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: eca:ECA4262 ATP-dependent protease ATP-binding
FT                   subunit; TIGRFAM: heat shock protein HslVU, ATPase subunit
FT                   HslU; PFAM: ATPase AAA-2 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05006"
FT                   /db_xref="GOA:C6CG23"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG23"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ACT05006.1"
FT                   /translation="MSEMTPREIVSELDSYIIGQHKAKRAVAIALRNRWRRMQLEENLR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLA
FT                   DVAIKMVRQQSIEKNRYRAEELAEERILDVLIPPAKNNWGQPEESHEPSAARQAFRKKL
FT                   REGQLDDKEIEIDLAAAPVGVEIMAPPGMEEMTNQLQSMFQNLAGQKQKSRKIKIREAF
FT                   KLLVEEEAAKLVNPEELKQQAIEAVEQHGIVFIDEIDKICKRGDTSGPDVSREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQVASPSDLIPELQGRLPIRVELQALTTEDF
FT                   ERILTEPSASLTRQYQALMETEGVNITFQPDGIRRIAEAAWQVNERTENIGARRLHTVL
FT                   ERLIEEVSYGASEMSGQTVTIDADYVRSHLDELVADEDLSRFIL"
FT   gene            complement(132701..133231)
FT                   /locus_tag="Dd1591_0114"
FT   CDS_pept        complement(132701..133231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0114"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   eca:ECA4261 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05007"
FT                   /db_xref="GOA:C6CG24"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG24"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ACT05007.1"
FT                   /translation="MTTIVSVRRNGQVVIGGDGQATLGNTVMKGNVRKVRRLYNDRVIA
FT                   GFAGGTADAFTLFELFERKLELHQGHLVKAAVELAKDWRTDRMLRRLEALLAVADENAS
FT                   LIITGNGDVIQPENDLIAIGSGGPYAQAAARALLENTELSAREIVEKSLGIAGDICIYT
FT                   NQFHTIEELASKA"
FT   gene            complement(133317..134156)
FT                   /locus_tag="Dd1591_0115"
FT   CDS_pept        complement(133317..134156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0115"
FT                   /product="cell division protein FtsN"
FT                   /note="TIGRFAM: cell division protein FtsN; PFAM:
FT                   Sporulation domain protein; KEGG: eca:ECA4260 cell division
FT                   protein FtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05008"
FT                   /db_xref="GOA:C6CG25"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG25"
FT                   /inference="protein motif:TFAM:TIGR02223"
FT                   /protein_id="ACT05008.1"
FT                   /translation="MVALAVAVLVTFAGGLYFIAHNKPDESPVLPHQGTKGNGLPPKPE
FT                   ERWRYIKELENRQIGVVSPTEPSAGGEIQSAGQLTDEQRQLLEQMQSDMKRQPTTLAEV
FT                   PYNDQSQMPARSLNTSRQQTVVPTVPNTNTMTLPATPRTTTAAPPANQHHAAPAVNTPT
FT                   QTAQKPAQAEPRKEVAKTEPAAVAKETAKTDNTKPESKPEKEQRWMVQCGSFKTAEPAE
FT                   SIRAQLAFAGVETRIASGGGWHRIMLGPYNSRAVADKMAQKLKGMGQSNCIPLASGG"
FT   gene            complement(134307..135377)
FT                   /locus_tag="Dd1591_0116"
FT   CDS_pept        complement(134307..135377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0116"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: eca:ECA4259 DNA-binding
FT                   transcriptional regulator CytR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05009"
FT                   /db_xref="GOA:C6CG26"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG26"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACT05009.1"
FT                   /translation="MEQKKIISPATMKDVADQAGVSTATVSRALTTPEKVSAATRKKVE
FT                   QAALTVGYSAQNLARNLRRHESRTILALVPDICDPFFSEMLRGIEETAAERGYLVLIGD
FT                   CAHQRKTEKTFLDLITTRQIDGILLLGSQLPFDAGKDERRHLPPMVMANEFAPELDMPT
FT                   VHIDNLTAAFEAVSYLHQLGHQRIACIAGPEQIPLSEYRLQGYIQALRRCGLVVDNQYI
FT                   VHGDFSYETGSRGLNRLMSHPTPPTAIFCHSDVMALGALTQARRMGLEVPRDLSLVGFD
FT                   DIEQAGHCFPALTTVAQPRYDIGREAMLLLLAQLQQHKVPRGSQLMSSQLVVRDSTAAP
FT                   PLRVTGFKNSGAGQTF"
FT   gene            complement(135682..137880)
FT                   /locus_tag="Dd1591_0117"
FT   CDS_pept        complement(135682..137880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0117"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: eca:ECA4258 primosome assembly protein PriA;
FT                   TIGRFAM: primosomal protein N'; PFAM: DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; type III
FT                   restriction protein res subunit; SMART: DEAD-like helicase;
FT                   helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05010"
FT                   /db_xref="GOA:C6CG27"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG27"
FT                   /inference="protein motif:TFAM:TIGR00595"
FT                   /protein_id="ACT05010.1"
FT                   /translation="MPVVQVALPVPLTRTFDYRLAPGVTPPVAGVRVSVPFGNRKMIGI
FT                   VTSLSAGSELPLAQLKPLHDVLDDAPLFPDSLWRILLWAAEYYHYPLGEVLFHALPILL
FT                   RQGKPAHSAPLWQWFATEQGRATPLNALKRAPKQQQALASLLQGPIYRHQVAEAELTEA
FT                   ALQALREKGLSELRAQPRHVQDWRNTFSLAGERLRLNTEQATAVGAIRSEDDHFAAWLL
FT                   AGITGSGKTEVYLSVLENILAQGKQALVLVPEIGLTPQTIARFRDRFNAPVEALHSGLN
FT                   DSERLSVWLRARQGEAAIVIGTRSALFTPFARLGLIVIDEEHDGSYKQQEGWRYHARDL
FT                   AVFRARQENIPIVMGSATPALETLYNVQIGKYRQLRLSKRAGNARLAQQHLLDLKGLPL
FT                   TSGLSQPLINRIRHHLAEDNQVILFLNRRGFAPVVLCHECGWIAECQRCDSYYTLHQHQ
FT                   RMMRCHHCDSQRPIPQQCPQCGSTHLVPVGLGTEQLEQVLPALFPDAPITRIDRDTTSR
FT                   KGALEQQLAQVRQGGARILIGTQMLAKGHHFPDVTLVALLDVDSALFSADFRATERFAQ
FT                   LYTQVSGRAGRAGKAGEVVLQTHHPEHPLLQTLLHQGYDAFASQTLKERQSVFLPPFTS
FT                   HVLFRADDHDNQQASLFLQQLRNLLEASPLRDDALWLMGPAPALQPKRAGRFRWQLLLQ
FT                   HPSRATLQRLIRNSMLLIDTLPQTRKVKWVMDVDPTDS"
FT   gene            138156..138371
FT                   /locus_tag="Dd1591_0118"
FT   CDS_pept        138156..138371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0118"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: stm:STM4096 50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05011"
FT                   /db_xref="GOA:C6CG28"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG28"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACT05011.1"
FT                   /translation="MKEGIHPNYVEITATCSCGNVIKTRSTVAHDLNLDVCGACHPFFT
FT                   GKQRVVDTGGRVERFNKRFSVPGTKK"
FT   gene            complement(138486..138803)
FT                   /locus_tag="Dd1591_0119"
FT   CDS_pept        complement(138486..138803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0119"
FT                   /product="methionine repressor, MetJ"
FT                   /note="PFAM: Methionine repressor MetJ; KEGG: eca:ECA4253
FT                   transcriptional repressor protein MetJ"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05012"
FT                   /db_xref="GOA:C6CG29"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG29"
FT                   /inference="protein motif:PFAM:PF01340"
FT                   /protein_id="ACT05012.1"
FT                   /translation="MAEWNGEYVSPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPNDDDLRKERGDEIPEAAKAIMREMGIDPDTWE
FT                   Y"
FT   gene            138992..140152
FT                   /locus_tag="Dd1591_0120"
FT   CDS_pept        138992..140152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0120"
FT                   /product="O-succinylhomoserine (thiol)-lyase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: eca:ECA4252 cystathionine gamma-synthase;
FT                   TIGRFAM: O-succinylhomoserine (thiol)-lyase; PFAM: Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05013"
FT                   /db_xref="GOA:C6CG30"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG30"
FT                   /inference="protein motif:TFAM:TIGR02080"
FT                   /protein_id="ACT05013.1"
FT                   /translation="MTRKQATIAVRSGLNNDEQFGCVVPPIHLSSTYNFTGFNEPRAHD
FT                   YSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAILLVCTVFLRPGDLLVAPHDCYGGS
FT                   YRLFDSLSKRGAFRVKFVDQGNEADLKAALAEKPKLVLVESPSNPLLRVVDIAAICQAA
FT                   REVGAVSVVDNTFLSPALQNPLTLGADLVVHSCTKYLNGHSDVVAGAVIARDPAVVTDL
FT                   AWWANNIGVTGAAFDSYLLLRGLRTLSPRMAMAQKNALQIVEYLRHQLLVKALYHPSLP
FT                   GNAGHEIACRQQSGFGAMLSFELDGDEDTLRRFLSALELFTLAESLGGVESLISHAATM
FT                   THAGMAPQARAAAGISETLLRISVGIEDGDDLVASLDRAFQAAAKR"
FT   gene            140155..142590
FT                   /locus_tag="Dd1591_0121"
FT   CDS_pept        140155..142590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0121"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /note="KEGG: eca:ECA4251 bifunctional aspartate kinase
FT                   II/homoserine dehydrogenase II; TIGRFAM: aspartate kinase;
FT                   PFAM: homoserine dehydrogenase; homoserine dehydrogenase
FT                   NAD-binding; aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05014"
FT                   /db_xref="GOA:C6CG31"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG31"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACT05014.1"
FT                   /translation="MSALGIAAAVKGRQLHKFGGSSLADVKCYQRVAGIMANYSQAGDL
FT                   MVVSAAGSTTNQLISWLNLSQSDRISAHQVQQSLRRYQSELISGLLPAETAAPLINEFI
FT                   RDLERLAALLDGKMTEATYAEVVGHGEIWSARLMAAVLNQKNLPAAWLDARTFLRAERA
FT                   AQPQVDEGRSWPLLQQLLTQHAGQRLVITGFISSNEAGETVLLGRNGSDYSATQIGALA
FT                   GAERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHARTLQPVSGSD
FT                   IDLQLRCSYQPEQGSTRIERVLASGTGAKIVTSHDDVCLIEIGVSADHDFARMHKDVEQ
FT                   LLQKSQIRPLALGVHQDRNLLQLCYTSEVVHSAWQVLEQAALPVSLHLREGLALVALVG
FT                   AGVCRNPLHSHRFYQQLRDQPIEFVWQAEDEISLVAVLRVGPTEHLVRGLHHSLFRAEK
FT                   RIGLVLFGKGNIGSRWLELFAREQSLISARTGFEFTLAGVVDSSRSLLNYEGLDAGRVL
FT                   AFFGDEAQERDDDELFLWMRAHPYDDLVVLDVTASQSVADLYLDFASYGFHVISANKLA
FT                   GASGGDNYRQIRDAFAKTGRHWLYNATVGAGLPVNYAVRDLRESGDSILAISGIFSGTL
FT                   SWLFLQFDGTVPFTELVDQAWQQGLTEPDPRVDLSGQDVMRKLVILAREAGYEIEPNQV
FT                   RVESLVPAGCENGSVDQFFEDGEPLNQQMLQRLEAANEMGLVLRYVARFDVNGKARVGV
FT                   EAVRADHPLAALLPCDNVFAIESRWYRDNPLVIRGPGAGRDVTAGAIQSDLNRLAQLL"
FT   gene            complement(142761..143684)
FT                   /locus_tag="Dd1591_0122"
FT   CDS_pept        complement(142761..143684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0122"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bxe:Bxe_B0832 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05015"
FT                   /db_xref="GOA:C6CG32"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG32"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACT05015.1"
FT                   /translation="MKAIRIHHFNDMPAIKESPVPDIAADQVLIRVQAAALNPLDTLVV
FT                   SGFAQHFFDIELPITLGTDFAGTIERVGSAVSQWKSGDRVIAWSDAGISGGLAEFAAVP
FT                   ASACVPLPSSLSAAEGAAIPTAGITAWHALFSTAGLKAGETVLIHAGAGGVGTFAIQFA
FT                   HKAGAHVIATASGDGLALAHSLGADKVIDYKAQDFTTEISGVDVVLDLVGGETQTRSYK
FT                   VLRTGGRLVSTAMPPDETTAEAHGVTATIFYAKPYADQLGELTETIAEQGMKVVIDRNV
FT                   PLEAFDEAWARLMSRQARGKVIVSLF"
FT   gene            complement(143894..144568)
FT                   /locus_tag="Dd1591_0123"
FT   CDS_pept        complement(143894..144568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0123"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: ara:Arad_2384
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05016"
FT                   /db_xref="GOA:C6CG33"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG33"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACT05016.1"
FT                   /translation="MAPQTAPTHRTAKGAQRIHDLIVVAAEQFLEHGFDTVAVDDLIAR
FT                   VGGSRRNIYSHFGGKEGLFHAAMLHVCEEMAKPLDQFTIEGREPDEVLPTFGRELVRTA
FT                   LSPRTLAVHRILTNEGNRFPEIAQAMLAASYLKILDKLATWIAAHQAKPASKISTRLPA
FT                   RVLAEKFISMTSSDVKLRAIVGLVHPPLSDTEIDDIVSSAVHTFLYGVAVQPPREHDSQ
FT                   NG"
FT   gene            144635..144739
FT                   /locus_tag="Dd1591_0124"
FT   CDS_pept        144635..144739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05017"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05017.1"
FT                   /translation="MLFVLDDDAGVRYVDSRFLQIERTGGKGYAFCRY"
FT   gene            144961..145857
FT                   /locus_tag="Dd1591_0125"
FT   CDS_pept        144961..145857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0125"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: eca:ECA4244 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05018"
FT                   /db_xref="GOA:C6CG35"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG35"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ACT05018.1"
FT                   /translation="MSFFHANHQEALNQNLAELQGRINVSFEFFPPRTSEMEETLWNSI
FT                   DRLSSLKPKFVSVTYGANSGERDRTHSIIKGIKERTGLEAAPHLTCIDASRDELKAIAQ
FT                   DYWQSGIRHIVALRGDLPPGAGKPEMYASDLVTLLKEVGDFDISVAAYPEVHPEAKSAQ
FT                   ADLINLKRKIDAGASRAITQFFFDVESYLRFRDRCVTTGIDVEIVPGILPVSNFKQLQR
FT                   FATMTNVRVPNWMTAMFEGLDNDPETRKMVGASIAMDMVKILSREGVKDFHFYTLNRSE
FT                   LSYAICHTLGVRPATLA"
FT   gene            complement(145981..146712)
FT                   /locus_tag="Dd1591_0126"
FT   CDS_pept        complement(145981..146712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0126"
FT                   /product="glutaredoxin-family domain protein"
FT                   /note="TIGRFAM: glutaredoxin-family domain protein; PFAM:
FT                   Redoxin domain protein; glutaredoxin; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; KEGG:
FT                   yen:YE0132 putative peroxiredoxin/glutaredoxin family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05019"
FT                   /db_xref="GOA:C6CG36"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011906"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG36"
FT                   /inference="protein motif:TFAM:TIGR02190"
FT                   /protein_id="ACT05019.1"
FT                   /translation="MFVSQEGKKIPSVTFHTRQGDQWVDVTTEELFSNKTVVVFSLPGA
FT                   FTPTCSSSHLPRYNELAAVFKQFGVDAVLCVSVNDTFVMNAWKADQDAENITFIPDGNG
FT                   EFTRAMNMLVEKADLGFGPRSWRYSMLVRHGMVEKMFVEPNKPGDPFEVSDADTMLKYL
FT                   APHYKVQESVSLFTKPGCSFCAKAKQLLQDRGIQYEEIMLGKDATTVSLRAVTGRSTVP
FT                   QVFIGGRHIGGSEELETFLTT"
FT   gene            146874..147791
FT                   /locus_tag="Dd1591_0127"
FT   CDS_pept        146874..147791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0127"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: eca:ECA4243 DNA-binding transcriptional
FT                   regulator OxyR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05020"
FT                   /db_xref="GOA:C6CG37"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG37"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACT05020.1"
FT                   /translation="MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGV
FT                   MLLERTSRKVLFTQAGLLLVEQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTVGPY
FT                   LLPQIIPMLHRTFPKLEMYLHEAQTHQLLAQLDSGKLDCAILAMVKESEAFIEVPLFDE
FT                   PMKLAIYQDHPWANRERVAMSDLSGEKLLMLEDGHCLRDQAMGFCFQAGADEDTHFRAT
FT                   SLETLRNMVAAGSGITLLPSLAVPQERIRDGVCYLPCYKPEPKRTIALVYRPGSPLRGR
FT                   YEQLADSVREHMQLHMEKLSAQSA"
FT   gene            complement(147876..149282)
FT                   /locus_tag="Dd1591_0128"
FT   CDS_pept        complement(147876..149282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0128"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; FAD dependent
FT                   oxidoreductase; KEGG: eca:ECA4242 soluble pyridine
FT                   nucleotide transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05021"
FT                   /db_xref="GOA:C6CG38"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR022962"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG38"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ACT05021.1"
FT                   /translation="MSIQQQYDYDAIVIGSGPGGEGAAMGLAKQGAKIAVIERHYNVGG
FT                   GCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNARVISTSFSDILRHADSVIGQQTRMRQ
FT                   GFYERNHCEIFSGEARFIDAHTIAVYYPDDTHDTLTAANIIIATGSRPYHPGGVDFDHP
FT                   RIYDSDSILDLDYEPQHVIIYGAGVIGCEYASIFRGLNVKVDLINTRDRLLAFLDQEMS
FT                   DALSYHFWNNGVVIRHNEEFERIEGLDDGVIIHLKSGKKMKADCLLYANGRTGNTETLG
FT                   LENVGLETDSRGQLKVNSMYQTAQAHIYAVGDVIGYPSLASAAYDQGRIAAQAITKGDA
FT                   SAHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMNVGSLK
FT                   ILFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYPTMAEAYRV
FT                   AALNGLNRLF"
FT   gene            149465..150121
FT                   /locus_tag="Dd1591_0129"
FT   CDS_pept        149465..150121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0129"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: eca:ECA4241
FT                   DNA-binding transcriptional repressor FabR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05022"
FT                   /db_xref="GOA:C6CG39"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023764"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG39"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACT05022.1"
FT                   /translation="MTAGRIMGVRAQQKERTRRSLVEAAFSQLSAERSFASLSLREVAR
FT                   EAGIAPTSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIVKSGGSVIRTSVSTFME
FT                   FIGNNPNAFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLEVENHIPRSFAEAQSEA
FT                   MVTIVFSAGAEALDVDLEQRRQLEERLVLQLRMIAKGAYYWYRKEQGKGFSYPEG"
FT   gene            150136..150510
FT                   /locus_tag="Dd1591_0130"
FT   CDS_pept        150136..150510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0130"
FT                   /product="protein of unknown function DUF1422"
FT                   /note="PFAM: protein of unknown function DUF1422; KEGG:
FT                   eca:ECA4240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05023"
FT                   /db_xref="GOA:C6CG40"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG40"
FT                   /inference="protein motif:PFAM:PF07226"
FT                   /protein_id="ACT05023.1"
FT                   /translation="MTEQINSEKSTLVLAMVAGLSANGSFVAVFSSIVPFSIFPLIALV
FT                   LSVYCLHQRYMHHAMPEGTPLLAAGCFLFGLLLYSAIVRAEYPQIGSNFVPSILCVVLA
FT                   LWLVVKLRARKPDSNDINTP"
FT   sig_peptide     150136..150219
FT                   /locus_tag="Dd1591_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.920) with cleavage site probability 0.730 at
FT                   residue 28"
FT   gene            complement(150523..151626)
FT                   /locus_tag="Dd1591_0131"
FT   CDS_pept        complement(150523..151626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0131"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="KEGG: eca:ECA4239 tRNA
FT                   (uracil-5-)-methyltransferase; TIGRFAM: tRNA
FT                   (uracil-5-)-methyltransferase; PFAM:
FT                   (Uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05024"
FT                   /db_xref="GOA:C6CG41"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6CG41"
FT                   /inference="protein motif:TFAM:TIGR02143"
FT                   /protein_id="ACT05024.1"
FT                   /translation="MTPEILPIDQYDAQLEEKTGRLGAMMAPFDAPAPAVFRSPVSHYR
FT                   MRAEFRIWHDGDDLYHIMFDQQTKQRIRVDQFPAASELINRLMPVLLNALRAEPVLRRK
FT                   LFQLDYLSTLSGEIAVSLLYHKALDDEWRQRARELCDELRAQGFALQLIGRATKTKICL
FT                   DRDYVDECLPVAGRQMIYRQVENSFTQPNAMMNIQMLEWALSVTQGSTGDLLELYCGNG
FT                   NFSLALARNFERVLATEIAKPSVAAAQYNIAANQIDNVQIIRMAAEEFTQAMNGVRQFN
FT                   RLQGIDLAGYRCETIFVDPPRSGLDDGTAKLVQAYPRILYISCNPETLCANLETLSQTH
FT                   RISQLALFDQFPYTHHMECGVLLEKRQ"
FT   misc_binding    151779..151978
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 104.10"
FT   gene            152049..153944
FT                   /locus_tag="Dd1591_0132"
FT   CDS_pept        152049..153944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0132"
FT                   /product="TonB-dependent vitamin B12 receptor"
FT                   /note="TIGRFAM: TonB-dependent vitamin B12 receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: yen:YE0139 vitamin B12/cobalamin outer membrane
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05025"
FT                   /db_xref="GOA:C6CG42"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG42"
FT                   /inference="protein motif:TFAM:TIGR01779"
FT                   /protein_id="ACT05025.1"
FT                   /translation="MFNKKITMLAAMIATAFSGWAQGSDNTQQNNNDAMVVTANRFPQP
FT                   ISSVLAPTTVVTRDDIDRWQSKNVLEVMKRLPGVDISQNGGLGQSASIYIRGSEARHTL
FT                   VLIDGVPLAKPGITGVADFNQIPMSLVQRIEFIRGPRSSVYGADAIGGVINIITQSDKK
FT                   GGTLETGIGSNHYQQYNGSLRQAITDNTTLTLAGAYQDTKGFNIRPTSTYSPDSDRDGW
FT                   RNKSFWGGVDHRFNEQWSAFIRGYGYGSNSDYDAGFANSADEQQVYNHTYNTGVRFAEG
FT                   DFASQLIASYQKYNFLNYLGTEGRYGSASSLDKMEQRNLQWGNTYRIGQGMLSAGLDWQ
FT                   QQKLISEGMSFNTAARESDDYKRDNTGVYLTAQQQISSVTIEGSLRSDDNEQFGQHGTW
FT                   QTAAGWEFLPDYKLTLSYGTGFQAPTLGQMFGQKHNDIISNKNLKPEESKQWEAGLEGV
FT                   TGPLNWRLSAYHNEVTNLLTYSSDPVTFEGVYSNIKAATLKGVEWTGQFDTGIFNHQIT
FT                   LGYLDARRDEDNEVLARRAKQQAKYRLGWQVFDVDVDVSYQYFSKRYDNNTNEFASTQR
FT                   QLPSYSTVDIAASYPVTSHLTVRARIANLFDKNYETAYGYRTAGREYYLTGSYSF"
FT   sig_peptide     152049..152114
FT                   /locus_tag="Dd1591_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.820 at
FT                   residue 22"
FT   gene            153889..154761
FT                   /locus_tag="Dd1591_0133"
FT   CDS_pept        153889..154761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0133"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: eca:ECA4237 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05026"
FT                   /db_xref="GOA:C6CG43"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:C6CG43"
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /protein_id="ACT05026.1"
FT                   /translation="MATELQGENIISPEAIVSDLPARPTVLVFDSGVGGLSVYDEVRKL
FT                   LPDLHYIYAFDNEAFPYGEKPEQFIIERVLSIVDAVEKQHPLSLVIIACNTASTISLPA
FT                   LRERFDFPVVGVVPAVKPAAKLTRNGVVGLLATRATVQRSYTHELISRFAHDCQILLLG
FT                   SAELVEFAEAKLQGESVSEEVLRKILRPWLKLAEPPDTVVLGCTHFPLLAEELQRVLPD
FT                   GTRLVDSGSAIARRTAWLIEHLDNPKCSTEKNLAYCLSITPKVAALWPVLRRYGFNSLE
FT                   KLPLAPVSE"
FT   gene            155115..156644
FT                   /locus_tag="Dd1591_R0001"
FT   rRNA            155115..156644
FT                   /locus_tag="Dd1591_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            156719..156795
FT                   /locus_tag="Dd1591_R0002"
FT                   /note="tRNA-Ile1"
FT   tRNA            156719..156795
FT                   /locus_tag="Dd1591_R0002"
FT                   /product="tRNA-Ile"
FT   gene            156908..156983
FT                   /locus_tag="Dd1591_R0003"
FT                   /note="tRNA-Ala1"
FT   tRNA            156908..156983
FT                   /locus_tag="Dd1591_R0003"
FT                   /product="tRNA-Ala"
FT   gene            157153..160060
FT                   /locus_tag="Dd1591_R0004"
FT   rRNA            157153..160060
FT                   /locus_tag="Dd1591_R0004"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            160189..160303
FT                   /locus_tag="Dd1591_R0005"
FT   rRNA            160189..160303
FT                   /locus_tag="Dd1591_R0005"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            160369..160445
FT                   /locus_tag="Dd1591_R0006"
FT                   /note="tRNA-Asp1"
FT   tRNA            160369..160445
FT                   /locus_tag="Dd1591_R0006"
FT                   /product="tRNA-Asp"
FT   gene            160454..160529
FT                   /locus_tag="Dd1591_R0007"
FT                   /note="tRNA-Trp1"
FT   tRNA            160454..160529
FT                   /locus_tag="Dd1591_R0007"
FT                   /product="tRNA-Trp"
FT   gene            complement(160792..161619)
FT                   /locus_tag="Dd1591_0134"
FT   CDS_pept        complement(160792..161619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0134"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: eca:ECA4232 transcriptional
FT                   regulator HdfR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05027"
FT                   /db_xref="GOA:C6CGF5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR020890"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGF5"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACT05027.1"
FT                   /translation="MDTDLLKTFLEVSRTRHFGRAAESLYLTQSAVSFRIRQLENQLGA
FT                   NLFTRHRNNIRLTPAGERLLPYAESLIGTWQIAKKEVARSQQHSQLSIGATASLWEAFL
FT                   TPWLNELYQQRPLLQLEARIALRQTLIKQLHERQLDLLITTESPKMDELSCQLLGNFSL
FT                   SLFASANNTVTEERPYIRLEWGADFHQHETPWLPSDQVPSLTTSSAHLTRQLMSSIGGC
FT                   AFLPSEWSQYYPELLLISEANTIVRPCYAVWLENSDQQELIKQLLKTPLNIAS"
FT   gene            161740..162078
FT                   /locus_tag="Dd1591_0135"
FT   CDS_pept        161740..162078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0135"
FT                   /product="protein of unknown function DUF413"
FT                   /note="PFAM: protein of unknown function DUF413; KEGG:
FT                   eca:ECA4231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05028"
FT                   /db_xref="InterPro:IPR007335"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGF6"
FT                   /inference="protein motif:PFAM:PF04219"
FT                   /protein_id="ACT05028.1"
FT                   /translation="MAESFSTTSRFFDNRFYPRGFSRHGDFTIKEAQLLERYGHAFNEL
FT                   DSGKRHPVTEEETQFVAVCRGERAAQTELEKIWAKYTSRIRRPKRFHTLSGGKPQMDAV
FT                   EEYTESDD"
FT   gene            complement(162141..163667)
FT                   /locus_tag="Dd1591_0136"
FT   CDS_pept        complement(162141..163667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0136"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: eca:ECA4230 magnesium-chelatase; TIGRFAM: Mg
FT                   chelatase, subunit ChlI; PFAM: magnesium chelatase ChlI
FT                   subunit; ATPase associated with various cellular activities
FT                   AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05029"
FT                   /db_xref="GOA:C6CGF7"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGF7"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ACT05029.1"
FT                   /translation="MTLAVTYTRATIGMQAPEVSIEVHISNGLPALTLVGLPETTVKEA
FT                   RDRVRSALINCGFTFPAKRITVNLAPADLPKEGGRYDLPIALAILAASEQIAGEKLAQY
FT                   EFLGELGLSGSLRGVHGAIPAALEAQKVGRSLILPEDNKMEMTLVPHGDTFLANHLLQV
FT                   CAFLQGEATLLRGDNIAYNAPPHTPAPDLKEIIGQEQAKRALEIAAAGGHNLLLLGPPG
FT                   TGKTMLASRLSGLLPELNDDEALESAAINSLIDIHSGLSQWRKRPFRSPHHTASITALV
FT                   GGGVLPKPGEISLAHNGVLFLDELPEFERRVLDSLREPLESGEIVISRTRAKVCYPARF
FT                   QLVAAMNPSPSGHYQGIHNRMPAQQILRYLNRLSGPFLDRFDLSIEVPLLPPGILQQQT
FT                   RIGEDSATVRERVFEARKRQLDRVGRINAQMKSDDIASHCRLKNEDAVYLEEVMSKLGL
FT                   SVRAWHRILKVSRTIADLGGEEQIRRAHLSEALSYRCMDRLLIQLHKSLA"
FT   gene            164014..165225
FT                   /locus_tag="Dd1591_0137"
FT   CDS_pept        164014..165225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0137"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: spe:Spro_4761 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05030"
FT                   /db_xref="GOA:C6CGF8"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGF8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACT05030.1"
FT                   /translation="MFGWTSLQRNAAIASFLSWALDAFDFFILVFLLSELAHAFSVSME
FT                   QISLAILLTLAVRPVGALLLGRLAETFGRKSVLMANIVLFSLFELLSATAPNIIVFLLL
FT                   RMLYGVAMGGVWGVASSLAMETIPDRSRGLMSGIFQAGYPFGYLLAAVVYGLLFDQVGW
FT                   RGMFIIGAVPILLLPFIYFCVEESPVWRAARIRKESTALLPVLKTHWKLCVYLVVLMTS
FT                   FNFFSHGTQDLYPAFLKIQHGFDAKTVSMIAISYNIAAIIGGIFFGTLSERIGRKKAII
FT                   AAALLALPVIPLWAFSQGPWMLGLGAFLIQFMVQGAWGVIPTLLNELVPGNTRAVLPGF
FT                   VYQLGNLIASSNATLQASIAEAHNHNYAMAMAAVAGIVAIVIAALAAFADSGWVTKKTN
FT                   LDMS"
FT   gene            165607..167253
FT                   /locus_tag="Dd1591_0138"
FT   CDS_pept        165607..167253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0138"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; KEGG: eca:ECA4229 acetolactate synthase 2
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05031"
FT                   /db_xref="GOA:C6CGF9"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGF9"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ACT05031.1"
FT                   /translation="MNGAQWVVQALRAQGVETVFGYPGGAIMPVYDALYDGGVEHLLCR
FT                   HEQGAAMAAIGYARSTGKVGVCIATSGPGATNLITGLADALLDSVPIVAITGQVGSALI
FT                   GTDAFQEIDVLGLSLACTKHSFLVESIDSLPEIMAEAFAVARSGRPGPVLIDIPKDIQL
FT                   AEGDFSPCFMPVDDAMPFSIQQVTEARAMLAQAKKPVLYIGGGVGMAQAVPALRTFIET
FT                   TRIPAVATLKGLGAVEKDYPYYLGMIGMHGTRAANLMVQECDLLVAVGARFDDRVTGKL
FT                   SAFAPHASVIHMDIDPAELNKLRQAHVALRGDLNQLLPALQQPLNIADWRQQAAMMRAE
FT                   YEWRYDHPGEAIYAPALLRTLADRMPAETVITTDVGQHQMWAAQHMHFTRPENFITSSG
FT                   LGTMGFGVPAAVGAQVARPDDTVICISGDGSFMMNVQELGTIKRKRLPLKIVLLDNQRL
FT                   GMVRQWQQLFFDERYSETNLSDNPDFLMLASAFGIPGRQITRKDQIDSALDALLNSEGP
FT                   YLLHVSIDENENVWPLVPPGAGNETMLDKTE"
FT   gene            167307..167564
FT                   /locus_tag="Dd1591_0139"
FT   CDS_pept        167307..167564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0139"
FT                   /product="acetolactate synthase 2 regulatory subunit"
FT                   /note="KEGG: eca:ECA4228 acetolactate synthase 2 regulatory
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05032"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGG0"
FT                   /inference="similar to AA sequence:KEGG:ECA4228"
FT                   /protein_id="ACT05032.1"
FT                   /translation="MTHHQLSIQARYRPEVLERVLRVARHRGFQVCAMNMTQANSDDQV
FT                   QIDMTVASHRPVDLLSTQLSKLLDIACVEIQPLTSQQIRA"
FT   gene            167588..168514
FT                   /locus_tag="Dd1591_0140"
FT   CDS_pept        167588..168514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0140"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: spe:Spro_4758
FT                   branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05033"
FT                   /db_xref="GOA:C6CGG1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGG1"
FT                   /inference="protein motif:TFAM:TIGR01122"
FT                   /protein_id="ACT05033.1"
FT                   /translation="MTKKADYIWFNGEMVPWADAKVHVMSHALHYGTSVFEGVRCYSSH
FT                   KGPVVFRHREHMQRLHDSAKIYRMPISYSVDELMEACRETLRRNNLTSAYIRPLVFVGD
FT                   VGMGVNPPVGYNTDVIIAAFPWGAYLGEEALDQGIDAMVSSWNRVAANTIPTAAKAGGN
FT                   YLSSLLVGSEARRHGYQEGIALDVNGYVSEGAGENLFEVKEGVIFTPPFTSAALPGITR
FT                   DAIIKLAKDKGFEVREQVLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGIGKCGPVT
FT                   KQLQQAFFGLFTGETEDKWGWLDPINR"
FT   gene            168588..170438
FT                   /locus_tag="Dd1591_0141"
FT   CDS_pept        168588..170438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0141"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="KEGG: ect:ECIAI39_3015 dihydroxyacid dehydratase;
FT                   TIGRFAM: dihydroxy-acid dehydratase; PFAM: dihydroxy-acid
FT                   and 6-phosphogluconate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05034"
FT                   /db_xref="GOA:C6CGG2"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGG2"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ACT05034.1"
FT                   /translation="MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQ
FT                   FVPGHVHLRDLGKLVAEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSNQLIKLD
FT                   LVDAMIQGANPNVSDADSDQIERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLL
FT                   ATHADRKELFINAGKRIVELTKRYYEQDDASALPRNIATKAAFENAMTLDIAMGGSTNT
FT                   VLHLLASAQEAEVDFTMDDIDRLSRKVPQLCKVAPSTQKYHMEDVHRAGGVIGILGELD
FT                   RAGLLNKNVKNVLGLTLPETLSAYDVMLTQDDEVKKMFAAGPAGIRTTQAFSQDCRWES
FT                   LDTDRQEGCIRSREHAYSQDGGLAVLYGNLAEDGCIVKTAGVDEGSLVFRGPAKVYESQ
FT                   DDAVDAILGGRVQAGDVVVIRYEGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFS
FT                   GGTSGLSIGHASPEAANGGTIGLVQDGDMIAIDIPKRSIALDVSDDELARRREQELARG
FT                   DAAWTPKNRNRQVSFALRAYASLATSADKGAVRDKSKLGG"
FT   gene            170444..171988
FT                   /locus_tag="Dd1591_0142"
FT   CDS_pept        170444..171988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0142"
FT                   /product="threonine dehydratase, biosynthetic"
FT                   /note="TIGRFAM: threonine dehydratase, biosynthetic; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   Threonine dehydratase domain protein; KEGG: eca:ECA4225
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05035"
FT                   /db_xref="GOA:C6CGG3"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGG3"
FT                   /inference="protein motif:TFAM:TIGR01124"
FT                   /protein_id="ACT05035.1"
FT                   /translation="MAVSQPLPAEPGGAEYLRAVLRAPVYEVAQVTPLEPMDKLSSRLG
FT                   NVILVKREDRQPVHSFKLRGAYAMMASLSNEQKSHGVVTASAGNHAQGVALSASRLGIR
FT                   ALIVMPVATADIKVDAVRDFGGEVLLHGANFDEAKAKAIELSQQQHMTFVPPFDHPAVI
FT                   AGQGTLAMELLQQDAHLDRVFVPVGGGGLAAGVAVLIKQLMPQIQVIGVEAEDSACLRA
FT                   ALDAGQPVDLTRVGLFAEGVAVKRIGNETFRLCREYLDDVVTVDSDAICAAVKDLFEDV
FT                   RAIAEPSGALALAGMKKYIQQHNIQGERLAHILSGANVNFHGLRYVSERCELGEQREAL
FT                   MAVTIPEQKGSFLKFCQLLGGRSVTEFNYRYADADNACIFVGVRLTRGNVERHEILAEL
FT                   QAGGYQVVDLSDDEMAKLHVRYMVGGRPSKPLKERLYSFEFPESPGALLKFLNTLGTYW
FT                   NISLFHYRSHGTDFGRVLAAFERTEHDPAFEQHLQALGYECHDETQNPAFRFFLQG"
FT   gene            172097..172837
FT                   /locus_tag="Dd1591_0143"
FT   CDS_pept        172097..172837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05036"
FT                   /db_xref="InterPro:IPR012808"
FT                   /db_xref="InterPro:IPR015996"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGG4"
FT                   /inference="similar to AA sequence:KEGG:ECA4224"
FT                   /protein_id="ACT05036.1"
FT                   /translation="MATGFNGFSPQTLTFLQQVRQQDSKEWFEDHRQTYEDQLLTPFRA
FT                   LVDTLSIAMLQIDDHFETKPAVGKTLSRIHRDTRFSHDKSRYRDKMWFTFKRVHKDWTD
FT                   APTYFFELTPTDWRYGLGYYSASRTTMELFRQTLRDNPPGFLKVAACLGREFELVGESY
FT                   KRPLMKEQPAELATWYNRKSFAVMATRQDQAPLFSGELASVLAKGFTRLEPLYHYLMKI
FT                   ETMKKAAEPEKVSPAFLDEKWFSR"
FT   gene            complement(172841..173605)
FT                   /locus_tag="Dd1591_0144"
FT   CDS_pept        complement(172841..173605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05037"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGG5"
FT                   /inference="similar to AA sequence:KEGG:ECA4223"
FT                   /protein_id="ACT05037.1"
FT                   /translation="MKRLLATWLLPLVVGGSALPALAASFPCQQASSAQEKLICQTPAL
FT                   SQLDDELAKEWQKSRAFLTGNPERVAQEKILTQFQRSWLSSRNTCRDEECLRQSYQQQL
FT                   TRLRYLNDVTQHPLPDPIARSRRSGCFDGDYSYEYYLQLSTQEYDELSDYFKEMYDQKA
FT                   PYHLVNLTLNTEDGDITGTGSVAFRYANKLDDITLSARQMTDTQAIGQAESSFGGQKKL
FT                   LLTCVDNRQLQITVFDAAGESYLFDYLMAKGK"
FT   sig_peptide     complement(173534..173605)
FT                   /locus_tag="Dd1591_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 24"
FT   gene            complement(173605..174492)
FT                   /locus_tag="Dd1591_0145"
FT   CDS_pept        complement(173605..174492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0145"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: eca:ECA4222 DNA-binding transcriptional
FT                   regulator IlvY"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05038"
FT                   /db_xref="GOA:C6CGG6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037404"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGG6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACT05038.1"
FT                   /translation="MDLRDLKLFLHLVESRHFGRTAKAMHISPSTLSRQIQRLEEDIGQ
FT                   ALFLRDNRTVRLTDAGEHLKTFAQQTLLQYQQLRLILQQQGQSLSGELRLFCSVTAAYS
FT                   HLPPILDRFRARHPLVEIKLTTGDAADALDKVQSNEADLGIAGHPETLPTSVDFMPIGK
FT                   VPLVLIIPALPCPVQTQALQPHPDWSKIPFILPEHGPVRKRIDVWFRRQHITNPPIYAT
FT                   VSGHEAMVSMVALGCGIALIPDVVLENSPEPVRNRVSILEAQAMEPFELGVCVQKKHLS
FT                   SPLIAAFWETLQEK"
FT   gene            174662..176140
FT                   /locus_tag="Dd1591_0146"
FT   CDS_pept        174662..176140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0146"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="KEGG: eca:ECA4221 ketol-acid reductoisomerase;
FT                   TIGRFAM: ketol-acid reductoisomerase; PFAM: acetohydroxy
FT                   acid isomeroreductase; Acetohydroxy acid isomeroreductase
FT                   catalytic domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05039"
FT                   /db_xref="GOA:C6CGG7"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGG7"
FT                   /inference="protein motif:TFAM:TIGR00465"
FT                   /protein_id="ACT05039.1"
FT                   /translation="MANYFNTLNLRQQLAQLGKCRFMNRDEFADEASYLKGKKVVIVGC
FT                   GAQGLNQGLNMRDSGLDIAYALRAEAIAEKRASWRKATENGFKVGTYEELIPQADLVVN
FT                   LTPDKQHSAVVQAVQPLMKQGAALGYSHGFNIVEVGEQVRKDLTVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHRAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSLLSFDKLVADGVDPAYAEKLIQFGWETITEALKQGGITLMMDRLSNPA
FT                   KLRAFALSEQLKGIMAPLFQKHMDDIISGAFSSGMMADWANDDVKLLTWREETGKTAFE
FT                   NAPQFEGKIDEQEYFDNGVLMIAMVKAGVELAFETMVSSGIIEESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFANAAVPLLKGAFMDSLQPGDLGKPVAANSVDNAQ
FT                   LRDVNEAIRNHPIETVGKKLRGYMTDMKRIAVAG"
FT   gene            176232..176330
FT                   /locus_tag="Dd1591_0147"
FT   CDS_pept        176232..176330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05040"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05040.1"
FT                   /translation="MQEMKVGYRLDNRIRLHNKHETLKTRITVTHP"
FT   gene            complement(176368..177867)
FT                   /locus_tag="Dd1591_0148"
FT   CDS_pept        complement(176368..177867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0148"
FT                   /product="sodium/proline symporter"
FT                   /note="TIGRFAM: sodium/proline symporter; SSS sodium solute
FT                   transporter superfamily; PFAM: Na+/solute symporter; KEGG:
FT                   eca:ECA4218 sodium/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05041"
FT                   /db_xref="GOA:C6CGG9"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGG9"
FT                   /inference="protein motif:TFAM:TIGR02121"
FT                   /protein_id="ACT05041.1"
FT                   /translation="MTTMSTPLLVTFLVYIFGMVLIGLMAYRATHNFGDYILGGRRMGS
FT                   VVTALSAGASDMSGWLLMGLPGAVFLSGISESWIAIGLTIGAYLNWTWVAGRLRVHTEV
FT                   NHNALTLPDYFSHRFEDKSKLLRVISALVILVFFTIYCASGIVAGARLFESTFGMSYDT
FT                   ALWAGAAATIAYTFIGGYLAVSWTDTVQASLMIFALILTPVIVILSVGGITPSLAVIES
FT                   KNPANLDMFKGLDTIAILSLLGWGLGYFGQPHILARFMAADSHHTIRNARRISMTWMVL
FT                   CLAGAVTVGFFGIAYFTGNPEQAGNVTQNGERVFIELARLLFNPWIAGILLSAILAAVM
FT                   STLSCQLLVCSSAITEDLYKPFLRKNASQRELVWVGRAMVLLVSVIAIALAVNPENRVL
FT                   GLVSYAWAGFGAAFGPVILISLLWPRMTRNGALAGMLVGATTVIVWKQYGWLNLYEIIP
FT                   GFVLSCAAIMVVSLLGRAPSAVVTERFHQAEREFKSAPADA"
FT   gene            178228..182205
FT                   /locus_tag="Dd1591_0149"
FT   CDS_pept        178228..182205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0149"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Proline dehydrogenase; Aldehyde
FT                   Dehydrogenase; KEGG: spe:Spro_2931 trifunctional
FT                   transcriptional regulator/proline
FT                   dehydrogenase/pyrroline-5-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05042"
FT                   /db_xref="GOA:C6CGH1"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR024090"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGH1"
FT                   /inference="protein motif:TFAM:TIGR01238"
FT                   /protein_id="ACT05042.1"
FT                   /translation="MGTTTMGVKLDEATRERLKAAARRIDRTPHWLIKQAIFSYLERLE
FT                   SGADTPEIPQPAGQDLIEAAEIMPQSPQEETHQPFLDFAEQVLPQSVLRSAITAAYRRP
FT                   ETEIVPMLLEQARMPEAMSHVAGTLAARLAATLRNQKNSGGRAGMVQGLLQEFSLSSQE
FT                   GVALMCLAEALLRIPDKPTRDALIRDKISTGNWQSHVGRSASLFVNAAAWGLLVTGKLV
FT                   STHNESHLSGALNRIISKSGEPLVRKGVDMAMRLMGEQFVTGETIAEALANARKMEARG
FT                   FRYSYDMLGEAALTADDAEAYLASYQQAIHAIGKAAGGRGIYEGPGISIKLSALHPRYS
FT                   RAQYERVMDELYPRLLSLTRLARQYDIGINIDAEEADRLELSLDLLERLCFDPQLAGWN
FT                   GIGFVIQAYQKRCPFVIDALIDLARRSQRRLMIRLVKGAYWDSEIKRAQMDGLEGYPVY
FT                   TRKLYTDISYLACARRLLAVPNLIYPQFATHNAHTLSAIYHLAGNNYYPGQYEFQCLHG
FT                   MGEPLYEQVVGKMADGKLNRPCRIYAPVGTHETLLAYLVRRLLENGANTSFVNRIADPS
FT                   VALETLVADPVSEAEVLAARDGQVGQPHPRIPLPRALYGGTRRNAGGLDLSNEHRLASL
FT                   SSALLSGAARLWQAQPILAVEGAGGGEGRPVINPAEPRDVVGYVREAQPQDIAPALEQA
FT                   ASAGDIWFATPADERAAILSRAADLLESQQQHLLGLLVREAGKTLANAVAEVREAVDFL
FT                   RYYAAQVGETFNNHDYRPLGPVVCISPWNFPLAIFTGQIAAALAAGNSVLAKPAEQTPL
FT                   IAAQAVQILHEAGVPAGALQLLPGAGETVGAALVRDERVRGVMFTGSTAVAAQLQRVLA
FT                   GRLDPQGRTTPLIAETGGVNAMIVDSSALTEQVVADVVTSAFDSAGQRCSALRLLCVQE
FT                   EVAEKTLAMLRGAMAECRIGNPERLSTDVGPLIDAEAKQQIARHIQTLRTKGRLVFQAA
FT                   WTNSRDEAEWTRGHFIPPTLIELESVEELQQEVFGPVLHVVRYSRSQLDALIGQINAAG
FT                   YGLTLGLHTRIDETITRVTSQAKVGNLYVNRNMVGAVVGVQPFGGEGLSGTGPKAGGPL
FT                   YLHRLLSHRPDDAAIQTLARQDSERPADFTARQTLLAGLQALETWARQVQRDALVSCCQ
FT                   RYGELTQSGTVRVLPGPTGERDTYTLLPREQVLCVADNDDDALVQLAAVLAVGSRALWL
FT                   DTPERQALYRQLPERVRTRVAFCRDGVTDGSRFDAVIFHGDADQLRHLCEQLAQRDGAI
FT                   IGVQGLSRGETDIVLERLLLERSLSINIAAAGGNASLMTIG"
FT   gene            complement(182640..182921)
FT                   /locus_tag="Dd1591_0150"
FT   CDS_pept        complement(182640..182921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0150"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: eca:ECA4216 peptidyl-prolyl cis-trans isomerase C"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05043"
FT                   /db_xref="GOA:C6CGH2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGH2"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACT05043.1"
FT                   /translation="MANTAAALHILVDTEQQATDILAQLEKGADFQQLAKKHSTCPSKR
FT                   NGGDLGEFRKGDMVPDFDKAVFSCELLKPFGPVKTQFGYHIIKVLYRN"
FT   gene            183106..185130
FT                   /locus_tag="Dd1591_0151"
FT   CDS_pept        183106..185130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0151"
FT                   /product="ATP-dependent DNA helicase Rep"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase Rep; PFAM:
FT                   UvrD/REP helicase; KEGG: eca:ECA4215 ATP-dependent DNA
FT                   helicase Rep"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05044"
FT                   /db_xref="GOA:C6CGH3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGH3"
FT                   /inference="protein motif:TFAM:TIGR01074"
FT                   /protein_id="ACT05044.1"
FT                   /translation="MRMNPSQQHAVEFVTGPCLVLAGAGSGKTRVITQKIAHLIRGCGY
FT                   QARHIAAVTFTNKAAREMKERVAQTLGRQETRGLLIATFHTLGLEIIKREYAALGMKSN
FT                   FSLFDDQDQLALLKELTELWLENDKDLLQQLVSALSNWKNDLIDPAQAAAQARSERDRL
FT                   FAHCYRLYDDHLRACNVLDFDDLILLPTLLLKRNEEVRERWQNRLRYLLVDEYQDTNTS
FT                   QYELVKLLVGNRARFTVVGDDDQSIYSWRGARPQNLSLLQQDFPQLQVVKLEQNYRSSG
FT                   RILKAANILIANNPHVFEKRLYSELGYGEELKIITANNEEHEAERVVGELIAHHFIQKT
FT                   QYGDYAILYRGNHQSRLFEKVLMQNRIPYRISGGTSFFSRPEIKDLLAYLRVLTNPEDD
FT                   SAFLRIVNTPKREIGPATLQKLGEWARQRNRSLFNASFDMGLSQTLSGRGLESLQRFTQ
FT                   WMGDIARLAEQEPVKAVRDLIHGLDYESWLYETSPSPKAAEMRMKNVNTLFTWMTEMLE
FT                   GSDLDEPMTLTQVVTRFTLRDMMERNEAEEELDQVQLMTLHASKGLEFPYVYLVGMEEG
FT                   LLPHQTSIDEDNVDEERRLAYVGITRAQKALTFTLCRERRQYGELIRPEPSRFLLELPQ
FT                   DDVMWETERKVVSPQERMQKGQNHLANLRAQLAKARDKG"
FT   gene            complement(185183..186991)
FT                   /locus_tag="Dd1591_0152"
FT   CDS_pept        complement(185183..186991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0152"
FT                   /product="glycoside hydrolase family 28"
FT                   /note="PFAM: glycoside hydrolase family 28; Fibronectin
FT                   type III domain protein; SMART: Fibronectin type III domain
FT                   protein; KEGG: yen:YE0164
FT                   exo-poly-alpha-D-galacturonosidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05045"
FT                   /db_xref="GOA:C6CGH4"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGH4"
FT                   /inference="protein motif:PFAM:PF00295"
FT                   /protein_id="ACT05045.1"
FT                   /translation="MTTISRRHALASLVSVCLFGTPALAATSTTQAPQKLQIPTLSYDD
FT                   HSVMLVWDTPEDTSNITDYQIYQNGQLIGLASQNNDKNSPAKPYISAFYKSDAANFHHR
FT                   IILQNAKVDGLKAGTDYQFTVRTVYADGTTSADSNTVTATTTAVPKVINITQYGAKGDG
FT                   TTLNTSAIQKAIDACPTGCRIDVPAGVFKTGALWLKSDMTLNLLQGATLLGSDNAADYP
FT                   DAYKIYSYVSQVRPASLLNAIDKNSSAVGTFKNIRIVGKGIIDGNGWKRSADVKDELGN
FT                   TLPQYVKSDNSKVSKDGILAKNQVAAAVATGMDTKTAYSQRRSSLVTLRGVQNAYIADV
FT                   TIRNPANHGIMFLESENVVENGVIHQTFNANNGDGVEFGNSQNIMVFNSVFDTGDDSIN
FT                   FAAGMGQDAQKQEPSQNAWLFNNFFRHGHGAVVLGSHTGAGIVDVLAENNVITQNDVGL
FT                   RAKSAPAIGGGAHGIVFRNSAMKNLAKQAVIVTLSYADNNGTIDYTPAKVPARFYNFTV
FT                   KNVTVQDSTGSNPAIEITGDSSKDIWHSQFIFSNMKLSGVSPTSISDLSDSQFNNLTFS
FT                   NLRSGSSPWKFGTVKNVTVDGKTVTP"
FT   sig_peptide     complement(186914..186991)
FT                   /locus_tag="Dd1591_0152"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            complement(187322..189136)
FT                   /locus_tag="Dd1591_0153"
FT   CDS_pept        complement(187322..189136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0153"
FT                   /product="glycoside hydrolase family 28"
FT                   /note="PFAM: glycoside hydrolase family 28; Fibronectin
FT                   type III domain protein; SMART: Fibronectin type III domain
FT                   protein; Parallel beta-helix repeat; KEGG: yen:YE0164
FT                   exo-poly-alpha-D-galacturonosidase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05046"
FT                   /db_xref="GOA:C6CGH5"
FT                   /db_xref="InterPro:IPR000743"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGH5"
FT                   /inference="protein motif:PFAM:PF00295"
FT                   /protein_id="ACT05046.1"
FT                   /translation="MEIIILPRRFVLASMAALCLIGTPMLAAAFPVPQKLQIPTLSYDD
FT                   HSVVLVWDAPENTEVIADYQIYQNDQLIGLASKNNDINSPAKPYINAFYKNDTGNFHHR
FT                   VIMQNAKVSGLKASTEYAFTVRAVYADGSISANSNTVTVTTTAAPPVINITQYGAKGDG
FT                   TTLNTAAIQKAIDACQIGCRVDIPPGVFKIGALWLKSDMTLNLLQGATLLGSDKPSDYP
FT                   DTYSNNAYSSLSRPASLINAIDKNHASGGKLKNIRITGKGIIDGNGWKRSANVNDELGN
FT                   GLPQYVKSDSDRVSLDGILAKNQVEAAVASGVNIKTAYNQRRSSLISLSNVQNVYIADV
FT                   TIRNPANHGVMILENSNVVENGVTHQTFNTNNGDGVEFGSSQNIMVFNSVFDTGDDCIN
FT                   FASGMGQQAQSQAPVKNVWLFNNYFRHGHGAVVLGSHTGAGIIGIQAENSVMSQTDIGL
FT                   RAKSAPDIGGGAHDIIFRNNAMKNLARQAVMVTLNYVDNTGTINYTPARIPARFYNFTV
FT                   KNVTVQDSTGKNPSIEIVGDSSKNIWHSQLNFSDMKLSGVMPTSISDLSDSQFNNLVFS
FT                   NLRSGTSPWNFGTVRNVTVNGQTVPAAF"
FT   sig_peptide     complement(189047..189136)
FT                   /locus_tag="Dd1591_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.914 at
FT                   residue 30"
FT   gene            complement(189461..190963)
FT                   /locus_tag="Dd1591_0154"
FT   CDS_pept        complement(189461..190963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0154"
FT                   /product="Ppx/GppA phosphatase"
FT                   /EC_number="3.6.1.40"
FT                   /note="PFAM: Ppx/GppA phosphatase; KEGG: eca:ECA4214
FT                   guanosine pentaphosphate phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05047"
FT                   /db_xref="GOA:C6CGH6"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR023709"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGH6"
FT                   /inference="protein motif:PRIAM:3.6.1.40"
FT                   /protein_id="ACT05047.1"
FT                   /translation="MPMPSSSSLYAAIDLGSNSFHMLVVREVAGSVQTLARIKRKVRLA
FT                   AGLDANNRLSPEAMQRGWQCLALFSERLQDIPAQQVRVVATATLRLATNADEFLERARH
FT                   ILGLPIQVISGEEEARLIYQGVAHTTGGPEQRLVVDIGGGSTELATGTGAHHTQLFSLP
FT                   MGCVTWLERYFTDRDLTPAHFDRAEQAAREMLQPVKDILRRQGWQICVGASGTVQALQE
FT                   IMVAQGMDEYITLGKLRQLKQRAIQCSKLEELEIEGLTLERALVFPSGLSILLAIFQEL
FT                   DIDSMTLAGGALREGLVYGMLHLPIEQDIRHRTLQNLQRRYLLDSEQAQRVRLLADNFL
FT                   QQVARDWQLDGRCRELLSSAGLIHEIGLSVDFRQAPFHAAYLVRNSDLPGFTPAQKKLL
FT                   ATLLQNQSNTIDPIPLTQQNALPVNLAQRLCRLLRLAIIFASRRRDDTLPAVRLRVEGE
FT                   SLRVILPAGWLDQHPLRAETLSQESLWQSYVHWPLLIEEHTV"
FT   gene            complement(190971..192257)
FT                   /locus_tag="Dd1591_0155"
FT   CDS_pept        complement(190971..192257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0155"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; KEGG: yps:YPTB0165 ATP-dependent
FT                   RNA helicase RhlB"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05048"
FT                   /db_xref="GOA:C6CGH7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR023554"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGH7"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACT05048.1"
FT                   /translation="MSKTHLTEQKFSDFALHPQVIEALEKKGFHNCTPIQALALPLTLS
FT                   GRDVAGQAQTGTGKTLAFLASTFHYLLTHPASSERQTNQPRALIMAPTRELAVQIHTDA
FT                   EALAKATGLRLGLAYGGDGYDKQLKVLEDGVDILIGTTGRLIDYTKQNHVNMGAIQVVV
FT                   LDEADRMYDLGFIKDIRWLFRRMPPANQRLNMLFSATLSYRVRELAFEQMNNAEYVEVE
FT                   PEQKTGHRIKEELFYPSNEEKMRLLQTLIEEEWPDRCIIFANTKHRCEDIWGHLAADGH
FT                   RVGLLTGDVAQKKRLRILEDFTQGNLDILVATDVAARGLHIPSVTHVFNYDLPDDCEDY
FT                   VHRIGRTGRAGASGCSISLACEEYALNLPAIEDYTGHRIPVSKYRSEALLTDLPEPKRL
FT                   SRPRTSGGPRRPGAPRRSGAPRNNRKRPG"
FT   gene            192377..192703
FT                   /locus_tag="Dd1591_0156"
FT   CDS_pept        192377..192703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0156"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: eta:ETA_01950 thioredoxin 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05049"
FT                   /db_xref="GOA:C6CGH8"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGH8"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ACT05049.1"
FT                   /translation="MSDKIIHLTDDSFETDVLRSEHVTLVDFWADWCGPCKMIAPILDE
FT                   IADEFEGKLKIAKLNIDDNPATAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFL
FT                   NANL"
FT   gene            193133..194392
FT                   /locus_tag="Dd1591_0157"
FT   CDS_pept        193133..194392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0157"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: cko:CKO_00124 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Ribonuclease B OB region domain; Rho termination
FT                   factor domain protein; Rho termination factor RNA-binding;
FT                   SMART: Cold shock protein; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05050"
FT                   /db_xref="GOA:C6CGH9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGH9"
FT                   /inference="protein motif:TFAM:TIGR00767"
FT                   /protein_id="ACT05050.1"
FT                   /translation="MNLTELKNTPVSELITLGENMGLENLARMRKQDIIFAILKQHAKS
FT                   GEDIFGDGVLEILQDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNEVNYDKPENARSKILFENLTPLHANSRLRMERGNGSTEDLTARVLD
FT                   LASPIGRGQRGLIVAPPKAGKTMLLQNIAQSIAYNHPDCVLMVLLIDERPEEVTEMQRL
FT                   VKGEVVASTFDEPASRHVQVAEMVIEKAKRLVEHKKDVIILLDSITRLARAYNTVVPAS
FT                   GKVLTGGVDANALHRPKRFFGAARNVEEGGSLTIIATALIDTGSKMDEVIYEEFKGTGN
FT                   MELHLSRKIAEKRVFPAIDYNRSGTRKEELLTTSEELQKMWILRKIIHPMGETDAMEFL
FT                   INKLAMTKTNDEFFDMMKRS"
FT   gene            194631..195692
FT                   /locus_tag="Dd1591_0158"
FT   CDS_pept        194631..195692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0158"
FT                   /product="undecaprenyl-phosphate alpha-N-acetylglucosaminyl
FT                   1-phosphatetransferase"
FT                   /note="TIGRFAM: undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminyl 1-phosphatetransferase; PFAM:
FT                   glycosyl transferase family 4; KEGG: eca:ECA4210
FT                   undecaprenyl-phosphate alpha-N-acetylglucosaminyl
FT                   1-phosphate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05051"
FT                   /db_xref="GOA:C6CGI0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGI0"
FT                   /inference="protein motif:TFAM:TIGR02380"
FT                   /protein_id="ACT05051.1"
FT                   /translation="MMNAQLVAVFLCSFFSLLLARNVARKTGLVDRPNHRKRHHGAVPL
FT                   VGGISVYIGVCLLPLLIPEPIPHFLIYLMCSGLLVMVGVLDDRFDLSIGVRLAVQAVVA
FT                   ILMMALAGLMLQHLGSILGPAWDIGLGPVRYFMTLLVVWAAINAFNMVDGIDGLLGGLS
FT                   GVLFAGLGLLFYNHGNRVLALWSFAMLAATLPYILLNLECLGRRYKVFMGDAGSTMIGF
FT                   TAIWLLLQGSQGPVSVIRPVTALWVIAIPLMDMVAIVYRRLRKGTSLFSPDRQHIHHLL
FT                   MRAGLTPGQACLLITLVAALLAGVGIAGEMLAVPESVMFVLFLLVFGGYGYCIKRAWRV
FT                   ARVVRRWRSHRYC"
FT   sig_peptide     194631..194693
FT                   /locus_tag="Dd1591_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.924) with cleavage site probability 0.873 at
FT                   residue 21"
FT   gene            195714..196739
FT                   /locus_tag="Dd1591_0159"
FT   CDS_pept        195714..196739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0159"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   spe:Spro_0162 lipopolysaccharide biosynthesis protein WzzE"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05052"
FT                   /db_xref="GOA:C6CGI1"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032895"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGI1"
FT                   /inference="protein motif:PFAM:PF02706"
FT                   /protein_id="ACT05052.1"
FT                   /translation="MKREISPQAVSLDNELDIRRLCRVLWQGKRWIVGAAALFILSALV
FT                   YSWLVLPVWRATAVTDKPATAMLSTFFEQQQWLRSLDTSATAVSDGNAIVTDAYTEFAM
FT                   QAGAYDTRREFWLQSPYYRERQHGDGKADAVLLDTLINDIQFVPHDDAKKTNDTLRLAA
FT                   DNPQDASNLLRQYVQFANQRAVNHLNQNLAGRWAARIRFEHAWLQREEAVARAAYDQEL
FT                   RRVMQALAIARQQGISQPKDEAPPDSALFLQGVSGLQARLDMLKANGPVFDADYAPRQA
FT                   VLAMLESGPALADRYQTYRYLHTPEEPVQRESPRRGFLLLMWGSIGLLVGAGLALARRS
FT                   R"
FT   gene            196820..197950
FT                   /locus_tag="Dd1591_0160"
FT   CDS_pept        196820..197950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0160"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /note="KEGG: spe:Spro_0163 UDP-N-acetylglucosamine
FT                   2-epimerase; TIGRFAM: UDP-N-acetylglucosamine 2-epimerase;
FT                   PFAM: UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05053"
FT                   /db_xref="GOA:C6CGI2"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="InterPro:IPR032892"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGI2"
FT                   /inference="protein motif:TFAM:TIGR00236"
FT                   /protein_id="ACT05053.1"
FT                   /translation="MKVLTVFGTRPEAIKMAPIIRAMSQDTFFESRVCVTAQHRDMLDQ
FT                   VLRLFEITPDYDLNIMQPDQGLVDISSRILSGLGPVLTAFQPDLVLVHGDTTTTLMASL
FT                   AAFYHHVPVAHVEAGLRTGTLTSPWPEEANRLLTGRLAAYHFAPTTNARRNLRREQVPS
FT                   SRIWVTGNTVIDALFWVRDRITDDKALHAQLQERYRFLDPARKMILVTSHRRESFGEGM
FT                   ERICHALAALARHHPDIQIVYPVHRNPNVREPVQRILHGIDNVFLIAPQDYLPFVYLMH
FT                   RAWLILTDSGGIQEEAPSLGKPVLVMRETTERPEALAAGTVRLVGTDTATIVREVSRLL
FT                   ADAALYQAMSYAHNPYGDGVASQRILSVLKQHRVTA"
FT   gene            197947..199209
FT                   /locus_tag="Dd1591_0161"
FT   CDS_pept        197947..199209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0161"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /note="TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase; KEGG: yps:YPTB0171
FT                   UDP-N-acetyl-D-mannosamine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05054"
FT                   /db_xref="GOA:C6CGI3"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR032891"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGI3"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ACT05054.1"
FT                   /translation="MSFNRICVLGLGYIGLPTAAVLATRQQAVFGVDVNPHVVETLNRG
FT                   HTHIAEPGLAQAVQQAVAQGYLQAGSHPVSAQAFLIAVPTPLKADHQPDVSFIDAAALS
FT                   LASVLKPGDVVILESTSPVGTTERMAARLAQARPDLSFPQQTGEASDIRIAYCPERVLP
FT                   GRIMAELLSQDRVIGGMTPRCAARASELYRLFLDGECVMTDSRTAEMCKLTENSFRDVN
FT                   IAFANELSLICAEQQIDVWALIQLANRHPRVNILQPGPGVGGHCIAVDPWFIVAQHPQQ
FT                   ARLIRTAREVNDAKPGWVVDQVKIRVADALAQEGKSARELRIACLGLTFKPDVEDLRES
FT                   PALAIAEQIAGWHVGATWVVEPYIRQLPPGLQGKAELVNSDRALSEADMLVLLVDHRQF
FT                   RAIAPEQVAQHWVVDTKGVWR"
FT   sig_peptide     197947..198018
FT                   /locus_tag="Dd1591_0161"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.902) with cleavage site probability 0.529 at
FT                   residue 24"
FT   gene            199257..199973
FT                   /locus_tag="Dd1591_0162"
FT   CDS_pept        199257..199973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0162"
FT                   /product="TDP-D-fucosamine acetyltransferase"
FT                   /note="TIGRFAM: TDP-D-fucosamine acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase; KEGG: eca:ECA4205
FT                   TDP-fucosamine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05055"
FT                   /db_xref="GOA:C6CGI4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012752"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGI4"
FT                   /inference="protein motif:TFAM:TIGR02382"
FT                   /protein_id="ACT05055.1"
FT                   /translation="MPVRAEICAEIEPLVWESEFFQRISGRLSFADAAAPLTSADLDRY
FT                   ELCQAKLAAGDLATADALSTLGFRLAEGEVDFSMPVVPAARAVFAVGVREAEVADIPAL
FT                   RTAAAKSFVLSRFRSPWYRPDDCGRFYARWVEKAVYGTFDDACLVLGGQGGPLQGFVTL
FT                   RQTSPNAARIGVLSAWPGMTGQGLGQRLMQVARVWCQQRGIRRLTVATQTSNLAALRLY
FT                   LRSGARVESTAYWFYR"
FT   gene            200008..201138
FT                   /locus_tag="Dd1591_0163"
FT   CDS_pept        200008..201138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0163"
FT                   /product="TDP-4-keto-6-deoxy-D-glucose transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="KEGG: eca:ECA4204 TDP-4-oxo-6-deoxy-D-glucose
FT                   transaminase; TIGRFAM: TDP-4-keto-6-deoxy-D-glucose
FT                   transaminase; PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05056"
FT                   /db_xref="GOA:C6CGI5"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR012749"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR032894"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGI5"
FT                   /inference="protein motif:TFAM:TIGR02379"
FT                   /protein_id="ACT05056.1"
FT                   /translation="MIPFNAPPVVGSELEYMQAAMRSGKLSGDGMFTHRCQQWLEHYSG
FT                   SCKVLLTPSCTASLEMAALLLHIQPGDEVIMPSYTFVSTANAFVLRGATIVFVDIRPDT
FT                   LNLDENRIEAAITNKTRAIVVVHYAGVGCDMNAIMTLAQQHGLFVVEDAAQGMMSHYQD
FT                   RPLGAIGHIGCFSFHETKNYTAGGEGGATLINDPELAARAEIIREKGTNRSQFFRGQAD
FT                   KYTWRDIGSSYLMAEIQAAYLWGQLEAAQRIHDRRLALWRHYAHAFAPLAASGRVTLPV
FT                   IPADCRHNGHLFFLRLGNEAERSAFIRHMKAADILTVFHYIPLHASPAGRRFGRFVGED
FT                   RHTTRESERLVRLPLFYNLSDADQRTVIHSALSFFS"
FT   gene            201138..202388
FT                   /locus_tag="Dd1591_0164"
FT   CDS_pept        201138..202388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0164"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   eca:ECA4203 entero common antigen biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05057"
FT                   /db_xref="GOA:C6CGI7"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGI7"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ACT05057.1"
FT                   /translation="MSLARASLWTAASTLVKIGAGLVVIKLLAVAFGPEGVGLAGNYRQ
FT                   LITVLGVMAGAGIVNGVTRAVAATPPDPDRPNPLLGTAVSLSMGFSLLLTLVLWGLSAP
FT                   LSRLLFGDDGYQPVIRALAWLQLGIALASLLLAILKGYQDAQGNALAVIAGSLLGAVAY
FT                   GMIFWLGAYTGALVGLALMPALVCVPALVLLLRRTPLGLRALTPSWSWPLAAQLTRFSL
FT                   MTLTTAVTLPVGYVMMRNLLAAHYSWLEVGLWQGMTTISDAWLQFITASFTVYLLPALA
FT                   RLQDKNAVRHEIFSALRWVLPVAALVAAAIWLARDVAIHILFSGAFSSMRGLFAWQLAG
FT                   DVLKVGAYVFGYLVIAKASLRFYVLAELSQFLLLTGFARWLIPLHGALGASQAYLATYA
FT                   VYFLLCCGVFMLYCRRA"
FT   gene            202385..203470
FT                   /locus_tag="Dd1591_0165"
FT   CDS_pept        202385..203470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0165"
FT                   /product="4-alpha-L-fucosyltransferase"
FT                   /note="PFAM: 4-alpha-L-fucosyltransferase; KEGG:
FT                   eca:ECA4202 4-alpha-L-fucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05058"
FT                   /db_xref="GOA:C6CGI8"
FT                   /db_xref="InterPro:IPR009993"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGI8"
FT                   /inference="protein motif:PFAM:PF07429"
FT                   /protein_id="ACT05058.1"
FT                   /translation="MTTLIHVLGADIPHHNHTVLRFFNDTLAPSLPLHQTRRFMVVSSA
FT                   AFSESDYPMLHVTRFSSQKALARAVVAQAREDRSVRFFFHGQFNPWLWLALLCGGIRPT
FT                   QAYWHIWGADLYEEARGWRYHWFYRLRRLAQRRVARVFATRGDIDYFRRRYPAAATSLL
FT                   YFPTRMSQHAASPDEKTPDAPLTILVGNSGDRSNRHLAALDAIHRQFGTQVRVIVPMGY
FT                   PAGNHAYVEQVSQHGLALFGAERCRVLRESLAFDDYLALLRTCDLGYFLFHRQQGIGTL
FT                   CLLIQLGVPFVISRHNPFRQDLAEQRLPVLLGEEELNETMVRDAREQLRRVDTRQIAFF
FT                   SPGYESGWRQALALAAGDGDD"
FT   gene            203463..204791
FT                   /locus_tag="Dd1591_0166"
FT   CDS_pept        203463..204791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0166"
FT                   /product="WzyE family protein"
FT                   /note="PFAM: WzyE family protein; KEGG: eca:ECA4201
FT                   putative entero common antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05059"
FT                   /db_xref="GOA:C6CGI9"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGI9"
FT                   /inference="protein motif:PFAM:PF06899"
FT                   /protein_id="ACT05059.1"
FT                   /translation="MTEWTFFGLWLVWLCGGGVVLWLSWREFRRWCFNFNVLFSLLYLL
FT                   TFYFGFPLTALLTFRFGVETASPLNLLSALLSATAFYVIYYVSYHTRLRPVPPASRPLP
FT                   LTMTRLEALLTGGLLALVALTTAAVFFANNGLLLFKLSSYSQIFSRDIAGVALKRFFYF
FT                   FIPAMLMWYFLHQTRRAWLIFLLATVAFGGLTYLLVGGTRANIIIAFALFLFIGLQRGW
FT                   IALWMLATAGCAGIVAMFWLALKRYGLDVRGEQAFYTFLYLTRDTFSPWENLATLWQHL
FT                   DQITLQGLAPIVRDFYVFIPTWLWPERPALVLNSANYFTWEVLNYHAGLAISPTLLGSL
FT                   LIMGGPLLIPPGAVAVGLLIRGFDSLYRYGRQAENRYLSAVLQAFCFGAVFNLIVLVRE
FT                   GVDAFVSRVVFFCLIFAACLLAANLLYWLLLRAGVVVSQGDVE"
FT   gene            204788..205522
FT                   /locus_tag="Dd1591_0167"
FT   CDS_pept        204788..205522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0167"
FT                   /product="glycosyl transferase, WecB/TagA/CpsF family"
FT                   /EC_number="2.4.1.187"
FT                   /note="KEGG: eca:ECA4200 putative
FT                   UDP-N-acetyl-D-mannosaminuronic acid transferase; TIGRFAM:
FT                   glycosyl transferase, WecB/TagA/CpsF family; PFAM: glycosyl
FT                   transferase WecB/TagA/CpsF"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05060"
FT                   /db_xref="GOA:C6CGJ0"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="InterPro:IPR023085"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGJ0"
FT                   /inference="protein motif:TFAM:TIGR00696"
FT                   /protein_id="ACT05060.1"
FT                   /translation="MKDVPQYAIRGIPVQGFRDREQCVSTLFAGGSPPAGTLIAINAEK
FT                   VLAAEHDATLRELMRQEEHCNYADGISVVCSIRRKYPGAQVERIAGADLWEALMQRAGQ
FT                   MGTPVFLLGGKPAVLAETERKLREQWQVNIVGVQDGYFAPEQRQSVLARVRDSGAQLVT
FT                   VALGSPRQELLIRDCRQLYPDALYMGVGGTYDVFTGQVKRAPLTWQRYGVEWLYRLLTQ
FT                   PSRFRRQLKLLRYLAWHVGGRL"
FT   gene            205810..207204
FT                   /locus_tag="Dd1591_0168"
FT   CDS_pept        205810..207204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0168"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   eca:ECA4199 putative transport protein YifK"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05061"
FT                   /db_xref="GOA:C6CGJ1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGJ1"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACT05061.1"
FT                   /translation="MANTEKQDKLHRGLEARHIELIALGGTIGVGLFMGAASALKWAGP
FT                   SVLLAYIVAGVFVFFIMRSMGEMLFLEPVTGSFAVYAHNYLSPFFGYLTAWGYWFMWMA
FT                   VGISEITAIGVYVQYWFPTLPQWIPAIGAVALVAAANLAAVRLYGEIEFWFSMIKITTI
FT                   VVMIVVGVGIIFFGIGNHGQATGFANLTEHGGFLAGGWKGLLFALCLVVASYQGVELVG
FT                   ITAGEARNPQVTLKRAINNILWRILIFYVGAIFVIVTIFPWNEIGTSGSPFVLTFAKIG
FT                   ITAAAGIINFVVLTAALSGCNSGMYSCGRMLYSLANNRQLPAALGRVTAGGVPAVGVMV
FT                   SILCLVAGSALNYVIPNPEKVFVYVYSASVLPGMIPWFVVLISQLRFRQQHQSAIAGHP
FT                   FKSILFPWVNYLTMAFLLCVLVGMYINEDTRMSLVVGGIFLAAVSLIYVALGLGKKQMQ
FT                   MQAEAE"
FT   gene            207352..207428
FT                   /locus_tag="Dd1591_R0008"
FT                   /note="tRNA-Arg1"
FT   tRNA            207352..207428
FT                   /locus_tag="Dd1591_R0008"
FT                   /product="tRNA-Arg"
FT   gene            207511..207586
FT                   /locus_tag="Dd1591_R0009"
FT                   /note="tRNA-His1"
FT   tRNA            207511..207586
FT                   /locus_tag="Dd1591_R0009"
FT                   /product="tRNA-His"
FT   gene            207605..207690
FT                   /locus_tag="Dd1591_R0010"
FT                   /note="tRNA-Leu1"
FT   tRNA            207605..207690
FT                   /locus_tag="Dd1591_R0010"
FT                   /product="tRNA-Leu"
FT   gene            207718..207794
FT                   /locus_tag="Dd1591_R0011"
FT                   /note="tRNA-Pro1"
FT   tRNA            207718..207794
FT                   /locus_tag="Dd1591_R0011"
FT                   /product="tRNA-Pro"
FT   gene            207977..208315
FT                   /locus_tag="Dd1591_0169"
FT   CDS_pept        207977..208315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0169"
FT                   /product="steroid delta-isomerase domain-containing
FT                   protein"
FT                   /note="KEGG: aha:AHA_0731 steroid delta-isomerase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05062"
FT                   /db_xref="GOA:C6CGJ2"
FT                   /db_xref="InterPro:IPR008317"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGJ2"
FT                   /inference="similar to AA sequence:KEGG:AHA_0731"
FT                   /protein_id="ACT05062.1"
FT                   /translation="MSIIAPVEKQFAAYNAHDLAAFSACFHENFRAYRMPSEGPSIVGK
FT                   AALTAFYREHRFNNPALRAELVSRTVLGNQVFDHEKIYGLSPEPVESIAVFEVKDGLIT
FT                   TAWFYFAA"
FT   gene            208574..209938
FT                   /locus_tag="Dd1591_0170"
FT   CDS_pept        208574..209938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0170"
FT                   /product="adenylosuccinate lyase"
FT                   /note="TIGRFAM: adenylosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: eca:ECA4197 adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05063"
FT                   /db_xref="GOA:C6CGJ3"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGJ3"
FT                   /inference="protein motif:TFAM:TIGR00928"
FT                   /protein_id="ACT05063.1"
FT                   /translation="MASHLIDFLLIGNNFGTPEMRAVWSEQNRLTRQVDVEIALALAEG
FT                   ELGVIPQDAADTIASHANASALNIEEIAQDAVRMKHSLMPTIAAIQKQCGEAGEYIHYG
FT                   VTTQDVVDTATVLQLSQAFDIVVRDTRLVAIELKRLAKKHQHTLMTGRTHGMQALPTTF
FT                   GFKLAVWLDEFVRHLQRLNEIRDRVLVGNINGAIGTYASFGELGPEIERHTLARLGLNT
FT                   PNIGWQSARDRFSEYASVAVLVSGTLGKIGNELYNLMRTEINEIEEPFSEGKIGSTTMP
FT                   HKRNPAALEGLASLTAPLFKSAALIHESMKVEHERDAMSWRAEWIALPEINIYLSAQLQ
FT                   NALGILRGMSVNEKQMRANLDLQNGLLLSEKVMFEIGKLLGKQTAHHLVYECSMAAFEQ
FT                   NREFKALLLEHPVLSQHLTADTLDAWLDPANYVGSAPQKVDEVIRYADNTGLLAE"
FT   gene            209950..210474
FT                   /locus_tag="Dd1591_0171"
FT   CDS_pept        209950..210474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0171"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   eca:ECA4196 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05064"
FT                   /db_xref="GOA:C6CGJ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGJ4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACT05064.1"
FT                   /translation="MTTVFRQATLADDDAFLALALAAYAPVRELGIKFDAAYADIDMVR
FT                   RHLRSNGVYVMEKDGCLAASVTLRYPWGPNPGPYGLPHIGWFATHPDFKQQGLGKQMLD
FT                   WLEQAVLKDQLKAPAVTLGTAKQHPWLLEMYRKYGFQEVGQADLGKGHLTIYMRKVLDQ
FT                   DLYHHWEKKHP"
FT   gene            210488..211267
FT                   /locus_tag="Dd1591_0172"
FT   CDS_pept        210488..211267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0172"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   eca:ECA4195 putative amino-acid ABC transporter binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05065"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGJ5"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACT05065.1"
FT                   /translation="MTMKKIILPVLALSAAILVAGCDSQNSNEKVLRIGATGQSYPSSF
FT                   KQDSKLVGFDVEVAETIAKDLNYKVEWVTADFSGLMGQLEANKLNTIANVVAITPARQE
FT                   KYGFSTPYSYYGSQIVTHKDNTGINTLDDLKGKTVAGVLGSNHVNNLKKAFADGSVTIR
FT                   TYETRDGAMSDALAKRVEGYINSRPILLAEINKRNLPFKMVGEPLVVEQVGFPFHKDQK
FT                   GDELRKKFDDELTKMRNDGRLKALSVKYFGEDITAGK"
FT   sig_peptide     210488..210553
FT                   /locus_tag="Dd1591_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.434 at
FT                   residue 22"
FT   gene            211328..212011
FT                   /locus_tag="Dd1591_0173"
FT   CDS_pept        211328..212011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0173"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: eca:ECA4194
FT                   amino-acid ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05066"
FT                   /db_xref="GOA:C6CGJ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGJ6"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACT05066.1"
FT                   /translation="MVWLMNIDLSYLLKVFPQVLMYLPTTLLLAVVSMLFAIVLGLVLA
FT                   LIRESRFVVVSKLVEIYISLFRGIPSLVQLFIIYFGLPQLFPSLNGLSAMTAAIIGFSL
FT                   KNSAYMAEIFRAALASVDFGQTEAGLSVGMNKVQIYRRIVLPQAMLNALPATGNTFISL
FT                   IKDTSVAFALGVSELFAEGKMIAAESLRFFETFLVVGLIYWLLIVVYSWLQSQLEKKLS
FT                   HSRQR"
FT   gene            212021..212782
FT                   /locus_tag="Dd1591_0174"
FT   CDS_pept        212021..212782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0174"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMC domain protein;
FT                   SMART: AAA ATPase; KEGG: eca:ECA4193 putative amino-acid
FT                   ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05067"
FT                   /db_xref="GOA:C6CGJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGJ7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT05067.1"
FT                   /translation="MISVKNLTKRFGDQVVLNDISLDIAQGEVVAIIGPSGSGKSTLLR
FT                   CLNLLEKPESGVIAIGEQSLDTRRYSSKEEYALRRQTAMVFQNYNLFKNKTALENITEA
FT                   LIVVKKMSKKQADEIGLSLLELVGLLPQAHQYPVTLSGGQQQRVSIARALAVDPKAILF
FT                   DEPTSALDPERVHEVLQVIQKLAGQNTTMVIVTHEMQFAKEVADRVIFMADGHIVEQGP
FT                   AEKVISFSDNPQTRRFLRQLTTIQEPSEFDI"
FT   gene            212862..214022
FT                   /locus_tag="Dd1591_0175"
FT   CDS_pept        212862..214022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0175"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /note="KEGG: eca:ECA4192 putative peptidase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05068"
FT                   /db_xref="GOA:C6CGJ8"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR033846"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGJ8"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACT05068.1"
FT                   /translation="MKEYAQHVPLAQFIQAFRHDLHQHPELSNQEFETTKKIRAVLEKE
FT                   GIRILDLPLKTGLVAEVGGLQDGPLVVVRSDIDALPIEEESGVEFSSKNAGVMHACGHD
FT                   FHSSAALGAAILLKRIEPELKGTVRILFQAAEETGLGAPEVIAVGALDGASAIFGIHND
FT                   PTLPVGVIGGKDGALTAGVDRFEIKIAAKGCHAAKPHEGNDPIIILGQLISAVQTIISR
FT                   TVPSDNNAVVSITQVHSGSTWNVIPDTAYVEGTVRTFSQEVRDLIEQRFRQIVDGIAST
FT                   FGAEIEFIWHAGPPSVVNTPRWVDFALQVADAEGFEARRVDASPIGEDFAFYQQKLPGT
FT                   FMMVGSGGPYALHHPKFRVDDKALFPTAHYLYQLTKQSLDQLSQTA"
FT   gene            complement(214646..215842)
FT                   /locus_tag="Dd1591_0176"
FT   CDS_pept        complement(214646..215842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0176"
FT                   /product="HemY protein"
FT                   /note="KEGG: eca:ECA4191 putative protoheme IX biogenesis
FT                   protein; TIGRFAM: HemY protein; PFAM: HemY domain protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05069"
FT                   /db_xref="GOA:C6CGJ9"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGJ9"
FT                   /inference="protein motif:TFAM:TIGR00540"
FT                   /protein_id="ACT05069.1"
FT                   /translation="MLKVLLLFVVLIAGIIVGPMLAGHQGYVLIQTDSYNIETSVTGLV
FT                   IMLVLFMLAFLAVEWVVRRVLRTGVRTRGWFIGRKRTRARQQTKAALLKLTEGDYLQVE
FT                   KLLTRNADHAEQPVVNYLLAAEAAQQRGDEFRTRQYLERAAEIADSNQLPVDITRVRIQ
FT                   LARNEDHAARHGVDRLLEVAPRHPEVLRLAEQAFLRTHAYSALLDILPAMRKTRLHDEP
FT                   YLDELQQRATIGLMDQAMAEGGSEGLKQWWKNQPRKARQALPMQVAMAERLIVCDDHTT
FT                   AQDIVVDGLKQQFDHRLVQLIPRLNAGQPEPLEKLLRQRLKQHHNDALLHSTLGQLLMK
FT                   HGEWQQASDAFSAALALRPDAYDYAWCADAFDRLKRPEDAARMRRDGLLLTLQAPQDA"
FT   sig_peptide     complement(215771..215842)
FT                   /locus_tag="Dd1591_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.834) with cleavage site probability 0.769 at
FT                   residue 24"
FT   gene            complement(215845..216978)
FT                   /locus_tag="Dd1591_0177"
FT   CDS_pept        complement(215845..216978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0177"
FT                   /product="Uroporphyrinogen-III C-methyltransferase"
FT                   /EC_number="2.1.1.107"
FT                   /note="PFAM: protein of unknown function DUF513 hemX; KEGG:
FT                   eca:ECA4190 putative uroporphyrinogen III
FT                   C-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05070"
FT                   /db_xref="GOA:C6CGK0"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGK0"
FT                   /inference="protein motif:PRIAM:2.1.1.107"
FT                   /protein_id="ACT05070.1"
FT                   /translation="MTEHITSSTPSEEVVERAESSSPQKQPPVSKAPRHGLVVGAIAIV
FT                   VSLALSGGVYYYAHQQMTRQNAALNQLQEQLAALQKQQSQAQQQWQQTLDQQAKTLSAD
FT                   GQRLAALTRQAGEMQEKLATLANSDSKTWLLAQADFLVKQAGRKLWSDKDVTTAGALLK
FT                   SADASLADMNDPSLLDVRRAITHDIGMLAGVSQVDFDGIILKVNQLADQVDNLRLADTD
FT                   TDEAPMEESDATLSASLSEWRQNLSKSWHNFLSDFITIRRRDDSAEPLLAPNQDVYLRE
FT                   NIRSRLLVAAQAVPRHQNETYRQSLETAATWVRAYFDESDPTTKAFLDQLDTLSQQSVA
FT                   MDVPSELQSQPLLDKLMQTRVRNLLAQPSASATPQEG"
FT   gene            complement(217067..217807)
FT                   /locus_tag="Dd1591_0178"
FT   CDS_pept        complement(217067..217807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0178"
FT                   /product="Uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="PFAM: Uroporphyrinogen III synthase HEM4; KEGG:
FT                   eca:ECA4189 uroporphyrinogen-III synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05071"
FT                   /db_xref="GOA:C6CGK1"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGK1"
FT                   /inference="protein motif:PRIAM:4.2.1.75"
FT                   /protein_id="ACT05071.1"
FT                   /translation="MTILVTRPSPAGEQLVARLRMAGLPAYHSPLIEFSPGDELPQLPA
FT                   MLQALRPGDLVFALSQQVVEYADPALSRAGMRWPESLTYFAVGRSTGLALHTVSGLPVH
FT                   YPPERATSETLLQSPELQQVTGKQALLLRGNGGRELLGETLQQRGAQVRYCECYQRNPV
FT                   VYDGAEQCQRWQRLGIDTLVITSGEMLQQFYTLVPDYYRTTWLTGCRVVVVSERLAGVA
FT                   RELGWRDILIADNADNDALMRALQ"
FT   gene            complement(217804..218772)
FT                   /locus_tag="Dd1591_0179"
FT   CDS_pept        complement(217804..218772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0179"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="KEGG: ent:Ent638_3987 porphobilinogen deaminase;
FT                   TIGRFAM: porphobilinogen deaminase; PFAM: Porphobilinogen
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05072"
FT                   /db_xref="GOA:C6CGK2"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGK2"
FT                   /inference="protein motif:TFAM:TIGR00212"
FT                   /protein_id="ACT05072.1"
FT                   /translation="MDKKDQYGTSMVDTILRIATRQSPLALWQAHFVKQRLEDCHPGLQ
FT                   VELVPMVTRGDVLLDTPLAKVGGKGLFVKELELALLENRADIAVHSMKDVPVEFPEGLG
FT                   LVTICERDDPRDAFVSNHYATLDDLPEGACVGTSSLRRQCQLRAYRPDLVVRDLRGNVG
FT                   TRLSKLDNGDYDAIILAVAGLKRLGLAHRIRTALSPEQSLPAVGQGAVGVECRLDDART
FT                   RALLAPLNHEDTATRVLAERAMNTRLEGGCQVPIGSYAELQDETLYLRALVGAPDGSRI
FT                   IYAERRGSRQDAETLGIALADELLERGARDILQSVYGGASS"
FT   gene            219070..221628
FT                   /locus_tag="Dd1591_0180"
FT   CDS_pept        219070..221628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0180"
FT                   /product="putative adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="PFAM: adenylate cyclase class-I; KEGG: eca:ECA4187
FT                   adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05073"
FT                   /db_xref="GOA:C6CGK3"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="InterPro:IPR024686"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGK3"
FT                   /inference="protein motif:PRIAM:4.6.1.1"
FT                   /protein_id="ACT05073.1"
FT                   /translation="MYFYIETLKQRLDAINQLRVDRALEAMKPAFQQVYSLLPVLLHHH
FT                   HPLMPGYLEGKVPHGICLFSADEKQQHYLDSVELRWGELSVPDRKGELPITGVYSMGST
FT                   SSIGQSCSSDLDIWVCHQSWLDSEERQRLQQKCSLLEKWAAGQGVDVSFFLMDENRFRH
FT                   NESGSLGGEDCGSTQHILLLDEFYRTAVRMAGKRILWNMVPVEEEEHYDEFVLSLYARG
FT                   ALAPNEWLDLGGLSALSAEEYFGASLWQLYKSIDSPYKAVLKTLLLEAYSWEYPNTRLL
FT                   SSEIKTRLHNGEIVSFGLDPYCMMLERVTQYLNAINDPTRLDLVRRCFYLKVCEKLSRE
FT                   RACTAWRRQILTQLVQSWGWSDERLVMLDNRANWKIGQVREAHNELLDAMMQSYRNLIR
FT                   FARRNNLSVSASPQDIGVLTRKLYAAFEALPGKVTLVNPQISPDLSEPNLTFIYVPAGR
FT                   ANRSGWYLYNQAPSMDAIVSHQPLEYNRYLNKLVAWAYFNGLLTSATRLHIKGHELCDI
FT                   TRLQELVSDVSSHFPLRVAAPTPKALYSPCEIRHLAIIVNLEHDPTAAFRNQVVHFDFR
FT                   QLDVFSFGQQQQCLVGSIDLLYRNSWNEVRTLHFSGEQAMLEALKTILGKMHQDAALPE
FT                   SLEVFCYSQHLRGLIRTRVQQLVSECIELRLSSTRHEPSRFKAVKVAGETWGLFFERLS
FT                   VSAQKLENAVEFYGAISNNKLQGLPVQVETNHIHLPPVVDGVASEGIIQFFFEDQPDNQ
FT                   GFNIYILDESNRVEVYHHCEGSKEELVRDVSRFYSSSHDRFTYGSSFINFNLPQFYQIV
FT                   QLDGRTQVIPFRSNALSHLCVTPSSEDKPNLVLSQRLQML"
FT   gene            complement(221686..222006)
FT                   /locus_tag="Dd1591_0181"
FT   CDS_pept        complement(221686..222006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0181"
FT                   /product="iron donor protein CyaY"
FT                   /note="TIGRFAM: iron donor protein CyaY; PFAM: Frataxin
FT                   family protein; KEGG: eca:ECA4185 frataxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05074"
FT                   /db_xref="GOA:C6CGK4"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGK4"
FT                   /inference="protein motif:TFAM:TIGR03421"
FT                   /protein_id="ACT05074.1"
FT                   /translation="MNDSEFHQLADTLMLKIEETLDQFDGDADIDYETNGGVMTLSFEN
FT                   GSKIVINRQEPMHQVWLAAKSGGYHFDYQNNRWICDRSGSDFMTLLAQACSEQSGEEIH
FT                   FD"
FT   gene            222066..222248
FT                   /locus_tag="Dd1591_0182"
FT   CDS_pept        222066..222248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0182"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: eca:ECA4184 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05075"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGK5"
FT                   /inference="similar to AA sequence:KEGG:ECA4184"
FT                   /protein_id="ACT05075.1"
FT                   /translation="MTGFNEMKTLFRQGALALLVLSLAGCGLKGPLYFPPEQPVPAKKT
FT                   QQQNTQAPQASSARQ"
FT   gene            222337..223161
FT                   /locus_tag="Dd1591_0183"
FT   CDS_pept        222337..223161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0183"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="KEGG: eca:ECA4183 diaminopimelate epimerase;
FT                   TIGRFAM: diaminopimelate epimerase; PFAM: diaminopimelate
FT                   epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05076"
FT                   /db_xref="GOA:C6CGK6"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGK6"
FT                   /inference="protein motif:TFAM:TIGR00652"
FT                   /protein_id="ACT05076.1"
FT                   /translation="MQFSKMHGLGNDFMVVDAVTQNVYFSPELIRRLSDRHCGVGFDQL
FT                   LIVEPPYDPELDFHYRIFNADGSEVAQCGNGARCFARFVRLKGLTSKREINVSTHNGRM
FT                   VLSVTEDELVRVNMGEPNFEPQQVPFRAVKPEKTYILRAAERTVLCGVVSMGNPHCVLQ
FT                   VENVDSASVEELGPLLENHERFPERANVGFMQVVNPHLIRLRVFERGAGETQACGSGAC
FT                   AAVAVGIQQGLLAADVKVQLPGGELDIHWDGPGQPLFMTGPATHVYDGFIHL"
FT   gene            223158..223859
FT                   /locus_tag="Dd1591_0184"
FT   CDS_pept        223158..223859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0184"
FT                   /product="protein of unknown function DUF484"
FT                   /note="PFAM: protein of unknown function DUF484; KEGG:
FT                   eca:ECA4182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05077"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGK7"
FT                   /inference="protein motif:PFAM:PF04340"
FT                   /protein_id="ACT05077.1"
FT                   /translation="MKNVEEQAERQALTDELVLQHLRQHPDFFIRHARQVETLHIPHPV
FT                   RGSVSLVEWQLARQRNRIQFLEEEIALLMEQATRNEELFSQLLQLQMALSTADSLQDLL
FT                   DRLHRWARELGLAGAAIRLFTDRWRIGAPSDFTHLSLNRTLFEPLRIQRLGERQHYLGT
FT                   LNGPELLLLLPQARHVGSVALSLMGKHGDLGLLIFSSRDSHHYQDGMGTELLQHLATVV
FT                   PVLLERWIERL"
FT   gene            223856..224764
FT                   /locus_tag="Dd1591_0185"
FT   CDS_pept        223856..224764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0185"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: eca:ECA4181 site-specific tyrosine
FT                   recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05078"
FT                   /db_xref="GOA:C6CGK8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011931"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGK8"
FT                   /inference="protein motif:TFAM:TIGR02224"
FT                   /protein_id="ACT05078.1"
FT                   /translation="MNPDSPLSAPAEAFLRYLRVERQLSPLTQRSYAHQLQVIIEMLSS
FT                   SGIAEWQALDAAGVRAVVARSKRDGLNAASLAQRLSALRSLLDWLVGRGELKANPARGV
FT                   PAPKAGRHLPKNMDVDEMNRLLEIDLNDPLAVRDRAMLEVMYGAGLRLAELVGLDCGHI
FT                   NLESGEVWVMGKGSKERRLPVGATAVTWLTHWLAIREIYAPEDDAVFISSLGKRISMRN
FT                   VQKRFAEWGVKQGVNSHVNPHKLRHSFATHMLESSGDLRAVQELLGHANLSTTQIYTHL
FT                   DFQHLASVYDAAHPRAKRGKS"
FT   gene            224764..225480
FT                   /locus_tag="Dd1591_0186"
FT   CDS_pept        224764..225480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0186"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: ecg:E2348C_4112 predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05079"
FT                   /db_xref="GOA:C6CGK9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGK9"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACT05079.1"
FT                   /translation="MYFYRPLGRIEAITFDLDDTLYDNYEVIRRTEQESLRFLQHYHPG
FT                   LQAFTSEGLRQLRQELLAQEPEIYHDVTHWRWRSVHLAMTRVGLSPNEAAAGADAVMAE
FT                   FARWRSDIMVPQETHDTLRALGQRWPLVAITNGNADPHACGLGDYFQFILRAGPDGRSK
FT                   PSRDMYQLAAERLNLPLHNLLHVGDDLTTDVAGAIRSGVQSCWINLHDGNLMQIHDSRL
FT                   LPHVEIFSLASLTTLL"
FT   gene            225567..227729
FT                   /locus_tag="Dd1591_0187"
FT   CDS_pept        225567..227729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0187"
FT                   /product="DNA helicase II"
FT                   /note="TIGRFAM: DNA helicase II; PFAM: UvrD/REP helicase;
FT                   KEGG: eca:ECA4179 DNA-dependent helicase II"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05080"
FT                   /db_xref="GOA:C6CGL0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGL0"
FT                   /inference="protein motif:TFAM:TIGR01075"
FT                   /protein_id="ACT05080.1"
FT                   /translation="MDVSDLLDSLNDKQRDAVAAARSNMLVLAGAGSGKTRVLVHRIAW
FT                   LLTVENCSPYSIMAVTFTNKAAAEMRHRIDQLLGTSQGGMWIGTFHGLAHRLLRAHHLD
FT                   AGLPQDFQILDSEDQLRLLKRLIKALNLDEKQWPPRQAMWYINGKKDEGLRPQHIDSYG
FT                   NPVEQTWLRIYQAYQEACDRAGLVDFAELLLRAHELWLNKPHILQHYRDRFNNILVDEF
FT                   QDTNRIQYAWIRLLAGDSAKVMIVGDDDQSIYGWRGAQVENIQHFLRDFNDVTTIRLEQ
FT                   NYRSTANILNAANALIAHNGDRLGKNLWTDGIEGEPISLYCAFNELDEARFVVNRIKVW
FT                   QEAGGALSECAILYRSNAQSRVLEEALLQQSLPYRIYGGMRFFERQEIKDALSYLRLLT
FT                   NRNDDAAFERVVNTPTRGIGDRTLDVVRQTARDRQLTLWQATRALLQEKVLAGRAAAAL
FT                   QRFLELVDALASDTADLPLHVQTDRVIRDSGLWSMYEQEKGEKGQTRVENLEELVTATR
FT                   QFSYQDEDQDLLPLQAFLSHAALEAGEGQADAYQDAVQLMTLHSAKGLEFPQVFVVGME
FT                   EGMFPSQMSLDEGGRLEEERRLAYVGVTRAMQKLTLTYAESRRLYGKEAYHRPSRFIGE
FT                   LPVECVEEVRLRASVSRPVNHQRLGTPVSQSDTGYKLGQRVRHAKFGEGTIVNVEGSGE
FT                   HCRIQVAFAGQGIKWLVAAYARLEAV"
FT   gene            228113..229063
FT                   /locus_tag="Dd1591_0188"
FT   CDS_pept        228113..229063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0188"
FT                   /product="magnesium and cobalt transport protein CorA"
FT                   /note="TIGRFAM: magnesium and cobalt transport protein
FT                   CorA; PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: eca:ECA4177 magnesium/nickel/cobalt transporter CorA"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05081"
FT                   /db_xref="GOA:C6CGL1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGL1"
FT                   /inference="protein motif:TFAM:TIGR00383"
FT                   /protein_id="ACT05081.1"
FT                   /translation="MLSAFKLDNCRLTRLELDESDDLTTSLWVDLVEPDVEEREFVQNQ
FT                   LGQSLATRPELEDIEASARFFEDEDGLHIHSFFFFEDADDHAGNSTVAFTIRDGRLYTL
FT                   RERELPAFRLYRMRARAQTLVDGNAYELLLDLFETKIEQLADEIENIYSDLESLSRVIM
FT                   DGRQGDEYDDALSTLAELEDVGWKVRLCLMDTQRALNFLVRRARLPSGQLEQAREILRD
FT                   IESLLPHNESLFQKVNFLMQAAMGFINIEQNRIIKIFSVVSVVFLPPTLVASSYGMNFE
FT                   FMPELKWAYGYPGALVLMLLAGLAPYLYFKRRNWL"
FT   gene            229239..230297
FT                   /locus_tag="Dd1591_0189"
FT   CDS_pept        229239..230297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0189"
FT                   /product="membrane protein AbrB duplication"
FT                   /note="TIGRFAM: membrane protein AbrB duplication; PFAM:
FT                   putative ammonia monooxygenase; KEGG: eca:ECA4176
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05082"
FT                   /db_xref="GOA:C6CGL2"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGL2"
FT                   /inference="protein motif:TFAM:TIGR03082"
FT                   /protein_id="ACT05082.1"
FT                   /translation="MERFPASTQWFMLLAVSLVLGFGLQIYHVPAALLLGPMLVGVTMG
FT                   LNGATIRIPRPLFYASNAVLGCLVAQSLSLSILTPLVKEWPLVLFILLSTLVASGLSGW
FT                   LLMRYSELPGTTGTWGASPGGASAMVAMAGDFGADVRLVAFMQYLRVLMVTAAAAFVAR
FT                   ASLGQDAQANNALLVWFPELDWRFPATLAVAFSGAWIGRRLRIPSGQLLGPMIIGAMLH
FT                   STGTLALQTPEWLLALAYALIGWSVGLAFTRPVFLLALRTLPKMMMSIVTLMVLCGGMA
FT                   LMLTHLLSVDILTAYLATSPGGLDSIAIIAAGSRVDIAFVIAMQTMRLFSTLIFSPILS
FT                   RYISRHAVAGTA"
FT   gene            complement(230256..231176)
FT                   /locus_tag="Dd1591_0190"
FT   CDS_pept        complement(230256..231176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0190"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   eca:ECA4175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05083"
FT                   /db_xref="GOA:C6CGL3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGL3"
FT                   /inference="protein motif:TFAM:TIGR00688"
FT                   /protein_id="ACT05083.1"
FT                   /translation="MSMPQHRQGFLFALGAYILWGIAPIYFKQLGQVPADEILSHRIIW
FT                   SFLFMLLLLSLCRKWGVVRNACRRPRQLLLLAITATLVACNWLVYIWAVNHNHMLEASL
FT                   GYFINPLVSVLLGMIFLGERFRPTQWLAMLLAVCGVLVQLWTLGSLPVIALTLAFSFGI
FT                   YGLLRKKIAIDGQTGMLFETLWLLPAALVYLEWLADSPTSHLSQNPLSLNLLLIAAGIV
FT                   TTVPLLLFTAAAVRLRLSTLGFFQYLAPTLTFLLAVLVYGETITPDRLVTFAFIWLALG
FT                   VFTLDALYMQRRLRRAGHSVTRDVT"
FT   gene            complement(231278..231748)
FT                   /locus_tag="Dd1591_0191"
FT   CDS_pept        complement(231278..231748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0191"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   eca:ECA4174 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05084"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGL4"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACT05084.1"
FT                   /translation="MLTTPLTQDTVRQRVSDIFIYQMPFNQELGLTLETFSPDAVTLHF
FT                   RHQHKLVGNALQQILHGGVIAAGLDVAAGLVCVGSALLRHTTLSEQELQHRLSRMGTID
FT                   LRVDYLRPGRGEHFILTSQLLRSGNKIAVARAELHNEKQSHIASAIATYIVG"
FT   gene            231993..232862
FT                   /locus_tag="Dd1591_0192"
FT   CDS_pept        231993..232862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0192"
FT                   /product="Phospholipase A(2)"
FT                   /EC_number="3.1.1.4"
FT                   /note="PFAM: phospholipase A1; KEGG: eca:ECA4173
FT                   phospholipase A"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05085"
FT                   /db_xref="GOA:C6CGL5"
FT                   /db_xref="InterPro:IPR003187"
FT                   /db_xref="InterPro:IPR036541"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGL5"
FT                   /inference="protein motif:PRIAM:3.1.1.4"
FT                   /protein_id="ACT05085.1"
FT                   /translation="MYKSGGMVLALMLTATAQAQEARVQEIHDAPAVPGSIIAGLLQKH
FT                   DTPFMLYPYESNYLLYTYTSNINKQAIQSYSWADHARKDEVNFQISLGFPLWRGIAGDN
FT                   SLLGASYTQRSWWQMSNKSESTPFRETNYEPQLFLGWATDYRFAGWTLRDVELGVNHQS
FT                   NGRADPTSRSWNRVYARLMAQNGNWQVEVKPWVRLSDSEDDNPDIIRYMGHYRVRVGYH
FT                   WGDSIFSAEGRYNWNSGYGGGELGWSYPITDHVRFYTKVFSGYGESLIDYNHRQTRYGI
FT                   GVTLNDMF"
FT   sig_peptide     231993..232052
FT                   /locus_tag="Dd1591_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 20"
FT   gene            233061..234860
FT                   /locus_tag="Dd1591_0193"
FT   CDS_pept        233061..234860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0193"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: eca:ECA4172 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase RecQ; ATP-dependent DNA
FT                   helicase, RecQ family; PFAM: DEAD/DEAH box helicase domain
FT                   protein; HRDC domain protein; helicase domain protein;
FT                   SMART: DEAD-like helicase; helicase domain protein; HRDC
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05086"
FT                   /db_xref="GOA:C6CGL6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGL6"
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /protein_id="ACT05086.1"
FT                   /translation="MLAMQVLRETFGYQQFRPGQQAIINAAVSGRDCLVIMPTGGGKSL
FT                   CYQIPALVLDGLTLVVSPLISLMKDQVDQLQAYGVAAACLNSTQSREQQQAVFSACRRG
FT                   ELKLLYIAPERLTTDGFLDQLAHWNTALIAIDEAHCISQWGHDFRPEYRALGQIKQQFP
FT                   ALPIVALTATADETTRQDIARLLDLRDPLTNISSFDRPNIRYTLVEKFKPLDQLWLFIQ
FT                   GQRGKSGIVYCNSRAKVEDLCARLQNRGLSVGAYHAGLENDRRAQVQEAFLRDDLQVVV
FT                   ATVAFGMGINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAALFYDPADMAWLRR
FT                   CLEEKPAGMQLDIERHKLNAMGAFAEAQTCRRLVLLNYFGENRQQACGNCDICLDPPRR
FT                   YDGLVDAQKALSCVYRVGQRFGIGYIAEVLRGANNQRIREFGHDKLPVYGLGKDKTQEQ
FT                   WVSILRQLIHLGLLAQNIAHHSALQLTESARPVLRGEVPLQLAVPRVISLSKPRASQKS
FT                   YGGNYDRKLFAKLRKLRKSIADEDNIPPYVVFSDATLLEMAELLPVTASELLAVNGVGQ
FT                   RKLERFGAPFMTLIRDHLDNGDD"
FT   gene            234922..235545
FT                   /locus_tag="Dd1591_0194"
FT   CDS_pept        234922..235545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0194"
FT                   /product="homoserine/threonine efflux pump"
FT                   /note="TIGRFAM: homoserine/threonine efflux pump; PFAM:
FT                   Lysine exporter protein (LYSE/YGGA); KEGG: eca:ECA4171
FT                   threonine efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05087"
FT                   /db_xref="GOA:C6CGL7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGL7"
FT                   /inference="protein motif:TFAM:TIGR00949"
FT                   /protein_id="ACT05087.1"
FT                   /translation="MVMLFLTVALVHLIALMSPGPDFFFVSQTAISRSRREALAGVLGI
FT                   TLGVLVWAAIALMGLHLLLERMAWLHRIVTVGGGLYLCWMGWQLLRSALRKRDHQGEET
FT                   VEVALPQRGKTFMRGLLTNLSNPKALIYFGSVFSLFVGDDVGAAARWGLFALISLETLL
FT                   WFSLVALVFALPVMRRGYQRLAKWVDGLAGALFTGFGIHLIISR"
FT   gene            complement(235635..236255)
FT                   /locus_tag="Dd1591_0195"
FT   CDS_pept        complement(235635..236255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0195"
FT                   /product="homoserine/threonine efflux pump"
FT                   /note="TIGRFAM: homoserine/threonine efflux pump; PFAM:
FT                   Lysine exporter protein (LYSE/YGGA); KEGG: eca:ECA4170
FT                   homoserine/homoserine lactone efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05088"
FT                   /db_xref="GOA:C6CGL8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGL8"
FT                   /inference="protein motif:TFAM:TIGR00949"
FT                   /protein_id="ACT05088.1"
FT                   /translation="MTQDWWLTYLVTTLILSLSPGSGAINTMSTSISHGYRGAVASIAG
FT                   LQLGLVIHIVLVGIGLGALLSQSVLAFDMLKWFGAAYLIWLGIQQWRSAGSLDLQTLAN
FT                   SMPRRRLFKRAILVNLTNPKSIVFLAALFPQFIIPHQPQAMQYLVLGVTTVVVDVVVMI
FT                   GYATLARRIALWLKGPRQLKQLNRTFGSLFMLVGALLATARKA"
FT   gene            236367..237359
FT                   /locus_tag="Dd1591_0196"
FT   CDS_pept        236367..237359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0196"
FT                   /product="Lysophospholipase"
FT                   /EC_number="3.1.1.5"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: spe:Spro_0196
FT                   lysophospholipase L2"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05089"
FT                   /db_xref="GOA:C6CGL9"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGL9"
FT                   /inference="protein motif:PRIAM:3.1.1.5"
FT                   /protein_id="ACT05089.1"
FT                   /translation="MNPYPECLLTREWQYAAFVTGPLLDFWRQRQEGMFIGVDDVPIRF
FT                   VRFTSPLHQHLVVVLPGRTDSYVKYAEVAYDLFQCGYDVLMMDHRGQGRSGRLLKDRYR
FT                   GHVKRFSDYVDDVATLWQQQVAPGRYTKRFALAHSMGGAILAQFLARQPQAFDAVALCA
FT                   PMCGILLPMPRWLAWRILDWAERHPAIRDYYAIGTSPWRPLPFMANVLTHSHARYRRHV
FT                   RFYADDPDLRIGGPTYHWVREALLVETQLLPQAAAITTPLLLLQAEEERVVDNRSQDAF
FT                   CRALAAAGHPCADGRPYVVRGARHDILSEKDAMRADAFGRILQHFNDYH"
FT   gene            237412..238209
FT                   /locus_tag="Dd1591_0197"
FT   CDS_pept        237412..238209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0197"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: eca:ECA4168 putative sugar
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05090"
FT                   /db_xref="GOA:C6CGM0"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGM0"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACT05090.1"
FT                   /translation="MYPIVASDLDGTLLSPDHTLSPYAKETLRLMTEQGVHFVFATGRH
FT                   HMDVAQIRDNLAISAYMITSNGARVHNTDGELIFSHNLDRDIAQELYGMVYHHPEIMTH
FT                   VYRDDEWFLCRSRPEEERFFTETVFRYKLFDPETLGTDGVGKVFFTCEDHDKLLPLEEA
FT                   LNARWGDRVNVSFSTLSCLEVMAGGVSKGHALEQVAKILGHTIKDCIAFGDGMNDYEML
FT                   SMAGKGCIMSNAHQRLKDMLPNNEVIGTHIEQAVPKYLRRLYF"
FT   gene            complement(238200..239282)
FT                   /locus_tag="Dd1591_0198"
FT   CDS_pept        complement(238200..239282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0198"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: spe:Spro_0198 glycerophosphodiester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05091"
FT                   /db_xref="GOA:C6CGM1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGM1"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACT05091.1"
FT                   /translation="MTPLFKPLLAGAALAMSLCALAQTGEKIVIAHRGASGYLPEHTLP
FT                   AKAMAYAQGADYLEQDLVMTKDDALVVLHDHYLDRVTDVASRFPGRARADGRYYAIDFT
FT                   LAEIRSLNFTEGFDLKDGKPVQSYPNRFPMGKSDFRVHTFQDEIEFIQGLNHSTGKNIG
FT                   IYPEIKAPWFHRQEGKDISRAVLEVLKQYGYRQKSDRVYLQCFDANELQRIKTELEPAL
FT                   GMNLKLVQLIAETRWQETQQQQPDGRWVNYDYDWMLKPGAMQKIARYADGVGPDYHMLL
FT                   SGEAGNVAISSLVKEAHASGMAVHPYTVRADRLPKYVNDVNALYALLYRQADVDGLFTD
FT                   FPDKAVAFLHSTQDSQPSQK"
FT   sig_peptide     complement(239214..239282)
FT                   /locus_tag="Dd1591_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 23"
FT   gene            complement(239427..240776)
FT                   /locus_tag="Dd1591_0199"
FT   CDS_pept        complement(239427..240776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0199"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /note="TIGRFAM: glycerol-3-phosphate transporter;
FT                   phosphoglycerate transporter; PFAM: major facilitator
FT                   superfamily MFS_1; KEGG: eca:ECA4166
FT                   sn-glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05092"
FT                   /db_xref="GOA:C6CGM2"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGM2"
FT                   /inference="protein motif:TFAM:TIGR00712"
FT                   /protein_id="ACT05092.1"
FT                   /translation="MLSIFKPAAHRPRVAEHQVDPLYRRLRWQIFLGIFFGYAAYYLVR
FT                   KNFALAMPYLVEQGFSKGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAA
FT                   AVMLFMGFVPWATSSIMVMFVLLFICGWFQGMGWPPCGRTMVHWWSQKERGGIVSIWNC
FT                   AHNVGGGIPPLLFLLGMAWFQDWKAALYMPAFAAILVALFAFAMMRDTPQSCGLPSIEE
FT                   YKNDYPVDYSEKDEQELTAKEIFMQYVFPNKLLWYIAFANVFVYLLRYGILDWSPTYLK
FT                   EVKHFALDKSSIAYFLYEYAGIPGTLLCGWMSDKVFKGNRGATGVFFMSLVTIATVVYW
FT                   LNPAGNPNVDMLCMIVIGFLIYGPVMLIGLHALELAPKKAAGTAAGFTGLFGYLGGSVA
FT                   ASAIVGYTVDFFGWNGGFMVMIGGSVLAVLLLILTMINEKKHKEELAKRA"
FT   gene            241076..242719
FT                   /locus_tag="Dd1591_0200"
FT   CDS_pept        241076..242719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0200"
FT                   /product="glycerol-3-phosphate dehydrogenase, anaerobic, A
FT                   subunit"
FT                   /note="TIGRFAM: glycerol-3-phosphate dehydrogenase,
FT                   anaerobic, A subunit; PFAM: FAD dependent oxidoreductase;
FT                   BFD domain protein [2Fe-2S]-binding domain protein; KEGG:
FT                   eca:ECA4165 sn-glycerol-3-phosphate dehydrogenase subunit
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05093"
FT                   /db_xref="GOA:C6CGM3"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR017752"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGM3"
FT                   /inference="protein motif:TFAM:TIGR03377"
FT                   /protein_id="ACT05093.1"
FT                   /translation="MANNGLRRETDVVIIGGGATGAGTARDCALRGLRCLLLERHDIAT
FT                   GATGRNHGLLHSGARYAVTDAESARECIEENQILRRIARHCIEPTDGLFLTLPQDDLDY
FT                   QTRFIAACQRAGIRAQAIDPQEALRLEPAANPALIGAVRVPDGTVDPFRLTAANMIDAC
FT                   EHGAEVLTYHEVIGLIRQGDRVVGVRVFDHKRQLANEIYAQVVVNAGGIWGQRIAEYAD
FT                   LNVRMFPAKGALLILGHRINNRVINRCRPPADADILVPGDTISLIGTTSTRIDYDQIDN
FT                   MTVTPAEVDTLIREGSLLAPQLAQTRILRAYAGVRPLVANDNDPSGRSVSRGIVLLDHA
FT                   SRDGLEGFVTITGGKLMTYRLMAEWVTDKVCEKLGHQVACTTASRPLPGSEVADPDTPQ
FT                   AASPLSAPLRGSAIYRHGHRAVALVSGQRVDSSLVCECEAVTAGEVRYAVESLQVNNLT
FT                   DLRRRTRVGMGTCQGELCACRAAGLLCRLGQSTPQQAVSQLSQFLNERWKGMRPIAWGN
FT                   TLRESEFTSWIYQGLCGLTERPEQEGGDAL"
FT   gene            242709..243959
FT                   /locus_tag="Dd1591_0201"
FT   CDS_pept        242709..243959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0201"
FT                   /product="glycerol-3-phosphate dehydrogenase, anaerobic, B
FT                   subunit"
FT                   /note="TIGRFAM: glycerol-3-phosphate dehydrogenase,
FT                   anaerobic, B subunit; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein; FAD dependent
FT                   oxidoreductase; KEGG: eca:ECA4164 anaerobic
FT                   glycerol-3-phosphate dehydrogenase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05094"
FT                   /db_xref="GOA:C6CGM5"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR009158"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGM5"
FT                   /inference="protein motif:TFAM:TIGR03378"
FT                   /protein_id="ACT05094.1"
FT                   /translation="MRYDVVIIGGGLAGLVCGIRLQEQGKRCAVVSSGQSALTFASGAL
FT                   DLLAALPDGTAVEQPLTALDELAAQAPHHPYTLIGKARVSQLAADAEALLARCGLWLRG
FT                   ESSGNHQRLTPLGKWRPCWLSPSDSVTRGLAGSPAWRQPLVAGIEGFMDFQSRLVAGEL
FT                   QAQGIAARADDLRLPLLDALRQNASEFRSLAIARLLDTPAGIAALAEELMTRASGNDAV
FT                   ILPACIGLEAQAQLNTALGKPVGLLATLPPSLPGMRLHQALLGRFRQTGGTLMPGDKVL
FT                   SAQSHEAGVALYTRSHGEVPLRAEHVVLASGSFFSNGLVAERDRVVEPVFGLDVDFLSV
FT                   HEDWSQPNLFAAQPYLQFGVVADAQLHPAIGGHTQSRLYAIGSVLRGYDPLRQGCGGGV
FT                   SLLTALYAAEMMIRENP"
FT   gene            243956..245158
FT                   /locus_tag="Dd1591_0202"
FT   CDS_pept        243956..245158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0202"
FT                   /product="glycerol-3-phosphate dehydrogenase, anaerobic, C
FT                   subunit"
FT                   /note="TIGRFAM: glycerol-3-phosphate dehydrogenase,
FT                   anaerobic, C subunit; PFAM: protein of unknown function
FT                   DUF224 cysteine-rich region domain protein; KEGG:
FT                   eca:ECA4163 sn-glycerol-3-phosphate dehydrogenase subunit
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05095"
FT                   /db_xref="GOA:C6CGM6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017753"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGM6"
FT                   /inference="protein motif:TFAM:TIGR03379"
FT                   /protein_id="ACT05095.1"
FT                   /translation="MMSRADTSFENCIKCTVCTTACPVARVNPLYPGPKQAGPDGERLR
FT                   RKDPSLFDEALKYCTNCKRCEVACPSDVKIGDIIQRAKASHSQHRPTLRDAILSHTDLM
FT                   GSVATPFAPLVNSLTGLKPMRQLLDKALKIDHRRQLPRYSHGTFRSWYRRQAAHQLQFE
FT                   EQVAYFHGCYVNYNHPQLGRDLIRVFNAMGVGVQLLTKEKCCGVALIANRFLDKARKQA
FT                   RFNLASLDDAINSRGLPVIATSSSCTFTLRDEYPHLLGLDNHHVRDGIELATRHLYRLL
FT                   DQGRTLPLQPLPLRVVYHTPCHLERMGWTAYTLELLRRIPGLELQVLDSQCCGIAGTYG
FT                   FKKENYDTAQGIGAPLFRQIEASGADLVITDCETCKWQIEMSTSKTCEHPLSLLAKALP
FT                   A"
FT   gene            245863..246561
FT                   /locus_tag="Dd1591_0203"
FT   CDS_pept        245863..246561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0203"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; Cupin 2 conserved barrel
FT                   domain protein; KEGG: eca:ECA4162 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05096"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGM7"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ACT05096.1"
FT                   /translation="MIYLRKAQDRGHANHGWLDSWHTFSFADYYDPDFMGFSALRVINE
FT                   DRIEGGQGFGTHPHRDMEILTYVLEGTVEHQDSMGNKEQIPAGEFQIMSAGTGIRHSEY
FT                   NASQDKLLHLYQIWVIPEKTGLTPRYEQRRFDAPQGRQLVLSPDARDGSLKVFQDMTLW
FT                   RWALKSQEESAYQAEQGRHLWIQVVRGTIEVNGQQATTSDALAIWDEASITVRAGEDSE
FT                   ILLFDLPPVK"
FT   gene            246846..248171
FT                   /locus_tag="Dd1591_0204"
FT   CDS_pept        246846..248171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0204"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   vha:VIBHAR_05087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05097"
FT                   /db_xref="GOA:C6CF98"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:C6CF98"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACT05097.1"
FT                   /translation="MSEHDMDFVVDAFSSERDAFSRSLDPAWIHQALNACHKASIRRRR
FT                   LPAEQAVWLVLMMGLLRDLSIKDVCHHLDIVLQPDEGYQPLAPSVLTAARQRLGEAPLR
FT                   YLFHACNEGWLPTVLGSDTFHGLHVLSVDGTLFRTPDSPDNAAAFGFIDPVHGTFPQVR
FT                   MVGLMATHSHMLLDAAFGGVAEGELTLAHRLVSSAPDHSLTLFDRCYFSASFLLEWRQA
FT                   GVETHWLTPVKRKLRYRVIERYSDYDMLIEMPVSPQARKAAPHLPAVWQARMVSYINGS
FT                   GKGKITGFLTSMTDPVAYPLEDLLRIYWTRWEIELGYGELKQRQLKGEVTLRSRFPEGV
FT                   KQELWGILVSYNLLRKEMADIAGEAGVQPTRISFIAALNILVSQVRVSGKGAAGNIPKH
FT                   LKGMRNNVKAFILPEKRKHRRYDRSVLYVPPKYPFSFKSREA"
FT   gene            complement(248278..249768)
FT                   /locus_tag="Dd1591_0205"
FT   CDS_pept        complement(248278..249768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA3946 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05098"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGM9"
FT                   /inference="similar to AA sequence:KEGG:ECA3946"
FT                   /protein_id="ACT05098.1"
FT                   /translation="MKLYRTGLFFITAGLTFSLGSAMAETTVPVEVKDTNKLPNKGVVS
FT                   LFKAPDKIQQKASDKYQFTKSEKDGVIVITPDVSAPKAAAKNKSLKSLSSSQAATSDST
FT                   FTPLCPTLAVNSIYTLSGLQNGGSACYHFEITQPSKTTTFVTGMSSGTNVSLTLFSDDG
FT                   KNNLTPIYYSDNPDNSDEATLNLTKPGHYYWYIEANTADGSELNFGAIVNTNIDSYELN
FT                   DAPSLATVVPDGLYQIKGNSDSDVDVDYYTFTAISGQQVLLQLAGADNAANNYWLIAYS
FT                   TDDGNTWVTSNTGQQNTITPSKSNETILVRVSPNPAKLPTPTQYYLLSFGSKIASFTNS
FT                   VKGESSVLNIPYSAPTPYGSMTTQAYRTVTWNVRLADSTGAGIPNVDAVLYLDQRAERQ
FT                   GDKVILEFNPSTAHVITTDASGNASGTITLDTCYADSTTEFNNYDRGYLNTWSTTFDFG
FT                   AWRLEVPIQEGIGVGGNNVQYVTFGHICKQTLVRSVKS"
FT   sig_peptide     complement(249694..249768)
FT                   /locus_tag="Dd1591_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(250617..251480)
FT                   /locus_tag="Dd1591_0206"
FT   CDS_pept        complement(250617..251480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0206"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   plu:plu0187 CpmF protein involved in carbapenem resistance"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05099"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGN0"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACT05099.1"
FT                   /translation="MKRNVVLYAVLLLSQFAHAVQPNVMPDEIAIKGGAFYVGNIFGNK
FT                   DYASHTNTTLKPFYIMRTEITYSQYQHVLQWAESHGYAFENGCNGGHFDDCLPAEQDNG
FT                   RHPVTTLSWWDAIVFANALSASQQLTPYYLTADGRPITSVPQDQALNVVRNTAATGYRL
FT                   PSLNEWQVAARGGEAALRQGLYGRIYSGSDNPDHIANMPKDNSTTFSTQPVARQQPNAL
FT                   GLYDMTGNVWEWIDDDFHMTGLNNMHYFCGGSYLMHISNLSECDVHTPNFPTSDIGFRL
FT                   VRSAPL"
FT   sig_peptide     complement(251421..251480)
FT                   /locus_tag="Dd1591_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(251489..252064)
FT                   /locus_tag="Dd1591_0207"
FT   CDS_pept        complement(251489..252064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0207"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmr:PMI1554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05100"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGN1"
FT                   /inference="similar to AA sequence:KEGG:PMI1554"
FT                   /protein_id="ACT05100.1"
FT                   /translation="MKYWTIFAIFALFFNVLSPIDANAKQPDQLRFHARLIQEFIDGWY
FT                   SPCLGEKKWPVKTPRNEASWLSGRLNALVSAGLVKKTDQGNEAIWSLTPSGQRNFMPYG
FT                   DFCYGRIALHQITHYESISPELVLINYTYRIEGLPEWVKNKDVRYAFSELDNWLSGIQH
FT                   TQYQVTIRTAIGSAPKIQSPPEPLNLDY"
FT   sig_peptide     complement(251990..252064)
FT                   /locus_tag="Dd1591_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.927) with cleavage site probability 0.870 at
FT                   residue 25"
FT   gene            complement(252021..252608)
FT                   /locus_tag="Dd1591_0208"
FT   CDS_pept        complement(252021..252608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0208"
FT                   /product="CpmJ protein"
FT                   /note="KEGG: plu:plu0880 CpmJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05101"
FT                   /db_xref="GOA:C6CGN2"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGN2"
FT                   /inference="similar to AA sequence:KEGG:plu0880"
FT                   /protein_id="ACT05101.1"
FT                   /translation="MVDTIAYWLINKRTLMFSYVIRVTTIILTVLITTKSYANCMQEEK
FT                   IKQGVNYLSLINHERKDLAILSFFDNNTSHPNRGMSFYIKNSNGYSIIPVPNSDMFIWF
FT                   DYSLSASRINIFDYRLYHHPKGKKLISVQKRGDDLTAMQPITITVYKLAESHDDPGVPP
FT                   YSWVIEKTVTTPEKYGSAYEVLDDIRYLCSVL"
FT   gene            complement(252644..252916)
FT                   /locus_tag="Dd1591_0209"
FT   CDS_pept        complement(252644..252916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0209"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: plu:plu0186 CpmE protein
FT                   involved in carbapenem biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05102"
FT                   /db_xref="GOA:C6CGN3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGN3"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACT05102.1"
FT                   /translation="MKKTLTCKIKNTQQTFPLTEEETILASSYQAEIPLRYRCNAGHCG
FT                   MCKVRLLEGEADMQHTGGISRDDIKNGYILPCCTRPLSNIEIETE"
FT   gene            complement(252913..254043)
FT                   /locus_tag="Dd1591_0210"
FT   CDS_pept        complement(252913..254043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0210"
FT                   /product="Proline dehydrogenase"
FT                   /EC_number="1.5.5.2"
FT                   /note="PFAM: Proline dehydrogenase; KEGG: plu:plu0185 CpmD
FT                   protein involved in carbapenem biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05103"
FT                   /db_xref="GOA:C6CGN4"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGN4"
FT                   /inference="protein motif:PRIAM:1.5.99.8"
FT                   /protein_id="ACT05103.1"
FT                   /translation="MEKINTASVFARYRTRTLTFKLLSSALLGNNKTRKIAIYALKKAL
FT                   HISKGTTLKIINGIYFGGETLHQVKNTTSILKEENINSIIDYAIEGENTDSVYNDVMNQ
FT                   TFSLIDLAAENKNIPFVVIKPSSLGSIALYQAITFGKALTPEQSQEWNLVMKRYIDIFD
FT                   SASEKNVKIMIDAEQSWIQPAVDNFIIEMMKTYNRSYPLLTLTLQFYCKDKLKKLKDYY
FT                   TQASNDNFHLGIKLVRGAYLEEEKRFNHGYCFAEKTETDNNYNSAIAFIAEHTDRISPF
FT                   FATHNERSLELIRQSQTLKKNIWLGQLYGMGDHITWSLMHEGFAVCKYIPFGPLKKSLP
FT                   YLLRRIEENAIPSATFVTERKLIRKELHRRMKRHVL"
FT   gene            complement(254154..254966)
FT                   /locus_tag="Dd1591_0211"
FT   CDS_pept        complement(254154..254966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0211"
FT                   /product="Taurine catabolism dioxygenase TauD/TfdA"
FT                   /note="PFAM: Taurine catabolism dioxygenase TauD/TfdA;
FT                   KEGG: plu:plu0184 CpmC protein involved in carbapenem
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05104"
FT                   /db_xref="GOA:C6CGN5"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGN5"
FT                   /inference="protein motif:PFAM:PF02668"
FT                   /protein_id="ACT05104.1"
FT                   /translation="MLNYTALMDSGFGAQMHSSDFMEAKPEEIKNLLMRQGFLLVKNIA
FT                   MDANQFRDTYSAYGKVVEYADEKIGVGFGYKDTLKLEGEKGKIVTGRGQLPFHADGGLL
FT                   LSQVDLVFLYAAEIKNMKFRGATTVCDHVLACQEMPAHLRRVLEEETFEVRVLEHGYYV
FT                   DVSPAGWFKVPVFTDLGWVRKMLMYFPFDEGQPASWEPRIVGFSEYETKAFFDELGQFM
FT                   KQPRYFYKHYWEDADLLIMDNRRVIHEREEFNDDNIIRRLYRGQTVEI"
FT   gene            complement(254986..255738)
FT                   /locus_tag="Dd1591_0212"
FT   CDS_pept        complement(254986..255738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0212"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   plu:plu0183 CpmB protein involved in carbapenem
FT                   biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05105"
FT                   /db_xref="GOA:C6CGN6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGN6"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACT05105.1"
FT                   /translation="MIIEETRDNVRIITLNHPNKHNPFSQALENAVKAALNDANNDPEV
FT                   NAIVVYGGKGCSFSAGGDFNEVKNLSGGADVERWIDRVIDLYEAVLHINKPTVAAVDGY
FT                   AIGMGFQFALMFDYRIMANGARFVMPELKHGIGCSVGAAILTFTHGYNLMKDIIFKCQE
FT                   LDEDFCLSHHIVNEKVEPNQLLDRAFTLAKELAAYPYAALSKTKQSTNRSFLELLEKTR
FT                   IESKEVHKAAFGARDAQKHFHHILGNKY"
FT   gene            complement(255742..257253)
FT                   /locus_tag="Dd1591_0213"
FT   CDS_pept        complement(255742..257253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0213"
FT                   /product="asparagine synthase"
FT                   /note="PFAM: asparagine synthase; KEGG: plu:plu0182 CpmA
FT                   protein involved in carbapenem biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05106"
FT                   /db_xref="GOA:C6CGN7"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015230"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGN7"
FT                   /inference="protein motif:PFAM:PF00733"
FT                   /protein_id="ACT05106.1"
FT                   /translation="MKHGFCIARGDACLNIKKDVTGLPLKIENLQNGYLFIGDKSPFAK
FT                   MVTDNETLYLIGTINNRRLLEGLAGRYDASAWSLSDIELLHTIFLYLGTHALSLAEGSF
FT                   FFFKENKKGELILLTDPNGFMPVHVIHDHTALWITDRLKFVGYVVQKGIFDFMPEDKVI
FT                   QHVLHSDTFTPIKNAIRLKPGSINQIKKDMQGYEYLGSDNIYPANTDKQLNISKDVLFE
FT                   LIDNYLKAPFRSLVQTHQTVGIPLSGGLDSSLVTAMASQFFQHIKTWSIGTEISNEFEY
FT                   SQMVADALGTEHHVKILTEADVINGVIEAIYHNEIFDGLSAEIQSGLFNVYRMAQNNVS
FT                   AMMTGYGSDLLFGGILKPGEKYASPNKILCEQVYRTRWTGEFVSHGAAHYGLQLNHPFW
FT                   NNDLISLCRNLNPDYKIKDNEVKNILREYTEKLNLLPKEIVWRKKIGIHEGSSVNKSFA
FT                   NILGLHVDDYSHKTRFTYRVYKSFLENTLSLENATSDHLRKLIMD"
FT   gene            257629..258473
FT                   /locus_tag="Dd1591_0214"
FT   CDS_pept        join(257629..257979,257979..258473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Dd1591_0214"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: plu:plu4519 IS427 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05107"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGN8"
FT                   /inference="protein motif:COG:COG3293"
FT                   /protein_id="ACT05107.1"
FT                   /translation="MARYDFPDDAWVLISPMLPPERGSSRGGRPYFAHRHVMNGIFWVL
FT                   CSGAPWRDLPERYGQWKTLYNRFNRWSKAGIMNSIFNKLLQILDEKALIDWDVIALDGS
FT                   NVRALKTAAGAKKKHPDECEDHGLGRSRGGFGTKIHLATDGTGLPLSFCLSGGQAHESR
FT                   YSETLLNRVGIIRKSGHLKSRPKAVLADKGYSGNNLRIYLKIKGIKAVIPFKSNEKASQ
FT                   DRRRPLDRRLYKKRNVVERCFAILKENRRIATRSEKTARNYLSMLKLGAIRLFLKRLLS
FT                   "
FT   gene            258624..259622
FT                   /locus_tag="Dd1591_0215"
FT   CDS_pept        258624..259622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0215"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: esa:ESA_04301 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05108"
FT                   /db_xref="GOA:C6CGN9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGN9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACT05108.1"
FT                   /translation="MIKKKRPGLQDVADRVGVTKMTVSRYLRNPEQVSEALRGKIGAVL
FT                   DELGYIPNRTPHILANATSRAIGVLLPSLTNQVFAEVLRGIEKVAESQGYQTMLAHYGY
FT                   QPEVEERRLMSLLAYNIDGLILAERNHTARTRQMIAVAGIPVVELMDSVSPCLDMAVGF
FT                   DNVDAARQMTRYMIARGRRRVVYLGARQDERTLLKRQGYEQAMAEAGLASYSVMSDSPS
FT                   SYTLGGELLRQAQAEYPQVDSLFCTNDDLAIGAMFECQRQGLRVPEHIAIAGFHGHDIG
FT                   QTTVPRLTSVLTPRKRIGEIGAAQLLARLHGESLPTTSVDVGFTLQVGESV"
FT   gene            complement(259633..260151)
FT                   /locus_tag="Dd1591_0216"
FT   CDS_pept        complement(259633..260151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0216"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: eca:ECA1839 gluconokinase; TIGRFAM:
FT                   carbohydrate kinase, thermoresistant glucokinase family;
FT                   PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05109"
FT                   /db_xref="GOA:C6CGP0"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGP0"
FT                   /inference="protein motif:TFAM:TIGR01313"
FT                   /protein_id="ACT05109.1"
FT                   /translation="MSGQSIILMGVSGSGKSSVGAQLARDINAKFIDGDDLHPKANIQK
FT                   MVSGQPLNDDDRAPWLERLNDAAYSLHHKNEAGIIVCSALKKRYRDRLRDGNDGMVFLY
FT                   LKGSFDTILQRHQARAGHFMPTELLQSQFDALEEPDEAETDVITVDINGPMDQVVARCV
FT                   AALRARLSR"
FT   gene            260399..261715
FT                   /locus_tag="Dd1591_0217"
FT   CDS_pept        260399..261715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0217"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: spe:Spro_4651
FT                   gluconate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05110"
FT                   /db_xref="GOA:C6CGP1"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGP1"
FT                   /inference="protein motif:TFAM:TIGR00791"
FT                   /protein_id="ACT05110.1"
FT                   /translation="MPLVIVAVGVALLLVLMIRFKLNGFIALILVALAVGIMQGMPVQK
FT                   VMTSIKNGVGGTLGSLALIMGFGAMLGKLLADCGGAQRIATTLIHRFGRKHIQWAIVLT
FT                   GFTVGFALFYEVGFVLLLPLVFSIVASARIPLLYAGVPMAAALSVTHGFLPPHPGPTAI
FT                   ASLFHADMGKTLLYGTLLGIPTVILAGPVYARFLKKIDKPIPQGLYNPKQFTEQEMPSF
FT                   LVSVMTALVPVILMALRAVAEMVLPKEHPLLPYAEFFGDPVMATLIAVLIAIFTFGLNR
FT                   GRSMDEVMGTITDSIKIIAMMLLILGGGGAFKQVLVDSGVDKYIAGMMHGSGFSPLLLA
FT                   WLIAATLRIALGSATVAAITAGGIVAPLIATTGVSPELMVIAVGSGSVIFSHVNDPGFW
FT                   LFKEYFNLSIPETLKSWSALETIIAVCGLVGTLLLSYVV"
FT   gene            complement(261811..262404)
FT                   /locus_tag="Dd1591_0218"
FT   CDS_pept        complement(261811..262404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0218"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: eca:ECA4157 dITP- and XTP- hydrolyzing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05111"
FT                   /db_xref="GOA:C6CGP2"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGP2"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ACT05111.1"
FT                   /translation="MTEMISATVLLLLIMDPLGNLPVFMSVLKHLDPKRRRVVLIREMI
FT                   IALGVMLVFLFAGEKILAILNLRTETVSISGGIVLFLIAIRMIFPTQEGFTSGLPAGDE
FT                   PFLVPLAIPMVAGPSILAALMLLSHQYPNQMPHLTLALFIAWGITVVVLLLSNLFLRLL
FT                   GDKGVNALERLMGLVLVMLSTQMFLDGIRAYLKL"
FT   gene            262604..263704
FT                   /locus_tag="Dd1591_0219"
FT   CDS_pept        262604..263704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0219"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="KEGG: eca:ECA4155 aspartate-semialdehyde
FT                   dehydrogenase; TIGRFAM: aspartate-semialdehyde
FT                   dehydrogenase; PFAM: Semialdehyde dehydrogenase
FT                   dimerisation region; Semialdehyde dehydrogenase NAD -
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05112"
FT                   /db_xref="GOA:C6CGP3"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011534"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGP3"
FT                   /inference="protein motif:TFAM:TIGR01745"
FT                   /protein_id="ACT05112.1"
FT                   /translation="MKNVGFIGWRGMVGSVLMQRMVEERDFDLIRPVFFSTSQHGQPAP
FT                   ALGGQQGTLQDAYNLDALRALDIIITCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMK
FT                   DDAIIILDPVNHGVIQSGLDKGIKTFVGGNCTVSLMLMSLGGLFANDLVEWASVATYQA
FT                   ASGAGARNMRELLIQMGQLNAEVASELSDPASAILDIERKVTALSRGGLDVENFGVPLA
FT                   GSLIPWIDKQLENGQSREEWKGQAETNKILNTAGTIPVDGLCVRIGALRCHSQAFTLKL
FT                   KKDVSIPEIEQMLATHNDWVKVVPNDREITMRELTPAAVTGTLSTPVGRLRKLNMGPQY
FT                   LSAFTVGDQLLWGAAEPLRRMLRILL"
FT   gene            263936..264355
FT                   /locus_tag="Dd1591_0220"
FT   CDS_pept        263936..264355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0220"
FT                   /product="transcriptional regulator NikR, CopG family"
FT                   /note="PFAM: NikR nickel binding; CopG domain protein
FT                   DNA-binding domain protein; KEGG: azo:azo3128 nickel
FT                   responsive regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05113"
FT                   /db_xref="GOA:C6CGP4"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR014864"
FT                   /db_xref="InterPro:IPR022988"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGP4"
FT                   /inference="protein motif:PFAM:PF08753"
FT                   /protein_id="ACT05113.1"
FT                   /translation="MQRLTISLDDPLAEALDALMLRKGYANRSEAFRDMLRRELGEMTV
FT                   AQDKNAECVAVLSYVYDHHERQLSSRLAGMQHEHHHLTVSTMHTHLSHDECVETVILRG
FT                   PTERVEQFAASVIAQTGVRHGRLNLIPMEQAAAKE"
FT   gene            264877..265089
FT                   /locus_tag="Dd1591_0221"
FT   CDS_pept        264877..265089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0221"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: yen:YE3823 major cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05114"
FT                   /db_xref="GOA:C6CGP5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGP5"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACT05114.1"
FT                   /translation="MSNKMTGSVKWFNESKGFGFISPADGSKDVFVHFSAIQSDSFKTL
FT                   YEGQKVEFVIGNGPKGPSAENVVGL"
FT   gene            complement(265269..266954)
FT                   /locus_tag="Dd1591_0222"
FT   CDS_pept        complement(265269..266954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0222"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: histidine kinase internal region; GAF domain
FT                   protein; 5TM Receptors of the LytS-YhcK type transmembrane
FT                   region; ATP-binding region ATPase domain protein; KEGG:
FT                   eca:ECA4152 putative two-component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05115"
FT                   /db_xref="GOA:C6CGP6"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGP6"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACT05115.1"
FT                   /translation="MVSQVELILSLLQQTCVYLVIAYLLSKTPLFTPLTQVTLHLPHKL
FT                   ICYLTFSMFCILGTYFGLHIDDSIANTRAIGALLGGVLGGPSVGMLVGFTGGLHRYSLG
FT                   GMTAMACMVSTTLEGLVGGLLHRYMIRHHRIDLLFQPLVIAAVTLLVEIVQMSIILLLS
FT                   RPFGDALMLVKSIALPMMITNSIGAAMFMRILLDRRAVFEKYTSAFSARALQIAARAEG
FT                   ILRQGFNPGTSMRVARILYEELGVGAVAITDREKLLAFIGIGDEHHRVGTLITSSHTHQ
FT                   AIDNNEVVYADGNEIPFCCSVSPQCKLGSTLVIPLRGEEQRVVGTIKLYEPKNKLFSSI
FT                   NRTLGEGIGHLLSAQIFAGRFEQQKQLLAQSEIKLLHAQVNPHFLFNTLNTLSAIIRRN
FT                   PDQARQLVLSLSTFFRKNLKRSGDEVTLGDELEHISAYLDIEKARFTNLLTVEIAVPLS
FT                   LRSARLPAFSLQPLVENAIKHGISHMLDDGRLRIDARTHANMLELTIEDNAGAYYPRNG
FT                   SDGLGMNLVDRRVKARYGHHYGITVTSEPNRFTRVKVRVPLRMA"
FT   gene            267334..269517
FT                   /locus_tag="Dd1591_0223"
FT   CDS_pept        267334..269517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0223"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: eca:ECA4151 glycogen branching enzyme;
FT                   TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM: alpha
FT                   amylase all-beta; glycoside hydrolase family 13 domain
FT                   protein; alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05116"
FT                   /db_xref="GOA:C6CGP7"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGP7"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ACT05116.1"
FT                   /translation="MSGFSDRNIINLLFSGHYADPFAVLGMHVTSSGLEVRALLPDASD
FT                   VHVVDAHSGRKVAHLQRLDPRGFFVAVIPRRKKPFSYRLAVTWQQDTHVIDDPYRFGPL
FT                   LQELDIWLLAEGRHLRPFETLGAHPSTLDGVGGTCFAVWAPNAQRVSVVGDFNFWDGRR
FT                   HPMRLRCENGVWELFVPGVGVGQLYKFEIIDCYGNVLVKSDPYAFASQMRPDTASVVSA
FT                   LPPALPVDEARQSANDLQSPISIYEVHLGSWRRHDDNNFWLSYRELADQLVPYVKDMGF
FT                   THVELMPVHEHPFDASWGYQPLGLYAPTRRFGSPEDFRYLVSAFHEAGINVLLDWVSGH
FT                   FPTDSYGLARFDGTALYEYADPKEGYHQDWNTLIYNFDRHEVRNYLAGNALYWTERFGV
FT                   DGLRVDAVASMIYRDYSRRDGEWVPNHYGGKENLEAIGFLRYTNQMLGQNRAGAVTIAE
FT                   ESTDYAGVTLPPEHSGLGFHYKWNMGWMHDSLAYMQQDPVHRKYHHDLLTFGMLYAYSE
FT                   NFVLPLSHDEVVHGKRSLLDRMPGDAWQKFANLRAYYGFMWAYPGKKLLFMGGEFAQGR
FT                   EWNHDTSLDWHLLDEPEGWHVGVQQLVRDLNHCYRQHPPLYQCDYLHQGFEWVVVDDRE
FT                   NSVFAFIRRDAEGNEILIISNFTPVPREGYRVGINQPGHWREVLNTDSMHYHGSNLGNQ
FT                   GLVRSEAVGSHSRPQSLVLTLPPLSTLYLVKEA"
FT   gene            269517..271487
FT                   /locus_tag="Dd1591_0224"
FT   CDS_pept        269517..271487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0224"
FT                   /product="glycogen debranching enzyme GlgX"
FT                   /note="KEGG: eca:ECA4150 glycogen debranching enzyme;
FT                   TIGRFAM: glycogen debranching enzyme GlgX; PFAM: glycoside
FT                   hydrolase family 13 domain protein; alpha amylase catalytic
FT                   region; SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05117"
FT                   /db_xref="GOA:C6CGP8"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR011837"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022844"
FT                   /db_xref="InterPro:IPR040784"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGP8"
FT                   /inference="protein motif:TFAM:TIGR02100"
FT                   /protein_id="ACT05117.1"
FT                   /translation="MVELLAGRPRPLGSHFDGEGVNFALFSSRASRVELCIFDGLRELR
FT                   LPLTARTGDIWHGYLPDAQPGLCYGYRVDGAFDPQRGLRFNANKLLLDPCARQMDGWVV
FT                   DDERLHGGYDYPDAVDSAEVMPRSVVVDERYDWQGDAFPRTPWSQTVLYEAHVRGLTRR
FT                   HPRIPAAIRGTYAALAHPVMLDYLTKLGVTALELMPVQQHADEPRLQAMGLRNYWGYNT
FT                   LLPFAVDSSLAAGDEPLNEFRDMVRALHNAGIEVILDVVFNHSAELDADGPTLTLRGID
FT                   NASYYWLTQDGAYHNWAGCGNVLRLEHPAVLQWVIECLTFWHETCRVDGFRFDLATILG
FT                   RMPDFSSSAPFFTALRNHRSLRNCKLIAEPWDIGPGGYQLGKFPSPFVEWNDRFRDDIR
FT                   RFWLHGDLPVGVFARRFAASSEVFERNGRLPWASVNMLTSHDGFTLRDLVSFNYKHNQA
FT                   NGEQNRDGTNSNFSFNHGTEGLEADEATQARRRASQQALLTTLLLSQGTPMLLAGDEFG
FT                   SSQQGNNNAYCQDNALAWLHWETADTELIAFTAGLLRLRRAIPALQKAGWWRDDEDDVR
FT                   WLNAQGEPLTPYEWEQGEHRLQIQLSKHWLLLINATSQTSDFSLPKGEWRVAPPFDAAD
FT                   HPLNERVWRGQANAVCVLVKK"
FT   gene            271504..272790
FT                   /locus_tag="Dd1591_0225"
FT   CDS_pept        271504..272790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0225"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.27"
FT                   /note="KEGG: eca:ECA4149 glucose-1-phosphate
FT                   adenylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   adenylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05118"
FT                   /db_xref="GOA:C6CGP9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="InterPro:IPR023049"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGP9"
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /protein_id="ACT05118.1"
FT                   /translation="MVSTEKHDPLMLARQLPLKSVALILAGGRGTRLKDLTAHRAKPAV
FT                   HFGGKYRIIDFALSNCLNSGIRRIGVITQYQSHTLVQHIQRGWSFLNIEMNEFVDLLPA
FT                   QQRHDENDHWYRGTADAVCHNLDIIRRYGAEYVVILAGDHIYKMDYSRMLLDHVENGAE
FT                   CSVACIPVPIKEAHAFGVMSVDKDNRIISFDEKPANPAPMPDDPDMALASMGIYVFNAK
FT                   YLYRILEADVCTSESSHDFGKDLIPKIVAQGHAWAHPFTLSCVTSSDNAPPYWRDVGTL
FT                   EAYWRANLDLASVMPELDMYDHNWPIRSAMAALPPAKFVQDRSGSHGLTMNSLVSGGCI
FT                   VSGSVVTHSVLFPRVRINSFCSIDSSVLLPDVNVGRSCRLHRCIVDRACDIPEGMVIGE
FT                   NAEEDSRRFYRSEEGIVLVTRAMLARLKP"
FT   gene            272870..274303
FT                   /locus_tag="Dd1591_0226"
FT   CDS_pept        272870..274303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0226"
FT                   /product="glycogen/starch synthase, ADP-glucose type"
FT                   /note="TIGRFAM: glycogen/starch synthase, ADP-glucose type;
FT                   PFAM: Starch synthase catalytic domain protein; glycosyl
FT                   transferase group 1; KEGG: eca:ECA4148 glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05119"
FT                   /db_xref="GOA:C6CGQ0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGQ0"
FT                   /inference="protein motif:TFAM:TIGR02095"
FT                   /protein_id="ACT05119.1"
FT                   /translation="MRVLHVCSELFPLLKTGGLADVVGALPSAQIAAGMDVRVLLPAFP
FT                   DVKKGIPDAQVVRELDTFGGHVTLRYGHYNGVGIYLIDVPHLYDRAGSPYHDTSLFAYS
FT                   DNVVRFGLLGWMGAEMASGADPFWRPDIVHAHDWHAGLACAYLAAKGRPAKSVFTVHNL
FT                   AYQGLFDARHMSQLRLPPEYFSMYGLEFYGQISYLKAGLYYADHITTVSPTYAHEITQP
FT                   EYGYGLEGLLKSREEAGRLSGILNGVDDDIWNPAHDSLLTATYSRDELARKAENKRHLQ
FT                   TAMGLKVDDRVPVFAIVSRLTSQKGLDIALQTVTSLLEQGGQLVVLGAGDATLQEGFLA
FT                   AAAEYHGRVGVQIGYHEAFSHRIIGGADVIMVPSRFEPCGLTQLYGLKYGTLPLVRRTG
FT                   GLADTVADCSLENLADGLASGFVFSDCNVASLSRAIRRVFVLWSRPSLWRYVQRQAMAM
FT                   DFSWQVAAQAYRALYQRLW"
FT   gene            274327..276774
FT                   /locus_tag="Dd1591_0227"
FT   CDS_pept        274327..276774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0227"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: eca:ECA4147 glycogen phosphorylase; TIGRFAM:
FT                   glycogen/starch/alpha-glucan phosphorylase; PFAM: glycosyl
FT                   transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05120"
FT                   /db_xref="GOA:C6CGQ1"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGQ1"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ACT05120.1"
FT                   /translation="MNSPFIYNSPTLSVDALKHSIAYKLMFTIGKDPSIASKHDWLNAA
FT                   VLAVRDRMVERWLRSSRAQLSQDVRQVYYLSMEFLLGRTLSNALLAMGMFDDLRDALEA
FT                   MGLDLNELLEEEDDPALGNGGLGRLAACFLDSLATMALPGRGYGIRYEYGMFRQNIVDG
FT                   KQAESPDYWLEYGNPWEFVRHSTRYKVRFGGRIQQEGSKTRWLETEEIIACAYDQIIPG
FT                   FDTDATNTLRLWAAQASNEINLGKFNQGDYFAAVEDKNHSENVSRVLYPDDSTYSGREL
FT                   RLRQEYFLVSATVQDILSRHWTMHKTYANLTEKFAIHLNDTHPVLAIPELMRLLIDEHK
FT                   FKWDVAWDVVTKVFSYTNHTLMGEALETWPVDMMGKILPRHLQLIFEINDRFLDEVQER
FT                   FPNEHDLFKRVSIIDEEHGRKVRMAWLAVICSHKVNGVSQLHTDLMVQSLFADFARIYP
FT                   DRFCNKTNGVTPRRWLALANPSLSKVLDDTIGKTWRTDLSQLADLKPHIDFPAFLQKVR
FT                   KAKQENKKRLALYIAQHLDIVVDPNALFDVQIKRIHEYKRQLLNVLHLITLYNRIKDDP
FT                   DLDRVPRVAIFAGKAASAYYMAKHIIHLINDVASVVNNDPEVKDKLKIVFIPNYGVSLA
FT                   QIIIPAADLSEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEMRERVGEDNIFIFG
FT                   NTTEEVEALRRSGYNPREFYNQDEELHRVLTQIATGVFSPDDPRRYADLFDSLVNFGDH
FT                   YQLLADYRSYVDSHDKVDDVYRDEDEWTRRTLQNIANMGYFSADRTIQEYADEIWHIKP
FT                   IRL"
FT   gene            complement(277248..278747)
FT                   /locus_tag="Dd1591_0228"
FT   CDS_pept        complement(277248..278747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0228"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   eca:ECA4141 glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05121"
FT                   /db_xref="GOA:C6CGQ2"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGQ2"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACT05121.1"
FT                   /translation="METKDLIVIGGGINGTGIAADAAGRGLSVLLLEAQDLACATSSAS
FT                   SKLIHGGLRYLEHYEFRLVGEALSEREVLLKMAPHIIFPMRFRLPHQPHLRPAWMIRAG
FT                   LFMYDHLGKRVSLPSSHGLRFGRESVLKPELTRGFEYSDCWVDDARLVVLNAQEVVRRG
FT                   GDVKTRMKVTRAHRENGLWIVEAEDTLSGEIHRWQAKGLVNATGPWVRQFFDDGLALPS
FT                   PYGIRLIKGSHIVVPRVHQEEQAYILQNKDHRIVFVIPWQDDFSIIGTTDVEYHGDPHQ
FT                   VKIDDNEIRYLLDVYNDHFKKQLTRDDIVWTYSGVRPLCDDESDSPQAITRDYTLSVAD
FT                   ENGKAPLLSVFGGKLTTYRKLAEHALEKLVKYYPQAGQAWTRNAILPGGDLSGSREDYA
FT                   ATLRRRYNLPEALARRYSRTYGSQSEKILGNAQSLNDLGEHFGHTLYEAELRYLVEHEW
FT                   VVSLEDAIWRRTKLGMWLDDAQRQRVADWLVSYRSQLAKAG"
FT   gene            279088..279408
FT                   /locus_tag="Dd1591_0229"
FT   CDS_pept        279088..279408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0229"
FT                   /product="Thiosulfate sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="KEGG: eca:ECA4139 thiosulfate sulfurtransferase;
FT                   PFAM: Rhodanese domain protein; SMART: Rhodanese domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05122"
FT                   /db_xref="GOA:C6CGQ3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGQ3"
FT                   /inference="protein motif:PRIAM:2.8.1.1"
FT                   /protein_id="ACT05122.1"
FT                   /translation="MEQFQSIDIEQAYQRWQQGHTLVDIRDPQSFGAAHVPGSTHLTNE
FT                   TLADFVRDADFEQPVMVMCYHGISSRNAASYLMSLGFEAVYSVDGGFDAWQKRFPQDVA
FT                   AG"
FT   gene            279584..280426
FT                   /locus_tag="Dd1591_0230"
FT   CDS_pept        279584..280426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0230"
FT                   /product="Rhomboid protease"
FT                   /EC_number="3.4.21.105"
FT                   /note="PFAM: Rhomboid family protein; KEGG: eca:ECA4138
FT                   intramembrane serine protease GlpG"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05123"
FT                   /db_xref="GOA:C6CGQ4"
FT                   /db_xref="InterPro:IPR022732"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR023662"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="InterPro:IPR038236"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGQ4"
FT                   /inference="protein motif:PRIAM:3.4.21.105"
FT                   /protein_id="ACT05123.1"
FT                   /translation="MRWAIVMIRIVALSNPRLAQAFVDYMHTHQVRLVARINGDDVDIW
FT                   LPDESQQERVKQELARFLQEPWHERYQAASWQSGTTNSGLRYPSFSYMQTLRQRAGPLT
FT                   LSLLVVAIAVYLLMKVYGVDRLMVLLAFPDSTQDLQLWRWFSHALLHFSLLHLLFNLMW
FT                   WWYLGGPVERVLGSRRLCVILLASSAFSGWVQSWFSGVYFGGLSGVVYALMGYVWLRGE
FT                   REPDGPLHFQRSLMAFALIWLVAGYFDVLGMSIANAAHVAGLVMGVLMAWWDTRRRSM"
FT   sig_peptide     279584..279643
FT                   /locus_tag="Dd1591_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.778) with cleavage site probability 0.651 at
FT                   residue 20"
FT   gene            280552..281310
FT                   /locus_tag="Dd1591_0231"
FT   CDS_pept        280552..281310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0231"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR; KEGG: eca:ECA4137 DNA-binding transcriptional
FT                   repressor GlpR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05124"
FT                   /db_xref="GOA:C6CGQ5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGQ5"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACT05124.1"
FT                   /translation="MKQTQRHDAIIDLVRRQGYVSTEELVEHFAVSPQTIRRDLNDLAE
FT                   QNKIHRHHGGAALPSSSVNTAYHDRKMMWSDEKARIARQVASQIPDGATLFIDIGTTPE
FT                   AVAHALMNHKDLRVVTNNLNVATLLTAKEDFRLILAGGEVRSRDGGIIGEATLDFISQF
FT                   RLDFGILGISGIDMDGSLLEFDYHEVRTKRAIIENSRCVMLVTDHSKFGRNAMVNLGNM
FT                   DLIDYLFTDQLPPPSVLKIIEQHKVQLELC"
FT   gene            281355..283772
FT                   /locus_tag="Dd1591_0232"
FT   CDS_pept        281355..283772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0232"
FT                   /product="glycogen/starch/alpha-glucan phosphorylase"
FT                   /EC_number="2.4.1.1"
FT                   /note="KEGG: eca:ECA4136 maltodextrin phosphorylase;
FT                   TIGRFAM: glycogen/starch/alpha-glucan phosphorylase; PFAM:
FT                   glycosyl transferase family 35"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05125"
FT                   /db_xref="GOA:C6CGQ6"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGQ6"
FT                   /inference="protein motif:TFAM:TIGR02093"
FT                   /protein_id="ACT05125.1"
FT                   /translation="MSPLFNSSQFAAALQHQLQACAQPSLQALSLRQCWQWVSAALTEQ
FT                   LDALTSAESAPPDAGPSGVRHVNYLSMEFLPGRLTGNNLLNLGWYNAVAEVLAQHGLAL
FT                   SDLLEQETDPALGNGGLGRLASCYLDAMATVGQPAIGYGLHYQYGLFRQHFDAGFQRET
FT                   PDDWLRDSYPWARPRPELAVEVGFGGELVAQPGGGERWIPEQVVVGEATDIPVIGYHNG
FT                   QVQPLRLWQATHSEPFDLEQFNAGHYLKAEQQGIAAASLTKVLYPNDNHAAGKKLRLMQ
FT                   QYFQCACAVADIFRRHERAGRPLATLPDYEVVQLNDTHPTLAIPETLRLLLDEYELSWE
FT                   QAWQLTGRLFAYTNHTLMPEALECWDERLFGRLLPRHLSIIKTINEHLRRQVEARWPGE
FT                   RQVWARLAVVHRRQVRMANLCVVACFAVNGVAQMHSELVVRDLFPEYYQLWPTKFHNVT
FT                   NGITPRRWLKQCNPALSALIDETLQTEWGNRLTLLEGLAPYAQDSAFRARYRQIKQDNK
FT                   TQLAHFLRREYGIVVDPAAVFDVQIKRLHEYKRQHLNLLHILSLYKRLLIDPGLDIVPR
FT                   LFLFGAKAAPGYVLAKNIIYAINCVAEHINRDKRVNDRLKVVFLPDYRVSLAERIIPAA
FT                   DVSEQISTAGKEASGTGNMKLALNGALTMGTLDGANVEMAQEVGAENLFIFGHTVDQVK
FT                   TLIADGYKPARYIAANPLLKEILADLADGTFSHGDKTAFAPLLDSLLELGDPYLVLADF
FT                   APYCQAQQRVDALYREPDEWTRRCILNTARMGMFSADRAIQDYQKRIWTMRD"
FT   gene            283785..285938
FT                   /locus_tag="Dd1591_0233"
FT   CDS_pept        283785..285938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0233"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: eca:ECA4135 4-alpha-glucanotransferase;
FT                   TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05126"
FT                   /db_xref="GOA:C6CGQ7"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGQ7"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ACT05126.1"
FT                   /translation="MALKAKKSVPHQMGIADTYKDAYGNERAIDNETRQALLQLLEVTE
FT                   PSTAPLPSVCVLRQEQQNRLPLRHAGDYVWTLTYEKGGIIEGRITGQAVLALPDNLPLG
FT                   YHQLMLMQGEQQWPCRVIVAPTRCYEPEPLTQGKRWWGVMVQLYTLRSSDNWGIGDFGD
FT                   LKTLVEQVARRGGAFVGLNPLHALYPAQPEAASPYSPSSRNWLNIVYIDVNQVDDFHQS
FT                   DAARAWWKQDDIQQQLTAARANRWVDYTAVTRLKLAALRLAFSHFTNRNALDPRKTAFQ
FT                   QFLKTHDESLLQQATYDALQAWMHQQGKPTADWRQWPQEYHAARSDATLAFRQEHADDV
FT                   QFYCWLQWLAHEQLAACFSHSKQLGMPIGLYRDLAVGVAQGGVDTWGDQQLYCMSVTIG
FT                   APPDPLGPGGQNWNLTPVHPTLLRQRGYQPFIDLLRSNMAHSGALRIDHVMGLLRLWWI
FT                   LNGNDATHGAYVFYPVDDLLGILALESHRHRCLVIGEDLGTVPEEIVNKLPDNSVYSYK
FT                   VLFFEKDQQDRFRAPDEYPPRSMATITTHDLATLRGYWQGVDLTLGKDLGLYPDAAALQ
FT                   RQHEARECAKQGLLDALHEQALLPQRVGRNASLTTMSAQLNRGVQRYLADSASALLGLQ
FT                   LEDWLDMSTPVNVPGTDQEYPNWRRKLSRPLDSIFTDRYLERLIRDIDLRRGGPVPSRS
FT                   KKTVKPAETPVDNGKQKETKKPE"
FT   gene            complement(286062..286637)
FT                   /locus_tag="Dd1591_0234"
FT   CDS_pept        complement(286062..286637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0234"
FT                   /product="IscR-regulated protein YhgI"
FT                   /note="TIGRFAM: IscR-regulated protein YhgI; PFAM:
FT                   HesB/YadR/YfhF-family protein; nitrogen-fixing NifU domain
FT                   protein; KEGG: eca:ECA4134 putative DNA uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05127"
FT                   /db_xref="GOA:C6CGQ8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR017726"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGQ8"
FT                   /inference="protein motif:TFAM:TIGR03341"
FT                   /protein_id="ACT05127.1"
FT                   /translation="MIRITDAAQEHFAKLLVKQEEGTQIRVFVINPGTPNAECGVSYCP
FT                   PDAVEPNDTELKFEKLSAYVDELSAPYLEEAEIDFVTDQLGSQLTLKAPNAKMRKVGDD
FT                   APLMERVEYVLQSQINPQLAGHGGRVTLMEITEEGYAILQFGGGCNGCSMVDYTLKEGI
FT                   EKELLQKFPELKGVRDLTEHQRGEHSYY"
FT   gene            complement(286694..287413)
FT                   /locus_tag="Dd1591_0235"
FT   CDS_pept        complement(286694..287413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0235"
FT                   /product="gluconate periplasmic binding protein"
FT                   /note="KEGG: spe:Spro_4633 gluconate periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05128"
FT                   /db_xref="GOA:C6CGH0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGH0"
FT                   /inference="similar to AA sequence:KEGG:Spro_4633"
FT                   /protein_id="ACT05128.1"
FT                   /translation="MLTIMAQCWLCQQPLYHSHHGICSHCRRHLPQPPVCCPRCGLPSA
FT                   SHVLPCGRCLQQPPPWQSLLFVSDYQPPLNTLVRRIKFQRRTELAPALARLLLLQWLAR
FT                   RRETALILPEAYPRPDAIVTVPLHRRRHWRRGFNQTSLLARQLAHWLGCAYQPDTLIRV
FT                   RYTVPQQSLKAAFRRRNLRGAFRCRHTVVNQWVAGKRLVLLDDVVTTGSTAAEISRTLL
FT                   NAGAQQVQVWCVCRTLS"
FT   gene            287492..288277
FT                   /locus_tag="Dd1591_0236"
FT   CDS_pept        287492..288277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0236"
FT                   /product="bioH protein"
FT                   /EC_number="3.1.1.1"
FT                   /note="KEGG: eca:ECA4132 putative biotin biosynthesis
FT                   protein; TIGRFAM: bioH protein; PFAM: alpha/beta hydrolase
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05129"
FT                   /db_xref="GOA:C6CGI6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGI6"
FT                   /inference="protein motif:TFAM:TIGR01738"
FT                   /protein_id="ACT05129.1"
FT                   /translation="MESLYWHTEGEGTCELVMLHGWGMNSQVWNSIVMRLAPHFRLHRV
FT                   DLPGYGQSQGFGVMSLADMAQQVLAQAPARAVWLGWSLGGLVASQAALSAPERVSALIT
FT                   LASSPCFEERDGWPGIRPQVLSGFQQLLSDDFFGTIERFLALQTLGTENARKDARSLKA
FT                   ALSGQPAPTTEVLNAGLGILRDTDLREPLSTLTMPFLRLYGALDGLVPRKVAALMDEQY
FT                   PHSTSVVIPKAAHAPFISHPEVFVEHVVGFVGKISTFDK"
FT   gene            complement(288411..288608)
FT                   /pseudo
FT                   /locus_tag="Dd1591_0237"
FT   gene            288612..289820
FT                   /locus_tag="Dd1591_0238"
FT   CDS_pept        288612..289820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0238"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: yps:YPTB3311
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05130"
FT                   /db_xref="GOA:C6CF00"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:C6CF00"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ACT05130.1"
FT                   /translation="MDEKKLKALATELAKGLKTEADLNQFSRMLTKLTVETALNAELTD
FT                   HLGYEKNAPKSGSNTRNGYSTKTVLSDEGEIELSTPRDRENTFEPQLIKKNQTRITQMD
FT                   SQILSLYAKGMTTREIVATFREMYDADVSPTLISKVTDAVKDQVAEWQNRPLDAIYPIV
FT                   YLDCIVVKVRHNGSVINKSVFLALGINTEGRKELLGMWLAENEGAKFWLNVLTELKNRG
FT                   LQDILIACVDGLKGFPDAINSVYPQTHIQLCIIHMVRNSLKYVSWKDYKDITSGLKAVY
FT                   RAPTEEAALMALEAFAGVWDEKYPQISKSWRTHWENLNTFFGYPPDIRKAIYTTNAIES
FT                   LNSVIRQAIKKRNVFPTDDSVRKVIYLAIQSASKKWSMPIQNWRLAMSRFIIEFGDRLS
FT                   AHL"
FT   gene            complement(289854..290069)
FT                   /locus_tag="Dd1591_0239"
FT   CDS_pept        complement(289854..290069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0239"
FT                   /product="protein of unknown function DUF1493"
FT                   /note="PFAM: protein of unknown function DUF1493; KEGG:
FT                   yps:YPTB1663 putative acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05131"
FT                   /db_xref="InterPro:IPR010862"
FT                   /db_xref="UniProtKB/TrEMBL:C6CGQ9"
FT                   /inference="protein motif:PFAM:PF07377"
FT                   /protein_id="ACT05131.1"
FT                   /translation="MESNKNKIISLVKRHAGVSITPYQKEITEKSIINSEFDFDEDEIE
FT                   ILMSDFFKEFSITPDGFNIKSYYYDY"
FT   gene            complement(290310..292652)
FT                   /locus_tag="Dd1591_0240"
FT   CDS_pept        complement(290310..292652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0240"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; RNA binding S1
FT                   domain protein; KEGG: eca:ECA4122 putative RNA binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05132"
FT                   /db_xref="GOA:C6CH20"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH20"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACT05132.1"
FT                   /translation="MTNALSQIIASELQARTEQVSAAVQLLDEGNTVPFIARYRKEVTG
FT                   GLDDTQLRQLESRLSYLRELEERRQTILKSIEEQGKLTDALAASINGTLSKTELEDLYL
FT                   PYKPKRRTRGQIAIEAGLEPLADSLWSDPSQTPERAAEAYVNADNGVADVKAALDGARY
FT                   ILMERFAEDAALLGKVRDYLWKNAHLVSRVVEGKEEDGAKFRDYFDHHEPLSQVPSHRA
FT                   LAMFRGRNEGVLQLSLNADPQFDEPPKESHCEHIIIDHLGLRLGNAPADGWRRAVVNWT
FT                   WRIKVLLHLETELMGSVREKAEDEAINVFARNLHDLLMAAPAGMRATMGLDPGLRTGVK
FT                   VAVVDATGKLVATDTIYPHTGQAAKAAAIVAALCIKHQVELVAIGNGTASRETERFFLD
FT                   TQKQFPEVKAQKVIVSEAGASVYSASELAALEFPSLDVSLRGAVSIARRLQDPLSELVK
FT                   IDPKSIGVGQYQHDVSQTQLAKKLDAVVEDCVNAVGVDLNTASVPLLTRVAGLTRLMAQ
FT                   NIVSWRDENGRFNNRDQLLKVSRLGPKAFEQCAGFLRINHGDNPLDASTVHPEAYPVVE
FT                   RILAATEQKLQDLMGNAGSLRSLKPASFTDDRFGVPTVTDIIKELEKPGRDPRPEFKTA
FT                   SFADGVETLNDLLPGMILEGAVTNVTNFGAFVDIGVHQDGLVHISSLSDRFVEDPHQVV
FT                   KAGDIVKVKVLEVDLQRKRIALTMRLDEQPGEGNSRRGSGRERERDNGNPSRPAQAGNK
FT                   ARPRQASSTPAGNSAMSDALAAAFKKR"
FT   gene            complement(292821..294530)
FT                   /locus_tag="Dd1591_0241"
FT   CDS_pept        complement(292821..294530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0241"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; SMART:
FT                   phospholipid/glycerol acyltransferase; KEGG: eca:ECA4119
FT                   putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05133"
FT                   /db_xref="GOA:C6CH21"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH21"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACT05133.1"
FT                   /translation="MFSLDTILQDIAPHRPTPKWQRSILRTMLFETEIQDFAQRYPHLK
FT                   GLDLVEQILDHFSLNCEMVEGDLENIPSRGPVILVANHPIGSLDGLALLRTVASVRPDV
FT                   RVVASQLLSYIGPLKNLFFAVDNFSNRTRRHQLAAIQEHLAGDGAIIMFPAGEVSRMSL
FT                   KGIRDGHWHSGFIRMAAKARAPIVPIHISGRNSNLFYLSSLIYRPLSTLLLVREMFRQR
FT                   GNRLRFRIGAQIPYATWSQGEWQPNDLAARFRRHVYRLGQGKPGCFPGEKPIALAEERT
FT                   LLKRALESCETLGTTPDGKKIYLYRRGSEDYVPILRELGRLREIAFRAVGEGSGKRRDL
FT                   DSFDDDYLHLVLWDDRELEIVGAYRFAPTARLLAEKDINSLYSHSLFQYGDEMAPVLAS
FT                   GIELGRSFIQPKYWGKRGLDYLWLGIGAYLARYPEYRYLFGPVSLSGSLPPTARDLLIA
FT                   FYRLHFAPSQMLARSRRPYPASLPDVLRQFEGDDYQQDLTRLKSILSNMGCSIPTLYKQ
FT                   YSELCEPGGVQFIDFGVDPDFNNCVDGLVLVDLQQLKPSRYQRYIEPFCNKA"
FT   gene            complement(294685..296685)
FT                   /locus_tag="Dd1591_0242"
FT   CDS_pept        complement(294685..296685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0242"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: asu:Asuc_0556 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05134"
FT                   /db_xref="GOA:C6CH22"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH22"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACT05134.1"
FT                   /translation="MHMNKYQQYARTLLKTLWWQVLLLSLLLSGARLTMFWVFADVQQL
FT                   HDHEAAIRLMWLTGLRYDLRAVSILLAPLLVIGLLISLHHIGWRWLQRIAPWYLGGCAF
FT                   LVSAIAIINYFYYQTYHTYIDIFAFGLIDDGPRAVLTTIWQDYPIVISLLLVLLFAWLS
FT                   ARLGRQTLLSTRSPRLLSRTMFVVYLFISLLLFFAMIRGSLSTFPLRRNDSQISSATIL
FT                   NKLTPNGLMASAWAMGDRDDDIRFEPVTRTAGEQLRAQSGLSTLEGRTPVNPWLAAHRP
FT                   NVVMALMESMGSNMLVYDHLPDNDMLGALRPHFATDFVFRRFVSEGNGTAPSFAAMFFQ
FT                   SPIQNLSHSSAQYKSLDDTPYATYKKAGYKVIFITSGSRMWRNFGNYLPRLGVDEIYDQ
FT                   SSLMERYPESRTMLTDWGVPDEFAFRLAQSLLADARQPLFISILTVTNHPPYQVPAGYH
FT                   PHPVHAGPEMMAHAEVNQQEQESIAATYQYATDALGEFITAVKSSPVGESTLIAASGDH
FT                   QMRRLKAQYPHEQFLDRAVPFYLYVPKTILTQTAWRFDPSRPGSHKDIFPTLYAYSLSD
FT                   TPYYALGGRNMLAEQDDATRAFGYNQVLWIDEQGVTPIGSNGRYPWDPANPMLTQSAPS
FT                   AISAEQQQRTTAYPALLHWQINAREQGVIDK"
FT   sig_peptide     complement(296563..296685)
FT                   /locus_tag="Dd1591_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.908 at
FT                   residue 41"
FT   gene            complement(296816..297298)
FT                   /locus_tag="Dd1591_0243"
FT   CDS_pept        complement(296816..297298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0243"
FT                   /product="transcription elongation factor GreB"
FT                   /note="TIGRFAM: transcription elongation factor GreB; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: shm:Shewmr7_3890 transcription elongation factor
FT                   GreB"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05135"
FT                   /db_xref="GOA:C6CH23"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006358"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH23"
FT                   /inference="protein motif:TFAM:TIGR01461"
FT                   /protein_id="ACT05135.1"
FT                   /translation="MKTDLITREGYEALHQELNYLWKERRPEITEKVAWAASLGDRSEN
FT                   ADYLYNKRLLREIDRRVRYLRKRLQVVRVVDYSPQQDGKVFFGAWVEVENEDGDIKCFR
FT                   IVGPDEIYGRKDYISIDAPMARALLKKAVDEEAVVSTPAGPKVWYVNKIDYHNPIG"
FT   gene            297569..298288
FT                   /locus_tag="Dd1591_0244"
FT   CDS_pept        297569..298288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0244"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: eca:ECA4108 osmolarity response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05136"
FT                   /db_xref="GOA:C6CH24"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH24"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACT05136.1"
FT                   /translation="MQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLT
FT                   RESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIP
FT                   KPFNPRELLARIRAVLRRQANELPGAPSQEEAVIAFGKFKLNLGTREMFRDDEPMPLTS
FT                   GEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYI
FT                   QTVWGLGYVFVPDGSKA"
FT   gene            298285..299697
FT                   /locus_tag="Dd1591_0245"
FT   CDS_pept        298285..299697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0245"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   eca:ECA4107 osmolarity sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05137"
FT                   /db_xref="GOA:C6CH25"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH25"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACT05137.1"
FT                   /translation="MTRWRFSPRSAFARTLLLIVTLLFVSLVTTYLVVLNFAILPSMQQ
FT                   FNKVLAYEVRMLMTDKLQLEDGSTLDVPPAFRREIYRELGISLYTNAAAEESGLRWAQH
FT                   YKFLSQQMAQQLGGPTEVRVEVSKNTPVVWLKTWLSPDIWVRVPLTEIHQGDFSPLFRY
FT                   TLAIMLLVIGGAWLFIRVQNRPLVELEHAAIQVGKGIIPPPLREYGASEVRSVTRAFNQ
FT                   MASGVKLLADDRTLLMAGVSHDLRTPLTRIRLATEMMSQEDEYLAESINKDIEECNAII
FT                   EQFIDYLRTGQEMQMEVADLNAILGEVVASESGYEREIDSELARGELLMKVSPLSIKRA
FT                   VANLVVNAARYGNGWIRVSSGRELQRAWFQVEDDGPGIDPSQLAHLFQPFVRGDSARST
FT                   SGTGLGLAIVQRIIDAHNGSLDVGSSERGGLRVRAYLPLAFPNQAGVSTVRTRDGHRRG
FT                   MPPPGHDRQERK"
FT   sig_peptide     298285..298377
FT                   /locus_tag="Dd1591_0245"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.938) with cleavage site probability 0.468 at
FT                   residue 31"
FT   gene            complement(299812..301431)
FT                   /locus_tag="Dd1591_0246"
FT   CDS_pept        complement(299812..301431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0246"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="KEGG: eca:ECA4106 phosphoenolpyruvate carboxykinase;
FT                   TIGRFAM: phosphoenolpyruvate carboxykinase (ATP); PFAM:
FT                   phosphoenolpyruvate carboxykinase (ATP)"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05138"
FT                   /db_xref="GOA:C6CH26"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH26"
FT                   /inference="protein motif:TFAM:TIGR00224"
FT                   /protein_id="ACT05138.1"
FT                   /translation="MQIKGITPEALTAYGIHDVREIVYNPSYDLLFTEETSPTLQGYER
FT                   GIETQLGAVAVDTGIFTGRSPKDKYIVRDDVTRDTVWWSDQGKGKNDNHPLSQETWQHL
FT                   KQRVTRQLSGKRVFVVDAFCGANADTRLKVRFITEVAWQAHFVKNMFIRPSDEELPGFE
FT                   PDFIVMNGAKCTNPQWQEQGLNSENFVAFNLTERIQLIGGTWYGGEMKKGLFSIMNYLL
FT                   PLKGIASMHCSANVGEKGDVAVFFGLSGTGKTTLSTDPKRQLIGDDEHGWDDDGVFNFE
FT                   GGCYAKTINLSAEAEPDIYHAIRRDALLENVTVLADGSVDFSDGSKTENTRVSYPIYHI
FT                   DNIVKPVSKAGHATKVIFLTADAFGVLPPVSRLTADQTQYHFLSGFTAKLAGTERGVTE
FT                   PTPTFSACFGAAFLTLHPTQYAEVLVKRMQAAGAKAYLVNTGWNGTGKRISIKDTRGII
FT                   DAILNGSIDDAETQTLPIFNLSIPTALPGVDPAILDPRDTYASVAQWEEKAHDLAQRFI
FT                   TNFDKYTDTPAGAALVSAGPKL"
FT   gene            301501..301746
FT                   /locus_tag="Dd1591_0247"
FT   CDS_pept        301501..301746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0247"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05139"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH27"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05139.1"
FT                   /translation="MTIKKLNKFINNFAYTCEQEVSKRLQYNQNGRVKYRSLMAGLIIL
FT                   KTTDNPLAGYPWRSKMAQYADRISVTSGYRWIDECR"
FT   gene            complement(301703..302575)
FT                   /locus_tag="Dd1591_0248"
FT   CDS_pept        complement(301703..302575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0248"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: eca:ECA4105 HSP33-like
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05140"
FT                   /db_xref="GOA:C6CH28"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH28"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ACT05140.1"
FT                   /translation="MANHDQLHRYLFENHAVRGELVTVSDTFQQMLANHDYPTPVKNLL
FT                   GDMLVATSLLTATLKFSGDITVQLQGDGPLKLAVINGNQQQQMRGVARLQGDIAPDSSL
FT                   HDMVGNGYLVITITPTEGERYQGVVGLDGDNVATCLENYFQQSEQLPTRLFIRTGEHDG
FT                   RQCAAGMLLQVLPAQQGNRDDFDHLTQLTATVKGEELFGLPADDVLYRLYHQENVTLYE
FT                   PQPVTFQCHCSRERCADALMTLSADEISDMLAQDGQIDMHCDYCGSHYLFNAQDINDIR
FT                   QSSDTPTLH"
FT   gene            complement(302601..303014)
FT                   /locus_tag="Dd1591_0249"
FT   CDS_pept        complement(302601..303014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0249"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; KEGG: ses:SARI_04118
FT                   ribosome-associated heat shock protein HSP15"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05141"
FT                   /db_xref="GOA:C6CH29"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH29"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACT05141.1"
FT                   /translation="MSKDSQHDGGNAVRLDKWLWAARFYKTRALAREMIDGGKVHYNGQ
FT                   RSKPGKLVELDAEITLRQGNDARTVIVRAVSDQRRPAVQAQALYEETQQSIEKREQLAQ
FT                   ARKLNALSMPHPDRRPDKKERRDLIKFKYSDAE"
FT   gene            complement(303011..303715)
FT                   /locus_tag="Dd1591_0250"
FT   CDS_pept        complement(303011..303715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0250"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: eca:ECA4103 putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05142"
FT                   /db_xref="GOA:C6CH30"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH30"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACT05142.1"
FT                   /translation="MNPELNWNEIDTVLLDMDGTLLDLAFDSYFWLQLVPESLSRQRDI
FT                   SLDQAQQLIAVEYQAVRHTLNWYCFDYWSERLSLDIHQMTSDIGHRARLRDDTAPFLHA
FT                   LRRSGRRTILLTNAHPHGLSVKVAHTGLDRHLDLLLSTHTYGYPKEDQRLWQAVQAETG
FT                   FNPERTLFVDDSEPILDAARAFGIRYCLGVSNPDSTNPQENRFRQHPSMNDYLALLPGI
FT                   HQSVPVGNQECS"
FT   gene            complement(303835..305970)
FT                   /locus_tag="Dd1591_0251"
FT   CDS_pept        complement(303835..305970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0251"
FT                   /product="Intracellular growth attenuator IgaA"
FT                   /note="PFAM: Intracellular growth attenuator IgaA; KEGG:
FT                   eca:ECA4102 intracellular growth attenuator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05143"
FT                   /db_xref="GOA:C6CH31"
FT                   /db_xref="InterPro:IPR010771"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH31"
FT                   /inference="protein motif:PFAM:PF07095"
FT                   /protein_id="ACT05143.1"
FT                   /translation="MRTILIILAVLFAGLITVGGIIGYLMYRRLLFARRLPVTPSGHRQ
FT                   LTASERIAIERYLTMAHLDSTVSASVPATLPRLLPGNRVYPITHSITRYGLSTDAPNKW
FT                   RYYIDTQEIHLPARWEQYITQNNEIELIKTRSIPLVISLNGHSLTEFVNEMDSFAGSDI
FT                   PGEQASIRPEIHEHTELVAIRKETKEEHAVHRSRGLRESAVLSLAFLLLVFSLTSPLAM
FT                   LPWLAGAACLMMAWGGWQLFRPPSQKELREVHCLHGTPQCMGLFSDTSQSQIGNVSLGN
FT                   IDLIYPPHWQPYIGYDLGRKTDVDIYLTRQVVRQGNYLSLHNEVKFFPLQQWGKNAVLA
FT                   AGALLSLTLLLTSVPLDLPLKLSLAWVQGASSLKVNQVEELEHMPLHIGDKLQVRGSGM
FT                   CYVPPISLNPTASKASAFAPFDCAAIYWNKAAPLPLPESDTIEKTAALQKTVNEQLHPA
FT                   ASDNQVSSQLADAIQKSGMILLNNFSDIVLKTDALCEKEEDCTRLKNALINLGNAKNWD
FT                   LLVKRARSGALKGMSVVLRPVSAESLDALVKNATDEFYNREIITASNSLNSPPPGGFLI
FT                   RSDEGRQFVNHQAPVAPLRDLPPQEQWQELQRLSSLLLHTPFEASGVITQLSIDANGTR
FT                   HISLHSEPDAVTMWRSLGACLLLLAFSVIMILNLVLLLVKRRRSRQRIANIQQYYARHL
FT                   VPEAPAAGPLYGSTVHP"
FT   gene            306393..306965
FT                   /locus_tag="Dd1591_0252"
FT   CDS_pept        306393..306965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0252"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: eca:ECA4100 ADP-ribose
FT                   diphosphatase NudE"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05144"
FT                   /db_xref="GOA:C6CH32"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH32"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACT05144.1"
FT                   /translation="MNNNLQKPKILKVETVARSHLFNVESVDLEFSNGERRIYERMRPS
FT                   GREAVMIVPVIGDELLLIREYAVGIEQYELGFPKGLIDPGETVFEAANRELMEEVGFGA
FT                   QQFELLSTLTMAPSYFSSCMNIVVANGLYPQRLQGDEPEPLQLVRWPLAEMMALLKEPD
FT                   FREARNVSALFLAQQFLAQQFLSQSAK"
FT   gene            complement(307119..309677)
FT                   /locus_tag="Dd1591_0253"
FT   CDS_pept        complement(307119..309677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0253"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: eca:ECA4099 peptidoglycan
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05145"
FT                   /db_xref="GOA:C6CH33"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH33"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ACT05145.1"
FT                   /translation="MKFVKYLFILAVSCILLGVASLYGLYRYIEPQLPDVATLKDVRLQ
FT                   TPMQVYSADGELIAQFGEKRRIPLKLDQIPPTLVNAFIATEDSRFFEHHGVDPQGIIRA
FT                   ALIALTSGHASQGASTITQQLARNFFLSPERTLLRKIKEVFLAIRIEQTLTKEEILELY
FT                   LNKIYLGYRAYGVGAAAQVYFGRPVDQLTLAQMAMIAGLPKAPSTFNPLYSYDRAVARR
FT                   NVVLSRMLDENYITQVQYNQARSEKLVADYHAPEIAFSAPYLAEMVRQEMVKRYGEDAY
FT                   NDGYQVYTTITRKLQLAAEDAVHNNVIAYDMRHGYRGPDQVLWKVGIPALTQDKIVEAL
FT                   KKLPVYGPLFPAVVTDAGADKAHAILASGDKIELPMVGVRWARAYRSDDQQGPTPKRVT
FT                   DVLEAGQQIWVRKVDNDWWLAQVPDVNSALVSLNPKDGAILALVGGFDFNQSKFNRATQ
FT                   ALRQVGSNIKPFLYTAAMDKGLTLATILNDAPITRWDPGAGSDWSPKNSPAVYDGPIRL
FT                   RQGLGQSKNVVMVRAMRAMGVDYAANYLERFGFPEQNIVHTESLALGAASFTPLQVVRG
FT                   YSVMANGGYLVDPYFITKIDNAAGNNLFTAMPKIVCDTCNLPVIYGDTQRSAVLSDDSM
FT                   ENVATSQENPVQAAPQVDPITPSEVARQAAMQPYAPHVISTPLAFLIKDALNSNVFGEP
FT                   GWMGTGWRAGKVLQRHDIGGKTGTTNNSKDAWFSGYGPNVVASVWIGFDDHRRDLGRTS
FT                   ASGVIRDQISGYEGGAKSAEPAWDDFMKVALNGVPEQKTPPPQGVVTVTIDRSSGKLSD
FT                   GGANSRQEYFIDGTQPNERAVHDAGTTLFNTSSGQAEELF"
FT   sig_peptide     complement(309609..309677)
FT                   /locus_tag="Dd1591_0253"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.869) with cleavage site probability 0.401 at
FT                   residue 23"
FT   gene            complement(309772..309924)
FT                   /locus_tag="Dd1591_0254"
FT   CDS_pept        complement(309772..309924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05146"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH34"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05146.1"
FT                   /translation="MFDLLIVSQQNRYPMGVEMQAGRQQSNARLFCLTLKGKGPGTESS
FT                   HAPVT"
FT   gene            309927..310805
FT                   /locus_tag="Dd1591_0255"
FT   CDS_pept        309927..310805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0255"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05147"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH35"
FT                   /inference="similar to AA sequence:KEGG:ECA4098"
FT                   /protein_id="ACT05147.1"
FT                   /translation="MAYPIWQVGLDIQNGFIRAMAVQRRRYGWQLRHWWQLPLPDGTLR
FT                   GGSLHHPTELCTVLRQWRQELPRFVSLRLGFPAPRVLQQRLAMPDRRLREPQRGDYIRK
FT                   MAVKALPVSGDDLALDYRPDPQTPNMLLVTAARQTELDVWLHCLRDAGLQPDAVDITPC
FT                   ALRCMAARAGLADDRLLLHRFDDHWLWVSPLKAPLAFGTFHPDDMADGATDIQVEPDLI
FT                   KYVSTCYQKEVPPVAYLSASTPAGLQHTSASLAAWSPLTAFSQQQPPLPAFPAAFAIAG
FT                   GLAIRPEDSPC"
FT   gene            310799..311359
FT                   /locus_tag="Dd1591_0256"
FT   CDS_pept        310799..311359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0256"
FT                   /product="Fimbrial assembly family protein"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   eca:ECA4097 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05148"
FT                   /db_xref="GOA:C6CH36"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH36"
FT                   /inference="protein motif:PFAM:PF05137"
FT                   /protein_id="ACT05148.1"
FT                   /translation="MLTVNLLVWRPRLLYRRMRLSLLLSGIVLLGIGGAAAILRGHYQQ
FT                   QRMWWTQQIEWVVLQPPRYEQLYLQTFAAWQQRETRLAQQAAQEQSRRRNQRYQILLEQ
FT                   LPIVLPDSLWLTEISDDGSRIHVSGVSNHYSAVVALTNVMAVLPHIADADVQQTERDPQ
FT                   NRARLNFSLRFYWQDVAESGEKA"
FT   sig_peptide     310799..310912
FT                   /locus_tag="Dd1591_0256"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.702 at
FT                   residue 38"
FT   gene            311359..311910
FT                   /locus_tag="Dd1591_0257"
FT   CDS_pept        311359..311910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA4096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05149"
FT                   /db_xref="GOA:C6CH37"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH37"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05149.1"
FT                   /translation="MRRLYPQLAHWLSAPLWLWLLAPSAAILLAALIGGGVWMSAERQH
FT                   LRQLKQQYRDGENAIEQWRRKITPLPDLHSLQRWLAGQPLSAQDWPLNRISSLLDAPLH
FT                   DSGVHLEVWQPLSAQARHGSSPAWRLVFNAEYGETLDFLSRFSRLPVVLRIDRISIRKV
FT                   PAGLRTELQLSLPQPSEAKP"
FT   sig_peptide     311359..311451
FT                   /locus_tag="Dd1591_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.834 at
FT                   residue 31"
FT   gene            311907..312266
FT                   /locus_tag="Dd1591_0258"
FT   CDS_pept        311907..312266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0258"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA4095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05150"
FT                   /db_xref="InterPro:IPR019684"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH38"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05150.1"
FT                   /translation="MKRGWIGILRAGLFLCCMGAEAVTRDPFQPLSTASCDDNPVKDKW
FT                   QLKGMVGSSSQWVGWLFQPQSHWLRVRDGDVLPLGDWQVMRLDRSGVVLRTTGGQGRCG
FT                   TAEIHLNAPFHHNME"
FT   sig_peptide     311907..311975
FT                   /locus_tag="Dd1591_0258"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.909 at
FT                   residue 23"
FT   gene            312270..313571
FT                   /locus_tag="Dd1591_0259"
FT   CDS_pept        312270..313571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0259"
FT                   /product="type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; Secretin/TonB short
FT                   domain; NolW domain protein; KEGG: eca:ECA4094 putative
FT                   outer membrane porin HofQ"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05151"
FT                   /db_xref="GOA:C6CH39"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH39"
FT                   /inference="protein motif:TFAM:TIGR02515"
FT                   /protein_id="ACT05151.1"
FT                   /translation="MQTGRFPNGRFRRYGWLVMLFGSMLAEASRDEPVSLSFDDVPVQR
FT                   VLQALADHQQLNLVVAPGVAGNVSLNLQQVPWQQALDIILRMGQLTLERQDSVMMVYPD
FT                   TMMKDRQQKQEELAAKQRQQLPLQNVSVTLQYAEAADVVANLQSQRGTLLTERGNVTVD
FT                   KRTNTLLVRDVGSALEQIRPWIEELDKPLSQVQLAAHIVTISSEHLKALGVNWGLGDGM
FT                   ATGQALQMNNFNVSLPIESPAINAGFHLAKLNGRLLDLELMALEQENEVEIIASPRLFT
FT                   AHQQTASIKQGTEIPYQVSSGASGSTSIEFKEAVLGMEVTPRILHGGQITLNLLISQNM
FT                   PGRAIKQGENGEILAIDKQEIQTQVTVQDGETIVLGGIFQQQKNQAERQVPGLGALPGI
FT                   GAWFRSGNRQHTRRELVIFITPTLIQAAKRKPAA"
FT   gene            314007..314576
FT                   /locus_tag="Dd1591_0260"
FT   CDS_pept        314007..314576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0260"
FT                   /product="Shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="PFAM: shikimate kinase; KEGG: esa:ESA_04351
FT                   shikimate kinase I"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05152"
FT                   /db_xref="GOA:C6CH40"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH40"
FT                   /inference="protein motif:PRIAM:2.7.1.71"
FT                   /protein_id="ACT05152.1"
FT                   /translation="MAGRVIINEFLSNTKKMAEKRNIFLVGPMGAGKSTIGRQLAQQLN
FT                   MEFFDSDQEIERRTGADVGWVFDVEGEEGFREREEKVINELTEKQGIVLATGGGSVKSR
FT                   ETRNRLSARGVVVYLETTIEKQLARTQRDKKRPLLQVETPPREVLEALAKERNPLYEEI
FT                   ADVTIRTDEQSAKVVANQIISMLENN"
FT   gene            314630..315715
FT                   /locus_tag="Dd1591_0261"
FT   CDS_pept        314630..315715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0261"
FT                   /product="3-dehydroquinate synthase"
FT                   /note="TIGRFAM: 3-dehydroquinate synthase; PFAM:
FT                   3-dehydroquinate synthase; KEGG: spe:Spro_4604
FT                   3-dehydroquinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05153"
FT                   /db_xref="GOA:C6CH41"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH41"
FT                   /inference="protein motif:TFAM:TIGR01357"
FT                   /protein_id="ACT05153.1"
FT                   /translation="MERVTVTLGERSYPITIAAGLFNDAASFMPLKAGDQAMLVTNETL
FT                   APLYLDAVRDRLEKSGVRVDQVILPDGEQFKSLAVLEQVFSALLAKPHGRDTTLVALGG
FT                   GVIGDLTGFAAACYQRGVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASV
FT                   VVDLDCLKTLPARELSSGLAEVIKYGIILDGTFFEWLETHIDEVRNLESAALAYCIRRC
FT                   CELKAEVVAADERESGLRALLNLGHTYGHAIEAEMGYGNWLHGEAVAAGMVMAAQAARR
FT                   LGQLNADDVERIKALLLCAGLPVTGPHEMVPQAYLPHMMRDKKVLAGELRLVLPTAIGQ
FT                   SEVRSGISHELVLASIADCLP"
FT   gene            315850..316902
FT                   /locus_tag="Dd1591_0262"
FT   CDS_pept        315850..316902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0262"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG: eca:ECA4091
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05154"
FT                   /db_xref="GOA:C6CH42"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR032899"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH42"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ACT05154.1"
FT                   /translation="MDEFNPEEELKPDTSDRRPVRQQRRSKSFSAPSVSLSRQHTMIGI
FT                   GIVVLVLLIIGIGSALQSPSQNSSSASSQSSGSGKNIDLSSSMSSSQEQAASPAASQPS
FT                   SPAPTGNQNTAGTGAPQTLSGQPVSGTPTQAPLPAQSNGQQRIELPGNITDALSQPQQQ
FT                   DRVNAFSAGLPTEPATVFSPTAKGGRTPSVEKSPSHVQAEKPSAPASHKTAAEAKEAAK
FT                   PATNTHRAPTTAVTPAPSSKPVTAVKPATSTGSQGNAAIQSAPASHFTVQLSSASREDS
FT                   LKTYAREQRLTNYWVYETKRDGRPWYVLVNGVYASPEDAKRAIASLPADVQAKKPWVRP
FT                   IRQVKQDLTK"
FT   gene            316979..317806
FT                   /locus_tag="Dd1591_0263"
FT   CDS_pept        316979..317806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0263"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: eca:ECA4090 DNA adenine methylase; TIGRFAM:
FT                   DNA adenine methylase; PFAM: D12 class N6 adenine-specific
FT                   DNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05155"
FT                   /db_xref="GOA:C6CH43"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH43"
FT                   /inference="protein motif:TFAM:TIGR00571"
FT                   /protein_id="ACT05155.1"
FT                   /translation="MKKNRAFLKWAGGKYPLVEEIRRYLPAGERLIEPFVGAGSVFLNT
FT                   DYDSYILADINSDLINLYKIVKNETDAFISDARKLFIDEVNTSDVFYQLRDEFNLCTND
FT                   YRRALLFLYLNRHCYNGLCRYNMRGEFNVPFGRYKKPYFPEEELYWFAEKAQNATFVCE
FT                   HYQQTLTNATSGSVVYCDPPYAPLSATANFTAYHTNNFNYQDQQNLAQLAQRLSSQNQI
FT                   PVLISNHDTVLTREWYRDASSLYVVKARRTISRNISGRSKVNELLALYCQATP"
FT   misc_binding    316996..317149
FT                   /locus_tag="Dd1591_0263"
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam(RF
FT                   00050), score 20.38"
FT   gene            318031..318708
FT                   /locus_tag="Dd1591_0264"
FT   CDS_pept        318031..318708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0264"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="KEGG: eca:ECA4089 ribulose-phosphate 3-epimerase;
FT                   TIGRFAM: ribulose-phosphate 3-epimerase; PFAM:
FT                   ribulose-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05156"
FT                   /db_xref="GOA:C6CH44"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH44"
FT                   /inference="protein motif:TFAM:TIGR01163"
FT                   /protein_id="ACT05156.1"
FT                   /translation="MKPFLIAPSILSADFARLGEDTARVLAAGADVVHFDVMDNHYVPN
FT                   LTIGPLVLKSLRNYGITAPVDVHLMVKPVDRLIPDFAEAGASFITFHPEASEHVDRTLQ
FT                   LIKSHGCKAGLVFNPATSLSYLDYVMDKLDIILLMSVNPGFGGQSFIPSTLDKLRQVRR
FT                   RIDESGYDIRLEVDGGVKVDNIAQIAAAGADMFVAGSAIFGQPDYRAVIDSMRQELKAV
FT                   RHD"
FT   gene            318701..319399
FT                   /locus_tag="Dd1591_0265"
FT   CDS_pept        318701..319399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0265"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="TIGRFAM: phosphoglycolate phosphatase;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 3;
FT                   HAD-superfamily hydrolase, subfamily IA, variant 1; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   eca:ECA4088 phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05157"
FT                   /db_xref="GOA:C6CH45"
FT                   /db_xref="InterPro:IPR006346"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR037512"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH45"
FT                   /inference="protein motif:TFAM:TIGR01449"
FT                   /protein_id="ACT05157.1"
FT                   /translation="MTDFAAIRGLAFDLDGTLVNSAPGLAKAVDMALGALSLPHAGEER
FT                   VSTWIGNGADVLVERALRWAGMEPTDRQIQDARTLFDKYYARTVDSGSLLFPEVQDTLA
FT                   ELAGRGFRMAVVTNKPTPFVAPLLDMLGIGRYFSLILGGDDVTEKKPHPAPLYMVLGKL
FT                   GLRVNELLFVGDSRNDIQAARAAGCPCVGMTYGYNYGEAIALSHPDVVLDRFADLLTLD
FT                   GLPFLNDQEA"
FT   gene            319401..320405
FT                   /locus_tag="Dd1591_0266"
FT   CDS_pept        319401..320405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0266"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: eca:ECA4087 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacyl-tRNA
FT                   synthetase class Ib"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05158"
FT                   /db_xref="GOA:C6CH46"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH46"
FT                   /inference="protein motif:TFAM:TIGR00233"
FT                   /protein_id="ACT05158.1"
FT                   /translation="MSKPIVFSGAQPSGELTIGNYMGALRQWVNMQDDFHCIYCIVDQH
FT                   AITVRQDPQQLRKATLDTLALYLACGIDPQKSTIFVQSHVPEHAQLSWLLNCYTYFGEL
FT                   SRMTQFKDKSARYEENINAGLFDYPVLMAADILLYQTNQVPVGEDQKQHLELSRDIAQR
FT                   FNAIYGDVFRVPEPFIPKSGARVMSLLEPTKKMSKSDDNRNNVIGLLEDTKSVVKKIKR
FT                   AVTDSDEPPVVRYDQQNKAGVSNLLDILSGVTGKSIPDLEKEFEGQMYGHLKGAVADAV
FT                   SGMLSELQARYHRFRDDEAFLQQVMRDGAQKASARAQETLRKVYDVVGFVARP"
FT   gene            320703..321857
FT                   /locus_tag="Dd1591_0267"
FT   CDS_pept        320703..321857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0267"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: eca:ECA4077 putative mandelate racemase /
FT                   muconate lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05159"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH47"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACT05159.1"
FT                   /translation="MKIESIDVTVFTYPTRRVSDSAGHSHPGDEHQASMALLTVSTDDG
FT                   HKGYAFAPPEVVRPYVMNSFFRKVLIGQDPFDRERLWQDLVHWQRGSANQLTDRALAIV
FT                   EQALWDLAGRALNVPVYKLLGGYRDKVPAYGSTMCGDELKGGLSTPEEYGQFAEKLVQR
FT                   GYKAIKLHTWMPPVSFAPSPQMDVKACAAVREAVGPDICLMLDGYHWYSRSEALYIGRE
FT                   LQKLNFTWFEEPMEEQSMASYSWLNKNLDIDVIGPESLGGKYFSRADWVKEGACDILRA
FT                   GVQGVGGITPCLKVAHLAEAFGMDCEIHGNGAPNLAVVGAIKNCRWYERGLLHPFLNYD
FT                   EPVAYLNSLVDPMDEDGFVHLSQRPGLGEDINFDWIEAHTLSQH"
FT   gene            322101..322676
FT                   /locus_tag="Dd1591_0268"
FT   CDS_pept        322101..322676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0268"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: eca:ECA4071 peptidyl-prolyl
FT                   cis-trans isomerase A (rotamase A)"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05160"
FT                   /db_xref="GOA:C6CH48"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH48"
FT                   /inference="protein motif:PFAM:PF00160"
FT                   /protein_id="ACT05160.1"
FT                   /translation="MSKCILAAVVTVLSLTAFSPAFAATPTSTHVLLTTSAGNIELALD
FT                   DQKAPVSVKNFVDYVNSGFYNGTIFHRVIPGFMVQGGGFSSDMKQKPTNPPIKNEADNG
FT                   LRNLRGTISMARTSEKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMEVADKIS
FT                   QVQTENVGPYQNVPSKPIVIQSVKIIKK"
FT   sig_peptide     322101..322172
FT                   /locus_tag="Dd1591_0268"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            complement(322884..324149)
FT                   /locus_tag="Dd1591_0269"
FT   CDS_pept        complement(322884..324149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0269"
FT                   /product="pectate lyase"
FT                   /note="KEGG: eca:ECA4070 pectate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05161"
FT                   /db_xref="GOA:C6CH49"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH49"
FT                   /inference="similar to AA sequence:KEGG:ECA4070"
FT                   /protein_id="ACT05161.1"
FT                   /translation="MMKHTLLFTLLFSTSVLTAQAASTAAPDLKGFGTETVAGSGGKVI
FT                   RVTTLASSGAGSLREALATKGPRIIVFEVGGIIDLNEQDIRLAEPYVTIAGQTAPSPGI
FT                   TLVKGGMSISTHDVLMQHIRFRIGDNGHAKKSGFEKDVSLTGPNAYNVVVDHCSFAWGT
FT                   DENLSVSGPRYDGQSGTAHNVTFSNNIIAEGLYDSSHSKGIHSMGTLVHDNVTNAAIIG
FT                   NLYAHNNERNPWFKGATTGVVVNNLIYNPGIWGVRIGAIQSEWEGRSLPVNAKVAIAGN
FT                   VMYHGANTKSDLSLVGSNTTGGDVWMSDNLAFDKAGKAVAQTSGTGINLLKSAPVWPTG
FT                   LTAISASSVANQVTQHAGARPKDRDTVDKRIVNDFQKRSGTFVNSQSEVGGYPTAAATK
FT                   RALTIPSTNVDAWLQQMAKELE"
FT   sig_peptide     complement(324084..324149)
FT                   /locus_tag="Dd1591_0269"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.906 at
FT                   residue 22"
FT   gene            complement(324317..325444)
FT                   /locus_tag="Dd1591_0270"
FT   CDS_pept        complement(324317..325444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0270"
FT                   /product="Pectate lyase/Amb allergen"
FT                   /note="PFAM: Pectate lyase/Amb allergen; SMART: Pectate
FT                   lyase/Amb allergen; KEGG: eca:ECA4069 pectate lyase III"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05162"
FT                   /db_xref="GOA:C6CH50"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH50"
FT                   /inference="protein motif:PFAM:PF00544"
FT                   /protein_id="ACT05162.1"
FT                   /translation="MKSLITPIAAGLLLAFSQYSLAADTGGYTKTDGGDVSGAVKKTAS
FT                   SMQDIINIIEAAKVDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDARGVE
FT                   IKDFTKGLTIIGANGSSANFGIWIVNSSDVVVRNMRIGYLPGGAQDGDMFRIDNSPNIW
FT                   LDHNELFAANHECDGTKDGDTTFESAFDIKKGATYVTISYNNIHGVKKVGLSGFSSSDT
FT                   AERNITYHHNIYSDVNARLPLQRGGNVHAYNNLYTGLTSSGLNVRQNGKALIENNWFEN
FT                   AVNPVTSRYDGSNFGTWVLKGNNITKPADFATYNITWTPDTKEYRNADTWTSTGTYPTV
FT                   PYSYSPVSAQCVKDKLANYAGVGKNLATLASSACK"
FT   sig_peptide     complement(325376..325444)
FT                   /locus_tag="Dd1591_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(325913..327040)
FT                   /locus_tag="Dd1591_0271"
FT   CDS_pept        complement(325913..327040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0271"
FT                   /product="Pectate lyase/Amb allergen"
FT                   /note="PFAM: Pectate lyase/Amb allergen; SMART: Pectate
FT                   lyase/Amb allergen; KEGG: eca:ECA4069 pectate lyase III"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05163"
FT                   /db_xref="GOA:C6CH51"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH51"
FT                   /inference="protein motif:PFAM:PF00544"
FT                   /protein_id="ACT05163.1"
FT                   /translation="MKSLITPITAGLLLALSQPLLAATDTGGYAATAGGNVTGAVSKTA
FT                   TSMQDIVNIIDAARLDANGKKVKGGAYPLVITYTGNEDSLINAAAANICGQWSKDPRGV
FT                   EIKEFTKGITIIGANGSSANFGIWIKKSSDVVVQNMRIGYLPGGAKDGDMIRVDDSPNV
FT                   WVDHNELFAANHECDGTPDNDTTFESAVDIKGASNTVTVSYNYIHGVKKVGLDGSSSSD
FT                   TGRNITYHHNYYNDVNARLPLQRGGLVHAYNNLYTNITGSGLNVRQNGQALIENNWFEK
FT                   AINPVTSRYDGKNFGTWVLKGNNITKPADFSTYSITWTADTKPYVNADSWTSTGTFPTV
FT                   AYNYSPVSAQCVKDKLPGYAGVGKNLATLTSAACK"
FT   sig_peptide     complement(326972..327040)
FT                   /locus_tag="Dd1591_0271"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            327498..328868
FT                   /locus_tag="Dd1591_0272"
FT   CDS_pept        327498..328868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0272"
FT                   /product="glutamate decarboxylase"
FT                   /note="KEGG: vvu:VV2_1425 glutamate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05164"
FT                   /db_xref="GOA:C6CH52"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH52"
FT                   /inference="similar to AA sequence:KEGG:VV2_1425"
FT                   /protein_id="ACT05164.1"
FT                   /translation="MQPVDELTILAEGLHDVVRRRILRTYIAHMEEQRRHFAGFQTNQQ
FT                   GEFDAGLRPLLGMNLLNLGDSMEPGAYQVNSKRFERAVLDYYARLWRLPAPYWGYLTAM
FT                   GSTEGNLFALWNARDFLCGAPTTQWPAAEGARYAPVVLYSERSHYSLAKACRVLQLATP
FT                   AEAGPSLGRCPINAGVWPRALPCDDAGRVDVESLLQLATFFYRYRRPVVICLTSGTTFS
FT                   GACDDWRQITAQLQRRLPPNTPQQRSYWLHVDGALSSNYLPFWPEPEGRRLAIDAQAAS
FT                   LHSICASPYKWLSMPWPCGVVMLSGPYRTVALNRPTYIGSGDATLSGSRPGLSAVVLWN
FT                   QLCRLGEQGQQDMIRRCHEIQRYAYQRLRYLFERLDPERERLFLQPLLSGSLIVQFSAP
FT                   HQSIIDRFSLSSDQLMVQGKPRLFCHLVVLPHCHRALVDNLLWTLAQPGAFPTEKEA"
FT   gene            328870..329901
FT                   /locus_tag="Dd1591_0273"
FT   CDS_pept        328870..329901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0273"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fph:Fphi_0374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05165"
FT                   /db_xref="GOA:C6CH53"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR036719"
FT                   /db_xref="InterPro:IPR036734"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05165.1"
FT                   /translation="MRILWILLGLGGLLCAVQTWAAGGDNTADVRPVDVSVSIFINKIY
FT                   GVNTLEQTYKVDGYIVAQWTGKPRKTPGDKPLIIENNQIERWITGGLWVPALEFINVVG
FT                   SPDTGNKRLMLFPDGRVIYNARFLGAFSNDMDFRLFPFDHQQFVLELEPFSYNNQQLRF
FT                   SSIQVYTENIDNEEIDEWWIRGKASTHISDIRYDHLSSVQPNQNEFSRITVQIDAVRNP
FT                   SYYLWSFILPLGLIIAASWSVFWLESFSERLQTSFTLMLTVVAYAFYTSNILPRLPYTT
FT                   VIDQMIIAGYGSIFAAILLIIFAHHRRASGLEDERLIRRCRLAFPLGFLTIGGWLIIRG
FT                   LTL"
FT   sig_peptide     328870..328935
FT                   /locus_tag="Dd1591_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 22"
FT   gene            329898..331184
FT                   /locus_tag="Dd1591_0274"
FT   CDS_pept        329898..331184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0274"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="KEGG: dal:Dalk_2018 PAS/PAC sensor hybrid histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05166"
FT                   /db_xref="GOA:C6CH54"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05166.1"
FT                   /translation="MNASPSRTALAEALFASLIFIGLLGFSTYMVYHKSINALEQEIKI
FT                   GLLSNVRSAATTLSGDDHQNITARTGRDDPVYQQLAVQLERIRQASQDVRYIYTTVLDQ
FT                   DKVRFVVNPSPQNDNDGDGLPDLPPALMQVYDNAPSELVDALREHKTGVSVQPYRDEWG
FT                   VFISAYAPFYDRQGVFRGILAMDLELSSFYQRLEALNQVFRKAIITILFLGLVVGLAVW
FT                   WMRRSSQQVRMQLTSREQAYYALLQATSPLQLERLYDWALPLLFLRGGTHTRPPTGMML
FT                   TIVDPAAEKDDALQANLGEWWQNAAPSLLPCPDSTLTITSHEVLEAHFSPEYHRRFWLQ
FT                   SFQLWRQLAQQPLMIEVSLKEEGLLYWMLEVRLTRSGNPNSVADEDPDWWLRFLHWQAE
FT                   AVSAQVTVRQVEKGQLWLSWRVQKYPEAQ"
FT   gene            331181..332323
FT                   /locus_tag="Dd1591_0275"
FT   CDS_pept        331181..332323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0275"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   azc:AZC_1856 putative cyanate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05167"
FT                   /db_xref="GOA:C6CH55"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH55"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACT05167.1"
FT                   /translation="MMRRLLPILLIMQTFLIQLVSGINYVTIPVLMNLQGHNNLWIGVA
FT                   MACEIIGVLLFHQRLSRIIQWIGLTWSTLLLVLLRSALCISMAWQQFYPGWLVSILGYG
FT                   LCTGMQLILLQTWLNQLPLRRRGVVMGLFSAALSLGVALGPVLLQLTQVSMTQRFWLTA
FT                   LLSLSALPLVWIAHINPQSGTVSAVRFRFVCRHARAILVSALVGGVSFYGLPNFLTLYG
FT                   ISDGLTDERASLLMTMFMLGSVTLGMAVSLLSDWVNRQWIVAFCIFCSVVCAVFLALAV
FT                   YADYGATLVLLYLWGGSMGGVYSIGLSLIGDRFPPQQQMSANMSYTMMDSLGGIAGLIG
FT                   IGFMMDRMGPEGMTMVLVVVGCAFLCYLVWELVEHQTPFQ"
FT   gene            332536..333162
FT                   /locus_tag="Dd1591_0276"
FT   CDS_pept        332536..333162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0276"
FT                   /product="glycoside hydrolase family 19"
FT                   /note="PFAM: glycoside hydrolase family 19; KEGG:
FT                   pfl:PFL_3798 chitinase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05168"
FT                   /db_xref="GOA:C6CH56"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH56"
FT                   /inference="protein motif:PFAM:PF00182"
FT                   /protein_id="ACT05168.1"
FT                   /translation="MTLEISQEKLKKVMTAASADDLALFQPALQQECNTAGINTPLRFA
FT                   HFIAQVAHESNELRARVENLNYSAKGLRSVFGRYFTTDEMAAQCERKPESIANIVYANR
FT                   LGNGATETGDGWKYRGRGLIQLTGRDNYRTCGSAIGQDLVTNPDLISQNPEVSVAAAIW
FT                   FWKKNGLSEFADQDDINTITRRINGGLNGLADRKNYLAKAKRAFG"
FT   gene            333771..335735
FT                   /locus_tag="Dd1591_0277"
FT   CDS_pept        333771..335735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0277"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: yen:YE2922 putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05169"
FT                   /db_xref="GOA:C6CH58"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023830"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR040483"
FT                   /db_xref="InterPro:IPR040636"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH58"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACT05169.1"
FT                   /translation="MMMHSSNTHELLIDDPLSGLQQLGINGEGIKIGIIDGAIENHHPI
FT                   LNHLTIEGLSAQKDKGTSHGTAVSSIIGGNGVGIAPAVTLLSIPVFHEDEQGNIHGCSE
FT                   RTLAKAIRDARLKGCRIINVSGASLSVNGQGTDELRKAIDDCEKEGVLIVAAVGNEGRN
FT                   SESLPASMDFVLAVGACDKAGLPASFNNYGLKLRKKMLLASGVSIPVATPNYDLSVVSG
FT                   SSFSAPVVSAISALIMRAMNIANDRRASKMIRERLFNTATPLVLSTAANRESVIYRLNI
FT                   QNLFRQIAQEFYHQPPKRIMTMSTEEKNIEPAAVELLVPSIIDAQQDIQDVESDDDAVL
FT                   APSSLNTEVSIPSRDAGLSLPKIHDPAANHYVHVPARRIMPQSSSLDARTIRDQEKIFV
FT                   IGQVGYDFGTEARLDYFTQVMGNKSGYPFDPVQMAEHLNTGDNAEQSNALIWTLKIDGI
FT                   PVYAIKPDAQFAVLEYARLVEFLYEQETKGVERVSIAGIISGETRLFNGQVIPTISPVL
FT                   RGMFNWESQDISKMLMGESAMGTSKSKELINFINRIYYELRNRGYESNERAINYAATNA
FT                   YQMKEIFDDAFAEGLFLNKISAERSPVSRPESDCWDVVLEFFNPKERLTAARKLYRYTI
FT                   DVSDVMPVTIGTLRSWHAY"
FT   gene            335842..335991
FT                   /locus_tag="Dd1591_0278"
FT   CDS_pept        335842..335991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05170"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05170.1"
FT                   /translation="MKLPTQAQNVNRANRVAEAKASGVNPAFWGEALKLLKKAGQGALS
FT                   GVLS"
FT   gene            337294..338499
FT                   /locus_tag="Dd1591_0279"
FT   CDS_pept        337294..338499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0279"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: smt:Smal_2105 putative sigma54
FT                   specific transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05171"
FT                   /db_xref="GOA:C6CH60"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH60"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACT05171.1"
FT                   /translation="MKTENILPGKLKNIPAEKIPLTGYSVGRHIPEFIFLPSALREQID
FT                   RLMLSGRPILLYGEPGADLSDITGYIRARLQASQERYIELSGEGDPIQRLADMLGAIPD
FT                   DRRLTLCIPGFDTLTEQQQQKLLVQLQNEHVGCNELRLVFGFLSPQAERGTLPTQPGAQ
FT                   WVSTFGCQLLSVPALKGRTPDIAELVHAAWQAYRQSVRQTLHPDVLFHLHHYDWPGNVR
FT                   QLWHSVARLLMLSDDEEISLAQAGRILPHIVPQEEATLAREHRRINRSLCDAVLGRDQD
FT                   ALQQFHPSVIKALLYLGEHFQREVTLIELAENSHISPSHLSYLLKHSLGLSFKQILNQA
FT                   RIFYACQRLECHPMSRITNLYLDCGYGDLSHFEKMFKRYTGVTPIEFRKQFNPVVLRNE
FT                   TG"
FT   gene            338630..338692
FT                   /pseudo
FT                   /locus_tag="Dd1591_0280"
FT   gene            338942..339262
FT                   /locus_tag="Dd1591_0281"
FT   CDS_pept        338942..339262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0281"
FT                   /product="protein of unknown function DUF891"
FT                   /note="PFAM: protein of unknown function DUF891; KEGG:
FT                   esa:ESA_03838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05172"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH61"
FT                   /inference="protein motif:PFAM:PF05973"
FT                   /protein_id="ACT05172.1"
FT                   /translation="MYELIFHPEAASEIYDLEPVMQAKALKGLEKLEAKGPELRYPDTD
FT                   IIEDGLFELRVGRKDISRTFFAYAKGRKIYILRTFIKKTPKTPKAEIALAKSRWEELKD
FT                   GG"
FT   gene            339252..339536
FT                   /locus_tag="Dd1591_0282"
FT   CDS_pept        339252..339536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0282"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: plu:plu0900
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05173"
FT                   /db_xref="GOA:C6CH62"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH62"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACT05173.1"
FT                   /translation="MAVKGIRFSDVKAEALSHPEVKKAYEDETQEEALRAVLIEMKSRS
FT                   GLTSTEIAARMGVSQPAVSRLERNVSSASISTLQRYAAACGMQLKLSLG"
FT   gene            339543..339686
FT                   /pseudo
FT                   /locus_tag="Dd1591_0283"
FT   gene            339859..340434
FT                   /locus_tag="Dd1591_0284"
FT   CDS_pept        339859..340434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0284"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   yen:YE3958 para-aminobenzoate synthase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05174"
FT                   /db_xref="GOA:C6CH63"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH63"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACT05174.1"
FT                   /translation="MLLLIDNYDSFTYNLYQYFCELGAEVQVRRNDVLTLADIERLSPQ
FT                   QLVISPGPCTPDDAGISLAAIRHFAGKLPILGVCLGHQALGQAFGARVVRARQVMHGKT
FT                   SPVRHTDRGVFAGLANPLIVTRYHSLILEKDTLPDCLEVTAWTENDGDIDEIMGVRHRT
FT                   LPLEGVQFHPESILSQQGHALLKNFLDL"
FT   gene            340537..341778
FT                   /locus_tag="Dd1591_0285"
FT   CDS_pept        340537..341778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0285"
FT                   /product="succinylornithine transaminase family"
FT                   /note="TIGRFAM: succinylornithine transaminase family;
FT                   acetylornithine and succinylornithine aminotransferase;
FT                   PFAM: aminotransferase class-III; KEGG: eca:ECA4065
FT                   bifunctional
FT                   N-succinyldiaminopimelate-aminotransferase/acetylornithine
FT                   transaminase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05175"
FT                   /db_xref="GOA:C6CH64"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH64"
FT                   /inference="protein motif:TFAM:TIGR03246"
FT                   /protein_id="ACT05175.1"
FT                   /translation="MTTGQQMATEKAAVTRDTYDKVILPVYAPAQFVPVKGKGSRVWDQ
FT                   QGKEYIDFSGGIAVTALGHCHPALVAALKEQGETLWHTSNVFTNEPALRLATKLINATF
FT                   ADRVFFANSGAEANEAAFKLARHYAITRHSPYKTKIISFYQSFHGRTLFTVSVGGQPKY
FT                   ADGFGPKPADIVHVPFNDLAAVKAVMDDHTCAVVLEPIQGEGGITPATPAFLNGVRELC
FT                   DQYQALLVFDEVQCGMGRSGKLFSYMHYGITPDILTTAKALGGGFPISAMLTTEEIASV
FT                   MAVGTHGTTYGGNPLACAVAEAALDVINTPEVLSGVVDRHARFVSALERINAQYDIFDE
FT                   VRGMGLLLGAQLKPAWHGRARDFLAASADLGLMILVAGPDVIRFVPSLVITPEEIDQGM
FT                   ALFENAVAQVVKGA"
FT   gene            complement(341890..342663)
FT                   /locus_tag="Dd1591_0286"
FT   CDS_pept        complement(341890..342663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0286"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; SMART: regulatory protein DeoR; KEGG:
FT                   ppr:PBPRB0268 transcriptional repressor UlaR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05176"
FT                   /db_xref="GOA:C6CH65"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH65"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACT05176.1"
FT                   /translation="MTEAQRHSAILELLNQKRHLSITGIMQAFDISPATARRDVNKLND
FT                   SGKLRKVRNGAEALTQTKAHWSPLNSHESVNRGEFSNHSEKVRIAQAAAALIKPGESAV
FT                   INCGSTAFVLGQEICGQDVQVITNYFPLANYLIEHDHDGVVIIGGQYNKSQSITLAPQD
FT                   EISSLYAGHWMFTSGKGITADGLYKMDMLTAMAEQKMLNHIGQLVVLADSSKIGQRAGM
FT                   LFCASDRINILITGKDADQHVIAQLRDKGVKVMLV"
FT   gene            complement(342761..343633)
FT                   /locus_tag="Dd1591_0287"
FT   CDS_pept        complement(342761..343633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0287"
FT                   /product="hexulose-6-phosphate isomerase"
FT                   /EC_number="5.1.3.22"
FT                   /note="KEGG: ppr:PBPRB0269 putative L-xylulose 5-phosphate
FT                   3-epimerase; TIGRFAM: hexulose-6-phosphate isomerase; PFAM:
FT                   Xylose isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05177"
FT                   /db_xref="GOA:C6CH66"
FT                   /db_xref="InterPro:IPR004560"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH66"
FT                   /inference="protein motif:TFAM:TIGR00542"
FT                   /protein_id="ACT05177.1"
FT                   /translation="MHNFDKPFRLGLYEKALPAALTWEKKILVAKELGFDFIEISVDES
FT                   DEKLQRLAWSDSETYQLRHLCEQNNFPLQSMCLSAHRRFPFGSHDPAIRKKAHEIMEQA
FT                   INLAYKLGIRCIQLAGYDVYYESPSAETHQYFIDGMKTATRMAERAGIMLGVEIMDTPY
FT                   LNSLSKFEVLKKAIPSPYFMAYPDVGNITGWNYDICTELKLSCDHIVQIHLKDTRKVST
FT                   HSQGQFRDLVIGEGEVDFAAIFRTLAEMGYNGPLVLEMWAKDEQWADNLKLARSRLAEI
FT                   GREAGLALA"
FT   gene            complement(343716..344783)
FT                   /locus_tag="Dd1591_0288"
FT   CDS_pept        complement(343716..344783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0288"
FT                   /product="putative L-ascorbate 6-phosphate lactonase"
FT                   /note="KEGG: ppr:PBPRB0271 putative L-ascorbate 6-phosphate
FT                   lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05178"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH67"
FT                   /inference="similar to AA sequence:KEGG:PBPRB0271"
FT                   /protein_id="ACT05178.1"
FT                   /translation="MSKIDEITRESWILSTFPEWGTWLNEEIEQEEVKQDTFAMWWLGC
FT                   TGIWLKSAGNTHISIDFWCGTGKKTHANPYMNKQHQMMRMGGVRKLQPNLRTSPFVLDP
FT                   FGIKQIDAVLATHDHADHIDVNVAAAVLKNCGSHVKFIGPKACVELWQRWGVPAERCIV
FT                   ARVGDEIPVGDIVIQVLDAFDRTALVTLPAGVSSKDKSILDGMDDRAVNYLVKTSGGNL
FT                   YHSGDSHYSNYYAKHGNDYQIDVALLSYGENPRGVTDKMTSSDILRAGESLNAQVVIPF
FT                   HHDIWANFQSDPREIEVLWNMKKDRLGYDFRPFFWQVGGKYTFPTDKNTLHYQHPRGFD
FT                   DIFVDEPELPYKSFL"
FT   gene            345326..347071
FT                   /locus_tag="Dd1591_0289"
FT   CDS_pept        345326..347071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0289"
FT                   /product="putative sugar-specific permease SgaT/UlaA"
FT                   /note="PFAM: putative sugar-specific permease SgaT/UlaA;
FT                   phosphotransferase system lactose/cellobiose-specific IIB
FT                   subunit; KEGG: ppr:PBPRB0273 ascorbate-specific PTS system
FT                   enzyme IIC/IIB"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05179"
FT                   /db_xref="GOA:C6CH68"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004703"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR017180"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH68"
FT                   /inference="protein motif:PFAM:PF04215"
FT                   /protein_id="ACT05179.1"
FT                   /translation="METLYSIFYIFYSQVMTKAPLLLGLVTCIGYLLLRRDGTTVIKGT
FT                   VKTIVGFMLVQVGSTTLVSGFKPVIDKISEYHHLTGSVIDPYTTMMATMETMGSRYSWV
FT                   GYAVLLALGLNILLVVFRRITGIRTIMLTGHIMFQQVGLVAVFYVVMGASMWETILYTA
FT                   VIMALYWGISSNIMFKPTQAVTGGAGFSIGHQQQVASWVATRLAPKLGNKEDSVDQLKL
FT                   PKWLHIFHDSITATAIVMTVFFGIILLSFGLDNLQKMAGSTHWTIYILETGLRFAVAIQ
FT                   VIVAGVRMFVAELSEAFKGISERVIPNAVLAIDCAAIYAYSPNAMVFGFIWGTLGQFLA
FT                   VIGLLLFNSSIMIIPGFIPMFFSNATIGVFANHFGGWRAVMKICFVMGIIEVLGSAWAI
FT                   QLFAHNGTRFNGWMGMADWALVFPAIMQGLSFSSLFFFVLLAGAGVYMYFASRTLRQEE
FT                   DNAQPAAAVADAEPVESQPAMPADGRAVRILAVCGNGQGSSMMMKMKIGKFLEQRGVPH
FT                   IMDSCAVADYKSKLPTTDIIVSSKHLAGEMHPGEGKFVLGVQNMLNPQSFGDELLGLIK
FT                   KNFAG"
FT   gene            347120..347596
FT                   /locus_tag="Dd1591_0290"
FT   CDS_pept        347120..347596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0290"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: vvy:VVA1605 PTS
FT                   system, IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05180"
FT                   /db_xref="GOA:C6CH69"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH69"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACT05180.1"
FT                   /translation="MKFKQSLIDNDSVLLNATAMDWREAIKLGTDMLIASGAVEPRYHE
FT                   AIISSIEKMGPYIVIAPQFAMPHARPENGVNRTAFALVTLTAPVKFDGEDEPVDVLITL
FT                   AGSTSDEHMEGLMEVTQVLEDEHSDSGINLDKLRACTSREEVFSVIDKALAQTA"
FT   gene            347639..348331
FT                   /locus_tag="Dd1591_0291"
FT   CDS_pept        347639..348331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0291"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: ppr:PBPRB0275 L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05181"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH70"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ACT05181.1"
FT                   /translation="MYQQLKAIVLDANLLLPRHGLVTLTWGNVSQIDRERGVIAIKPSG
FT                   VSYEQMTIDDIVVVDMDGRVVEGRLNPSSDTATHLALYSAFGSIGGIVHTHSRHGTIWA
FT                   QAGRDIPALGTTHADYFYGDIPCTRPLSEGEIADDYEKNTGLVIVEEFQRRGLDPLAVP
FT                   GAVITGHAPFCWGENALDAVHNALVLEEVAAMAFSTRLLNADIHLDQALSDKHYFRKHG
FT                   ANAYYGQR"
FT   gene            348479..349123
FT                   /locus_tag="Dd1591_0292"
FT   CDS_pept        348479..349123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0292"
FT                   /product="3-dehydro-L-gulonate-6-phosphate decarboxylase"
FT                   /EC_number="4.1.1.85"
FT                   /note="PFAM: Orotidine 5'-phosphate decarboxylase; KEGG:
FT                   ppr:PBPRB0276 3-keto-L-gulonate-6-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05182"
FT                   /db_xref="GOA:C6CH71"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041710"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH71"
FT                   /inference="protein motif:PRIAM:4.1.1.85"
FT                   /protein_id="ACT05182.1"
FT                   /translation="MTKPMLQIALDSTDLSTAVEIAERVGGFVDIIEVGTILAFAEGMA
FT                   AVRTLRERHPNHIIVCDMKTTDGGAILARMAFSAGANWITVSAAAHVATIAACKKVADE
FT                   FGGEIQIELYGNWNLDDARQWVAMGITQAIYHRSRDAELAGVNWTSADLGRMRALSELG
FT                   LELSITGGIVPEDIHLFDGISAKAFIAGRALASESGKATAEALRTEINKYW"
FT   gene            complement(349223..349855)
FT                   /locus_tag="Dd1591_0293"
FT   CDS_pept        complement(349223..349855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0293"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; SMART: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: see:SNSL254_A3737 catabolite gene activator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05183"
FT                   /db_xref="GOA:C6CH72"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH72"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACT05183.1"
FT                   /translation="MVLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVK
FT                   GSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEDGQERSAWVRAKTACEVAEISYKKFR
FT                   QLIQVNPDILMRLSSQMARRLQVTSQKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHPDG
FT                   MQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR"
FT   gene            350233..350640
FT                   /locus_tag="Dd1591_0294"
FT   CDS_pept        350233..350640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0294"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: efe:EFER_3329
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05184"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH73"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACT05184.1"
FT                   /translation="MQARVKWVEGLTFLGESASGHQLLMDGNAGDKAPSPMEMVLMAAG
FT                   GCSAIDVVSILQKGRHDVVDCEVRLTSERREEAPRLFTAINLHFVVTGKGLSDKAVERA
FT                   VSLSAEKYCSVALMLEKAVNVTHSHEVIALD"
FT   gene            complement(350695..351564)
FT                   /locus_tag="Dd1591_0295"
FT   CDS_pept        complement(350695..351564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0295"
FT                   /product="Phosphoribulokinase"
FT                   /EC_number="2.7.1.19"
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   eca:ECA4062 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05185"
FT                   /db_xref="GOA:C6CH74"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH74"
FT                   /inference="protein motif:PRIAM:2.7.1.19"
FT                   /protein_id="ACT05185.1"
FT                   /translation="MSHQHPIIAVTGSSGAGTTTTSLAFRKIFQQLNLRAALVDGDSYH
FT                   RYTRPEMDMAIRKARDLGRHISYFGPEANDFSQLEHTFIEYGRSGTGQTRKYLHTYDEA
FT                   IPYNQVPGTFTPWEPMPEPTDLLFYEGLHGGVVTDQHDVARHVDLLVGVVPIVNLEWIQ
FT                   KLVRDINERGHSREAVMDSVVRSMEDYITHITPQFSRTHINFQRVPTVDTSNPFAAKAI
FT                   PSMDESFVVIHFQGLDHIDYPYLLAMLQGSFISHINTLVVPGGKMGLAMELIMMPLVQR
FT                   LIEGNKID"
FT   gene            complement(351722..351952)
FT                   /locus_tag="Dd1591_0296"
FT   CDS_pept        complement(351722..351952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0296"
FT                   /product="protein of unknown function UPF0270"
FT                   /note="PFAM: protein of unknown function UPF0270; KEGG:
FT                   efe:EFER_3326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05186"
FT                   /db_xref="InterPro:IPR010648"
FT                   /db_xref="InterPro:IPR036685"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH75"
FT                   /inference="protein motif:PFAM:PF06794"
FT                   /protein_id="ACT05186.1"
FT                   /translation="MIIPWQELAPETLQNLIESFVLREGTDYGEQERTLDEKVADVRQQ
FT                   LAHGEVVLVWSELHETVNIMPRSQLGSGERY"
FT   gene            complement(351949..352944)
FT                   /locus_tag="Dd1591_0297"
FT   CDS_pept        complement(351949..352944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0297"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: eca:ECA4060
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05187"
FT                   /db_xref="GOA:C6CH76"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000952"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH76"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACT05187.1"
FT                   /translation="MNHSSYRNTCFQPLSGAHNPHVQTLLPRLLRRRPALQPVWQRLTL
FT                   PDGDFVDLAWSEAPAQAAHKPRVVLFHGLEGSFHSPYAHGLMAACRQRGWLAVVMHFRG
FT                   CSGQPNLLPRAYHAGETEDARYFLHWLRRTFGAAPTVAVGFSLGGNMLACLLAQQQESL
FT                   LNAAAVVSAPLMLEPCSNRLEHGFSRFYQRYLLHSLRRNALHKLTMYPDCLPISAGQLR
FT                   QVRRLRQFDELITARLHGFADATDYYRRSSALPLLPRIRQPLLIIHAKDDPFMTPAVIP
FT                   EPSQLPANIDYQLTEHGGHVGFVGGTWHQPELWLEQRLPNWFTPYLEQIA"
FT   gene            353063..353668
FT                   /locus_tag="Dd1591_0298"
FT   CDS_pept        353063..353668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0298"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   eca:ECA4059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05188"
FT                   /db_xref="GOA:C6CH77"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH77"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACT05188.1"
FT                   /translation="MEHVSLFLSMLGFLWVTAITPGPNNMLLTASAANFGVLRSMSLML
FT                   GIMIGMQIMLLLVALGLGSLILLYPSLHLALKVLGSVYLLWLSWKIATAAYEKLDTDTA
FT                   PPKPIPLYQGGLLQFLNPKAWLMSLGAVAGFSLAGDGYVGSVVAISVAMVCVNFVAGII
FT                   WLGFGAMIGRLLQSPRAWKIFNLVMGLLTATCVLMIWH"
FT   gene            complement(353740..355659)
FT                   /locus_tag="Dd1591_0299"
FT   CDS_pept        complement(353740..355659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0299"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA4058 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05189"
FT                   /db_xref="GOA:C6CH78"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH78"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT05189.1"
FT                   /translation="MIVFSSLQIRRGTRVLLDNATATVNPGQKVGLVGKNGCGKSTLLS
FT                   LLKGEISADGGSVAFPQNWALAWVNQETPALTRSAIDYVIDGDREFRQLEADLDAANAR
FT                   DDGHAIATLHGKLDAIQAWSIQSRAASLLNGLGFQQEQLQRSVSDFSGGWRMRLNLAQA
FT                   LICRSDLLLLDEPTNHLDLDAVIWLEKWLKNYPGTLVLISHDRDFLDPIANRILHIEQE
FT                   TLFEYTGNYTSFEQQRATRLAQQQAMYQHQQERVAHLQHYIDRFRAKASKAKQAQSRIK
FT                   MLERMELIAPAHVDNPFRFSFREPEALPNPLLRMEKVSAGYGDRLILDAIKLNLVPGSR
FT                   IGLLGHNGAGKSTLIKLLAGELQPFSGDIGLAKGVRLGYFAQHQLEFLRPDESPLQHLT
FT                   RLAERETEQQLRDYLGGFGFRGDKVTESTERFSGGEKARLVLALIVWQRPNLLLLDEPT
FT                   NHLDLDMRQALTEALIDFEGALVVVSHDRHLIRSTTDDLYLVHDGKVEPFDGDLEDYQQ
FT                   WLLDAQKQDNAGDSAPKENAANSAQSRKDQKRRDAELRALTQPLRKQITQLEQQMEKLQ
FT                   AALTTVEERLADSALYDASRKNELTECLQKQSATKTELENAEMAWLDAQEQLEQLLRDA
FT                   ESQG"
FT   gene            355783..356334
FT                   /locus_tag="Dd1591_0300"
FT   CDS_pept        355783..356334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0300"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   eca:ECA4057 glutathione-regulated potassium-efflux system
FT                   ancillary protein KefG"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05190"
FT                   /db_xref="GOA:C6CH79"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023947"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH79"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ACT05190.1"
FT                   /translation="MSQPPKILLLFAHPESQDSVANKLLLHSARQLGHVTVHDLYAHYP
FT                   DFFIDIHHEQQLLREHQLIVFQHPLYTYSCPALLKEWLDRVLTRGFANGVGGNALAGKY
FT                   WRSVVTTGEQQDVYRASGVNRYTMDEVLRPFEMTAAMCHMHWLSPLVIYWARRLPPDVL
FT                   REQAKAYSNWLTSPFPHGEP"
FT   gene            356337..358151
FT                   /locus_tag="Dd1591_0301"
FT   CDS_pept        356337..358151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0301"
FT                   /product="potassium efflux system protein"
FT                   /note="TIGRFAM: potassium efflux system protein; PFAM:
FT                   sodium/hydrogen exchanger; TrkA-N domain protein; KEGG:
FT                   eca:ECA4056 glutathione-regulated potassium-efflux system
FT                   protein KefB"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05191"
FT                   /db_xref="GOA:C6CH80"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR020884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH80"
FT                   /inference="protein motif:TFAM:TIGR00932"
FT                   /protein_id="ACT05191.1"
FT                   /translation="METSSLLNAGVLFLFVAVLMVPIAARLGIGAVLGYLLAGIAIGPW
FT                   GLGFIRDVEAILHFSELGVVFLMFIIGLELDPAKLWRLRRSIFGTGAAQVLLSAAALGG
FT                   VLYLSRFSWQAALIGGIGLAMSSTAIALQLMREKGMNRNESGQLGFSVLLFQDLAVIPA
FT                   LALIPVLAGVQGELDDWNQVGLKVVAFGGMLIGGRYLVRPLFRFIAASGVREVFTAASL
FT                   LLVLGSALFMDALGLSMALGTFIAGVLLAESEYRHELEIAIEPFKGLLLGLFFISVGMS
FT                   LNLGVLYANILMVLAGVAMLVVVKGIILYLLAWLYGLRSSERLQFAGVLSQGGEFAFVL
FT                   FSSAATYKVLKGSQLPLLLVTVTLSMMVTPLLMTLIDKLLSRRFNHPEEEDETHYVEND
FT                   RPQVIVVGFGRFGQVVARLLMANKMRITVLDRDISAVRLMRTYGYKVYYGDATQLELLR
FT                   AAGADQAQSIVITCVSPEHSMTIVHLCQQHFPHLEILVRARGRVEAHELLKAGVTQFTR
FT                   ETFSSALELGRKTLVSLGMHPHQAYRAQQHFRRLDMRMLRELMPQHQGDVAQISRVKEA
FT                   RRELEEIFEREMQRERRRPDDWDQHEEH"
FT   gene            358210..358404
FT                   /locus_tag="Dd1591_0302"
FT   CDS_pept        358210..358404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4055 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05192"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH81"
FT                   /inference="similar to AA sequence:KEGG:ECA4055"
FT                   /protein_id="ACT05192.1"
FT                   /translation="MRKRFIAGAVCPKCHTQDTLAVGREGDDDVVVCVHCGYQQSQSET
FT                   PPKAATPPAGEIIGLFRPE"
FT   gene            358554..359132
FT                   /locus_tag="Dd1591_0303"
FT   CDS_pept        358554..359132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0303"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   ent:Ent638_3766 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05193"
FT                   /db_xref="GOA:C6CH82"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH82"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ACT05193.1"
FT                   /translation="MKVAKDLVVSLAYQVRTEDGVLVDESPVSAPLDYLHGHGSLISGL
FT                   EKALEGRDVGERFDVSVGANDAYGEYDDNLVQRVPKDVFVGVDELQVGMRFLADTDQGP
FT                   VPVEITEVQDDHVVVDGNHMLAGQNLKFNVEVVAIREATEEELAHGHVHGAHDHDHDHD
FT                   GCCGGHGHDHDHEHGKGGCGGNGGCGCHH"
FT   gene            complement(359224..360591)
FT                   /locus_tag="Dd1591_0304"
FT   CDS_pept        complement(359224..360591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0304"
FT                   /product="ethanolamine transproter"
FT                   /note="TIGRFAM: ethanolamine transproter; PFAM: amino acid
FT                   permease-associated region; KEGG: eta:ETA_25540 putative
FT                   ethanolamin permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05194"
FT                   /db_xref="GOA:C6CH83"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH83"
FT                   /inference="protein motif:TFAM:TIGR00908"
FT                   /protein_id="ACT05194.1"
FT                   /translation="MTMQLKPTLGTLHLWGIAVGLVISGEYFGWSYGWGVAGTLGFLVT
FT                   TLIIAAMYTCFIFSFTELTTAIPHAGGPFAYSRRAFGETGGLIAGMATLIEFVFAPPSI
FT                   AMAIGAYLNVQYPSLDPRYAATGAYLIFMSLNILGVKLAAMFELLVTVLAVIELLVFMG
FT                   VVAPGFSISHFVANGWAGSNDFGGPAISGIFAAIPFAIWFFLAIEGAAMAAEEAKDPQR
FT                   TIPKAYISGIITLVVLALGVMIMAGGVGDWRTLSNINDPLPQAMKAVVGENSGWMHMLV
FT                   WIGLFGLIASFHGIILGYSRQFFALARAGYLPAGLAKLSRFQTPHRAILTGGVIGIATI
FT                   FSDSWINLQGMSLTAAMITMAVFGANVMYMMSMLSLFRLRRTEPELHRTFHASGYPFIP
FT                   AVALVLSVVCLIAMLWFNPVIGGLFIVLMLAGYSYFLMTRTQRDNAPQDAMLVGKE"
FT   gene            361020..362036
FT                   /locus_tag="Dd1591_0305"
FT   CDS_pept        361020..362036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0305"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   eta:ETA_25530 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05195"
FT                   /db_xref="GOA:C6CH84"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH84"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACT05195.1"
FT                   /translation="MAEQVMAEQYDTLDNTTLDHLAALAMQRYPSAQQGELTLLCRSEN
FT                   ATYRLIAGGKRYAMRIHRPGYHQREDIAGELAWLDALREEGITVPQALHGLDGEAVQTV
FT                   TMADGTTRNVVLFHWIEGEMPTTAVDAVAFEQLGMITARLHQHSRRWERPAGFRRLVWD
FT                   HDTMVGPQGHWGRWQDAPNLKAHDHGIIEETLAQVRQALAHYGKDRQRYGLIHADLRLT
FT                   NLLLQNGETRVIDFDDCGFSWYLHDLAAAISFVEHHPSAPAWVEGWLSGYQKVCPLGEA
FT                   DRAVIPSLLIQRRIQLMAWAGSHSQTEQAISLGVDWSDHTVRLCRRYLEKEALPVGA"
FT   gene            362187..363230
FT                   /locus_tag="Dd1591_0306"
FT   CDS_pept        362187..363230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0306"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: eta:ETA_25520 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05196"
FT                   /db_xref="GOA:C6CH85"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH85"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACT05196.1"
FT                   /translation="METTSFRLPPVAELSIGHRGVLAAAASGLTDFIGEKGGDADRILG
FT                   ISGIDPEMLACPTLSVGLVNYCRVLEEAARYSDCDNFGLHYGRQFKPQALGLIGYVGLC
FT                   SATLEQALHNVVNAFPFHQHDTLIRLVDKGDCWRFDYQVRHGAILHCRQDAELTLGMML
FT                   NLIRHAAGKNWAPREVHFEHPRPEQWHEHCKAFDAPVYFDQPFNSLLIPKRDLMRAMPD
FT                   HDPLLLLVVQDALCRLNNDAPQQSVVDLARARLRQVLPQGEPALEEVAENIGLSSWSLQ
FT                   RRLKEEGMTFTQLVEKVRCEMATHYLRQRQLSISEMAFLLGYSEVSAFSRAFRRWFGIS
FT                   PRQWRKA"
FT   gene            complement(363240..363458)
FT                   /locus_tag="Dd1591_0307"
FT   CDS_pept        complement(363240..363458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0307"
FT                   /product="SlyX family protein"
FT                   /note="PFAM: SlyX family protein; KEGG: eta:ETA_31750 host
FT                   factor for lysis of phiX174 infection SlyX"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05197"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH86"
FT                   /inference="protein motif:PFAM:PF04102"
FT                   /protein_id="ACT05197.1"
FT                   /translation="MSQSPLEQRLELLESRLAFQEVTIEELNHTVVQHELEMTRLREQL
FT                   RLLTEKLRATSPSMIASQAEETPPPHY"
FT   gene            363671..364522
FT                   /locus_tag="Dd1591_0308"
FT   CDS_pept        363671..364522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0308"
FT                   /product="FKBP-type peptidyl-prolyl isomerase domain
FT                   protein"
FT                   /note="PFAM: FKBP-type peptidyl-prolyl isomerase domain
FT                   protein; peptidylprolyl isomerase FKBP-type; KEGG:
FT                   spe:Spro_4556 FKBP-type peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05198"
FT                   /db_xref="GOA:C6CH87"
FT                   /db_xref="InterPro:IPR000774"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR036944"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH87"
FT                   /inference="protein motif:PFAM:PF01346"
FT                   /protein_id="ACT05198.1"
FT                   /translation="MKSLFKVTLLTAAMGLALSTGVMAADAAKTTDAAAAPAAADAAKA
FT                   AAGKFKSDEEAAAYALGASLGRYMDNSLKEQEKLGIKLDRQQLILGVQDAFADKSKLSD
FT                   EEIEKTLQSFEGRVKEAAQAKMQQDAKDNADKGTQFRDAFAKEKGVKKTESGLLYQVEK
FT                   EGTGATPKDSDTVVVNYKGALVDGSEFDNSYKRGEPLSFRLDGVIPGWTEGLKHVKKGG
FT                   KIKLVIPPALAYGEAGVPGIPANSTLVFDVELLDIKSDADAKGAAPKAEKPADDKAKKA
FT                   AQ"
FT   sig_peptide     363671..363745
FT                   /locus_tag="Dd1591_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 25"
FT   gene            complement(364648..365805)
FT                   /locus_tag="Dd1591_0309"
FT   CDS_pept        complement(364648..365805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0309"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: eca:ECA4045 sensor protein BasS/PmrB"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05199"
FT                   /db_xref="GOA:C6CH88"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH88"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACT05199.1"
FT                   /translation="MSQISHSAPFEHTASIRTRLILTLGCILLACQLISVIWLWHESKE
FT                   QIELLVEQTLTAKSLSHDIDFEINEAIASLSLPSLVMIIASLVMCTHAVNRITRPLIKL
FT                   QEELHNRTAENLEPLQQRSDVTEVAAVIASMNQLFIRFSESLRRDRLFASNVAHELRTP
FT                   LAGIRLSLELHEQTHHIDCQPLIKRVDHLTKTIEQLLLLARVGNELAAGHYESVSLVDD
FT                   VITPKREELEEMAATRHQRLDWQSDFQDGNVPGNATLLQLLVRNLVENAYRYSPEHSTI
FT                   SIKITDFPDGGCELIVADEGAGINESQVGELTKAFVRLDTRYGGIGLGLSIVTRIVQLH
FT                   HGEFFLENRRDRTGTQARVVFRQRTDDTCNDEESDLEALADNRTA"
FT   gene            complement(365802..366500)
FT                   /locus_tag="Dd1591_0310"
FT   CDS_pept        complement(365802..366500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0310"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: eca:ECA4044 DNA-binding transcriptional
FT                   regulator BasR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05200"
FT                   /db_xref="GOA:C6CH89"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH89"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACT05200.1"
FT                   /translation="MKLLIVEDDALLQEGLLQAMRNEGYVCDCASTAKEADALIASAHY
FT                   SLVVLDLGLPDEDGLTLLGRWRRNHYQQPVLILTARDTVDDRVTGLDVGADDYMIKPFA
FT                   LSEFQARVRALIRRHQGSSDSWIRVDNITLDLNNQQVMLDDKPIVLTPKEFAILSRLIL
FT                   KAGSQVHREVLHQDLYSWDDDPSSNSLEVHIHNLRQKIGKNRIKTLRGFGYLLTKDDQS
FT                   KDEQSREEQP"
FT   gene            complement(366497..368140)
FT                   /locus_tag="Dd1591_0311"
FT   CDS_pept        complement(366497..368140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0311"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; protein of unknown function
FT                   DUF1705; KEGG: eca:ECA4043 putative cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05201"
FT                   /db_xref="GOA:C6CH90"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH90"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACT05201.1"
FT                   /translation="MFNIPLISRPTWSCFTYNLVFAAFITLIQNIAYYRQVSHLVAVES
FT                   WRDGLFLATMPIVIFAVLNILFTLLIIRWLRQGVVALLLIGGAAVQYFMINYGIIIDRT
FT                   MMQNVFETNMAESMALVTPQYLLWLTLLGIVPAIGALWIKIRPTPLSWIAVGSRVFSIM
FT                   MSIVAILLVATFFYKDYASLMRNNKELVKSLTPSNIILAGISYYRHHAQANLPLVQIGL
FT                   DAHKNSPSTGDGKKNLVILVVGETSRAENFALGGYSKPNNPRLTNDNVIYFKQTSSCGT
FT                   ATGVSVPCMFSGMPRTGYDDQLAAHQEGLLDILQRAGVSVRWQDNDGGCKDVCNRVPTQ
FT                   DVTTLNLPGLCIDGECHDEALFQGVDDYINQLNNDGIIVLHTMGSHGPAYYQRYPEAFR
FT                   KFTPTCDTNQIQTCPQESLINTYDNTILYVDYIVDKAINVLKEHQDKFNTALVYLSDHG
FT                   ESLGEDGIYLHSMPYAVAPTQQTHIPMLMWFSGGYQQQFAINDSCMRKQADQQRFSQDN
FT                   LFHTVLGMFNIATKEYQAPLDILQPCRGTS"
FT   gene            368324..369046
FT                   /locus_tag="Dd1591_0312"
FT   CDS_pept        368324..369046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0312"
FT                   /product="YheO domain protein"
FT                   /note="PFAM: YheO domain protein; KEGG: eca:ECA4042
FT                   putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05202"
FT                   /db_xref="InterPro:IPR013559"
FT                   /db_xref="InterPro:IPR039445"
FT                   /db_xref="InterPro:IPR039446"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH91"
FT                   /inference="protein motif:PFAM:PF08348"
FT                   /protein_id="ACT05202.1"
FT                   /translation="MSTSLVNGESNDLDLLDQRPFMQTDYEILKSYEAVVDGLAMLIGD
FT                   HCEIVLHSLDDLKCSAVRIANGEHTGRKIGSPITDLALRMLHDMAGEDSSVSRAYFTRA
FT                   KSGVLMKSVTIAIRNREQRVIGLLCINMNLDVPFSQIMQTFLPPEIKEVASSVNFASSV
FT                   DELVAQTLEFTIEEVNADRNVSNNAKNRQIVLNLYEKGIFDIKDAINQVADRLNISKHT
FT                   VYLYIRQFKSGDFSGHDR"
FT   gene            369046..369435
FT                   /locus_tag="Dd1591_0313"
FT   CDS_pept        369046..369435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0313"
FT                   /product="sulfur relay protein TusD/DsrE"
FT                   /note="TIGRFAM: sulfur relay protein TusD/DsrE; PFAM: DsrE
FT                   family protein; KEGG: eca:ECA4041 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05203"
FT                   /db_xref="GOA:C6CH92"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017463"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH92"
FT                   /inference="protein motif:TFAM:TIGR03012"
FT                   /protein_id="ACT05203.1"
FT                   /translation="MLSYCLLVTGPAYGTQQASSAFQFAQALVAQGYRLQSVFFYREGV
FT                   LNANQFTAPANDEFDLVRAWQQLAQTHQVALNVCVAAALRRGVTDAQQAEQLHLPGANL
FT                   QPGFTLSGLGELSQSILRCDRVVQF"
FT   gene            369452..369811
FT                   /locus_tag="Dd1591_0314"
FT   CDS_pept        369452..369811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0314"
FT                   /product="sulfur relay protein TusC/DsrF"
FT                   /note="TIGRFAM: sulfur relay protein TusC/DsrF; PFAM: DsrE
FT                   family protein; KEGG: eca:ECA4040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05204"
FT                   /db_xref="GOA:C6CH93"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR017462"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR037450"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH93"
FT                   /inference="protein motif:TFAM:TIGR03010"
FT                   /protein_id="ACT05204.1"
FT                   /translation="MKRVAFVFTQAPHGSASGREGLDALLAMSALTEDIGVFFISDGVF
FT                   QLLPNQQPDLILMRNYIATFGVLPLYDIERCYVCEASLRQRGLPVETRWVLDVEPLAAD
FT                   ALRAMLNTYDTVLTF"
FT   gene            369823..370110
FT                   /locus_tag="Dd1591_0315"
FT   CDS_pept        369823..370110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0315"
FT                   /product="sulfur relay protein TusB/DsrH"
FT                   /note="TIGRFAM: sulfur relay protein TusB/DsrH; PFAM: DsrH
FT                   family protein; KEGG: eca:ECA4039 putative intracellular
FT                   sulfur oxidation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05205"
FT                   /db_xref="GOA:C6CH94"
FT                   /db_xref="InterPro:IPR007215"
FT                   /db_xref="InterPro:IPR023526"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH94"
FT                   /inference="protein motif:TFAM:TIGR03011"
FT                   /protein_id="ACT05205.1"
FT                   /translation="MLHTLAHSPYHTDLKALLRNIGEGDVILLLQDGVIAALSGTSVNE
FT                   RILTSGVPVYALQEDVAARGLSGQISTTVVLIDYTQFVQLTALHSRQLAW"
FT   gene            370243..370617
FT                   /locus_tag="Dd1591_0316"
FT   CDS_pept        370243..370617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0316"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: ypg:YpAngola_A3678 30S ribosomal
FT                   protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05206"
FT                   /db_xref="GOA:C6CH95"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH95"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ACT05206.1"
FT                   /translation="MATINQLVRKPRSLKVAKSNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGALDC
FT                   SGVKDRKQSRSKYGVKKPKA"
FT   gene            370714..371184
FT                   /locus_tag="Dd1591_0317"
FT   CDS_pept        370714..371184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0317"
FT                   /product="ribosomal protein S7"
FT                   /note="TIGRFAM: ribosomal protein S7; PFAM: ribosomal
FT                   protein S7; KEGG: kpe:KPK_0391 ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05207"
FT                   /db_xref="GOA:C6CH96"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH96"
FT                   /inference="protein motif:TFAM:TIGR01029"
FT                   /protein_id="ACT05207.1"
FT                   /translation="MPRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAEAIVYT
FT                   ALETLAQRSGKSELEAFEVALDNVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWI
FT                   VEAARKRGDKSMALRLANELSDAADNKGTAVKKREDVHRMAEANKAFAHYRW"
FT   gene            371276..373390
FT                   /locus_tag="Dd1591_0318"
FT   CDS_pept        371276..373390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0318"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor G domain protein; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: esa:ESA_04401 elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05208"
FT                   /db_xref="GOA:C6CH97"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH97"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ACT05208.1"
FT                   /translation="MARTTPIARYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWSGMAKQYEPHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGAVMVYCAVGGVQPQSETVWRQANKYKVPRIAFVNKMDRMGANFLKVVDQIKVRLG
FT                   ATPVPLQLAIGAEENFTGVVDLVKMKAINWNEADQGTTFVYEDIPADMQDLAAEWHQNL
FT                   IESAAEASEDLMEKYLGGEELTEEEIKKALRQRVLNNEIILVTCGSAFKNKGVQAMLDA
FT                   VIDYLPAPTDVPAIKGMLDDGKDTPAERHASDDEPFSALAFKIATDPFVGNLTFFRVYS
FT                   GVVNSGDTVLNSVKSERERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVITGDTLCN
FT                   PDHPIILERMEFPEPVISIAVEPKTKADQEKMGLALGRLAKEDPSFRVWTDEESNQTII
FT                   AGMGELHLDIIVDRMKREFNVEANVGKPQVAYREAIRSKVTDVEGKHAKQSGGRGQYGH
FT                   VVIDMYPLEPGSNPKGYEFVNDIKGGVIPGEYIPAVDKGIQEQLKAGPLAGFPVVDLGV
FT                   RLHFGSYHDVDSSELAFKLAASIAFKAAFGKANPVLLEPIMKVEVETPEENTGDVIGDL
FT                   SRRRGMLRGQESNVTGVVIHAEVPLSEMFGYATQLRSLTKGRASYSMEFLKYDDAPNNV
FT                   AQAVIEARRK"
FT   gene            373480..374664
FT                   /locus_tag="Dd1591_0319"
FT   CDS_pept        373480..374664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0319"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: sgl:SG2283
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05209"
FT                   /db_xref="GOA:C6CH98"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH98"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACT05209.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGQAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPVIRGSALKALEGEAEWEAKIIELAEALDSYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGIKDTAKTTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   TKRDEVERGQVLAKPGSIKPHTQFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVNLIAPIAMDDGLRFAIREGGRTVGAGVVAKVIA"
FT   gene            374794..374988
FT                   /locus_tag="Dd1591_0320"
FT   CDS_pept        374794..374988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0320"
FT                   /product="BFD domain protein (2Fe-2S)-binding domain
FT                   protein"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: eca:ECA4034 bacterioferritin-associated
FT                   ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05210"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH99"
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /protein_id="ACT05210.1"
FT                   /translation="MYVCLCNAVSDKVIRQVVRQHQPQSLKQLKQFVPIGTSCGKCIRQ
FT                   ARLILEEETAKNAELHQVA"
FT   gene            375064..375537
FT                   /locus_tag="Dd1591_0321"
FT   CDS_pept        375064..375537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0321"
FT                   /product="bacterioferritin"
FT                   /note="TIGRFAM: bacterioferritin; PFAM: Ferritin Dps family
FT                   protein; KEGG: eca:ECA4033 bacterioferritin, iron storage
FT                   and detoxification protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05211"
FT                   /db_xref="GOA:C6CHA0"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHA0"
FT                   /inference="protein motif:TFAM:TIGR00754"
FT                   /protein_id="ACT05211.1"
FT                   /translation="MKGDKKVITHLNKLLGNELVAINQYFLHARMFKNWGLKRLNDHEY
FT                   HESIDEMKHADRYIERILFLEGVPNLQDLGKLNIGEDVEEMLRSDLALELEGAKDLREA
FT                   IAYADSVRDYVSRDLMIDVLADEEEHIDWLETELELIARLGIQNYLQTQLKEE"
FT   gene            375831..376142
FT                   /locus_tag="Dd1591_0322"
FT   CDS_pept        375831..376142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0322"
FT                   /product="ribosomal protein S10"
FT                   /note="TIGRFAM: ribosomal protein S10; PFAM: ribosomal
FT                   protein S10; KEGG: kpn:KPN_03720 30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05212"
FT                   /db_xref="GOA:C6CHA1"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHA1"
FT                   /inference="protein motif:TFAM:TIGR01049"
FT                   /protein_id="ACT05212.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   gene            376175..376804
FT                   /locus_tag="Dd1591_0323"
FT   CDS_pept        376175..376804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0323"
FT                   /product="ribosomal protein L3"
FT                   /note="PFAM: ribosomal protein L3; KEGG: eca:ECA4031 50S
FT                   ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05213"
FT                   /db_xref="GOA:C6CHA2"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHA2"
FT                   /inference="protein motif:PFAM:PF00297"
FT                   /protein_id="ACT05213.1"
FT                   /translation="MIGLVGKKVGMTRIFTEEGVSIPVTVIEIEANRVTQVKTLENDGY
FT                   RAVQVTAGAKKANRVTKPEAGHFAKAGVEAGRVLREFRLADSEEFAVGQDISVEIFADV
FT                   KKVDVTGTSKGKGFAGTVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAG
FT                   QLGNERVTVQSLDVVRVDAERNLLLVKGAVPGATGSDLIVKPAVKA"
FT   gene            376815..377420
FT                   /locus_tag="Dd1591_0324"
FT   CDS_pept        376815..377420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0324"
FT                   /product="ribosomal protein L4/L1e"
FT                   /note="PFAM: ribosomal protein L4/L1e; KEGG: spe:Spro_4543
FT                   50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05214"
FT                   /db_xref="GOA:C6CHA3"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHA3"
FT                   /inference="protein motif:PFAM:PF00573"
FT                   /protein_id="ACT05214.1"
FT                   /translation="MELVLKDAQSALTVSETTFGRDFNEALVHQVVVAYAAGARQGTRA
FT                   QKTRAEVTGSGKKPWRQKGTGRARSGSIKSPIWRSGGVTFAAKPQDHSQKVNKKMYRGA
FT                   LKSILSELVRQDRLIVVEKFSVEAPKTKLLAQKLKELALDDVLIITGELDENLFLAARN
FT                   LYKVDVRDVAGIDPVSLIAFDKVVMTADAVKQVEEMLA"
FT   gene            377417..377719
FT                   /locus_tag="Dd1591_0325"
FT   CDS_pept        377417..377719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0325"
FT                   /product="Ribosomal protein L25/L23"
FT                   /note="PFAM: Ribosomal protein L25/L23; KEGG: sgl:SG2276
FT                   50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05215"
FT                   /db_xref="GOA:C6CHA4"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHA4"
FT                   /inference="protein motif:PFAM:PF00276"
FT                   /protein_id="ACT05215.1"
FT                   /translation="MIREERLLKVLRAPHVSEKASTAMEKNNTIVLKVAKDATKAEIKA
FT                   AVQKLFEVEVNDVRTLIVKGKVKRHGQRIGRRSDWKKAYVTLKEGQNLDFIGGAE"
FT   gene            377737..378558
FT                   /locus_tag="Dd1591_0326"
FT   CDS_pept        377737..378558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0326"
FT                   /product="ribosomal protein L2"
FT                   /note="TIGRFAM: ribosomal protein L2; PFAM: ribosomal
FT                   protein L2; KEGG: eum:ECUMN_3790 50S ribosomal subunit
FT                   protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05216"
FT                   /db_xref="GOA:C6CHA5"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHA5"
FT                   /inference="protein motif:TFAM:TIGR01171"
FT                   /protein_id="ACT05216.1"
FT                   /translation="MAVVKCKPTSPGRRHVVKVVNPELHKGKPFAPLLEKNSKSGGRNN
FT                   NGRITTRHIGGGHKQQYRIVDFKRNKDGIPAVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLKAGDQIQSGVDAAIKTGNTLPMRNIPVGSTVHNVEMKPGKGGQLARSAGAYVQ
FT                   IVAREGAYVTLRLRSGEMRKVESDCRATLGEVGNAEHMLRVLGKAGAARWRGVRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRRTK"
FT   gene            378575..378853
FT                   /locus_tag="Dd1591_0327"
FT   CDS_pept        378575..378853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0327"
FT                   /product="ribosomal protein S19"
FT                   /note="TIGRFAM: ribosomal protein S19; PFAM: ribosomal
FT                   protein S19/S15; KEGG: kpn:KPN_03715 30S ribosomal protein
FT                   S19"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05217"
FT                   /db_xref="GOA:C6CHA6"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHA6"
FT                   /inference="protein motif:TFAM:TIGR01050"
FT                   /protein_id="ACT05217.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMI
FT                   GLTIAVHNGRQHVPVFISDEMVGHKLGEFAPTRTYRGHAADKKAKKK"
FT   gene            378868..379200
FT                   /locus_tag="Dd1591_0328"
FT   CDS_pept        378868..379200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0328"
FT                   /product="ribosomal protein L22"
FT                   /note="TIGRFAM: ribosomal protein L22; PFAM: ribosomal
FT                   protein L22/L17; KEGG: ypb:YPTS_3885 ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05218"
FT                   /db_xref="GOA:C6CHA7"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHA7"
FT                   /inference="protein motif:TFAM:TIGR01044"
FT                   /protein_id="ACT05218.1"
FT                   /translation="METIAKHRHARSSAQKVRLVADLIRGKKVSQALEILTYTNKKAAG
FT                   LVKKVLESAIANAEHNDGADIDDLKVTKIFVDEGPSMKRIMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
FT   gene            379218..379919
FT                   /locus_tag="Dd1591_0329"
FT   CDS_pept        379218..379919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0329"
FT                   /product="ribosomal protein S3"
FT                   /note="KEGG: esa:ESA_00011 30S ribosomal protein S3;
FT                   TIGRFAM: ribosomal protein S3; PFAM: ribosomal protein S3-
FT                   domain protein; KH type 2 domain protein; Ribosomal protein
FT                   S3 domain; SMART: KH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05219"
FT                   /db_xref="GOA:C6CHA8"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHA8"
FT                   /inference="protein motif:TFAM:TIGR01009"
FT                   /protein_id="ACT05219.1"
FT                   /translation="MGQKVHPNGIRLGIVKTWNSTWYANTKEFADNLDSDFKVRQYLNK
FT                   ELEKASVSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKGVADIAGVPAQINIA
FT                   EVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKVEVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVWIFKGEILGGMAAVEQPEKPAA
FT                   QPKKQQRKGRK"
FT   gene            379933..380343
FT                   /locus_tag="Dd1591_0330"
FT   CDS_pept        379933..380343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0330"
FT                   /product="ribosomal protein L16"
FT                   /note="TIGRFAM: ribosomal protein L16; PFAM: ribosomal
FT                   protein L16; KEGG: eca:ECA4024 50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05220"
FT                   /db_xref="GOA:C6CHA9"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHA9"
FT                   /inference="protein motif:TFAM:TIGR01164"
FT                   /protein_id="ACT05220.1"
FT                   /translation="MLQPKRTKFRKVHKGRNRGLAAGTDVSFGTFGLKAVGRGRLTARQ
FT                   IEAARRAMTRAVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYE
FT                   MDGVPEELAREAFELAAAKLPIKTTFVTKTVM"
FT   gene            380343..380534
FT                   /locus_tag="Dd1591_0331"
FT   CDS_pept        380343..380534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0331"
FT                   /product="ribosomal protein L29"
FT                   /note="TIGRFAM: ribosomal protein L29; PFAM: ribosomal
FT                   protein L29; KEGG: ypb:YPTS_3882 ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05221"
FT                   /db_xref="GOA:C6CHB0"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHB0"
FT                   /inference="protein motif:TFAM:TIGR00012"
FT                   /protein_id="ACT05221.1"
FT                   /translation="MKAKELREKSVEELNTELLGLLREQFNLRMQAASGQLQQTHLLKQ
FT                   VRRNVARVKTLLTEKAGA"
FT   gene            380534..380788
FT                   /locus_tag="Dd1591_0332"
FT   CDS_pept        380534..380788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0332"
FT                   /product="ribosomal protein S17"
FT                   /note="PFAM: ribosomal protein S17; KEGG: eum:ECUMN_3784
FT                   30S ribosomal subunit protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05222"
FT                   /db_xref="GOA:C6CHB1"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHB1"
FT                   /inference="protein motif:PFAM:PF00366"
FT                   /protein_id="ACT05222.1"
FT                   /translation="MTDKIRTLQGRVVSDKMQKSAVVAIERFVKHPIYGKFIKRTTKLH
FT                   VHDENNECGIGDVVEIRECRPLSKTKSWTLVRVVEKAIL"
FT   gene            380954..381325
FT                   /locus_tag="Dd1591_0333"
FT   CDS_pept        380954..381325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0333"
FT                   /product="ribosomal protein L14"
FT                   /note="TIGRFAM: ribosomal protein L14; PFAM: ribosomal
FT                   protein L14b/L23e; KEGG: kpn:KPN_03709 50S ribosomal
FT                   protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05223"
FT                   /db_xref="GOA:C6CHB2"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHB2"
FT                   /inference="protein motif:TFAM:TIGR01067"
FT                   /protein_id="ACT05223.1"
FT                   /translation="MIQEQTMLNVADNSGARRVMCIKVLGGSHRRYAGVGDIIKITIKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVVRFDGNACVILNNNSEQPIGTRIFGPVT
FT                   RELRTEKFMKIISLAPEVL"
FT   gene            381336..381650
FT                   /locus_tag="Dd1591_0334"
FT   CDS_pept        381336..381650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0334"
FT                   /product="ribosomal protein L24"
FT                   /note="KEGG: eum:ECUMN_3782 50S ribosomal subunit protein
FT                   L24; TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; SMART: KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05224"
FT                   /db_xref="GOA:C6CHB3"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHB3"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ACT05224.1"
FT                   /translation="MAAKIRRDDEVIVLTGKDKGKRGKVKNVLTSGKVVVEGINLVKKH
FT                   QKPVPALNQPGGIVEKEAAIQVSNVAIFNAATGKADRVGFRFEDGKKVRFFKSNSETIK
FT                   "
FT   gene            381665..382204
FT                   /locus_tag="Dd1591_0335"
FT   CDS_pept        381665..382204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0335"
FT                   /product="ribosomal protein L5"
FT                   /note="PFAM: ribosomal protein L5; KEGG: set:SEN3256 50S
FT                   ribosomal subunit protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05225"
FT                   /db_xref="GOA:C6CHB4"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHB4"
FT                   /inference="protein motif:PFAM:PF00281"
FT                   /protein_id="ACT05225.1"
FT                   /translation="MAKLHDYYKDEVVSKLMTQFSYNSVMQVPRVEKITLNMGVGEAIA
FT                   DKKLLDNAAADLTAISGQKPLITKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLI
FT                   TIAVPRIRDFRGLSSKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKSD
FT                   DEGRALLAAFNFPFRK"
FT   gene            382218..382523
FT                   /locus_tag="Dd1591_0336"
FT   CDS_pept        382218..382523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0336"
FT                   /product="ribosomal protein S14"
FT                   /note="PFAM: ribosomal protein S14; KEGG: sgl:SG2265 30S
FT                   ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05226"
FT                   /db_xref="GOA:C6CHB5"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHB5"
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /protein_id="ACT05226.1"
FT                   /translation="MAKQSMKAREVKRVKLADKFFAKRVELKAIISNVNSSDEDRWDAV
FT                   LKLQTLPRDSSPSRQRNRCRQTGRPHAFLRKFGLSRIKVREAAMRGEIPGLKKASW"
FT   gene            382557..382949
FT                   /locus_tag="Dd1591_0337"
FT   CDS_pept        382557..382949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0337"
FT                   /product="ribosomal protein S8"
FT                   /note="PFAM: ribosomal protein S8; KEGG: eum:ECUMN_3779 30S
FT                   ribosomal subunit protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05227"
FT                   /db_xref="GOA:C6CHB6"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHB6"
FT                   /inference="protein motif:PFAM:PF00410"
FT                   /protein_id="ACT05227.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVAVTMPSSKLKVAIANVLKEEGF
FT                   IEDFKVEGDTKPELELTLKYFQGKAVVESIQRISRPGLRIYKRKDELPKVMAGLGIAVV
FT                   STSKGVMTDRAARQAGLGGEIICYVA"
FT   gene            382963..383496
FT                   /locus_tag="Dd1591_0338"
FT   CDS_pept        382963..383496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0338"
FT                   /product="ribosomal protein L6"
FT                   /note="PFAM: ribosomal protein L6; KEGG: eca:ECA4016 50S
FT                   ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05228"
FT                   /db_xref="GOA:C6CHB7"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHB7"
FT                   /inference="protein motif:PFAM:PF00347"
FT                   /protein_id="ACT05228.1"
FT                   /translation="MSRVAKAPVVIPAGVEVKLNGQDISIKGKNGELVREINAAVEVKQ
FT                   ADNVLTFAPREGFTDGWAQAGTTRALLNSMVIGVTEGFTKKLQLVGVGYRAAVKGNVVN
FT                   LALGFSHPIDHELPAGITAECPSQTEIVLKGADKQLIGQVAADLRAYRRPEPYKGKGVR
FT                   YADEVVRTKEAKKK"
FT   gene            383506..383859
FT                   /locus_tag="Dd1591_0339"
FT   CDS_pept        383506..383859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0339"
FT                   /product="ribosomal protein L18"
FT                   /note="TIGRFAM: ribosomal protein L18; PFAM: ribosomal
FT                   protein L18P/L5E; KEGG: stm:STM3424 50S ribosomal protein
FT                   L18"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05229"
FT                   /db_xref="GOA:C6CHB8"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHB8"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ACT05229.1"
FT                   /translation="MDKKSARIRRATRARRKIRELGATRLVVHRTPRHIYAQVIAPNGS
FT                   EVLVAASTVEKAIAEQLKYTGNKDAAAAVGKAVAERALEKGIKGVAFDRSGFQYHGRVQ
FT                   ALADAAREAGLQF"
FT   gene            383874..384374
FT                   /locus_tag="Dd1591_0340"
FT   CDS_pept        383874..384374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0340"
FT                   /product="ribosomal protein S5"
FT                   /note="TIGRFAM: ribosomal protein S5; PFAM: ribosomal
FT                   protein S5 domain protein; Ribosomal protein S5; KEGG:
FT                   eca:ECA4014 30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05230"
FT                   /db_xref="GOA:C6CHB9"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHB9"
FT                   /inference="protein motif:TFAM:TIGR01021"
FT                   /protein_id="ACT05230.1"
FT                   /translation="MAHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRNMMNVALNNGTLQHPVKGAHTGSRVFMQPASEGTG
FT                   IIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLANMKSPEMVAAKRGKSVED
FT                   ILG"
FT   gene            384381..384560
FT                   /locus_tag="Dd1591_0341"
FT   CDS_pept        384381..384560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0341"
FT                   /product="ribosomal protein L30"
FT                   /note="TIGRFAM: ribosomal protein L30; PFAM: ribosomal
FT                   protein L30; KEGG: eca:ECA4013 50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05231"
FT                   /db_xref="GOA:C6CHC0"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHC0"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ACT05231.1"
FT                   /translation="MAKTIKITQTRSAIGRLPKHKATLLGLGLRRIGHTVEREDTPAVR
FT                   GMVNAVSYMVKVEE"
FT   gene            384564..384998
FT                   /locus_tag="Dd1591_0342"
FT   CDS_pept        384564..384998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0342"
FT                   /product="ribosomal protein L15"
FT                   /note="TIGRFAM: ribosomal protein L15; PFAM: ribosomal
FT                   protein L15; KEGG: eca:ECA4012 50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05232"
FT                   /db_xref="GOA:C6CHC1"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHC1"
FT                   /inference="protein motif:TFAM:TIGR01071"
FT                   /protein_id="ACT05232.1"
FT                   /translation="MRLNTLSPAEGSKHAPKRLGRGIGSGLGKTGGRGVKGQNSRSGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSRKAMITAEIRLSDLACVEGDVVDLNTLKAANVIGVQ
FT                   IEFAKVILSGEVARPVTIRGLRVTKGARAAIEAAGGKIEE"
FT   gene            385006..386337
FT                   /locus_tag="Dd1591_0343"
FT   CDS_pept        385006..386337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0343"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecY subunit; PFAM:
FT                   SecY protein; KEGG: eca:ECA4011 preprotein translocase
FT                   subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05233"
FT                   /db_xref="GOA:C6CHC2"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHC2"
FT                   /inference="protein motif:TFAM:TIGR00967"
FT                   /protein_id="ACT05233.1"
FT                   /translation="MAKQPGLDFQSAKGGVGELKRRLLFVIGALIVFRIGSFIPIPGID
FT                   ATVLAKLLEQQRGTIIEMFNMFSGGALSRASIFALGIMPYISASIIIQLLTVVHPALAE
FT                   IKKEGEAGRRKISQYTRYGTLVLGIFQSIGIATGLPNMPGMEGLVINPGFAFYFTAVVS
FT                   LVTGTMFLMWLGEQITERGIGNGISIIIFAGIVAGLPPAIGHTIEQARQGDLHFLLLLL
FT                   VAVLVFAVTFFVVFIERGQRRIVVNYAKRQQGRRVYAAQSTHLPLKVNMAGVIPAIFAS
FT                   SIILFPATIASWFGGGTGWNWLTTISLYLQPGQPLYVLLYASAIIFFCFFYTALVFNPR
FT                   ETADNLKKSGAFVPGIRPGEQTAKYIDKVMTRLTLVGAMYITFICLIPEFMRDAMKVPF
FT                   YFGGTSLLIVVVVIMDFMAQVQTLLMSSQYESALKKANLKGYSR"
FT   gene            386371..386487
FT                   /locus_tag="Dd1591_0344"
FT   CDS_pept        386371..386487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0344"
FT                   /product="ribosomal protein L36"
FT                   /note="TIGRFAM: ribosomal protein L36; PFAM: ribosomal
FT                   protein L36; KEGG: eca:ECA4010 50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05234"
FT                   /db_xref="GOA:C6CHC3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHC3"
FT                   /inference="protein motif:TFAM:TIGR01022"
FT                   /protein_id="ACT05234.1"
FT                   /translation="MKVRASVKKLCRNCKIVKRNGIVRVICSAEPKHKQRQG"
FT   gene            386634..386990
FT                   /locus_tag="Dd1591_0345"
FT   CDS_pept        386634..386990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0345"
FT                   /product="ribosomal protein S13"
FT                   /note="PFAM: ribosomal protein S13; KEGG: pmr:PMI3277 30S
FT                   ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05235"
FT                   /db_xref="GOA:C6CHC4"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHC4"
FT                   /inference="protein motif:PFAM:PF00416"
FT                   /protein_id="ACT05235.1"
FT                   /translation="MARIAGINIPDHKHTVIALTAIYGIGKTRSKSICAATGIAEDVKI
FT                   SELSEEQIDKLRDEVAKFVVEGDLRREITLSIKRLMDLGTYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   gene            complement(386980..387360)
FT                   /locus_tag="Dd1591_0346"
FT   CDS_pept        complement(386980..387360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spq:SPAB_04257 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05236"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHC5"
FT                   /inference="similar to AA sequence:KEGG:SPAB_04257"
FT                   /protein_id="ACT05236.1"
FT                   /translation="MRDRSHISNISDAETSRVQCADSRLTARTRSFNHNFQILDTVLFH
FT                   SFSAALCCYLSGERSGFTRTTETGTTGSCPTQRITLTISNGNDGVVERSMDMSHTVRDL
FT                   LSYTLTCTNRCLCHYSITPIIS"
FT   gene            387427..388047
FT                   /locus_tag="Dd1591_0347"
FT   CDS_pept        387427..388047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0347"
FT                   /product="ribosomal protein S4"
FT                   /note="KEGG: eca:ECA4007 30S ribosomal protein S4; TIGRFAM:
FT                   ribosomal protein S4; PFAM: ribosomal protein S4;
FT                   RNA-binding S4 domain protein; SMART: RNA-binding S4 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05237"
FT                   /db_xref="GOA:C6CHC6"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHC6"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ACT05237.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKIEQAPGQHGARK
FT                   PRLSDYGVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGANLLQLLEGRLDNVVYR
FT                   MGFGATRAEARQLVSHKAVMVNGRVVNIASYQVSPNDVVSIREKAKKQSRVKAALELAE
FT                   QREKPTWLEVDAAKMEGVFKRIPERTDLSADINEHLIVELYSK"
FT   gene            388073..389062
FT                   /locus_tag="Dd1591_0348"
FT   CDS_pept        388073..389062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0348"
FT                   /product="DNA-directed RNA polymerase, alpha subunit"
FT                   /note="KEGG: ypb:YPTS_3865 DNA-directed RNA polymerase,
FT                   alpha subunit; TIGRFAM: DNA-directed RNA polymerase, alpha
FT                   subunit; PFAM: RNA polymerase insert; RNA polymerase alpha
FT                   subunit domain protein; RNA polymerase dimerisation; SMART:
FT                   RNA polymerase RpoA/D/Rpb3-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05238"
FT                   /db_xref="GOA:C6CHC7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHC7"
FT                   /inference="protein motif:TFAM:TIGR02027"
FT                   /protein_id="ACT05238.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNK
FT                   SGIGPVTAADITHDGDVEIVKPQHVICHLTDENASINMRIKVQRGRGYVPASARIHTEE
FT                   DERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAAT
FT                   ILAEQLEAFVDLRDVRQPEVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDL
FT                   VQRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIADE"
FT   gene            389103..389495
FT                   /locus_tag="Dd1591_0349"
FT   CDS_pept        389103..389495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0349"
FT                   /product="ribosomal protein L17"
FT                   /note="TIGRFAM: ribosomal protein L17; PFAM: ribosomal
FT                   protein L17; KEGG: eca:ECA4005 50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05239"
FT                   /db_xref="GOA:C6CHC8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHC8"
FT                   /inference="protein motif:TFAM:TIGR00059"
FT                   /protein_id="ACT05239.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNMAGSLVRHEIIKTTLPKAKELR
FT                   RVVEPLITLAKTDSVANRRLAFARTRDNEIVAKLFNELGPRFASRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRAVSQTEEVAAAE"
FT   gene            389624..390013
FT                   /locus_tag="Dd1591_0350"
FT   CDS_pept        389624..390013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0350"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpn:KPN_03693 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05240"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHC9"
FT                   /inference="similar to AA sequence:KEGG:KPN_03693"
FT                   /protein_id="ACT05240.1"
FT                   /translation="MFPIDEWAERHILEAQKRGELDHLSGSGKPLQLDDNSAVPAELRS
FT                   AYHLMKNSGFLPPELSARKDALTLADLLLATDPASKEYVELSRQLRALELRLQLSGVNT
FT                   NFLKMPYRHQLINRFEKRLHPDKDD"
FT   gene            390071..390295
FT                   /locus_tag="Dd1591_0351"
FT   CDS_pept        390071..390295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0351"
FT                   /product="protein of unknown function DUF331"
FT                   /note="PFAM: protein of unknown function DUF331; KEGG:
FT                   eum:ECUMN_3765 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05241"
FT                   /db_xref="GOA:C6CHD0"
FT                   /db_xref="InterPro:IPR005589"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHD0"
FT                   /inference="protein motif:PFAM:PF03889"
FT                   /protein_id="ACT05241.1"
FT                   /translation="MSNYRHTKGRITDNALEALLHDPLFRQRVEQNVKGKGSYRRKEKH
FT                   QKVQSKNWEASGKRNNTFTTGLLICCFSC"
FT   gene            complement(390302..390727)
FT                   /locus_tag="Dd1591_0352"
FT   CDS_pept        complement(390302..390727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0352"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: spe:Spro_4515 large-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05242"
FT                   /db_xref="GOA:C6CHD1"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHD1"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ACT05242.1"
FT                   /translation="MSLIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVSDIIMPPL
FT                   GLLIGGVDFKQFHWVLREAQGNLAAVSINYGTFIQNIFDFVIVAFAIFMAIKLMNKLRR
FT                   TQQEQPNTPPKITAEETLLTEIRDLLKQQIDSQSKNS"
FT   gene            complement(390834..392210)
FT                   /locus_tag="Dd1591_0353"
FT   CDS_pept        complement(390834..392210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0353"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: eca:ECA4002 potassium transporter peripheral membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05243"
FT                   /db_xref="GOA:C6CHD2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHD2"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACT05243.1"
FT                   /translation="MKIIILGAGQVGGTLAENLSGENNDITVVDTNTTRLRQLQDKFDL
FT                   RVVTGYASHPRVLREAGAEDADMLIAVTNSDETNMIACQVAYSLFNTPNRIARIRASEY
FT                   IRESEQLFHAEAVPIDHLISPEQLVIDNIYKLIEYPGALQVVNFAEGKVSIAAVNAYYG
FT                   GPLVGNAIATMRDHMPHIETRVAAIFRHDRPIRPQGSTVIEAGDEVFFIAASQHIRAVM
FT                   SEMQRLEKPYKRIMIVGGGNVGSGLARKLEKDYSVKLIERDALRATELAERLQNTIVFH
FT                   GDASDQELLAQEHVEQIDVFIAITNDDEANIMSAMLAKRMGAKKAMVLIQRKAYVDLVQ
FT                   GSVIDVAISPQQATISALLGHVRKADIVSVSSLRRGVAEAIEAIAHGDEGTSKVVGRMI
FT                   ADIKLPPGTIIGAIVRGDDVIIANNNLQIEQGDHVIMFLTDKKYISDVERLFQPSPFFL
FT                   "
FT   gene            complement(392253..393548)
FT                   /locus_tag="Dd1591_0354"
FT   CDS_pept        complement(392253..393548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0354"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: yen:YE3891 16S rRNA
FT                   methyltransferase B"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05244"
FT                   /db_xref="GOA:C6CH57"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR023541"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C6CH57"
FT                   /inference="protein motif:TFAM:TIGR00563"
FT                   /protein_id="ACT05244.1"
FT                   /translation="MKSTYNLRSIAATVLVQVVEQGQSLSQLLPVFQRDISEKDRGLLQ
FT                   EICFGVLRVLPQLDWYLRQLMAKPLTGKQKVLHYLLMVGIYQLIHTRIPPHAALAETVN
FT                   AAVTLKRPQLKGLINGVLRQFQRQQEELQQRLQNNTARYSHPDWLLQRLKKAYPDQWEQ
FT                   IIDANNQHPPMWLRVNRLHHSREAYLVLLQEKGIEAHPHPFYTDAIRLITPCAVSGLPG
FT                   FDQGWVTVQDASAQGCIHWLSPKNHEDILDLCAAPGGKTTHILEAAPQARVLAVDVDEQ
FT                   RLKRVKENLQRLRLHADVKCGDGRTPEAWCADQCFDRILLDAPCSATGVIRRHPDIKWL
FT                   RRDSDIAELASLQQAILEAIWPRLKNGGTLVYATCSVLPEENSQQIAAFLQHHPDAILA
FT                   DTGNTTSPGIQVLPMPEDGDGFFYAKLVKSGQ"
FT   gene            complement(393609..394550)
FT                   /locus_tag="Dd1591_0355"
FT   CDS_pept        complement(393609..394550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0355"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: eca:ECA4000
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05245"
FT                   /db_xref="GOA:C6CHD3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C6CHD3"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ACT05245.1"
FT                   /translation="MSLRIIFAGTPDFAAQHLAALLSSEHEIVGVFTQPDRPAGRGNKL
FT                   TPSPVKMLAEQHNLPVFQPKSLRPSESQQLVAELSADVMVVVAYGLILPQAVLDMPRLG
FT                   CINVHGSLLPRWRGAAPIQRALWAGDRLTGITIMQMDAGLDTGAMLHKIECPILPDDTS
FT                   ATLYDKLANLGPQGLLHTLTQLSASQVTAVAQDDSLATYAEKLSKEEARLDWRLSAEQL
FT                   ERCIRAFNPWPVSYFMVEEQPVKVWKAEVLDISHQQLPGTVLAADKEGIQVATTDGVLN
FT                   IQILQPSGKKAMSAQDLLNSRREWFTPGSTLA"
FT   gene            complement(394589..395098)
FT                   /locus_tag="Dd1591_0356"
FT   CDS_pept        complement(394589..395098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0356"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: eca:ECA3999 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05246"
FT                   /db_xref="GOA:C6CI00"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI00"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACT05246.1"
FT                   /translation="MSVLQVLHFPDERLRIQAKPVKEVNAEIQRIVDDMFDTMYEEEGI
FT                   GLAATQVDIHQRIIVIDVSEERDQRLVLINPELLEKSGDTGIEEGCLSIPETRALVPRA
FT                   EHVKVRALDREGKPFELEADGLLAICIQHEMDHLIGKLFVDYLSPLKRQRIRQKLEKLA
FT                   RQNSKA"
FT   gene            395212..396345
FT                   /locus_tag="Dd1591_0357"
FT   CDS_pept        395212..396345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0357"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: eca:ECA3998 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05247"
FT                   /db_xref="GOA:C6CI01"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI01"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ACT05247.1"
FT                   /translation="MTDTEIWLRLASVKGFGGKRCAMLFDKLKTESTYSAGYLKSLGFN
FT                   GDQVEQFSSLNTPDIQNTLQWLENRDHHLVTFNSGGYPPLLSNIASPPVCLYVAGDINV
FT                   LSSPQIAVVGSRNNSAYGEQWGHFFSEQLSLNHLTITSGLAIGIDGIAHHAALNAEGKT
FT                   VAVLGSGLNQLYPRRHQALADAIVAKGGALVSEFPLHTKPLPINFPRRNRIISGLSLGV
FT                   LVVEASMRSGSLVTARYALEQNREVFALPGPIGNPMTEGNHWLIQQGASLVTQPKDIFE
FT                   QLHNGLRWFADIPNEGIAEIICSTESELELPFADVLATVGDEVTPVDVVAERAGQPVPE
FT                   VVSKLLDLELAGWIAAVPGGYVRIRRAGHVRRTHVLV"
FT   gene            396317..396790
FT                   /locus_tag="Dd1591_0358"
FT   CDS_pept        396317..396790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0358"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   eca:ECA3997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05248"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI02"
FT                   /inference="protein motif:PFAM:PF04361"
FT                   /protein_id="ACT05248.1"
FT                   /translation="MFDVLMYLFETYIHNETEMRVDQDTLTDDLTRAGFDRDDIYSALD
FT                   WLEKLADLQEGQTPPLALASDPLALRIYTAEEEQRLDVDCRGFLLFLEQIQVLNLETRE
FT                   MVIDRVMALETQDFDLEDLKWVILMVLFNVPGCESAYQQMEDLLFEVNEGYLQ"
FT   gene            396810..397367
FT                   /locus_tag="Dd1591_0359"
FT   CDS_pept        396810..397367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0359"
FT                   /product="DNA topoisomerase type IA zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase type IA zn finger domain
FT                   protein; KEGG: eca:ECA3996 putative DNA topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05249"
FT                   /db_xref="GOA:C6CI03"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI03"
FT                   /inference="protein motif:PFAM:PF01396"
FT                   /protein_id="ACT05249.1"
FT                   /translation="MNKTLVAEKHQQVCPECGAVLVIRSGQHGPFLGCSRYPECRYIRS
FT                   LKANADGHVVKVLDGHYCPRCQSTLVLRQGRYGMFIGCSNYPECDHTEAIDRPDETALI
FT                   CPQCREGRLLQRKSRYGKTFHACERYPVCQFTLNYKPIAGECGYCHYPLLIEKKTAQGI
FT                   RHFCASKLCGKLVSAEEHHCDE"
FT   gene            397357..397929
FT                   /locus_tag="Dd1591_0360"
FT   CDS_pept        397357..397929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0360"
FT                   /product="SUA5/yciO/yrdC domain protein"
FT                   /note="PFAM: SUA5/yciO/yrdC domain; KEGG: eca:ECA3996
FT                   putative DNA topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05250"
FT                   /db_xref="GOA:C6CI04"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI04"
FT                   /inference="protein motif:PFAM:PF01300"
FT                   /protein_id="ACT05250.1"
FT                   /translation="MMSNVNSEELTLLLKQLREERVIAYPTEAVFGLGCDPDSEMAVER
FT                   LLALKQRPREKGLILIAADFRQLEPYVEMAALSDAQRQTIFTTWPGPVTWVIPAKTSTP
FT                   DWLTGRFNSLAVRVSDHPLVRQLCLAFGKPLVSTSANLTGQPPCRTVSEVVRQFGEGFP
FT                   VLNGCVGGRLNPSEIRDALTGEMLRQG"
FT   gene            397949..398776
FT                   /locus_tag="Dd1591_0361"
FT   CDS_pept        397949..398776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0361"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM: Shikimate
FT                   dehydrogenase substrate binding domain protein;
FT                   Shikimate/quinate 5-dehydrogenase; KEGG: eca:ECA3995
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05251"
FT                   /db_xref="GOA:C6CI05"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI05"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ACT05251.1"
FT                   /translation="MPVSQSFAVFGHPIAHSKSPRIHSLFAEQTGISLTYERILAPLDG
FT                   FDSSLKMFFQRGACGANVTAPFKERACAAMDELSERARSAGAVNTIQKKGDGSLYGDNT
FT                   DGIGLLSDLQQNAFIQPHYRVLLVGAGGAARGVIQPLLAYGCELVIANRTFARAGALAE
FT                   HFGRYGQVSALSMDALSDHRFDLIINATSSGVMGDIPDLPVSLISPDVCCYDMFYQAEP
FT                   TPFLTWCIQQGAQRYVDGMGMLVWQAAHAFSLWHGIMPDAVPVIRKMKQELGE"
FT   gene            398773..399042
FT                   /locus_tag="Dd1591_0362"
FT   CDS_pept        398773..399042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0362"
FT                   /product="protein of unknown function DUF1488"
FT                   /note="PFAM: protein of unknown function DUF1488; KEGG:
FT                   eca:ECA3994 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05252"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI06"
FT                   /inference="protein motif:PFAM:PF07369"
FT                   /protein_id="ACT05252.1"
FT                   /translation="MNQAIQFPEREWWSDHDEAIIFPVLVGGFQRECVIRRYILLERYG
FT                   DVRPEQWLSLFREHRWDWEDEFERIIRDNEYDEQGRFLFSDGTH"
FT   gene            complement(399061..399597)
FT                   /locus_tag="Dd1591_0363"
FT   CDS_pept        complement(399061..399597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0363"
FT                   /product="putative transferase"
FT                   /note="KEGG: eca:ECA3993 putative transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05253"
FT                   /db_xref="GOA:C6CI07"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI07"
FT                   /inference="similar to AA sequence:KEGG:ECA3993"
FT                   /protein_id="ACT05253.1"
FT                   /translation="MSETLRPFKGTRPVIGKNVMVDPSSVVIGDVTLADDVSIWPLVVI
FT                   RGDVNLIRIGSRTNIQDGSVLHVTHRSEKNEHGNSLIIGEDVTVGHKAMLHGCTIGNRV
FT                   LVGMGSILLDGVTVEDDVIIGAGSLVSPGKTLEKGYLYLGSPAKKIRPLTEQELEGLLY
FT                   SSSNYVRWKDEYLNQ"
FT   gene            400069..401598
FT                   /locus_tag="Dd1591_R0012"
FT   rRNA            400069..401598
FT                   /locus_tag="Dd1591_R0012"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            401673..401749
FT                   /locus_tag="Dd1591_R0013"
FT                   /note="tRNA-Ile2"
FT   tRNA            401673..401749
FT                   /locus_tag="Dd1591_R0013"
FT                   /product="tRNA-Ile"
FT   gene            401862..401937
FT                   /locus_tag="Dd1591_R0014"
FT                   /note="tRNA-Ala2"
FT   tRNA            401862..401937
FT                   /locus_tag="Dd1591_R0014"
FT                   /product="tRNA-Ala"
FT   gene            402107..405014
FT                   /locus_tag="Dd1591_R0015"
FT   rRNA            402107..405014
FT                   /locus_tag="Dd1591_R0015"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            405146..405260
FT                   /locus_tag="Dd1591_R0016"
FT   rRNA            405146..405260
FT                   /locus_tag="Dd1591_R0016"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            405764..406693
FT                   /locus_tag="Dd1591_0364"
FT   CDS_pept        405764..406693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0364"
FT                   /product="homoserine O-succinyltransferase"
FT                   /EC_number="2.3.1.46"
FT                   /note="KEGG: spe:Spro_4504 homoserine
FT                   O-succinyltransferase; TIGRFAM: homoserine
FT                   O-succinyltransferase; PFAM: homoserine
FT                   O-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05254"
FT                   /db_xref="GOA:C6CI08"
FT                   /db_xref="InterPro:IPR005697"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033752"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI08"
FT                   /inference="protein motif:TFAM:TIGR01001"
FT                   /protein_id="ACT05254.1"
FT                   /translation="MPIRVPDELPAVSFLRNENVFVMTSSRAKTQEIRPLKVLVLNLMP
FT                   KKIETENQFLRLLSNSPLQIDIQLLRIDSRESKNTPTEHLNNFYCDFEDIEHENFDGLI
FT                   VTGAPLGLVDFCDVVYWPQIERVVNWAKEHVTSTLFVCWAVQAALNVLYGIPKLTRDVK
FT                   LSGVYSHHTLQPHALLTRGFDETFLAPHSRYADFPSDVIRQYTDLDILVESEAAGAYLF
FT                   ASKDKRLAFVTGHPEYDVLTLSGEYLRDCDAGLNPVIPVNYFPDDDPQKTPRATWRSHG
FT                   HLLFANWLNYYVYQITPFDLRHMNPTLD"
FT   gene            407010..408608
FT                   /locus_tag="Dd1591_0365"
FT   CDS_pept        407010..408608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0365"
FT                   /product="malate synthase A"
FT                   /EC_number="2.3.3.9"
FT                   /note="KEGG: esa:ESA_00053 malate synthase; TIGRFAM: malate
FT                   synthase A; PFAM: malate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05255"
FT                   /db_xref="GOA:C6CI09"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI09"
FT                   /inference="protein motif:TFAM:TIGR01344"
FT                   /protein_id="ACT05255.1"
FT                   /translation="MTQQTISRELVFTHALGDAEQQILTADAVNFLTVLVSRFTSQRNH
FT                   LLAERREVQGRIDSGELPGFISEMDSIKNSDWKIRGIPSDLLDRRVEITGPVERKMVIN
FT                   ALNANVKVFMADFEDSLAPSWSKVIDGQINLRDAVRGTITYTSEAGKIYQLKPNPAVLI
FT                   CRVRGLHLPEKHVLWNDEPIPGSLFDFALYFFHNYRQLLAKGSGPYFYLPKTQSWQEAA
FT                   WWGDVFSYTEDHFGLTRGTIKATVLIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFS
FT                   YIKTLKNHPDRVLPDRQSVTMDKPFLSAYSRLLIKTCHRRGAFAMGGMAAFIPSKEVER
FT                   NAWVQEKVRQDKELEARNGHDGTWIAHPGLADTVMPVFDRLLGERSNQLDVLREDDAPV
FT                   TADELLAPCPGERTEAGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIW
FT                   QWIHHGKTLSDGRVVTKALFRQMLTEEMQVIRGELGDTRFDGGRFEEAARLMERITTQD
FT                   ALIDFLTLPGYDLLD"
FT   gene            408632..409939
FT                   /locus_tag="Dd1591_0366"
FT   CDS_pept        408632..409939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0366"
FT                   /product="isocitrate lyase"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: eca:ECA3990 isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05256"
FT                   /db_xref="GOA:C6CI10"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI10"
FT                   /inference="protein motif:TFAM:TIGR01346"
FT                   /protein_id="ACT05256.1"
FT                   /translation="MSTSRTQQIEQLEQEWTTPRWEGITRPYHAEDVVNLRGSVNPACT
FT                   LAQLGAEKLWKLLNGKSRKGYVNCLGALTGGQALQQAKAGLEAVYLSGWQVAADANLAA
FT                   SMYPDQSLYPSNSVPAVVQRINNTFRRADQIQWANGIGQDDPRYTDYFLPIVADAEAGF
FT                   GGVLNAFELMKSMIEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAAD
FT                   VLGVPTLLVARTDADAADLLTSDCDDYDRDFVTGERTVEGFYRTRAGVEQAISRGLAYA
FT                   PYADLVWCETSTPDLALARRFAEAIHARFPGKLLAYNCSPSFNWKKNLDDHTIARFQDE
FT                   LSAMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFAAIEQGYTFSS
FT                   HQQEVGTGYFDKVTTLIQGGASSVTALTGSTEEQQF"
FT   gene            410018..411775
FT                   /locus_tag="Dd1591_0367"
FT   CDS_pept        410018..411775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0367"
FT                   /product="(Isocitrate dehydrogenase (NADP(+))) kinase"
FT                   /EC_number="2.7.11.5"
FT                   /note="PFAM: Isocitrate dehydrogenase kinasephosphatase;
FT                   KEGG: eca:ECA3989 bifunctional isocitrate dehydrogenase
FT                   kinase/phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05257"
FT                   /db_xref="GOA:C6CI11"
FT                   /db_xref="InterPro:IPR010452"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI11"
FT                   /inference="protein motif:PRIAM:2.7.11.5"
FT                   /protein_id="ACT05257.1"
FT                   /translation="MSRGREKLVAQTILQGFDAQYGRFLEVTAGAQQRFEQADWHAVQQ
FT                   AMKQRIQLYDHHVGLVVEQLGCITDRQCYDAAFVARVKQIYTALLPDYPRFEIAESFFN
FT                   SVYCRLFHHRELTPDKLFVFSSQPAQRFQEIPRPLARTYQPDGGWPAMLEAVLTALPLR
FT                   LPWEDLARDIDYIVRSLRETFPTASLANASLQVANELFYRNKAAWLVGKLRLPGGVFPF
FT                   LLPIHHNERGALFIDTCLTRHADASIVFGFARSYFMVYAPLPSALVAWLREILPGKTTA
FT                   ELYLAIGCQKHSKTEYYREYLDFIAGTQEPFITAPGVKGMVMLVFTLPTFDRVFKVIKD
FT                   RFAPQKEVSEARVRECYQLVKEHDRVGRMADTQEYENFVLEKARISPELLAELWREVPD
FT                   KLEDLGDRLVIRHLYMERRMTPLNLYLEQASGQALRDVIEEYGNAIRQLAAANIFPGDM
FT                   LFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRDPADELAAEPWYSVGPNDVFPEE
FT                   FRRFLCSDRRLLPLFEELHADLFRAEYWRALQQRIRSGHIEDVYAYRRRKRFSFRYADP
FT                   VTPADALTS"
FT   gene            complement(411782..412615)
FT                   /locus_tag="Dd1591_0368"
FT   CDS_pept        complement(411782..412615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0368"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Transcriptional regulator IclR; regulatory
FT                   protein IclR; SMART: regulatory protein IclR; KEGG:
FT                   eca:ECA3988 transcriptional repressor IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05258"
FT                   /db_xref="GOA:C6CI12"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI12"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ACT05258.1"
FT                   /translation="MMTPPEPAKRGKKPRAAAASPTQPAGQVQSLTRGLTLLEYIAKAN
FT                   GSIALTDLAQQAGLPNSTTHRLLTTMQQQGFVRQVGDLGLWTIGTHAFIVGSSFLQSRN
FT                   LLSLVHPMLRQLMESSGETVNLAVLDQTDYQAIIIDQVQCTALMRMSAPIGGKLPMHAS
FT                   GAGKAFLAMLPDEKVTQLLHRKGLHSYTPQTLSAQTLKENLTAIRRQGYALDDEEHALG
FT                   LRCVAACILDEHHEAFAAISISGPISRITDNRITELGALVIKAAKEVTYQYGGAR"
FT   gene            412774..416460
FT                   /locus_tag="Dd1591_0369"
FT   CDS_pept        412774..416460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0369"
FT                   /product="methionine synthase"
FT                   /note="TIGRFAM: methionine synthase; PFAM: homocysteine
FT                   S-methyltransferase; Methionine synthase B12-binding module
FT                   cap domain protein; cobalamin B12-binding domain protein;
FT                   dihydropteroate synthase DHPS; Vitamin B12 dependent
FT                   methionine synthase activation region; KEGG: eca:ECA3987
FT                   B12-dependent methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05259"
FT                   /db_xref="GOA:C6CI13"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI13"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ACT05259.1"
FT                   /translation="MMANRLQALQQQLAQRIMVLDGGMGTMIQSYRLQEEDYRGERFAD
FT                   WHCDLKGNNDLLVLSKPEVITAIHHDYLAAGADILETNTFNATRIAMADYEMEALSAEI
FT                   NTVAARLARACADEWTARTPERPRYVAGVLGPTNRTASISPDVNDPAYRNVSFDQLVDA
FT                   YRESTRALVEGGVDIILIETIFDTLNAKAAIFAVETEFEALGVTLPVMLSGTITDASGR
FT                   TLSGQTTEAFYNSLRHARPLSFGLNCALGPDELRQYVAELSRIAECYVTAHPNAGLPNA
FT                   FGEYDLDADEMARQIGEWAQSGFLNIIGGCCGTTPEHIAAMVNAVEGVAPRALPTLPVA
FT                   CRLAGLEPLNIGDDTLFVNVGERTNVTGSAKFKRLIKEEKYNEALDVARQQVESGAQII
FT                   DINMDEGMLNAEAAMVRFLNLIAGEPDIARVPIMIDSSKWDVVEAGLKCIQGKGIVNSI
FT                   SMKEGVDAFVHHARLVRRYGAAVVVMAFDEVGQADTRARKIEICRRAYHILTEEVGFPP
FT                   EDIIFDPNIFAVATGIDEHNNYAVDFIEACADIKAQLPHALISGGVSNVSFSFRGNEPV
FT                   REAIHAVFLYYAIRNGMDMGIVNAGQLAIYDDLPAELRDAVEDVILNRRDDGTERMLEI
FT                   AEKYRGSKSDDDSNKGAAEWRGWPVRKRLEYALVKGITEFIEQDTEEARAESARPIEVI
FT                   EGPLMDGMNVVGDLFGAGKMFLPQVVKSARVMKQAVAYLEPFIQASKDQGSSAGKILLA
FT                   TVKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPTDKILKTAREEKVDIIGLSGLITPSL
FT                   DEMVNVAKEMERQGFTLPLLIGGATTSKAHTAVKIEQNYSGPTVYVQNASRSVGVVSAL
FT                   LSDTQRDDFVARIRKEYETVRIQHGRKKPRTPPVSLGVARDNAMPIDWESYTPPVAHRL
FT                   GVQPVTASIETLRNYIDWTPFFMTWSLAGKYPNILEDEVVGEEAKRLFADANAMLDTLS
FT                   ASGTLNPRGVVGLFPANRVGDDVEIYTDERRTEVLTVSHHLRQQTEKTDFPNYCLADVV
FT                   APKASGKPDYLGAFAVTGGLEEDALAAQWEAQHDDYNKIMLKALADRLAEAFAEYLHER
FT                   VRKVYWGYAPNENLGNDELIRENYQGIRPAPGYPACPDHTEKAAIWQLLDVDNTVGMKL
FT                   TESYAMWPGASVSGWYFSHPDSKYFAVAQIQRDQVEDYAVRKQMPVEEIERWLAPNLGY
FT                   DAD"
FT   gene            complement(416537..417991)
FT                   /locus_tag="Dd1591_0370"
FT   CDS_pept        complement(416537..417991)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0370"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter; Citrate transporter; KEGG: eca:ECA3984 putative
FT                   sodium:sulfate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05260"
FT                   /db_xref="GOA:C6CI14"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI14"
FT                   /inference="protein motif:TFAM:TIGR00785"
FT                   /protein_id="ACT05260.1"
FT                   /translation="MKTKTAYGLNWLALIVIVIVAAFFWQLTPPSGLKPAAWHSAVLFV
FT                   ATIVSIVANVLPIGAIGIISITLFALTYAAGDTSASASIQTALSDLNSSLIWLIVVAFM
FT                   IARGFIKTGLGRRIALQMIRLLGKRTLGLAYGLAFADLVLSPAMPSNTARCGGVIYPIA
FT                   DSLARSFDSRPDDASRSKIGTFLVTCIGNVNDVTAALFMTGYTGNLLAVKLAANAGVTI
FT                   TWGSWFVAAIVPCVISLLLVPLCVYVLAKPEIRHTPDAPKLAVSELEKMGSMSRGEWLM
FT                   AATVVILLVLWIFGDLLGVDATTASFVGLSFLLLTGVLSWEDIKSEKGAWDTLIWFAAL
FT                   LMMANQLKKLGFTTWFGDLIGNSIGHLMQDTSWVLVLLLLNAAYFYTHYFFASGNAQIA
FT                   ALYAVFLGVGINLHIPAAPMALMLAFTSSLYCSLTQYTHARGPILFGAGYVPTAVWWRT
FT                   GFVISLINQAIFMSVGLLWWKTIGLY"
FT   gene            418309..419955
FT                   /locus_tag="Dd1591_0371"
FT   CDS_pept        418309..419955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0371"
FT                   /product="sodium-dependent inorganic phosphate (Pi)
FT                   transporter"
FT                   /note="TIGRFAM: sodium-dependent inorganic phosphate (Pi)
FT                   transporter; Na/Pi-cotransporter II-related protein; PFAM:
FT                   Na+/Picotransporter; PhoU family protein; KEGG: eca:ECA3983
FT                   putative sodium/phosphate cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05261"
FT                   /db_xref="GOA:C6CI15"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI15"
FT                   /inference="protein motif:TFAM:TIGR01013"
FT                   /protein_id="ACT05261.1"
FT                   /translation="MLTLLNLLSAIALLVWGTHIVRTGIMRVYGARLRRTISDSVSRKP
FT                   LAFLAGIGVTALVQSSNATALLAISFVSQGLIALAPALVIILGADVGTALMVRVLTFDL
FT                   SWLSPLLIFLGVVFFLSRKQTRAGQLGRVAIGLGLILLALELIVQAATPITQTAGVKVV
FT                   FSSLTGDVMLDALVGAIFAIVSYSSLAAVLLTATLTASHVISLDAALCLVIGANLGSGI
FT                   LALANASAQGPAARQVALGSMFFKLIGSLPVLPAIGYLADLIETVPLPDAERVIYFHLF
FT                   YNLARCLLLLPFAERMAELCSNLVRVEPDLDPRLRPRHLDISALDTPTLALANAARETL
FT                   RIGDVIEQMLKMFQDTLQGNNQQAREIRKLDDDVDVLYNAIKLYLAQIEKAGLHERDSR
FT                   RWAEVIEMALNLEQAGDIIERVVCDLDAHAPDGLRGFSTAGRDELNTLYEQLMSNLRLG
FT                   MSVFLSADITSARRLRRAKHRFRILNRRYSHAHVDRLHQQNIQSLETSSLHLGLLGDMN
FT                   RLNSLFCAVAYNVLMMTEDEDEGREESSASA"
FT   gene            complement(420034..421398)
FT                   /locus_tag="Dd1591_0372"
FT   CDS_pept        complement(420034..421398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0372"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /note="KEGG: eca:ECA3981 aspartate kinase III; TIGRFAM:
FT                   aspartate kinase; aspartate kinase, monofunctional class;
FT                   PFAM: aspartate/glutamate/uridylate kinase; amino
FT                   acid-binding ACT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05262"
FT                   /db_xref="GOA:C6CI16"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041745"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI16"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACT05262.1"
FT                   /translation="MSANTNNSLIIAKFGGTSVADFDAMNRSADIVLSDFQVRVVVLSA
FT                   SAGVTNLLVALAEGLPPDERAAQLEKLRQIQYAIINRLNQPAVIREEIERMLENVARLS
FT                   EAAALATSNALTDELVSHGELMSTLLFVEILRERNVAAEWFDVRKIMRTNDRFGRAEPD
FT                   CDMLGELTRSQLAPRLAQGLVITQGFIGSEAKGRTTTLGRGGSDYTAALLGEALNVGRI
FT                   DIWTDVPGIYTTDPRVVQSAHRIDQITFEEAAEMATFGAKVLHPATLLPAVRSDIPVFV
FT                   GSSKDPAAGGTLVCNNTENPPLFRALALRRKQTLLTLHSLNMLHARGFLAEVFSILARH
FT                   NISVDLITTSEVNVALTLDTTGSTSTGDSLLSSALLTELSSLCRVEVEENMSLVALIGN
FT                   KLSQACGVGKEVFGVLEPFNIRLICYGASSHNLCFLVPSSDAEQVVQTLHHNLFE"
FT   gene            421905..423554
FT                   /locus_tag="Dd1591_0373"
FT   CDS_pept        421905..423554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0373"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="PFAM: phosphoglucose isomerase (PGI); KEGG:
FT                   eca:ECA3979 glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05263"
FT                   /db_xref="GOA:C6CI17"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI17"
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /protein_id="ACT05263.1"
FT                   /translation="MKNINPTQTAAWQALQQHFAAMKEVQISDLFAQDPERFSHFSATF
FT                   GDLMLVDYSKNRITAETLEKLQALARETDLSAAIQSMFSGEKINRTEDRAVLHVALRNR
FT                   SNTPIVVDGNDVMPDVNAVLQKMKQFSERVIGGEWKGYTGKAITDVVNIGIGGSDLGPY
FT                   MVTEALRPYKNHLTMHFVSNVDGTHIAEILKRVNPETTLFLVASKTFTTQETMTNAHSA
FT                   RDWFLKAAGDEKHVAKHFAALSTNVKAVGEFGIDTDNMFEFWDWVGGRYSLWSAIGLSI
FT                   VLSVGFDNFEQLLSGAHAMDQHFATTPAEKNLPVLLALIGIWYNNFFGAETEAILPYDQ
FT                   YMHRFAAYFQQGNMESNGKYVDRNGNPVDYQTGPIIWGEPGTNGQHAFYQLIHQGTKLV
FT                   PCDFIAPAMTHNPLSDHHSKLLSNFFAQTEALAFGKSREAVEAEFAAAGKSAKDVEHVA
FT                   PFKVFEGNRPTNSILLREITPYSLGALIALYEHKIFTQGAILNIFTFDQWGVELGKQLA
FT                   NRILPELQDDSAVSSHDSSTNGLINRFKQWRA"
FT   gene            423823..424167
FT                   /locus_tag="Dd1591_0374"
FT   CDS_pept        423823..424167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spe:Spro_0410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05264"
FT                   /db_xref="InterPro:IPR025294"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI18"
FT                   /inference="similar to AA sequence:KEGG:Spro_0410"
FT                   /protein_id="ACT05264.1"
FT                   /translation="MRTRILMGLAAVTLLAGCSTNNELSAAGQAVRFTDTKPSAQCQLL
FT                   GSVTGTQSNWLSGGNSEGSSMRGAANDLRNKAAAMGGNVIYGASTPSQTFLSSFAPLDS
FT                   KMQGQVYKCL"
FT   sig_peptide     423823..423903
FT                   /locus_tag="Dd1591_0374"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.450 at
FT                   residue 27"
FT   gene            complement(424219..425256)
FT                   /locus_tag="Dd1591_0375"
FT   CDS_pept        complement(424219..425256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0375"
FT                   /product="lysine 2,3-aminomutase YodO family protein"
FT                   /EC_number="5.4.3.2"
FT                   /note="KEGG: eca:ECA3977 hypothetical protein; TIGRFAM:
FT                   lysine 2,3-aminomutase YodO family protein; PFAM: Radical
FT                   SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05265"
FT                   /db_xref="GOA:C6CI19"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI19"
FT                   /inference="protein motif:TFAM:TIGR00238"
FT                   /protein_id="ACT05265.1"
FT                   /translation="MAHIVTLNIPSREDWLQQLADVITDPDELLRLLALDNHPQLTAGR
FT                   EARRLFPLRVPRAFAARMRPGDARDPLLLQVLTAQDEFIATPGFSHDPLDEQHSVVPGL
FT                   LHKYHNRALLLVKGGCAVNCRYCFRRHFPYQDNQGNKANWRQALDYIRQHPQLDEIIFS
FT                   GGDPLMAKDHELDWLLTELEQIPHLKRLRIHTRLPVVIPARITAELCRRLAQSPLRVVL
FT                   VTHINHANEIDTELADGMARLRQAGVTLLNQSVLLRGVNDNANTLAALSNALFDAGILP
FT                   YYLHVLDKVQGAAHFLVPDDDARTLVRELMMQVSGYLVPSLAREIGGEASKTLLDIGMR
FT                   QQSQG"
FT   gene            425296..425862
FT                   /locus_tag="Dd1591_0376"
FT   CDS_pept        425296..425862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0376"
FT                   /product="translation elongation factor P"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P; Elongation factor P/YeiP protein;
FT                   Elongation factor KOW domain protein; KEGG: spe:Spro_0412
FT                   translation elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05266"
FT                   /db_xref="GOA:C6CI20"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI20"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ACT05266.1"
FT                   /translation="MATYFSNDFRSGLKIMFEGEPYAIESSEFVKPGKGQAFARVKMRR
FT                   LLTGSRVEKTFKSTDSAEGADVMDTNMNYLYNDGEFFHFMHPETFEQHQVEAKTVGDSA
FT                   KWLQDNAECIVTLWDGRPIAVQPPNFIEAEITETDPGLKGDTAGTGGKPATLSTGAVVK
FT                   VPLFVQIGEVIKVDTRSGEYVSRVK"
FT   gene            426018..426371
FT                   /locus_tag="Dd1591_0377"
FT   CDS_pept        426018..426371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0377"
FT                   /product="protein of unknown function DUF486"
FT                   /note="PFAM: protein of unknown function DUF486; KEGG:
FT                   eca:ECA3974 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05267"
FT                   /db_xref="GOA:C6CI21"
FT                   /db_xref="InterPro:IPR007437"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI21"
FT                   /inference="protein motif:PFAM:PF04342"
FT                   /protein_id="ACT05267.1"
FT                   /translation="MSPLIITVFMLTLSNVFMTFAWYGHLRYFSGRTWMVAALVSWGIA
FT                   LFEYLLQVPANRIGYQVASAGQLKILQEVISLSVFIPFSMIILKEPFRTDYIWAGLCLL
FT                   GAVFFMFRDKIMG"
FT   gene            complement(426512..427051)
FT                   /locus_tag="Dd1591_0378"
FT   CDS_pept        complement(426512..427051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0378"
FT                   /product="Lipocalin family protein"
FT                   /note="PFAM: Lipocalin family protein; KEGG: eca:ECA3973
FT                   outer membrane lipoprotein Blc"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05268"
FT                   /db_xref="GOA:C6CI22"
FT                   /db_xref="InterPro:IPR000566"
FT                   /db_xref="InterPro:IPR002446"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR022271"
FT                   /db_xref="InterPro:IPR022272"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI22"
FT                   /inference="protein motif:PFAM:PF08212"
FT                   /protein_id="ACT05268.1"
FT                   /translation="MKHWRVLLTSLMTLFTTACSTTPPQGVQVVDNFEPSRYMGAWYEI
FT                   ARLDNHFERGLEQVTATYSPREDGGITVINRGFDPVQRVWRESIGKGYFTGSPQRAALK
FT                   VSFFGPFYGSYNVIALDNGYRYALVCGPNRNYLWILSRTPELPTLVRQALLAAAQRNGF
FT                   QTDKLIWINTNAGAGK"
FT   sig_peptide     complement(426989..427051)
FT                   /locus_tag="Dd1591_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.444 at
FT                   residue 21"
FT   gene            complement(427163..427519)
FT                   /locus_tag="Dd1591_0379"
FT   CDS_pept        complement(427163..427519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0379"
FT                   /product="fumarate reductase D subunit"
FT                   /note="PFAM: fumarate reductase D subunit; KEGG:
FT                   eca:ECA3972 fumarate reductase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05269"
FT                   /db_xref="GOA:C6CI23"
FT                   /db_xref="InterPro:IPR003418"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI23"
FT                   /inference="protein motif:PFAM:PF02313"
FT                   /protein_id="ACT05269.1"
FT                   /translation="MNNQQPKRSDEPPFWGLFGAGGMWSAMFAPVIILLIGVLLPLGMF
FT                   PQALSYDRIAAFSHSLIGRAFLLLMIVLPLWCGLHRIHHAMHDLKIHVPAGKWVFYGLA
FT                   AILSVVTIIGVVTL"
FT   gene            complement(427534..427929)
FT                   /locus_tag="Dd1591_0380"
FT   CDS_pept        complement(427534..427929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0380"
FT                   /product="fumarate reductase subunit C"
FT                   /note="PFAM: fumarate reductase subunit C; KEGG:
FT                   eca:ECA3971 fumarate reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05270"
FT                   /db_xref="GOA:C6CI24"
FT                   /db_xref="InterPro:IPR003510"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI24"
FT                   /inference="protein motif:PFAM:PF02300"
FT                   /protein_id="ACT05270.1"
FT                   /translation="MITKRKAYVRGMTPTWWQKLGFYRFYMLREGTAVPAVWFSIVLLH
FT                   GVFSLKAGPEGWGHFVGFLQNPLVLLLNIVALLAAVLHTKTWFDLAPKATIIIVKEEKM
FT                   GPEPVVKALWAATVVITLAVLAIALLF"
FT   gene            complement(427942..428676)
FT                   /locus_tag="Dd1591_0381"
FT   CDS_pept        complement(427942..428676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0381"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /note="KEGG: yen:YE0363 fumarate reductase iron-sulfur
FT                   subunit; TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; PFAM: 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05271"
FT                   /db_xref="GOA:C6CI25"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI25"
FT                   /inference="protein motif:TFAM:TIGR00384"
FT                   /protein_id="ACT05271.1"
FT                   /translation="MADMKTLKMEVMRYNPEQDNAPHFETYDVPYTRETSLLDALGYIK
FT                   DNLAPDLSYRWSCRMAICGSCGMMVNNVPKLACKTFLRDYTGGMKIEALGNFPIERDLV
FT                   VDMTHFIESLEAIKPYIIGNKRTPDQGPNTQTPAQMAKYHQFSGCINCGLCYAACPQFG
FT                   LNPEFIGPAAITLAHRYNLDNRDHGKKERMPQLNGDNGVWSCTFVGYCSEVCPKHVDPA
FT                   AAIQQSKVESAKDFMIAMLRPQ"
FT   gene            complement(428669..430465)
FT                   /locus_tag="Dd1591_0382"
FT   CDS_pept        complement(428669..430465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0382"
FT                   /product="fumarate reductase, flavoprotein subunit"
FT                   /note="TIGRFAM: fumarate reductase, flavoprotein subunit;
FT                   succinate dehydrogenase or fumarate reductase, flavoprotein
FT                   subunit; PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: eca:ECA3969 fumarate
FT                   reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05272"
FT                   /db_xref="GOA:C6CI26"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005884"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI26"
FT                   /inference="protein motif:TFAM:TIGR01176"
FT                   /protein_id="ACT05272.1"
FT                   /translation="MQTFNADLAIIGAGGAGLRAAIAAAEANPQLKIALISKVYPMRSH
FT                   TVAAEGGSAAVTQDHDSFDFHFHDTVAGGDWLCEQDVVDHFVQNCPREMTQLEQWGCPW
FT                   SRKPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLKYPQIQRFDEHFVLDILV
FT                   DDGHARGVVAINMMEGSLIQIRANAIVMATGGAGRVYRYNTNGGIVTGDGMGMAFRHGV
FT                   PLRDMEFVQYHPTGLPGSGILMTEGCRGEGGIMVNKDGYRYLQDYGLGPETPLGEPKNK
FT                   YMELGPRDKVSQAFWHEWRAGRTVSTPLGDVVYLDLRHLGEKKLKERLPFICELAKAYV
FT                   GVDPVKEPIPIRPTAHYTMGGIETDQQCETRIQGLFAVGECSSVGLHGANRLGSNSLAE
FT                   LVVFGRVAGEKAVERSQSAAPANAGALDAQAKDVEQRLHALMKQEGTESWAKIRDEMGL
FT                   SMEEGCGIYRTTDLMQKTVDKLAELKERFKRVKITDRSSVFNTDLLYTIELGHSLDVAE
FT                   CMAHSAINRKESRGAHQRLDEGCTERDDVNFLKHTLAFYNPEGAPRLEYSDVKITKLPP
FT                   AKRVYGAEAEAQEKNKKEQANG"
FT   sig_peptide     complement(430394..430465)
FT                   /locus_tag="Dd1591_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.895) with cleavage site probability 0.362 at
FT                   residue 24"
FT   gene            430873..431850
FT                   /locus_tag="Dd1591_0383"
FT   CDS_pept        430873..431850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0383"
FT                   /product="lysyl-tRNA synthetase-related protein GenX"
FT                   /EC_number="6.1.1.6"
FT                   /note="KEGG: eca:ECA3968 lysyl-tRNA synthetase; TIGRFAM:
FT                   lysyl-tRNA synthetase-related protein GenX; PFAM: tRNA
FT                   synthetase class II (D K and N)"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05273"
FT                   /db_xref="GOA:C6CI27"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004525"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI27"
FT                   /inference="protein motif:TFAM:TIGR00462"
FT                   /protein_id="ACT05273.1"
FT                   /translation="MSETVSWQPSAPVANLLKRASIMKEIRRFFSDRGVLEVETPAMSQ
FT                   ATVTDVHLFPFQTRFVGPGVADGMALYLMTSPEYHMKRLLAAGSGPIYQLCRSFRNEES
FT                   GRYHNPEFTMLEWYRPHYDMYRLMNEMDDLLQQVLECDGAEMLSYQQAFQRHLEVDPLS
FT                   ADKAQLREAAEKIGVGDVANREEDRDTLLQLLFAFGVEPQIGRDKPAFVYHFPATQAAL
FT                   AEISTEDHRVAERFEVYYKGVELANGFCELTDGKEQRQRFEQDNRKRAARGLPVQPIDE
FT                   NLLAALAAGIPPCSGVAVGVDRLVMLALNAESIGEVMAFTVDRA"
FT   gene            complement(431986..435309)
FT                   /locus_tag="Dd1591_0384"
FT   CDS_pept        complement(431986..435309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0384"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   eca:ECA3967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05274"
FT                   /db_xref="GOA:C6CI28"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI28"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACT05274.1"
FT                   /translation="MRLILIFLMGCLLSTTSPAAQLPDETQLKQDLQQAETNKSAPAQA
FT                   DIVKELQSALRLLDERRETRQRADQYQRAIDDFPKLTRDLRQQLEAEDAKPAAPPKTTS
FT                   VNDLEQQIVQLGSQLLEQSRQLQQEQDHQREISDSLAQLPQQQTEANRALSDVERRVQA
FT                   LGNPATPLGQAQLAALQAEAALRKSRLEELELAQLSASNRQELSRLQADVYKKRRDRLD
FT                   NQLQLLRSTLNTLRQREAEQALERTEQLAEQEGQLPAAVAGLLQTNRDLSMALNQQAQR
FT                   MDQIAARQRQTAAQTLQVRQALSTLREQAQWLGSSPALGETLRAQVARLPEMPKPQQLD
FT                   GDMAQLRAQRLHYEDQLNKLPANSEPARQDNGAPLTSAQQKIVNDQLRTQRDLLTSLIS
FT                   GCDTQILELTKLKVASSQLEDALIEIRDAAHRYLFWVADVDPIGFAYPLNLLRDLSRLL
FT                   SLDTLTQLSGAMLMMATSQSTLLPLLAALLLVGLSISSRRHYHAFLERASSRVGKVTLD
FT                   YFMLTLRTVFWSVMVAMPLPVLWAALGYGLQSAWPYPVAVAIGDSVTATVPLMWVVMVC
FT                   AAFSHRQGLFIVHFGWSPKQVARAMRYYRLSIGFIVPLVMALITFDNLNDREFSSTLGR
FT                   LCFILLCMALSLVTTSLKRAGIPLYLDKEGSGENPVNRAMWNLMICIPLIAALASCLGY
FT                   LTTSQALLARLETSVAIWFFLLVIYHIIRRWMWIQRRRIAFDRARQRRADMLAQRARGE
FT                   EEANPSSHEANGDVVEEPVVDLDAISARSLKLVRSILTLIALVSVIALWSEIHSAFAFM
FT                   ENISLWDVTSTVKGVESVQPITLGSVLIALLVFVITTQLVRNLPALLELAVLQHIELSP
FT                   GTGYAITTVSKYLMMLVGGLMGFSLIGIEWSKLQWLVAALGVGLGFGLQEIFANFISGL
FT                   IILFEKPIRIGDTVTIRDLTGSVMRINTRATTISDWDRKEIIVPNKAFITEQFINWSLS
FT                   DSVTRVVLTIPAPADANSQEVTTLLLDAVKRCSLVLDNPPPEVFLVDLRQGIQIFELRI
FT                   FAAEMGHRMPLRHELHQLILESYREHNLVMPFPPFQVRMDSVQVAGRNAATATRTAGGL
FT                   "
FT   sig_peptide     complement(435247..435309)
FT                   /locus_tag="Dd1591_0384"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.954 at
FT                   residue 21"
FT   gene            complement(435339..436253)
FT                   /locus_tag="Dd1591_0385"
FT   CDS_pept        complement(435339..436253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0385"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /note="KEGG: eca:ECA3966 phosphatidylserine decarboxylase;
FT                   TIGRFAM: phosphatidylserine decarboxylase; PFAM:
FT                   phosphatidylserine decarboxylase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05275"
FT                   /db_xref="GOA:C6CI29"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI29"
FT                   /inference="protein motif:TFAM:TIGR00163"
FT                   /protein_id="ACT05275.1"
FT                   /translation="MLDRIKIALQHLLPKVWLTQLAGWGADRQAGMITKLVIDLFARIY
FT                   KVNMQEAQQPDTASYRTFNDFFVRPLKPGIRPVDPLPNRLVFPADGAISQLGTIDDDRI
FT                   LQAKQHDYSLEALLAGNYIIADLFRDGLFVTTYLSPRDYHRVHMPCDGILRDMIYVPGD
FT                   LFSVNPLTAANVPNLFARNERVICLFDTPFGPMVQILVGATIVGSIETVWAGVVTPPRE
FT                   GIIKRWAYPMEGEGAVILEKGDEMGRFKLGSTVINLFVKDRIQFMPGLASQSVTRMGEA
FT                   MAEALDEDIQTRMSANDDTDTTP"
FT   gene            complement(436324..437373)
FT                   /locus_tag="Dd1591_0386"
FT   CDS_pept        complement(436324..437373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0386"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: eca:ECA3965 ribosome-associated
FT                   GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05276"
FT                   /db_xref="GOA:C6CI30"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI30"
FT                   /inference="protein motif:TFAM:TIGR00157"
FT                   /protein_id="ACT05276.1"
FT                   /translation="MSKKKLSKGQQRRVSANHQRRLKHVDSKVEWDDNQLGEPQEGIII
FT                   SRFGMHADVEAPDGKLHRCNIRRTIHSLVTGDRVVWRAGDETLAGISGIVEAVHPRQSV
FT                   LTRPDYYDGLKPIAANIDQIVIVSAILPELSLNIIDRYLVACETLEVEPLIVLNKIDLL
FT                   DDEGRAFVEEVMDIYRALHYRVLMVSSHAQQGVAELEAALTGRVSIFAGQSGVGKSSLL
FT                   NTLLYPDDAKILVNDVSDASGLGQHTTTAARLYHFPHGGDVIDSPGVREFGLWHLEPEQ
FT                   VTRGFVEFRDYLGSCKFRDCKHDTDPGCAIRAALERGEIAAERFDNYHRILESMAQVKT
FT                   RKSFSASDN"
FT   gene            437521..438063
FT                   /locus_tag="Dd1591_0387"
FT   CDS_pept        437521..438063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0387"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: spe:Spro_0424 oligoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05277"
FT                   /db_xref="GOA:C6CI31"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI31"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ACT05277.1"
FT                   /translation="MVNENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGPTL
FT                   AVHQSDSQLALMDEWNVRTHTASGLVERVKASAYDDRAAELETLRFLQQWVPAGKSPIC
FT                   GNSIGQDRRFLFRYMPELEAYFHYRYLDVSTLKELARRWKPEMLAGFKKRNTHQALDDI
FT                   RESVAELAYYREHFIQL"
FT   gene            438317..438392
FT                   /locus_tag="Dd1591_R0017"
FT                   /note="tRNA-Gly1"
FT   tRNA            438317..438392
FT                   /locus_tag="Dd1591_R0017"
FT                   /product="tRNA-Gly"
FT   gene            438643..439494
FT                   /locus_tag="Dd1591_0388"
FT   CDS_pept        438643..439494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pen:PSEEN0738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05278"
FT                   /db_xref="GOA:C6CI32"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI32"
FT                   /inference="similar to AA sequence:KEGG:PSEEN0738"
FT                   /protein_id="ACT05278.1"
FT                   /translation="MPSDFAHTFAQSRQVSVNNVNYSVFRRALGLLTVCVLAYHVQAQA
FT                   DDPLLLNPAHPGQLAVSSDNQARGIVVAVEQATISSDLAGRIVEMPFREGESFKKGDVL
FT                   ARFDCAIYQAQLAASQAAMRAAQAELDQNQQLAQLKSVGKHAVALSAARLAQAQAESQV
FT                   YQIQVNRCRIAAPFDGQVVKRRAQAYESVAPGAPVLDIVNNRHLEINLLVPSRWLPILK
FT                   SGLAFTFTPDETGTPLQARVARLGARIDESSQTLGLTGVIETQDAALMAGMSGTAHFPE
FT                   KP"
FT   sig_peptide     438643..438780
FT                   /locus_tag="Dd1591_0388"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.670) with cleavage site probability 0.657 at
FT                   residue 46"
FT   gene            439491..440810
FT                   /locus_tag="Dd1591_0389"
FT   CDS_pept        439491..440810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_0146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05279"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI33"
FT                   /inference="similar to AA sequence:KEGG:Pfl01_0146"
FT                   /protein_id="ACT05279.1"
FT                   /translation="MSTTPPVSSERIFARFLDIERQARSADAAEALAYCIVNDSQTLFG
FT                   FRHAALVINGTVRAVTGVTQPAPHAPFVAFIERACVQLQRAQRHEQCAVVEAAWLDQQS
FT                   RNDWLALSAPEVLWTPLKDRQGRLFGGIWYAREQPWQPAEQLLVEQLAHTFGHAWLALE
FT                   PQPVWRRTRRRWKLAVPLLVAVGCLFIPVRQSVLAPAEVIPLNGRVVAAPLDGVIQAFA
FT                   VQPNQGVRKGDLLVRFDDTTLKAQADVAERALNVAEAEYRASSQRAFQDTDSKARLDFL
FT                   AAQVAQKRAERDYANALLGRTEIRAERDGIAVFADAERWTGKPVRTGERLMDLADPASV
FT                   SLRIELDVGDAIRLEPNAPITLFLDSDPITPHGALLDRIAYESEQTPAGNLAYRLDARF
FT                   NGEPPRIGLRGTAKISGEYVPLAVYLFRRPLAVLRQSVGL"
FT   gene            440807..442930
FT                   /locus_tag="Dd1591_0390"
FT   CDS_pept        440807..442930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0390"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: pfo:Pfl01_0147 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05280"
FT                   /db_xref="GOA:C6CI34"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI34"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ACT05280.1"
FT                   /translation="MTNGGTGHFLPALRTDLQLVESATGLDGAPQWVLADPVTGRYFTL
FT                   TPSAIRLLRHWSLRHPQSVLEAANREPGLPLQGRELEQLLRFLRNHDLIAAGDPVQRQG
FT                   YAIKAAALRVSLWKTLLHQYLFFRIPLWRPDPVLNWCWPWLQRYGLLFLRVALPVILLL
FT                   GSFLVSRDWVRYTHSFPHLFSLQGMAAFGIALVFAKFIHELGHAFMAKRAGCRVQTMGV
FT                   AFIVLFPLFYTDVSDAWKLKDQRARLLISAGGILAELMLACVALLAWALLPDGPVRTAA
FT                   FMLSSATWITTLVVNLNPLMRFDGYFLLSDFWRVENLQERAYALCRWRLREVLFGYGHP
FT                   APQTWSPPMRRKLLIWGYASWIWRFFLFFGIALMVYHFFIKVVGIVLMSVEIGWFIALP
FT                   IVKEARIWWSMRKNAHPVSLLRSGLIVAAVLVSLLFPWRGSIRIPAVLEAENVSALYAP
FT                   IPAQVKALYVADGQQVQAGEKLLELTSSDLDYRINIERRQIAVLQQQRQRGAGRQETAS
FT                   ETQVLDRQLAESLARYRGLDAQRQRLSLTAPQAGQVRDMARDMTEGRWLTTDMPLLRVV
FT                   EQGAGKVQGYLPEDSLTRAKAGMTGAFIADDPAYPRLAVQLKDIAPTGTAWLQQEMLAS
FT                   DRHGPIAVRRDRDHNPQPVQAQYRVRFAVQEGQFSPPQQPLRGSVILEGEKESILGAVW
FT                   RRIAALGIRESGF"
FT   gene            443204..444118
FT                   /locus_tag="Dd1591_0391"
FT   CDS_pept        443204..444118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0391"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG: avi:Avi_5259
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05281"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI35"
FT                   /inference="protein motif:PFAM:PF07484"
FT                   /protein_id="ACT05281.1"
FT                   /translation="MKRAQRFFTQSAIAAALSVGMFLPQAALACNGAGDEFIGSVCYMA
FT                   IRYCPEGYLPADGRTLNVNGYQALYSLIGNIYGGTAPTTFSLPDLRGKTAIGTGTVATQ
FT                   SGNVTYTLGKAIGQETAIGNGSGSVVLNASQVPPHTHPATLSLSGTSSTVSLPLSGSIT
FT                   NLPFNAVASLGVTGIAKIGSSTTVSRSVNLTDKALLTSVSGPAALLYAPAGAANDRQLG
FT                   PDGSVTGTASGSVAGTASGGQLSGSAAGTVTLPLTGTVNVGANVTTPNPVVIPVSISVP
FT                   VRDPSLPLTACIAVTGLYPVNPG"
FT   sig_peptide     443204..443293
FT                   /locus_tag="Dd1591_0391"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 30"
FT   gene            444285..450290
FT                   /locus_tag="Dd1591_0392"
FT   CDS_pept        444285..450290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0392"
FT                   /product="Ig family protein"
FT                   /note="PFAM: Ig family protein; SMART: Dystroglycan-type
FT                   cadherin domain protein; KEGG: hch:HCH_03194 outer membrane
FT                   protein domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05282"
FT                   /db_xref="GOA:C6CI36"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="InterPro:IPR041690"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI36"
FT                   /inference="protein motif:PFAM:PF05345"
FT                   /protein_id="ACT05282.1"
FT                   /translation="MLWRHLFGNRYLFSNKRSNPARSVELTADMPLGYALEARMLFDGA
FT                   IAATVDQTNPAQNTTTATTDMAVHADDSHAQNSTGQTDSSSRDSGTKDTATKDTSTDGE
FT                   KVAVAGEAVQTHKEVVFIDTSVADYQTLVNQVPAGTDVVLLDSSKDGLTQMAAWAQTHS
FT                   GYDAIHIISHGSEGQVSLGTLTLNTTTAASRSADLATLGSALTNDGDLLLYGCDVASNT
FT                   GAEFLTKVADLTGADVAASTDATGASTLGGDWTLEAVNKDGIIDSHGLLFSHYSYLLDT
FT                   LTFGDTGHENEFSYGSSTFTRVVNSATITFTSVDAFGNATYSGRDYLYNSDSPNNQTEV
FT                   TLSVTGYTFDINSFKYYAESQSSSEVAPTVTIIVTYANNSTATASFLATQDSEQIVSNF
FT                   SFNNGQTTINDVISVTIKASNGSSIPSFGMQDLVINDVRAITSQDSTSTLTAGAASEAT
FT                   TFSTTATSVGSATSLMDFTITDTGASDGVATTVSALYANVSGSATSSELSQMTFLLSGP
FT                   DATNVVGTYNSGTGRVTFSGLNVSIADGGSETYTIKAYYNDNISSSDITDHHTVVLSIN
FT                   ASNVTTGSGSSTFAGSQANVTSGSGASIDVAATQLVYNQPPSTSVVSGINFTTQPVVYA
FT                   VDARGNIDTDFNSSVTLSENGSGSLTGTTQVTASNGIATFSGVKYTSASDADANFVLTA
FT                   ASGSLVSATSASINPDVVATRLVFSTQPVPTTIQNGQSTNFTTVPVVQAVDANGIVDQD
FT                   YTTNIVLSVTDPNDSVVDGTINSLTVTSGDNDGSATTVTLTPSGGIATYTGLIIQYTNS
FT                   GSANTLALRATSGGLTAINSSSITSTTNAAPVFSNLNGGATYTENGSAVVMDNNVTVAD
FT                   TELDALNSGQGNYNGASITIARNGGASSNDTFGNSGLLGALTQGQNFTYNGTTVGSVTT
FT                   NSGGTLTLTFNSNATSAMVDAVLQSLTYANSSDDPPASVTLNWTFNDGSLNSSGSNQAV
FT                   LSITPVNDAPVISNTSVSKTFNEDSAQTFSASDFGFSDVDSGDTLQSITIVTAPTAGEL
FT                   FIDANSDGVRGVGDTLLGDGAVVSAANIGKLTFRPAANANGAGYATFNWTVSDGTASSA
FT                   NMGTMTLNVTAVNDAPVISNTSVSKTFNEDSAQTFSAADFGFSDVDSGNTLQSITIVTG
FT                   PSVGELFIDANSDGVRGGGDTLLGNGAVVSAADIGKLTFRPTANANGAGYAAFTWKVSD
FT                   GTALSGNTGTMTLNVTPVNDAPTLSNGVTVTLTSTTEDVTSSATTVSSLLSNAGYGDVD
FT                   SGASSGIAITTTAGNGGWQYSTDSGANWFSIGTVSGSSALLLSSTAQVRYVPDSANGET
FT                   ATLGFRAWDQTSGTATAGASKGLADTSTTGGSSAFSTNNAQASLVVTSVNDAPTVGSPV
FT                   SLQSATKDTAFSFTVPGGTFVDVDSGDTLTLSATQSDGSPLPTWLSFNPSTRTFSGTPG
FT                   SNDVGNLTIRVTATDGSNASVSTTFGLTVNNSNLPPVVSVPVADQAIAQNGGFSFTVPA
FT                   GTFTDPDTGDTLTLSATQSDGSPLPTWLSFNPSTRTFSGTPGSNDVGNLTIRVTATDGS
FT                   NASVSTTFGLTVNNSNLPPVVSVPVADQAIAQNGGFSFTVPAGTFTDPDTGDTLTLSAT
FT                   QSDGSALPGWLSFNPSTRTFSGTPGNGDVGNLTIRVTATDGSNASVSTTFGLNVTNVND
FT                   APVVSGSLAAQTVAQNGGFSFTVPAGTFTDPDSGDTLTLSATQADGSALPGWLSFNPAT
FT                   RTFSGTPGNGDVGNLTIRVTATDGSNASVSTTFGLVVTGSTVDNGDPEFRINGGTSVPP
FT                   TATPVPVVTVAPAAPVTLGALFSSTSLGALNTGATADNATAASTIFQAAQRAPQVNNGA
FT                   PVSQIAGAFVQGVVSGSASLFDSSLGSFPSFNTGGALGGSSSLAGLFSGISLPSLSPMA
FT                   VFSGGSWRDINTNGANSSRLTTGLGAMQFAPDLEQQLQHLGDDTQQRLAAMEQALNDIG
FT                   QITRARQQG"
FT   gene            450348..451856
FT                   /locus_tag="Dd1591_0393"
FT   CDS_pept        450348..451856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0393"
FT                   /product="outer membrane efflux protein"
FT                   /note="KEGG: ppw:PputW619_0676 outer membrane efflux
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05283"
FT                   /db_xref="GOA:C6CI37"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI37"
FT                   /inference="similar to AA sequence:KEGG:PputW619_0676"
FT                   /protein_id="ACT05283.1"
FT                   /translation="MLKGRKLFSLSLIVVAMSGCAVTSQPISKQQSEQRIQQDKAAMFS
FT                   QQEPVTAPITLYDAMARALKYNLEARLKVMEQALSQQQLELARYDMLPQMAMSAGYVGR
FT                   SNTSASSSRSIQTGRQSLEPSTSLDQNRDVADLTMVWNVLDFGVSYVNAKQKADQRWIA
FT                   DERKRKVVHTIIQDVRSAYWRAVAAERLLGRIDSLIDRVNQAREASEHMSKQQVGDPIE
FT                   ALSYRRALIDAVRQLEEQRRALSLAKTELATLMNLPLDTPYTLAQPDSREMAVPQLNVD
FT                   FGTLEQTALLSRPELKEQDYQVRIHAAETRKSLLRMLPGLEVSAGGHYDSNSFMANQSW
FT                   ADVGVKVTWNLFNLLSGPTAYKTAQVNESVSEVQRQAMSLAIMAQLYIARANFNEALRQ
FT                   YKTSAELRSLDGQIAEQLRNRYQANSIGELQLIQGELNALNANLRQDLAYAELRNSYGQ
FT                   ILSTVGLDLLPKTLPSDRLADISQALRQSEANWQQGKIGALQSF"
FT   sig_peptide     450348..450419
FT                   /locus_tag="Dd1591_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.687 at
FT                   residue 24"
FT   gene            complement(451977..453569)
FT                   /locus_tag="Dd1591_0394"
FT   CDS_pept        complement(451977..453569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0394"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; KEGG: yen:YE0409 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05284"
FT                   /db_xref="GOA:C6CI38"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI38"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACT05284.1"
FT                   /translation="MLEKIKIKNGLYCVIAVFVLLLLAVCTFSLYSSIQSNQSIRKVNG
FT                   IEGEQLVPLYSAYSEMLNARLAGINVALAIEDKKDDATIQAGLERLGGYIAAANNTMAE
FT                   LRRVQAQTAEGQALRNDIDAVFNDYMNNAVAPMQASLRDRNIDRFYTTLVPIALEKGAV
FT                   FREKLARFVTLAKGIGNEEIAKADDFYQHTLTILIATLIVVILLSLFTLKFVRTVVLSP
FT                   MQKVRTYFGMMEQGVLTLDIPPQHNTEMGALMLSLKDMQQAFRKIVLDVRESASSVAAG
FT                   AEQISAANRDFAARTEAQASSVEQTAASMEQITASVQENTANTSKAMTLTSSVATLAEK
FT                   NSSNFSQMIERIQHIADSSNKINDIISIMDGIAFQTNILALNAAVEAARAGEAGKGFAV
FT                   VASEVRSLAQRSAGSAREIKELIEKTADEIAHGEKVASLSTQDMAQLMDEIKRVNEFMA
FT                   DISMASSEQAKGIEQVNTAITLLEQSSQQNAALVEESASASASLHEQARNLDDTMTFFN
FT                   LNDNPPVTIAALR"
FT   sig_peptide     complement(453471..453569)
FT                   /locus_tag="Dd1591_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.863 at
FT                   residue 33"
FT   gene            454364..456034
FT                   /locus_tag="Dd1591_0395"
FT   CDS_pept        454364..456034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0395"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; KEGG: yen:YE3615 putative
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05285"
FT                   /db_xref="GOA:C6CI39"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI39"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACT05285.1"
FT                   /translation="MSIIRNIRIKIMMLAILIIFTLLWGGVSFFSLYSLNSLTDEIGLT
FT                   NVQQINGDIINGASDRYYKVKLTMDEALAAEDNSSRERALLNEAAGDVEFLKGGLAQFK
FT                   VTDHANISTKSIDDIYNSSYQLFSEAIVPMLDAARQNNHDAYAKLMSEKYNPLRVKFTT
FT                   AINEYNQIIKNLKTEAQGRISAWVYWCKVTLIVAMIIGLGVVLLTDRYLAIHMGRPLEQ
FT                   VKAHLQILSNGQLDTSVDEMGRNEVGQLIPFVHTMQNNWIKTVAEIRRSASEIYHGSSE
FT                   IAAGNSDLSSRTEEQAAALSETAASMEQLSAVVKQNADNAQQASVLAKDASTAANNGGG
FT                   VVQAVSHSMQNITQSSQKIADIINVIDGIAFQTNILALNAAVEAARAGEAGRGFAVVAS
FT                   EVRSLAQRSAQAAKEIKTLIDESVDNVKNGYEQVSLASKSMEDILKSVTNVTDIMGEIA
FT                   SASSEQSKGISQVGTAITQMDSVTQQNAALVEQSSATSASLEEQAHHLNEIVAVFRLPG
FT                   VADASATRRVHKPAGKVAALTNLSTASAPQKSGDDWTSF"
FT   sig_peptide     454364..454483
FT                   /locus_tag="Dd1591_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.620 at
FT                   residue 40"
FT   gene            complement(456248..457144)
FT                   /locus_tag="Dd1591_0396"
FT   CDS_pept        complement(456248..457144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0396"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: spe:Spro_4199 putative DNA-binding
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05286"
FT                   /db_xref="GOA:C6CI40"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI40"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACT05286.1"
FT                   /translation="MSQNVKLHQLQSFVEVARHGSIRAASRQLNLSQPALTKSIQELEA
FT                   CLGARLFLRHRQGMVLTDCGEAYFRHASLIMEELRVAREDIQQRLGQASGRVNIGVGAS
FT                   VAHTVMPEVVSRFHRLYPQVKLRITEGQLVAMIHELRQGELDFTVNTYSGSAYDNELLY
FT                   EKLMEKEYCVVVRRDHPIQQARSLEDLLDYEWTMPTPRGSYYKQLFDLFATLPTTPRIS
FT                   VTCETLMSSVSLVAKTDFISILSRDVIRDPILGERLRVLELEQPLPKATFYLIQRKDTM
FT                   LSPMGTQLAKLFRLYCQ"
FT   gene            457304..458635
FT                   /locus_tag="Dd1591_0397"
FT   CDS_pept        457304..458635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0397"
FT                   /product="amidohydrolase"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; KEGG: spe:Spro_4200
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05287"
FT                   /db_xref="GOA:C6CI41"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR033845"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI41"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACT05287.1"
FT                   /translation="MHSDALYSDLSQRVAQLIPWLRETRRDLHKYAESGWLEFRTATRV
FT                   AEALHQMGYRLQLGREVINADARMGLPPDEVLQAQEQRALAQGALPQWLPYFSGGFTGI
FT                   VATLDTGRPGPVIGYRVDMDALDLNEQLADDHRPFRDGFASCNNGMMHACGHDGHTTIG
FT                   LGLAQVLMAMRDQLCGTIKILFQPAEEGTRGGKSMAEAGVVDDVDYFTAIHIGTGIPNG
FT                   HLVCGNDTFMATTKLDVSYRGVASHAGGRPEEGRNALLAAAQATLGLHAIPRHSGGSSR
FT                   INVGVLQAGTGRNVVPSHATMKVETRGATNEVNEFIYQQALKVIEGAALMHGVEVDVAL
FT                   MGAAQCSQPSPEWVAFIHRQAGLVGELTHIIDRKDGAAGSEDATYLMERVKAHGGLASY
FT                   AVFGTELSAGHHNEKFDFDESVMAVAVKTLALLALNIHAFGAAS"
FT   gene            458632..460083
FT                   /locus_tag="Dd1591_0398"
FT   CDS_pept        458632..460083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0398"
FT                   /product="amidohydrolase"
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; KEGG: spe:Spro_4201
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05288"
FT                   /db_xref="GOA:C6CI42"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017145"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI42"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACT05288.1"
FT                   /translation="MTQTIVEFVNDILAARERQLVAIADDIWDHPETRFTEHYSAERLA
FT                   GALEAEGFSVQRGVAGIDTAFVASFGSGRPVVALLGEFDALAGLSQQAGCAIPTPLAAG
FT                   GNGHGCGHNLLGTAGLGGVLAVKAWLEQHPQAGTVRFYGCPGEEGGSGKTFMAREGVFD
FT                   DVDAALTWHPETFSGMFCTPTLANIQAAFRFKGVAAHAAAAPHLGRSALDAVTLMNTGA
FT                   NFLREHIIPEARLHYAVTDTGGHSPNVVQADAEVLYLVRAPQIDQAQAIYERVVNIARG
FT                   AALMTDTTLTVRFDKACSNYVPNRTLEQAMYGFVQAFGVPAYSAQEQDYAADIVRTLSA
FT                   EDIASNLATLARTGGAAGQAFSRSLKGHALTTQVAPYAPTEAVLSGSTDVGDVSWLVPT
FT                   AQCFSPCYALGTPLHTWQAVAQGRTSLAHKGMLLAAKLMSATALALFTDGALLQASRQE
FT                   WQQQRQETPYRCPIPAGIRPSPLAH"
FT   gene            complement(460446..461435)
FT                   /locus_tag="Dd1591_0399"
FT   CDS_pept        complement(460446..461435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0399"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   transposase IS111A/IS1328/IS1533; KEGG: sea:SeAg_B4544
FT                   invertase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05289"
FT                   /db_xref="GOA:C6CEH4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C6CEH4"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACT05289.1"
FT                   /translation="MYYVGIDISKRVVDVCLLADGIKGKRKTKTLPNGPRAVEALAEWL
FT                   TRQKCDLGQAHIVMEATGIYHEHLAYGLHQSGIAVSVINPHRLREFAKGMGILTKTDKV
FT                   DAYVLACYGCLRQPEGWTPPSPEIRKLRALLQHRDSLLGDKQRLENRLSALSSTLTTEE
FT                   VMASLESMVQHVKGELERIEGLIADHIDKHPGLKNDLKLLKSIDGVGDQIGWNMLATIR
FT                   GSNFRSAEQVAAYLGVIPVERRSGTSVRGRARLSKIGPSAMRAKLYMGAIAAISHNHHV
FT                   KAQYERLLLKGKAKMLAIGAAMRKLVHLCYGVLHTQQPYDRNYGVVAS"
FT   gene            461843..463360
FT                   /locus_tag="Dd1591_0400"
FT   CDS_pept        461843..463360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0400"
FT                   /product="AbgT transporter family"
FT                   /note="TIGRFAM: AbgT transporter family; PFAM: AbgT
FT                   putative transporter; KEGG: plu:plu3724 putative
FT                   aminobenzoyl-glutamate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05290"
FT                   /db_xref="GOA:C6CI44"
FT                   /db_xref="InterPro:IPR004697"
FT                   /db_xref="InterPro:IPR011540"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI44"
FT                   /inference="protein motif:TFAM:TIGR00819"
FT                   /protein_id="ACT05290.1"
FT                   /translation="MSVTAESRQPGGLFQWVERVGNKIPNPFLLFVYLIAVLMAASALF
FT                   SWFGITATNPANGEVVRVKNLLSVEGLQWILPNVIKNFSAFTPLGAILALVLGAGLAER
FT                   VGLLQTLMYKMASRVSARYASYMVLFIAFFSHISSDAALVVMPPLGALIFLAVGRHPVA
FT                   GLLAAIAGVGSGFTANLLIVTTDVLLSGLSTESAKVINPAVHVSVIDNWFFMAASVFVL
FT                   TIAGALLTDKFIEPRLPSYQGERNENLSRLTPEQNRGLRASGIAALVFIAIVALLVVPE
FT                   WGPLRDPVKHTVMPSPFIQGIVPLIIAFFFVVSIPYGVVTGQIKSQNDLPQLMVDPMKG
FT                   MAGFIVMVFPLSQFVAFFNWSNMGKFIAIGLTDLLESLGMTGIPAFVGLIFLSAFLCMF
FT                   IASGSAIWSILAPIFVPMFMLLGFHPAFAQIVFRVADSSVIPLAPVSPFVPLFLGFLQR
FT                   YHKESQLGTYYSLVLPYPLVFFTVWLVLLLAWYLLGLPIGPGVYPHL"
FT   gene            463512..463982
FT                   /locus_tag="Dd1591_0401"
FT   CDS_pept        463512..463982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0401"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: eca:ECA3168 transcriptional regulator
FT                   of organic hydroperoxide resistance gene ohr"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05291"
FT                   /db_xref="GOA:C6CI45"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI45"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACT05291.1"
FT                   /translation="MNRKDTNTQPTLSDDAFQLDGQLCFALYSANLAMNKLYRRLLTEL
FT                   NLTYPQYLVMLVLWERDGITVSELGERLFLDSATLTPLLKRLQTAGLVTRRRGTEDERQ
FT                   VLIELTDDGRGLQDKAKAVPEGVFCASECNIEQLRAIKHDLETLRASLIRHI"
FT   gene            464103..464528
FT                   /locus_tag="Dd1591_0402"
FT   CDS_pept        464103..464528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0402"
FT                   /product="OsmC family protein"
FT                   /note="PFAM: OsmC family protein; KEGG: eca:ECA3167 organic
FT                   hydroperoxide resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05292"
FT                   /db_xref="GOA:C6CI46"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI46"
FT                   /inference="protein motif:PFAM:PF02566"
FT                   /protein_id="ACT05292.1"
FT                   /translation="MSIEKVLYVAHAQATGGRDGRAVSSDQQLDVKLTTPRELGGAGGE
FT                   GTNPEQLFAAGYSACFLGALKFVGARDKVSIPAGTTINGSVGIGAIPNGFGIEVELKIT
FT                   LPGLDRATAEDLVQKAHIVCPYSNATRGNIDVTLTVI"
FT   gene            464598..465608
FT                   /locus_tag="Dd1591_0403"
FT   CDS_pept        464598..465608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0403"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: psp:PSPPH_3647 lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05293"
FT                   /db_xref="GOA:C6CI47"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI47"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACT05293.1"
FT                   /translation="MRKSLVAALLVAIAGNAAAVDNNTPYAERHVRAFLDKLNAGGGKP
FT                   IEQLSPAEAREVLVSAQAGANLPTADVTQKTVTVDGQKIPLIIVKPAGSTGVLPVFMFF
FT                   HGGGWILGDYPTHERFVRDLVVQSGAAAVFVDYSRSPEVHYPVAIRQAYAATRWVAENG
FT                   KEIGVDGSRLALAGNSVGGNMVAAVAQQAKQAGTPRIRYQVMFWPVTDANFDTASYQQF
FT                   QKGYFLSRSMMEWFWDAYTTDSKQRRDVLASPLQGTREQLKGLPPALIQTAELDVLRDE
FT                   GEAYGRKLDAAGVDVTVTRYNGMIHDFGLLNALSDVPATRAALLQASTELRERLK"
FT   sig_peptide     464598..464657
FT                   /locus_tag="Dd1591_0403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            complement(465669..466487)
FT                   /locus_tag="Dd1591_0404"
FT   CDS_pept        complement(465669..466487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0404"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA2153 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05294"
FT                   /db_xref="GOA:C6CI48"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI48"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT05294.1"
FT                   /translation="MSEAIDLYSIARTAPRAVTHQGRIDIQGVGKWFGTHRALDNINLT
FT                   LPPGSVTVIIGPSGSGKSTLLRTINHLERVDEGTIRIDGDYIGYRRAGDTLYELKEREI
FT                   LRQRLGVGYVFQNFNLFPHLTVLENIIEAPRVHRLYRRAQAQSVALALLDRVGLRHKAN
FT                   AYPRHLSGGQQQRIAIARALALNPKVMLFDEPTSALDPELVGEVLDVIKDLARSGVTMV
FT                   IVTHEIGFAREVADQVVFMVDGKIVEHGDTHQVLNHPAHPRTVRFLNKVL"
FT   gene            complement(466506..467441)
FT                   /locus_tag="Dd1591_0405"
FT   CDS_pept        complement(466506..467441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0405"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: eca:ECA2154
FT                   putative ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05295"
FT                   /db_xref="GOA:C6CI49"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI49"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACT05295.1"
FT                   /translation="MTSSIPFVRHPADAPSPALRVVPARYPLRIAGTLFSLFIFAGVAE
FT                   SVALNGRWEWPVFASYFFNPVIVEGLGRTLLLTLLGTLFSIIAGTGLALAQLSSSALLS
FT                   TLAWLYIWLFRSLPLILVLIILYNFSYLYDALALGIPFTSIEFFRYPTIDALGPFAVAV
FT                   LGLTLVQSAYTAEIIRGGILGVDAGQFEAAAALGLPGYRRTWRIILPQALRSILPTGFN
FT                   EIISLAKGTSVVYVLALPELFYTVQVIYNRTQQVIPLLMVATVWYLVITSVLSVLQYFV
FT                   ERYVARGAVRETPTHPLRRLFQRLTAHRRR"
FT   gene            complement(467455..467985)
FT                   /locus_tag="Dd1591_0406"
FT   CDS_pept        complement(467455..467985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0406"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   eca:ECA2155 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05296"
FT                   /db_xref="GOA:C6CI50"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI50"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACT05296.1"
FT                   /translation="MSDERFIITDPEDPRITPVLDGLFAEYRQRYGDYFDHQDSEDHGL
FT                   YLPPDGIFIVLLRDERPIATGAFKRYDVATAELKRIWTDKTLRRQGLARRVLRELEHHA
FT                   RRLGYQELFLTTGFRQPEAVGLYLNEGYLPQFDTQLDPEYYSLPPHDGRLPFRKPLYEP
FT                   SASRAAQHERAVG"
FT   gene            complement(468015..468962)
FT                   /locus_tag="Dd1591_0407"
FT   CDS_pept        complement(468015..468962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0407"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   eca:ECA2156 ABC transporter, substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05297"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI51"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACT05297.1"
FT                   /translation="MQTLAVHSFYRLVATLFGGWLLLGSAQAAGIDLNANRQPIHAPKN
FT                   PQAIAQIPPGFRFVAPGKLTVAVAALGSSPPLAFLADDNKSLIGSEPDIARLVADSLGL
FT                   ELNLVATSWEDWPLGVASGKYDVAITNVTVTKARKERFDFATYRADTLGFYVKSSSKIQ
FT                   TIQSAKDIAGLKIIVGSGTNQEAILLDWDKQNQAAGLPLFQPVYVTDAAAANLSIQSGR
FT                   ADATFGPNVTGAYAAALHGQTRLVGTVNGGWPQVAHIAVTTRKGNGLVTALNTALNGVI
FT                   QGGEYDRVLNRWGESVERIDRSAINPPGLGDTPL"
FT   sig_peptide     complement(468876..468962)
FT                   /locus_tag="Dd1591_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.930 at
FT                   residue 29"
FT   gene            complement(469037..470413)
FT                   /locus_tag="Dd1591_0408"
FT   CDS_pept        complement(469037..470413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA2158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05298"
FT                   /db_xref="GOA:C6CI52"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI52"
FT                   /inference="similar to AA sequence:KEGG:ECA2158"
FT                   /protein_id="ACT05298.1"
FT                   /translation="MSEKTIPGNNTNPGRRQLRLGVILQGAAGNMSAWRHSSVVPDASI
FT                   NFGFVLDTVKKAEQGKFDFAFVADGLYINEKSIPHFLNRFEPLTLLSALAASTHHIGLV
FT                   GTLSTSYSEPFTTARQFASLDHLSQGRAGWNVVTSPLEGSAKNFSRARHPEHALRYRIA
FT                   DEFLQVVKGLWDSWEDDAFIRDQASGRFFDPQKLHPLNHQGEFFSVAGPLNIGRTPQGR
FT                   PIIFQAGASDDGKKLAASHADAIFTHQHTLTEAQAFYRDVKQQLAEHGRREDQLHIFQG
FT                   VSVLVGDDAEDVERQYQNTAALVTIEDALNYLGRYFEHYDFSQHPLDEPFPDIGALGQN
FT                   SFRSTTDEIKRNARERGLTLRQVALEATTPRPLFGGTPQQVADGLQLWFEQRAADGFII
FT                   QSATPDNFTRFVDQVVPLLQQRGVFRRDYPGYTLRESLALEYPVNRYAAARQPTEETAP
FT                   "
FT   gene            470837..471826
FT                   /locus_tag="Dd1591_0409"
FT   CDS_pept        470837..471826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0409"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   eca:ECA2161 putative luciferase-like monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05299"
FT                   /db_xref="GOA:C6CI53"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI53"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACT05299.1"
FT                   /translation="MDYRLGLLDQSPIAQGMTAADALAQTTALAGVAETLGYSRFWVSE
FT                   HHNSDVLAGASPEVLIAWLLAHTRHIRIGSGGVMLQHYSPYKVAENFHVLSSLAPERVD
FT                   LGVGKAPGGFPLSTRALQQETDPTRQVAFDDKLRQLNALLEAVPSDHDGLSATPLPPAP
FT                   PTRFLLGASADSARLAASLGWHFVFAGFIQPSERVLTEALLAWREYRPEHAQALLSLSV
FT                   VVAGSHDEAKALAGERYNYKVYIGDRAPLNVLTQEQADRLVQQSGSALFRIEKQAQNIL
FT                   YGTTQEVHHQLQYYHQRFGIDEFIIHTPIDDPTARLTSIRGLAAGLRG"
FT   gene            complement(471816..472406)
FT                   /locus_tag="Dd1591_0410"
FT   CDS_pept        complement(471816..472406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0410"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ent:Ent638_0389 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05300"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI54"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05300.1"
FT                   /translation="MSRQELYQKARALLDQLTGIEDDDSYQHDHTELPADDVRERLART
FT                   RQAAAFVNGAGTNPFSGLTYHQLSLIVYDDSGEFTLNERRAAWSEAYTQDQAWRRHIVT
FT                   QARLNYGHPHWQIHFFTAVLKNYRSLPAIEKAQYPRHYEREVQCHILPSGDRAHPLDFS
FT                   GLFNYPSLLEMLLAIRQDGARQETFSPEVNPIP"
FT   gene            473317..473392
FT                   /locus_tag="Dd1591_R0018"
FT                   /note="tRNA-Gly2"
FT   tRNA            473317..473392
FT                   /locus_tag="Dd1591_R0018"
FT                   /product="tRNA-Gly"
FT   gene            473621..475495
FT                   /pseudo
FT                   /locus_tag="Dd1591_0411"
FT   gene            complement(475648..475902)
FT                   /locus_tag="Dd1591_0412"
FT   CDS_pept        complement(475648..475902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0412"
FT                   /product="putative transcriptional regulator, Nlp"
FT                   /note="KEGG: pmr:PMI3401 sugar fermentation stimulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05301"
FT                   /db_xref="GOA:C6CI55"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI55"
FT                   /inference="similar to AA sequence:KEGG:PMI3401"
FT                   /protein_id="ACT05301.1"
FT                   /translation="MTMNKQDWHNADIIAGLRKKHTTLAALSRQAGLSSSTLANALTRS
FT                   WPKGEKLIADALGVEPAEIWPSRYFDDDGNKLERKIRNC"
FT   gene            complement(476340..477638)
FT                   /locus_tag="Dd1591_0413"
FT   CDS_pept        complement(476340..477638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0413"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: eca:ECA0932 permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05302"
FT                   /db_xref="GOA:C6CI56"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI56"
FT                   /inference="protein motif:PFAM:PF02133"
FT                   /protein_id="ACT05302.1"
FT                   /translation="MNSINDYPVSRVPVTARLPFLNVALVYLGMLTALDQFMLGAVLGH
FT                   SMSLDDAFLAIVIGSAIFGVVTLGLGYAGMKEGMSGSLLARWCGFGRVGSVLIGMTIAI
FT                   SLIGWFGVQNAVFAHSLNFALGDRLGFGWSAALSGGVLTLLVTFGFSALRYTARIAVPL
FT                   FILVVGYISVMTLTGHHFSQLLQGTGSGAAISVSAGATMVVGGCIVATLITPDLTRYVR
FT                   SGRHVFWITMLTIIVGEFVVNGLAILIARALNTADIVTIMSQTAGGIGLITVVFSTLRI
FT                   NDINLYSSALGVANAVEGMCGKKLGYKSITLIIGVIGTTLSVIGILDRFVDFLTFLGVF
FT                   FPPVIGVMLVDYYVLRSSRALLDISRQRGELPESTSHIGWSAIIASLAGAGIGLYTSWG
FT                   IPALNSLLVASMFYWLMKASTRYTLRTAVTETH"
FT   gene            complement(477663..478331)
FT                   /locus_tag="Dd1591_0414"
FT   CDS_pept        complement(477663..478331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0414"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: PAS fold-4 domain protein; regulatory protein
FT                   LuxR; SMART: regulatory protein LuxR; KEGG: yen:YE0514
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05303"
FT                   /db_xref="GOA:C6CI57"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI57"
FT                   /inference="protein motif:PFAM:PF08448"
FT                   /protein_id="ACT05303.1"
FT                   /translation="MDNLGGIMAVLNNLRDPWGIKGLDSRHVYMNAAAYAYTNTPKNFQ
FT                   VEGKLDAEFPVGWADFADEMVEHDRRTEQGDGERVVVIETYNWFDSRELAPYLCEKIPL
FT                   FSDQKEMIGTLWTSRPIRTLSPVYLSAKQRDPVEWTTCYEGPFSSAEMETLFLLLCQFT
FT                   KEEIAARMNLSKRTIDNRIQRMYQKAGVHNLRQFEEYCYQHKLHGYIPPNLLIKGTLFL
FT                   "
FT   gene            478529..478816
FT                   /locus_tag="Dd1591_0415"
FT   CDS_pept        478529..478816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0415"
FT                   /product="putative transcriptional regulator, Nlp"
FT                   /note="KEGG: spe:Spro_0470 putative transcriptional
FT                   regulator, Nlp"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05304"
FT                   /db_xref="GOA:C6CI58"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR038722"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI58"
FT                   /inference="similar to AA sequence:KEGG:Spro_0470"
FT                   /protein_id="ACT05304.1"
FT                   /translation="MEVKKDWHNADIIAELRKKGTSMSAVSRQAGLSSTTLANALFRPW
FT                   PKGEWLIAKAIGVPPEDIWPSRYFDNGELIDRKKRIRNRQPDTIYFSQAK"
FT   gene            complement(479110..479971)
FT                   /pseudo
FT                   /locus_tag="Dd1591_0416"
FT   gene            480420..480938
FT                   /locus_tag="Dd1591_0417"
FT   CDS_pept        480420..480938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0417"
FT                   /product="type VI secretion system effector, Hcp1 family"
FT                   /note="TIGRFAM: type VI secretion system effector, Hcp1
FT                   family; PFAM: protein of unknown function DUF796; KEGG:
FT                   eca:ECA2866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05305"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:C6CF09"
FT                   /inference="protein motif:TFAM:TIGR03344"
FT                   /protein_id="ACT05305.1"
FT                   /translation="MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVQGHEDEMLVQEFK
FT                   HIVTVPTDPQSGQPAGQRVHKPFKFTVALNKAVPLLYNALASGEMLPTVTLKWYRTSVE
FT                   GKQEHFFTTTLTDATIVDINNQMPHCQDPSKQDYTQLIEVSLAYRKVDWEHTVAGTSGS
FT                   DDWRAPIEA"
FT   gene            481104..482957
FT                   /locus_tag="Dd1591_0418"
FT   CDS_pept        481104..482957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0418"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; Rhs element Vgr protein; PFAM: Rhs element Vgr
FT                   protein; KEGG: eca:ECA2867 putative rhs accessory genetic
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05306"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI60"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ACT05306.1"
FT                   /translation="MANSTGLQFTVKVGALPDTTFAVVDFELSEALNQPFALSLNLASS
FT                   QPGIDFGAVLDQPCELLVWYEGELQRRVSGIVSRFAQGDTGFRRTRYQAEVRPALWRLG
FT                   LRTNARIFQTQKPDTIISTLLEEAGITDYAFALRHDHVVREYCVQYRESDLAFIHRLAA
FT                   EEGLFYFHEFEAGKHRVVFADDAGALTKGPELFFNLATQGLSEGAYVRRFRYAEAVSTA
FT                   EVALKDYSFKTPAYGLLHNKMSSELDHQRESYQHFDYPGRFKQDPSGKAFTGYRLDALR
FT                   AGAMTGAGESNAAELRPGSSFTLTEHPNPAFNLAWQVVAVTHSGQQPQALEEESGGEPT
FT                   TLSNSFEVVKATTTWRAAMPYKPMVDGPQIATVVGPAGEEIYCDEFGRVKLQFPWDRYG
FT                   ASDDQSSCWVRVSQGWAGGQYGLIAIPRIGHEVVVSFLEGDPDQPIVTGRTFHATNPSP
FT                   YPLPANKTRTSLRTSTHKGAGFNELRFEDQAGQEEVFIHAQKDMNTVVLNNRSTAVNAS
FT                   HTENVGGDQTVVVQHNQTVSVKENQVTEIQGEQTVAVTKNRNTTVDDNESLQVKNNIAI
FT                   QSQSGDILIATAGGFIAIDSEGNISITGKGLVLNGTRIDLN"
FT   gene            482971..483378
FT                   /locus_tag="Dd1591_0419"
FT   CDS_pept        482971..483378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0419"
FT                   /product="Domain of unknown function DUF1795"
FT                   /note="PFAM: Domain of unknown function DUF1795; KEGG:
FT                   eca:ECA2868 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05307"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:C6CF11"
FT                   /inference="protein motif:PFAM:PF08786"
FT                   /protein_id="ACT05307.1"
FT                   /translation="MYQMNEGTLAIPAGWRDESLHVFVLPGDTANLVVNRTPIEFGLSP
FT                   DTVYEQTLSQFSAHLKGYQERAAWELTLDGQPARGLEYSWRSPEGPMHQVVVMQVRGAL
FT                   LLTFTVTAAGELQDEQKTALLAVIETFKAAS"
FT   gene            483390..487817
FT                   /locus_tag="Dd1591_0420"
FT   CDS_pept        483390..487817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0420"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: YD
FT                   repeat-containing protein; PAAR repeat-containing protein;
FT                   KEGG: eca:ECA4278 rhs-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05308"
FT                   /db_xref="GOA:C6CI62"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI62"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACT05308.1"
FT                   /translation="MLNDILSRVARVGAMHAGNRPNPPADRPQPCQGKPPTSPGKTIKH
FT                   KSFLGALAGAVAGALVAAAVFTAAAAVAGAIAVAAIGTGGMGAALVVGVVKLAAGFGAV
FT                   SLLGGLIDAVSSKVSAMVDSGSPSFGPVMAGSGNVFVEKQPVARATKDTVACTRHNSPQ
FT                   LIAQGSESVFVNDAPAARIDDKTVCGATIKEGASTVFFGSGQGTYLEIAEEFTALQRAL
FT                   LIAVEFLVPPSRGMFRGLGKLFTRGPMAVLKGMRAGALKTLEGLKSAVKCASEGFRNSR
FT                   GLSRVTEAVRGFLKDPVYIASGEVIESRTDIALGQTLPLVFERTYRSASVHTGLLGRGW
FT                   HDSWSEVATVTRDGLNTHVVITLAQGYDIDFTFHQDVQAVYCPHYPEFTLHRRGDGFSL
FT                   WHRDQQTWRDFSVVQGERRLLSAIHDSHDNRIELVRDPKGYLRQVRHSDGVTLLLVWRG
FT                   EYLHQIQRIDGGQKTLLAEYRQDEQGRLVEANATHAYHLYYEYDAAHRLTRWHDNDQTW
FT                   ARYEYDTQGRCVYTTCADGFLTARFDYLPDRVVMTDGLGQRSEFGFNDLHLMSWEQSPL
FT                   GHVTRYEYDEVGNLLREISPAGRVVEFGYLDDTGRVSTFTDASGHQWRYDYDDALRLCG
FT                   VTDPLGREWRWVYDAEGNPERLTGPEASEVRFAWNRYGLLTQVSDAAGEVQARLQYDHR
FT                   QRLLSATDAESRTQQMRYDMQDRVVQWQRADGARFRLGYRRASWALPEQLIRPDDKEEQ
FT                   RQYDRHNNLLSYVDGNGALWRQSFGPFDLLTARTDAEGHTWRYAYDKESQQLTTVIAPD
FT                   GSRWQWWLDADGRVVRERDMTGTETHYGYDEDGLCVSVRNGEGDTRHFLYDARGLLLRE
FT                   TAPDDTLHYRYDAVGRLTEVSSATAHVQLDYDLRDRVVREWHNGTLLTRQVDDNARTVT
FT                   RTLTWDGDAGDTTGTLAPLTSLFHYTRTGELRQVQLPDGADLTLTYDAAGRESHRRGGS
FT                   GFVQQREYDVMGWLTREMSGAQHDGHLLAAQTREYRYDGAGNLTGVRHNRDAEGYRLDA
FT                   TGRVQAVLSGGAGKPVDTTARFHYTRTGLPQEAGRLTEWQAGRLVQHDDTHYQYDRAGR
FT                   LIRKQVVQPGYRPQVWQYRWDSRNQLRVVDTPTGERWLYRYDPFGRRVGKRCDQKAEET
FT                   RYQWDGDQIAEIRHYRHGQLVARRHWVYNGWELVVQQRQHTGGDWETDFVTSSQNGTPQ
FT                   ALFTPDGTLRWQAPTATLWGQRQAEKSESPDPGLAFAGQLRDSESGLCYNRFRYYDPAG
FT                   GCYVSPDPIGIAGGENNYGYVQNPMCWVDPFGLAGCSSYLNAWGGRNAKAFKNFWNNSS
FT                   HADFMKAWNNPAFKKNIKARLRGGGLTNSGGYHEWLPVSQGDKFKKMGFSFEEYMSLTS
FT                   PTNKVGFLDKFGNYGSHTSYTGGVTKASAQAHRDLINMAKLAQTKSGYLGAVQKWSGEH
FT                   LPFGQFDLPSGFWK"
FT   gene            487820..488224
FT                   /locus_tag="Dd1591_0421"
FT   CDS_pept        487820..488224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0421"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: esa:ESA_03890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05309"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI63"
FT                   /inference="similar to AA sequence:KEGG:ESA_03890"
FT                   /protein_id="ACT05309.1"
FT                   /translation="MYTNVAVWISESMTDDLAHALFSQESGISKFRNDFDIDHQSDFFD
FT                   EEHLIILYPEVSGGESIEDVGSNYLDRDFWSKVIGKLKKINASKVNYVLAVPDFKYSGK
FT                   KKEVDGVIFLGNFKYIESDNDVLKYFSDGF"
FT   gene            488695..488955
FT                   /locus_tag="Dd1591_0422"
FT   CDS_pept        488695..488955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05310"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05310.1"
FT                   /translation="MKCPIGDSILIMASDEGVLKPYELVEIPNKEALFQYAVGIKEYIS
FT                   DDELKNDLFLMLRGVVKKVPFAIPDHDQYENIFRVWESNFI"
FT   gene            489383..489618
FT                   /pseudo
FT                   /locus_tag="Dd1591_0423"
FT   gene            489756..491357
FT                   /locus_tag="Dd1591_0424"
FT   CDS_pept        489756..491357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0424"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; ATPase associated with various cellular activities
FT                   AAA_5; SMART: AAA ATPase; KEGG: eca:ECA3435 putative
FT                   sigma-54 dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05311"
FT                   /db_xref="GOA:C6CI65"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI65"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACT05311.1"
FT                   /translation="MPESRALSSGEYGTESAEESVPTSSFDLVLAMIRQKTEPDLCDWL
FT                   LSTVTSVWQPQGIILGLVDGCGRQLLCCGRVGDESVALALEVDDFSHPLAYALRENKAY
FT                   AWSSLNAGARIEHPLFQQVLSGLGADCGMYAIPLLSESGKVLGQLALLDTPERLQLWHD
FT                   GGEGNLLAQVFCNQLSLLRELAGAQQVRLTLRASVERERDEARQKALLTRIKDTLIGQS
FT                   SVMKALQQKVCQAAGHNLSVLIQGETGTGKDVVARLLHQCSVRADGPFVVINCAALPES
FT                   LIESELFGHQKGAFSDALSDKVGLVAQANGGTLFLDEVGDMPLSMQAKLLRVLETRCFR
FT                   PLGAEQEVHSDFRLVAATHHTLKQRVSDGAFRQDLYHRLCQCVLHVAPLRERTEDISLL
FT                   CHHFIAQCCEREQKTPGVLASSFLQQLCGYDFPGNVRELRNLLEVTCAHSSSGQPITMQ
FT                   ALPPDMQKRLTNELAQLDEGYQHVKDLGFSVRSFEAAVIEARLRQYGGDRQAAADSLNM
FT                   PSRTFNDKCLRMGITY"
FT   gene            complement(491443..493242)
FT                   /locus_tag="Dd1591_0425"
FT   CDS_pept        complement(491443..493242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0425"
FT                   /product="Relaxase"
FT                   /note="PFAM: Relaxase; protein of unknown function DUF1528;
FT                   KEGG: bpt:Bpet1092 putative helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05312"
FT                   /db_xref="InterPro:IPR011093"
FT                   /db_xref="InterPro:IPR011119"
FT                   /db_xref="InterPro:IPR022391"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI66"
FT                   /inference="protein motif:PFAM:PF07514"
FT                   /protein_id="ACT05312.1"
FT                   /translation="MFTLFQRKKPTPPKSDLVMPEKGLLRPEPAASLLATPRRQQLLEH
FT                   IWQRTSVSQKQFAWLYRAPFERYAELVQQFPASESHHHAYHGGMLDHGLEIVAFALKLR
FT                   QSRLLPVGSPPEDQAAQEEAWTAAVAYTALLHDIGKIAVDLHVEQEDGSTWHPWHGSLK
FT                   RPYRFRYREDREYRLHSAATSLLYHQVLDPRILDWLSSYPSLWASLLYVLAGQYEHADV
FT                   LGEIIVKADQASVAQALGGDPTKVMAAPKHALQRKLLDGLRYLLKEEFKLNQPQASDGW
FT                   LTQDALWLVSKTVSDKLRAYLLSQGIDGIPANNTVVFNVLQEHGVLQPTPDGKAIWRAT
FT                   ICNSSGWSHRFTLLKLSPALIWEASDRPAPFAGTVTIDVTPCDSSDSIPDATEPAISTS
FT                   PAFTATDFATAQATTAPHDVMDDMLAMLIPAEAPRTAPPDNNTSDIVTNKSTSVQASNA
FT                   PPQLEPTKLRSAEHFMEWLREGVQSRRIIINDAKALVHSVDDTVYLVSPGVFQRYAKEY
FT                   LQIGELAKQEKMQDWQWVQKRFERLQIHRKQANGLNIWACTINGPRKSRRLNGYLLSDP
FT                   RLIFSSPMPNNPYISLTSPLPSK"
FT   gene            493556..494524
FT                   /locus_tag="Dd1591_0426"
FT   CDS_pept        493556..494524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05313"
FT                   /db_xref="GOA:C6CI67"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI67"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05313.1"
FT                   /translation="MTKEFERDINVIRQELTGSELDQSRQETRSLKYYVRDIHNDLVTL
FT                   MYTRKDEREESHRNLEVALCVIGFIGVLLAITRSAENDFDWIREHTLSFRLWGVALCAI
FT                   FVGVSLERLSLVISLWSFTVTKVLLSIVLSGLVIYARGQAGIYVNHVFHVDASALPITL
FT                   LFTTGLMVFKLILPFIIVVAAAMFIINILFLLAWLKNKFDGGDSELPLLYPVLCVLVSS
FT                   VLLYHGRLWSNEQLSDARVPEKIYLLAHALDFNNSHQCANVPAGRPVVFLGNAQDVVLV
FT                   APYQSEGFDFTTFFEASVNVPQQFMRMRCEYKMAQALPEGE"
FT   gene            494726..495091
FT                   /locus_tag="Dd1591_0427"
FT   CDS_pept        494726..495091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0427"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pla:Plav_3432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05314"
FT                   /db_xref="GOA:C6CI68"
FT                   /db_xref="InterPro:IPR022213"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI68"
FT                   /inference="similar to AA sequence:KEGG:Plav_3432"
FT                   /protein_id="ACT05314.1"
FT                   /translation="MTMNSASHNSIAERFGRWLGRGWRVYARCEQQISGWFVEQGMPVK
FT                   GAFALLWMTKLTLLGLLLYVAFWLATLLIFVVAAALMANAAGFVDEPPKPEWRNGPAGF
FT                   GLYTYDDFRIDPHIEDD"
FT   gene            complement(495098..496621)
FT                   /locus_tag="Dd1591_0428"
FT   CDS_pept        complement(495098..496621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pla:Plav_3431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05315"
FT                   /db_xref="GOA:C6CI69"
FT                   /db_xref="InterPro:IPR012931"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI69"
FT                   /inference="similar to AA sequence:KEGG:Plav_3431"
FT                   /protein_id="ACT05315.1"
FT                   /translation="MTLFTTDYLEYYLTLVSWIVHNGIWAVLVSSGVFVLPFVAIIIDE
FT                   WLRARTEGADEGNKGVLSSMRIENRVWVAIVVVMFAGIPFIDVDLNTIRYDQARSAQCR
FT                   ISVPQPEDTGWSKSFSTLNNQSAKVPVWWAFMHALSRAITSASVSAIPCGTDLRQMRME
FT                   INATRIDDPVLAQEIADFTHDCYGPARAKLFMTRPNLDKTQMHDVTWIGSTYFVSTAGF
FT                   YDTYHARTPREGWAYDSHRDAGLAQVPSGAGYPSCRQWWSDGGNGLRARLLAQVDPSLL
FT                   NRIAGWAGFLSRTEVDDSVIRTIASPHQQKLNQGSVYTDYGGQIDKTLPNIVTRAAGDI
FT                   GMTVGGLAAFPALDVMRQGLPMVLALLKMALVICIPLVLLVGTYNLKTTITVSVVQFAL
FT                   FFADFWFQLARWIDSTILDALYGWGWGWNRPHGNVDPMAGLSNTFGDMLLNFVMGTMFI
FT                   VLPTFWIMALAWAGVRAGNVLQGFAGATADAKAAGAKGGDMVLKSVSKK"
FT   gene            complement(496633..496983)
FT                   /locus_tag="Dd1591_0429"
FT   CDS_pept        complement(496633..496983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0429"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet1504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05316"
FT                   /db_xref="GOA:C6CI70"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI70"
FT                   /inference="similar to AA sequence:KEGG:Bpet1504"
FT                   /protein_id="ACT05316.1"
FT                   /translation="MKFAWLQSHRLFSWRTPRVLLWIVSLLVITVTANVLGIHFVGSIA
FT                   GWEHWLADTAGYFLLWRLCLYGATVYGWLWMRRRLLLRETRTDDRRRLIRAEVFGVGAL
FT                   LVLEFSLLVQYV"
FT   sig_peptide     complement(496882..496983)
FT                   /locus_tag="Dd1591_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.881) with cleavage site probability 0.707 at
FT                   residue 34"
FT   gene            complement(496980..498380)
FT                   /locus_tag="Dd1591_0430"
FT   CDS_pept        complement(496980..498380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_0075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05317"
FT                   /db_xref="InterPro:IPR021204"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI71"
FT                   /inference="similar to AA sequence:KEGG:Neut_0075"
FT                   /protein_id="ACT05317.1"
FT                   /translation="MMKHLNPNAFSTPTLHLWQCALLVTALSMTSGLALAQDGGFQNSG
FT                   AVIGDEVMYSIGGGNAISMSSAASMRSIGVGVGWNSNLICGDMNISTTIQNQLNGLTNG
FT                   FQNIMSSVIQNATSAVASLPALIIQRADPGLYNLLTNGILQARLDFDRSKLTCRAMAER
FT                   MADTAGGQLGWSQIAEGMALRQAVSSTDAVSAIEQAEKNRGNDGVPWVGGDNAGGVGQH
FT                   SIKVIGDVTRAGYNLVNGRNVADTSSIDTASCQSLSCQTWASPQQAIDFATRVLGEQEQ
FT                   RTCEGCIRTETVPGVGLTPVIQEEYDTKLKVLQELVRGTRNTTFENLHDAGSTSLPITR
FT                   GVIEALRDEPDQDILARRLASEVALASVLEKALLLQRTLLTGQKEPNVAANRLAVAAVT
FT                   QESNTLDREILNLKTELELRRELASNSPMAIIQRHSVRSAGSRGIYEGDPVPNRLDQLQ
FT                   RRNPGGTP"
FT   sig_peptide     complement(498270..498380)
FT                   /locus_tag="Dd1591_0430"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 37"
FT   gene            complement(498388..499314)
FT                   /locus_tag="Dd1591_0431"
FT   CDS_pept        complement(498388..499314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0431"
FT                   /product="protein of unknown function DUF1527"
FT                   /note="PFAM: protein of unknown function DUF1527; KEGG:
FT                   eba:ebA2511 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05318"
FT                   /db_xref="InterPro:IPR009649"
FT                   /db_xref="InterPro:IPR026331"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI72"
FT                   /inference="protein motif:PFAM:PF07513"
FT                   /protein_id="ACT05318.1"
FT                   /translation="MRLPRCLHASILLTAASSSFALNTVAIISSSLSPDCLEYRVTGIC
FT                   YWLLCTPFGCSVRTSVKVRHYVPDAVVSSYGNTGKNPWIEVRAMSMPNTTAQDGGDGTS
FT                   NHSNEDNLSRFRNADVIGHPGGQAFSQFASSSGYICDGAGIAFMPYLLSTLDTVAWRYN
FT                   IPEVVYPEALIPGMREIGARATLNLWGSLYPRGGFLHQVDSYKASAVVAQRAGDIVTRR
FT                   GQLHVYQPLLANAHDGYWPAGALMENDASTGKWQELAPDLSSSCTVFPHNGPLTQAQQD
FT                   DYAWALWRPYSCCQRRGQTFLGSMDFN"
FT   sig_peptide     complement(499249..499314)
FT                   /locus_tag="Dd1591_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.755 at
FT                   residue 22"
FT   gene            complement(499311..499769)
FT                   /locus_tag="Dd1591_0432"
FT   CDS_pept        complement(499311..499769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0432"
FT                   /product="protein of unknown function DUF1525"
FT                   /note="PFAM: protein of unknown function DUF1525; KEGG:
FT                   ajs:Ajs_2183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05319"
FT                   /db_xref="InterPro:IPR011090"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI73"
FT                   /inference="protein motif:PFAM:PF07511"
FT                   /protein_id="ACT05319.1"
FT                   /translation="MINFAVLHMLASASIYSFSLHRLATVLLTALLSPLVQAADLLAVT
FT                   DTRHPMQNLGNTRLIELDRPSRIEAELAANLPKDPTYATAIVQQRLKEGGTALQQRINE
FT                   AYQNVVDAWSLGITTLPAVIVDQRYVVYGEPDVAKAVARIEAYTRTQQ"
FT   sig_peptide     complement(499653..499769)
FT                   /locus_tag="Dd1591_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 39"
FT   gene            499921..500532
FT                   /locus_tag="Dd1591_0433"
FT   CDS_pept        499921..500532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0433"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_0393 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05320"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI74"
FT                   /inference="similar to AA sequence:KEGG:Maqu_0393"
FT                   /protein_id="ACT05320.1"
FT                   /translation="MSTAQAIRERISAQLVGEPFTPAIFAGLGSRAAIDQALMRLTKAG
FT                   SIERIGHGLYVVPKVGRFGVKTLPAPEQIAQTLAEAEGATIEIHGAEAARRFGFSTQMP
FT                   TQAVFYTTGSSRVVRLGKMTVRLQHVASRKLALAGRPAGQALSALWYLGRHQVTSGTFQ
FT                   RIAQKLAPTEFQALCSAKASMPAWMLEALRGYERSEVTHV"
FT   gene            500525..501544
FT                   /locus_tag="Dd1591_0434"
FT   CDS_pept        500525..501544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0434"
FT                   /product="Domain of unknown function DUF1814"
FT                   /note="PFAM: Domain of unknown function DUF1814; KEGG:
FT                   maq:Maqu_0394 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05321"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI75"
FT                   /inference="protein motif:PFAM:PF08843"
FT                   /protein_id="ACT05321.1"
FT                   /translation="MSDTSGASYFDLTPVEQAELLNGLAPKLGRRAEILEKDIWLCQVL
FT                   GSLFALPCRKPMAFKGGTSLSKVYQAIERFSEDIDVTIDYRSLVPDVPVLDTLSGNQRR
FT                   KLSDTLREALAEHVTGELVPTLHEALLQALPNHEITIEISDNAEELRLYYPSAVENTDA
FT                   YLRPSVLIEFGGRNATLPQEMLTIVPDIGEHVPGLVFPTAKVAVLSPMRTFWEKATLIH
FT                   VECHRPDLRTGAARLSRHWYDLARLADHHIGRRALEDVALLQDVLNIKKTFFRSSSSHY
FT                   DLCLTGALRLIPDAALLDALRQDYQAMLNAQMFYGETLSFDSIVERLTRLEQQINQPR"
FT   gene            complement(501545..504394)
FT                   /locus_tag="Dd1591_0435"
FT   CDS_pept        complement(501545..504394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0435"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_0086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05322"
FT                   /db_xref="InterPro:IPR022303"
FT                   /db_xref="InterPro:IPR025955"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI76"
FT                   /inference="similar to AA sequence:KEGG:Neut_0086"
FT                   /protein_id="ACT05322.1"
FT                   /translation="MVWSLLRRKSAEVIKDALPDGWQHHVNTLQQAGIPEPGSTTRGNS
FT                   PATQADEQALYQVVPSLVELLPWVEYLPTSQSMLLEDGSSVAAFFELTPLGTEGREPSW
FT                   LAQARDALENALQDSFDEFDDNPWVLQLYAQDETNFDAYLQTLHRYIRPRAQGSRFTEF
FT                   YLHSMAHHLHAVAKPGGLFDDTTVTRLPWRGQMRRVRMVVYRRTTGGTARRGQTPEQGL
FT                   NVVCDRLTGGLTNAGIRAHRLDAAQIHDWLLRWFNPHPTLLGLGAEDRERFYQLTAYPN
FT                   TCDADEIELASGRDFSQRLFFSQPRSNADQGVWYFDDIPHRAVVTDRLRTPPDVGHLTG
FT                   ENHKGDAINTLFDQMPEDTVMCLTLVATPQDVLETHLNHLAKKAVGETLASEQTLADVQ
FT                   EARSLIGSSHKLYRASLAFYLRGRNEEELDSKGLQLANVMLGAGLQPVREEDEVAPLNT
FT                   YLRWLPCMYNPAQDRKQWYTQLMFAQHVANLSPTWGRSRGTGHPGITVFNRGGGLITFD
FT                   PFNRLDRQMNAHLFLFGPTGSGKSATLNNLLNQVTAIYRPRIFIVEAGNSFGLFCEFAR
FT                   RLGLTVNRVKLAPGAGVSLAPFADARRLIETPSDVQTLDADELDDERQSKGTEADEQRD
FT                   VLGELEITARLIITGGEDKEEARMTRADRSLIRQCILDAAQRGVTANRTVLTRDVRDAL
FT                   RERGHDTTLPEIRRARLLEMADAMDMFCQGSDGEMFDRDGTPWPEADITLVDLATYARE
FT                   GYNAQLSIAYISLINTVNNIAERDQFLGRPILNVTDEGHIITKNPLLSPYVVKVTKMWR
FT                   KLGAWFWLATQNIDDLPKAAEPMLNMIEWWICLSMPPDEVEKIARFRELTPAQKALMLS
FT                   ARKESGKFTEGVILSKNLEVLFRAVPPSLYLALAQTEPEEKAERYRLMQQCGISELDAA
FT                   FKVAEMIDHARGITPMVQR"
FT   gene            complement(504394..504831)
FT                   /locus_tag="Dd1591_0436"
FT   CDS_pept        complement(504394..504831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0436"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: net:Neut_0087 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05323"
FT                   /db_xref="InterPro:IPR022262"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI77"
FT                   /inference="similar to AA sequence:KEGG:Neut_0087"
FT                   /protein_id="ACT05323.1"
FT                   /translation="MHSNWTKSLAIMVTVTVLTSCATSKEELLPHGGRTMQDIWQQESG
FT                   NGGSPGQMAYRQLLDARQSLRRPLSHADVKTVSTEQESYTRTAANDVRSQFQRLPNPDL
FT                   LMYVFPHLAGTDPVPVPGYTTIFPLYQRVQYAMPGERTEDY"
FT   sig_peptide     complement(504757..504831)
FT                   /locus_tag="Dd1591_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.987) with cleavage site probability 0.703 at
FT                   residue 25"
FT   gene            complement(504812..506212)
FT                   /locus_tag="Dd1591_0437"
FT   CDS_pept        complement(504812..506212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0437"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: xcv:XCV2369 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05324"
FT                   /db_xref="GOA:C6CI78"
FT                   /db_xref="InterPro:IPR021207"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI78"
FT                   /inference="similar to AA sequence:KEGG:XCV2369"
FT                   /protein_id="ACT05324.1"
FT                   /translation="MPSNGLLKWLMIPVILLVLFVGIRIFSGHGTHTPDTADTGSQLTP
FT                   EEMKALGIEGDTPRDTVATLVAQVRQLRSELQTATADNRTQHEENQRLRQRESTIDQRI
FT                   NTALESERANLRRDQEQFSSERQQTEGLLADLQRRLDSIGSNGHADLPVGLGLRDGDAE
FT                   GFGNEAAIRWVEPDDARQTAGRNSNTARSFPTSFGPAQKTLDTTVESVTRASATGTKPA
FT                   RAVYTVPTNSTLMGSVAMTALIGRVPIDGTVNDPYPFKVLVGPDNLTANGIDIPDVAGA
FT                   VFSGTASGDWTLSCVRGQVRSITFVFHDGTIRTIPQDSEHSHQQSNDQNSLGWISDPYG
FT                   IPCVSGERRSNAQQYLGTQALITAAGAGAASLMDSKSSQMSYTGANGSIGTVGISSNEA
FT                   VGRILAGGVRDMSDWVNKLYGQAFAAVYVKPGAQVAVHLEKPLAIDYETEGRKVDHRTG
FT                   ESHAFELD"
FT   gene            complement(506202..507095)
FT                   /locus_tag="Dd1591_0438"
FT   CDS_pept        complement(506202..507095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0438"
FT                   /product="putative signal peptide"
FT                   /note="KEGG: har:HEAR2017 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05325"
FT                   /db_xref="InterPro:IPR021844"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI79"
FT                   /inference="similar to AA sequence:KEGG:HEAR2017"
FT                   /protein_id="ACT05325.1"
FT                   /translation="MKFRLIRLGLLTLVMASSAHAVEILRWERLPLAVPLTVGQERIVF
FT                   VEHNVRVGIPASIGDRLRVQSAGGAIYLRASKPIEPTRLQLQDVDSGALILLDIDAMPA
FT                   KEGEPKLEPVRIVEDNTTPPHYAQQLDSATKTPITEPDRPTQHETPVAVVLTRYAAQNL
FT                   YAPLRTVEPVPGIMRVNLRHNLPFDTLLPTLPVQATALVSWRLEDQWVTAVRLTHTEGG
FT                   WIRLDPRTLQGDFLAATFQHAALGPHGTPEDTTVLYLVTRKHGLSQSLLPAIQRVDPAV
FT                   HLPTSTPPTTEVNHAQ"
FT   sig_peptide     complement(507030..507095)
FT                   /locus_tag="Dd1591_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(507092..507772)
FT                   /locus_tag="Dd1591_0439"
FT   CDS_pept        complement(507092..507772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0439"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: net:Neut_0090 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05326"
FT                   /db_xref="GOA:C6CI80"
FT                   /db_xref="InterPro:IPR021548"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI80"
FT                   /inference="similar to AA sequence:KEGG:Neut_0090"
FT                   /protein_id="ACT05326.1"
FT                   /translation="MSRFKNEVIHLQAHIKTLRIGASALLLVALVMGVGWWSAPRDLTI
FT                   HIPPDLRSGSSRAWWEVPPESVYAFTFYVFQQLNRWPTNGEEDYARNLHALSPYFTPAC
FT                   LAFLQADYDYRRSTGELQQRVRGVYEIPGRGYGDNPAARVRVVSDRDWVVTLDLSADEY
FT                   HGPEQVKRALVRYPLKVARVDVDPVRNPFGLVLDCYDGVPQHISPPTQETPNRVGMGKQ
FT                   GETP"
FT   gene            complement(507769..508167)
FT                   /locus_tag="Dd1591_0440"
FT   CDS_pept        complement(507769..508167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ajs:Ajs_1403 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05327"
FT                   /db_xref="GOA:C6CI81"
FT                   /db_xref="InterPro:IPR021877"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI81"
FT                   /inference="similar to AA sequence:KEGG:Ajs_1403"
FT                   /protein_id="ACT05327.1"
FT                   /translation="MSAYPHVRADGTVTFLPHRLNRHPVVVRGLTADELWICCGLFGCA
FT                   GLLIGVPLSWLLSTIALAPTCIVLGITCGVFVGGGFLRRQKRGRPDTWLYRQLQWRITT
FT                   RYPLLTGWVGGHLLITRSGFWSNRRTIR"
FT   gene            complement(508180..508539)
FT                   /locus_tag="Dd1591_0441"
FT   CDS_pept        complement(508180..508539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1190 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05328"
FT                   /db_xref="GOA:C6CI82"
FT                   /db_xref="InterPro:IPR021356"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI82"
FT                   /inference="similar to AA sequence:KEGG:Bxe_A1190"
FT                   /protein_id="ACT05328.1"
FT                   /translation="MKHYRYPTRLVQRAALVLGLTTLPALSFAQGLPQLENPSRGTGGG
FT                   IMETIRNYGYDIVLLVALLVVASMFIGVCYHAYGTYAEIHNGKKTWGQFGLTVAVGAVL
FT                   LVIGIWLLTEATGIL"
FT   sig_peptide     complement(508450..508539)
FT                   /locus_tag="Dd1591_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 30"
FT   gene            complement(508558..508791)
FT                   /locus_tag="Dd1591_0442"
FT   CDS_pept        complement(508558..508791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_0093 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05329"
FT                   /db_xref="GOA:C6CI83"
FT                   /db_xref="InterPro:IPR021676"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI83"
FT                   /inference="similar to AA sequence:KEGG:Neut_0093"
FT                   /protein_id="ACT05329.1"
FT                   /translation="MTTSQISAFQANSSITPAAMSTVLTGIVFAVLLLWGAWAIRTAYV
FT                   GWAENQLNQRQFLGVIVRFLAMYLVLTFFLLS"
FT   sig_peptide     complement(508699..508791)
FT                   /locus_tag="Dd1591_0442"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.610 at
FT                   residue 31"
FT   gene            complement(508788..509165)
FT                   /locus_tag="Dd1591_0443"
FT   CDS_pept        complement(508788..509165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0443"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05330"
FT                   /db_xref="InterPro:IPR019110"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI84"
FT                   /inference="similar to AA sequence:KEGG:Neut_0094"
FT                   /protein_id="ACT05330.1"
FT                   /translation="MGISIYAGAVRYSAVLLIATFWMGTSLPVSADTPAQRQELAAALR
FT                   QLDALQRVVAQSAATTPLAPNERYYFDYPRLLDDLAHVRSGIQFYLSPSRAQPRDTTEL
FT                   NSDYRLESAPKHRSTSQEDQP"
FT   sig_peptide     complement(509070..509165)
FT                   /locus_tag="Dd1591_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.989 at
FT                   residue 32"
FT   gene            509418..509831
FT                   /locus_tag="Dd1591_0444"
FT   CDS_pept        509418..509831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0444"
FT                   /product="Domain of unknown function DUF1863"
FT                   /note="PFAM: Domain of unknown function DUF1863; KEGG:
FT                   mgm:Mmc1_3118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05331"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="InterPro:IPR036490"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI85"
FT                   /inference="protein motif:PFAM:PF08937"
FT                   /protein_id="ACT05331.1"
FT                   /translation="MPALKVYVGFISHAWKYHSEYEQLTEMLKEAPNFLFRNSSVPKTD
FT                   PIPTPITDEKLKAALDEQIRIANVVIILSGMYAAHSDWINTEIAIAAKYQKPIVGVVPW
FT                   GQQRIPEVVQTVAKEMVRWNTDSIVTAIRKHAM"
FT   gene            509859..511130
FT                   /locus_tag="Dd1591_0445"
FT   CDS_pept        509859..511130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0445"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo3763 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05332"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05332.1"
FT                   /translation="MRDYVGVGAESKLCFVVMGFGKKTDYETGRTLDLNATYREIIKPA
FT                   AIAAGLRCIRADEVMHSGHIDLPMYEMLLRADLVIADISTGNPNALYELGVRHALKPFS
FT                   TIIMKESKGKLHFDLNHTSTFTYDHLGEDIGASEARRAIQDLSNLINKVLDVQRPDSPV
FT                   YTFIPRLIQPKMSDEQIEALIQQSEHSEEQFAYVLESAESALRSDEFSAAIDNYSAALK
FT                   IKQGDTYIIQRLALATYKSELPSKISALVNALKIINELSPDDSNDPETLGIAGAIHKRI
FT                   WQVTQDVAELNLAIKYYGRGFDIRRDYYTGENKAICLNYRAELETDTVEKNYYNVSARK
FT                   VREELEDILDEIINSSSFEERSDQKWVLASMANVLLSLGRVDRANSFEKRFFDFESSGR
FT                   LAQWEIETFIAGKNAILKFTAQKV"
FT   gene            511335..512450
FT                   /locus_tag="Dd1591_0446"
FT   CDS_pept        511335..512450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sse:Ssed_3748 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05333"
FT                   /db_xref="GOA:C6CI87"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI87"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05333.1"
FT                   /translation="MGLFRCLFFHFIIEGSSLDQQINSLNQETSHRRTNALVFISHDTR
FT                   DAEIAEAFSRLLSSVSAGVLKSFRSSDKKGNQGIEYGVEWYPEIMKKLEASSDVVCLLT
FT                   PNSINRPWILFEAGVAKGKLDTPVHGVALGIGLNIAATGPFAQFQNLDDDVDSLTRLVI
FT                   QLVRRIPNSEPDHEVVKTQVEAFKKKITAFLERKSEIDVKEEENKDSSVAKIFEEIKVM
FT                   FRDLPARIEKRIDPDSPIARRRNRRVHPGMLDEIIHMSSKESGGNISILIVASFLKEDF
FT                   PWIYELALETYRKLESGHPGAFENLNQFFRIFERITHSPLFWEMGGRSKDRIFELEELM
FT                   MHSRHLLDRTLERQRRANKSGSMDEPEIGQE"
FT   gene            complement(512527..513276)
FT                   /locus_tag="Dd1591_0447"
FT   CDS_pept        complement(512527..513276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xcv:XCV2376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05334"
FT                   /db_xref="GOA:C6CI88"
FT                   /db_xref="InterPro:IPR022266"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI88"
FT                   /inference="similar to AA sequence:KEGG:XCV2376"
FT                   /protein_id="ACT05334.1"
FT                   /translation="MSDPAAAAQHQQTRRQSLLASVITLPFRLLGVLIGSLLISIIVEC
FT                   AGMNLFWKDQGWRHSQAMLQYELGHLSNNFTRSAIVQEPGRTAHQIVDTGYEWMFVKTG
FT                   LFERIKQIAERARAPSQTPKHDFRYSVSQVYIWLENYLIAAAFTTLTFMVRLLVLVLTL
FT                   PLILMAVFVGLVDGLVRRDVRRFGAGRESGFIYHRAKAALLPLAMLPWVTYLALPISVH
FT                   PLLILLPGAALLGFAVNLTVGSFKKYL"
FT   gene            complement(513273..515432)
FT                   /locus_tag="Dd1591_0448"
FT   CDS_pept        complement(513273..515432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_0098 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05335"
FT                   /db_xref="GOA:C6CI89"
FT                   /db_xref="InterPro:IPR022458"
FT                   /db_xref="InterPro:IPR022503"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032689"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI89"
FT                   /inference="similar to AA sequence:KEGG:Neut_0098"
FT                   /protein_id="ACT05335.1"
FT                   /translation="MAKSQPVEVLLRPAVELYTVAVCAGAVLLCLTAPWSLALSPDIGI
FT                   GSALAFVVFGALRWRDAQVILHYRRNIRRLPRYVMTSRDVPVSGQRLFIGRGFLWEQKH
FT                   THRLMQTYRPEFRRYVEPTPAYQLARRLEERLEFAPFPLSQLPRITTWDVPFNPVRPQP
FT                   PVGGLPRLHGIEPDEVDVSLPLGERVGHSLVLGTTRVGKTRLAELFITQDIRRKNHLGE
FT                   HEVVIVFDPKGDADLLKRMCVEAKRAGRENEFYVFHLGWPEISARYNAVGRFGRISEVA
FT                   TRVAGQLSREGNSAAFREFAWRFVNVIARALIELGQRPDYLLIQRHVINIDALFIEYAQ
FT                   HYFARTEPKAWEVIVQIEARLNENNIPRNMIGREKRVVALEQYLSQARNYDPVLDGLRS
FT                   AVRYDKTYFDKIVASLLPLLEKLTSGKIVQLLAPNYSDLSDPRPIFDWLQIIRKRAIVY
FT                   VGLDALSDAEVAAAVGNSMFSDMVSVAGHIYKFGIDDGLPGASADTKVPINVHADEFNE
FT                   LMGDEFIPMVNKGGGAGIQITAYTQTLSDIEARIGNRAKAGLVVGNFNNLFMLRVRETA
FT                   TAELLTKQLPKVEVYTTTVASSVTDSSDIHAKTDFTSNTQDRISLSSVPMIEPSHVVQL
FT                   PKGQCFALLQGGNLWKVRMPLPSPDPDEVMPTDLQQLAGYMRQSYTDAGQWWQNQGTPV
FT                   LQEQVLPPELLDENLDSTADQGRAP"
FT   gene            complement(515437..515979)
FT                   /locus_tag="Dd1591_0449"
FT   CDS_pept        complement(515437..515979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pla:Plav_3413 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05336"
FT                   /db_xref="InterPro:IPR021300"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI90"
FT                   /inference="similar to AA sequence:KEGG:Plav_3413"
FT                   /protein_id="ACT05336.1"
FT                   /translation="MTTHITTAYGFLLALTTVSPLLHAAQPPIVVVEDHGGASAMPYYE
FT                   ALNLQARSPNAPLSRITLPSVQVNPATEADMLPVRSPKLTPGTVARRVIDAPGLQPFFL
FT                   VGDDEASHVWLQRQGKSLRERKAIGLVVNVENEAGLAHLRAITPDLQFAPVAADDLAER
FT                   LGLQHYPVLITSTGIEQ"
FT   sig_peptide     complement(515905..515979)
FT                   /locus_tag="Dd1591_0449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(515976..516566)
FT                   /locus_tag="Dd1591_0450"
FT   CDS_pept        complement(515976..516566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0450"
FT                   /product="putative signal peptide"
FT                   /note="KEGG: har:HEAR2003 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05337"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI91"
FT                   /inference="similar to AA sequence:KEGG:HEAR2003"
FT                   /protein_id="ACT05337.1"
FT                   /translation="MAASALTSMRRRWILLVNILLSSLAQGQEIPPPAYQLAAQRAGIP
FT                   SVVLYVVALQESGVRRAERIVPWPWSLNVDGQSCRYASQVQACAGIHQALRDVPPTRID
FT                   VGLGQINLGWQKHRYRQPCDLLNPYNNLAIAAQILKEQYIPGEDWLLAIGRYHRPSGGT
FT                   PAARYRHGVSQHLQRVLGPQQAFTNTNSKETSP"
FT   sig_peptide     complement(516483..516566)
FT                   /locus_tag="Dd1591_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.982 at
FT                   residue 28"
FT   gene            complement(516548..517255)
FT                   /locus_tag="Dd1591_0451"
FT   CDS_pept        complement(516548..517255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0451"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: ajs:Ajs_1277 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05338"
FT                   /db_xref="InterPro:IPR022293"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI92"
FT                   /inference="similar to AA sequence:KEGG:Ajs_1277"
FT                   /protein_id="ACT05338.1"
FT                   /translation="MKRQMTLLIAATLTMSAMAQPPTTMQSRIVPVQGGQHRDERLAQE
FT                   WGLKTDEWQRYRELMEGPIGTYSPNLDPLSALGIEARSDEERQRYAELQVKAEARRVEK
FT                   LLAYQRAYDEAWQRLNPGMQRVSLPDAGLSRNAVTGNGRTAVFVKDNCQPCTQLVQRLQ
FT                   ASGTAFDLYMVGSHQDDALIRAWARGAQIDPEQVRNGTITLNHDAGRWLSLGLPGDLPA
FT                   SIRQVNGRWQRQP"
FT   sig_peptide     complement(517196..517255)
FT                   /locus_tag="Dd1591_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(517267..517917)
FT                   /locus_tag="Dd1591_0452"
FT   CDS_pept        complement(517267..517917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_0102 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05339"
FT                   /db_xref="GOA:C6CI93"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI93"
FT                   /inference="similar to AA sequence:KEGG:Neut_0102"
FT                   /protein_id="ACT05339.1"
FT                   /translation="MNNAPTSLKRTAAAISWFLIYAWVSVLTVFISLSYRAIADLAERK
FT                   QVDASLQQIRILEESVTELADSMRVLQTHTLPVSATALRELQQHVENRLAQIEQKQENQ
FT                   ASTQAVQTLRDEFEQLKSQQAVAIPNTATTSHIARPAATAPKKMPFPFRILGLELRAGQ
FT                   RMVSIAPASGEPAPTQIQVVFPGETVGQWRLKTIDGDTAIFSHAGQTHRLAIP"
FT   gene            complement(517914..518483)
FT                   /locus_tag="Dd1591_0453"
FT   CDS_pept        complement(517914..518483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0453"
FT                   /product="putative secreted protein"
FT                   /note="KEGG: ajs:Ajs_1279 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05340"
FT                   /db_xref="InterPro:IPR022260"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI94"
FT                   /inference="similar to AA sequence:KEGG:Ajs_1279"
FT                   /protein_id="ACT05340.1"
FT                   /translation="MSPTHSTRRLFVSHLLIIAALSSGCTTTTAPPPLPPIKAVSPVPD
FT                   ATSNFIPIVRYGRYTLVELAPNAAQHDLLLQIIDVAIPEDTRATVGDGLRHVLKRSGYQ
FT                   LCETAQSLIELYSLPLPAAHLHMGPMTLRDALLTLAGPAWDMQVDDRVRQVCFVRASTD
FT                   SEVSAAPSNLPAAKADTSALPSGGQP"
FT   sig_peptide     complement(518394..518483)
FT                   /locus_tag="Dd1591_0453"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.546 at
FT                   residue 30"
FT   gene            519035..520168
FT                   /locus_tag="Dd1591_0454"
FT   CDS_pept        519035..520168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0454"
FT                   /product="integrase"
FT                   /note="KEGG: mms:mma_3162 integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05341"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI95"
FT                   /inference="similar to AA sequence:KEGG:mma_3162"
FT                   /protein_id="ACT05341.1"
FT                   /translation="MKYCWLCPRPLEGENVTGEHVIPSAIGGHKEVFNFICRKCNSEHG
FT                   IKWEAEVARQFLWFSSTAAVKRGRGGKHPDLKVQTANGEKLRLRSDTMLVPDAPSYDVN
FT                   ELDDKIEITIRANDHKTVRNLVNKIAREYPEFEVQNALREVSMVNSYLDSPLALSFRYG
FT                   GPEAGRSMVKSCLSLLPDAGIEPDACGRALAYLKDSSPDAPRPFWIFFDADLVANRPQD
FT                   HLFHCVSVVGQPEQRRLLGYVEFFNFARILVHIGDGYEGEAFQATYAIDPVDAQVLDLS
FT                   VDFDLVPKCLEDIKMPAHPPQMYLDAFEAALRIVGIINGDRVRALAVSRAAADALKSVG
FT                   LDPATEEVPAELKEEWLKHFLNHLRPYLRSQLRRAMK"
FT   gene            complement(520325..521326)
FT                   /locus_tag="Dd1591_0455"
FT   CDS_pept        complement(520325..521326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA1658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05342"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI96"
FT                   /inference="similar to AA sequence:KEGG:ECA1658"
FT                   /protein_id="ACT05342.1"
FT                   /translation="MADTENSTSSTVSAMRFARVLMNVTYPIVSAYEFDFLQEEKVIRE
FT                   RWDASTIYLIVQRPLTYFDNVVLDDKYIRFEIADGEKPPLPCRINPVAAGICQVGESID
FT                   IQIGFYSNKANTKQPIRNVGALKLYRENGDFILWWSPQKLLYEILVKGLEVEIAEGFDP
FT                   YNFLDFKVHYIGKSFSQKVWNRLTGHNKMQRILTREREVGRAPEARAPFEISLVILQIT
FT                   GVDDMPIIGGDADHPMAGSNPIVHTLDDNDESLERFMTQSNVHLGDEALTCEVEAYLIN
FT                   LFKPTYNEILFNKYPNITGGMRSKGYSWTEVDLESVPAFLYTDCFSMVPKVD"
FT   gene            521692..522492
FT                   /locus_tag="Dd1591_0456"
FT   CDS_pept        521692..522492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05343"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI97"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05343.1"
FT                   /translation="MKDVWSSFIFIDFYTDKVREKVKKDEIEPFLLESLSGKLKRTHEK
FT                   NKVYTYGVADHVAKVVNPERSFITAVALTEDFLKDLMVTVYEEYPEKMLSTDALESIDR
FT                   QYKLLDTILAKATKEEIVASLIEEKVRGVFYGNPIDYFTKDKKAKLGFGNYFEKNHSLN
FT                   LKYFAEITARRNLFAHNRGRVDAKYLREVENPIIKAGQKAVIEKEYLRHTIIILRGLSA
FT                   VAALLVNKNIFKETQAHGTMKPVVEAFEKYYNDSIPPVKRAFSC"
FT   gene            complement(523485..525764)
FT                   /locus_tag="Dd1591_0457"
FT   CDS_pept        complement(523485..525764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0457"
FT                   /product="DEAD-like helicase"
FT                   /note="SMART: DEAD-like helicase; KEGG: net:Neut_0104
FT                   helicase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05344"
FT                   /db_xref="GOA:C6CI98"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C6CI98"
FT                   /inference="protein motif:SMART:SM00487"
FT                   /protein_id="ACT05344.1"
FT                   /translation="MSIQIEAAPAVTQSPETGDLFTPANAELAISLQDFVSEFGDELLD
FT                   SLNRANPPVYNGVPRANRQRILANLKRQLFPAQAEVVHAAAELLVNQGERSAIVNGEMG
FT                   TGKTTVGIALAAVLNAEGYRRTLVLSPPHLVYKWRREILETVTGARVWVLNGPDTLLKL
FT                   IKLREQLNVPADGQEFFIIGRVRMRMGFHWRPAFVRKRTRHGTVGLCPHCGTMINTLDG
FT                   EPVSALELDAEEVRRKCGFCKSALWTLMRPRSVSGSDQSAAVLRALKRIPTIGEATAAK
FT                   LMKTFGDSFLASMLGDNFHQFINLMDNRGELVFSDRQAQRMERAMSSMEFGFGEGGYQP
FT                   SEFVKRYLPQSTFDLLIADEAHEYKTGGSAQGQAMGVIAAKTRKTLQLTGTLMGGYASD
FT                   LFYLLFRALPERMIEDGYRPSTRGSMNAAAMAFMRDHGVLKDIYSESDGPSHKTAKGSK
FT                   ITVRTVKAPGFGPKGVLRCVLPFTIFLKLRDIGGVLPPYDEEFREVEMEAEQSDTYSKL
FT                   AASLTTQLKEALRKRDTTLLGVVLNVLLAWSDCCFRTETVRHPRTREVLAFIPAQFNEL
FT                   QVMPKEQELIDICKQEKAEGRKTLVYSVYTGTRDTTSRLKMLLEQEGFKVAVLRASVDA
FT                   SRREDWIAEQLDRGIDVLITNPELVKTGLDLLEFPTIVFMQSGYNVYTLQQAARRSWRI
FT                   GQTQPVKVIYLGYAATSQMTCLALMAKKILVSQSTSGDVPESGLDVLNQDGDSIEVALA
FT                   RQLVAA"
FT   gene            complement(525900..527009)
FT                   /locus_tag="Dd1591_0458"
FT   CDS_pept        complement(525900..527009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_0106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05345"
FT                   /db_xref="GOA:C6CIW6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIW6"
FT                   /inference="similar to AA sequence:KEGG:Neut_0106"
FT                   /protein_id="ACT05345.1"
FT                   /translation="MALMFPRLARNFAKNGYYPTDESTLERTLAALAPSDEPMCIIDPC
FT                   AGEGVAIAEAAHALGLDHTRSYAVEYDQERASHARLLVEHCIHADLMDTIISRQAFGLL
FT                   WLNPPYGDLSRDANGNIGYEGKGRPRLEKLFYQRTLPLLQYHGILVFIIPFYVLDQEMV
FT                   GWLTRHFAELSVFRAVDTQFKQVVLFGRRARQHDLASEDVKSTRARLLQIGQGEQDAEE
FT                   LPPEWTSLPYIVPGTQAEPEHFYRISIEPMQFAEEVQRLRGLWPAFDTHLGAAQQSLRA
FT                   PARALSEWHLALALAAGAISGVVQSKSGRTLAVKGDTYKQKVTSTEYCERDDGSIAETR
FT                   ILTDKFVPVIRAWDLSPDSATLGRILTIH"
FT   gene            complement(527079..527723)
FT                   /locus_tag="Dd1591_0459"
FT   CDS_pept        complement(527079..527723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: net:Neut_0107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05346"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIW7"
FT                   /inference="similar to AA sequence:KEGG:Neut_0107"
FT                   /protein_id="ACT05346.1"
FT                   /translation="MPESSLQQPLFRIDECTDLMVDACVCSENGDLVFVSIWARDTAVQ
FT                   QFIARLTLGHDEDGLNQFHLVTEHGGSVPVFIPSVERLEKRLTRNYRRTLFGSITNLWL
FT                   FDQRCICPDKSTASAFALLPRSATPTVRLWQLVKDTCPLPLLDHWQTPMLALLHSRNML
FT                   HKLPVALGPLQGFHLGLDVPALTDALGELIRNGVLTAYPSPSPVWIPQAVA"
FT   gene            complement(527842..528186)
FT                   /locus_tag="Dd1591_0460"
FT   CDS_pept        complement(527842..528186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0460"
FT                   /product="plasmid-related protein"
FT                   /note="KEGG: net:Neut_0109 plasmid-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05347"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIW8"
FT                   /inference="similar to AA sequence:KEGG:Neut_0109"
FT                   /protein_id="ACT05347.1"
FT                   /translation="MFTSDNTASSCVNGDPCAALNEQTWQRVCKTAAKDASKGCGLSYD
FT                   HYIALFSSSIDRHVDQLPEHQRAQALAIAREWNYATPVERQENQDWNAENGYCRHGLDP
FT                   NCCPAGCGEY"
FT   gene            complement(528277..528939)
FT                   /locus_tag="Dd1591_0461"
FT   CDS_pept        complement(528277..528939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rme:Rmet_2322 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05348"
FT                   /db_xref="InterPro:IPR021693"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIW9"
FT                   /inference="similar to AA sequence:KEGG:Rmet_2322"
FT                   /protein_id="ACT05348.1"
FT                   /translation="MATAAVQSDPPIIVRGQLTIRTISGRNGRFTVGRLITHLGLFHVK
FT                   DPELEQYPEGKYEGEFAIRYIYPKAYPVGDGMRFEIRASLNGMTLSGIDKLSKAEARAF
FT                   ATQDVDPLDEEPGTQPTPVPKSKARPASVQVSRDPLVDTTPFGVDAPSNAVTASGSPDS
FT                   DDAALFGILWPLGESVKLDSTIDRRTLRLQIARLSQLDYAFDATAQQWNRQSESLTT"
FT   gene            complement(529022..529915)
FT                   /locus_tag="Dd1591_0462"
FT   CDS_pept        complement(529022..529915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pla:Plav_3399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05349"
FT                   /db_xref="InterPro:IPR021960"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIX0"
FT                   /inference="similar to AA sequence:KEGG:Plav_3399"
FT                   /protein_id="ACT05349.1"
FT                   /translation="MVHSTSGEKAYFDLHTEGYGRLQRVREVPVRGGRRAQPFLACTIA
FT                   ALVGSAKEPVIRYFDVKVSGTEAKKLVEHYIGTDNAQQCPVVKFRLGDLWSDAFIRPGG
FT                   ERKGEPAASLKGRLLKAELIDPATLAAIEQYELITRGIGYLNRPIDVTPKEGDPFLTCT
FT                   IGALAGPVEEPEYRYINTIVTAPEAQHLVRRCVQAVEAQRKVLIAFRLNDMKANPYLRK
FT                   KGEHAGEPAASLESRLIHIGQIKIDGQRVYPTANQAPSESESPDNSADMPPTSSGTHEP
FT                   EAQFSAEEESALATSR"
FT   gene            complement(530420..530785)
FT                   /locus_tag="Dd1591_0463"
FT   CDS_pept        complement(530420..530785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebB76 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05350"
FT                   /db_xref="InterPro:IPR021436"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIX1"
FT                   /inference="similar to AA sequence:KEGG:ebB76"
FT                   /protein_id="ACT05350.1"
FT                   /translation="MTLRFKGAELRPVIAEAVANQCRIILVKDQGVYWLAEHGERHPDG
FT                   RQKLIAYAVGCNPDIDPFDDWWERSRAEFGSDDFGEFFEPRDKVFTRILDGAGDLDVSA
FT                   TATHISLQVVTTTLDSD"
FT   gene            complement(530934..531731)
FT                   /locus_tag="Dd1591_0464"
FT   CDS_pept        complement(530934..531731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA2454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05351"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIX2"
FT                   /inference="similar to AA sequence:KEGG:ebA2454"
FT                   /protein_id="ACT05351.1"
FT                   /translation="MDHQTIRNQMQSLVRDHVPSNARSFKFNIFDGQPKVSTLGFHIDP
FT                   KPFEGKIIARTEDAIIVKTGRIEFAVLDRTLVTEDPDEGAKVQVEPYARHRFDGLRADT
FT                   PEERTEYTADGTPYKLKTYILGSAPARLPIPQPRCPELQELIRQLEELPAPDGFRRITH
FT                   LLVDAGARDFTWVDPLPQDIIATPPAISFNTSTAKFDGRVTVQYERADDLYAVVLRHDG
FT                   KLVERVDGVFFDSLGEVLLRLIDDGSWRRIRVCTIQKPRRRKS"
FT   gene            complement(532114..533586)
FT                   /locus_tag="Dd1591_0465"
FT   CDS_pept        complement(532114..533586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0465"
FT                   /product="DNA-cytosine methyltransferase"
FT                   /note="TIGRFAM: DNA-cytosine methyltransferase; PFAM: C-5
FT                   cytosine-specific DNA methylase; KEGG: bxe:Bxe_A1222 C-5
FT                   cytosine-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05352"
FT                   /db_xref="GOA:C6CIX3"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIX3"
FT                   /inference="protein motif:TFAM:TIGR00675"
FT                   /protein_id="ACT05352.1"
FT                   /translation="MNTHHTSHMLQYGSVCSGIEAVSLAWEPLGLQAAWFSEVDPFPNA
FT                   VLAHRYPHIPNLGDITRIADRVQNGEVTAPDILVGGTPCQAFSIAGTRRGLNDPRGALT
FT                   LSYVELANVIDQTRIKNHQLPATLVWENVSGVLSDRSNAFGCLLGALAGESHALEPPGG
FT                   KWAHAGHVSGPRRCLAWRVLDAQYFGVAQRRKRVFLVASGRDDIDPCEILFERNSVCGD
FT                   SSAGSAPWQKATRTAGAGTAATGSDAGLNPYDKVAMTFGFGGGTGPVDVAVCLMAAGAK
FT                   HDICTENFLLQSVVAPLSHALNAATYGNVYREGSANNGIPMIAVTAQNSRADAVKGVPP
FT                   TLWARIGPAITFAQNRRGELCLETRYDQIAGSLLSNSGNPGQNQNLPTVFSIALRGSDK
FT                   SHALTQNREAHFHYTSLKPDRQHWPQWKVRRLMPVECERLQGMPDGWTQVPYRGKPAAD
FT                   TPRYKAIGNSMAVPCVAWLGQRLLQALQPSRL"
FT   gene            complement(534110..536122)
FT                   /locus_tag="Dd1591_0466"
FT   CDS_pept        complement(534110..536122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0466"
FT                   /product="DNA topoisomerase III"
FT                   /note="KEGG: xcv:XCV2287 DNA topoisomerase III; TIGRFAM:
FT                   DNA topoisomerase III; PFAM: DNA topoisomerase type IA
FT                   central domain protein; TOPRIM domain protein; DNA
FT                   topoisomerase type IA zn finger domain protein; SMART: DNA
FT                   topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05353"
FT                   /db_xref="GOA:C6CIX4"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIX4"
FT                   /inference="protein motif:TFAM:TIGR01056"
FT                   /protein_id="ACT05353.1"
FT                   /translation="MRLFLCEKPSQGKDIGRVLGTTQRGNGCLTGSGITVTWCIGHLVE
FT                   AAPPETYGEQYKRWSIEQLPIIPECWRVEVKSKTASQFNVVKELLSKATELVIATDADR
FT                   EGELIAREIIELCGYRGPIQRLWLSALNDTSIRKALSVLRPSDETLPMYFSALARSRAD
FT                   WLIGMNLSRLFTVLGRQAGYDGVLSVGRVQTPTLKLVVDRDREIARFVSVPFWAVEVVL
FT                   SSAGQHFTAAWLAPDTAADNAGRCLQEPIARQATERMRVTGSAQVTSVETEHMREGPPL
FT                   PFDLGTLQEVCSRQLGLDVQETLEIAQALYETHKATTYPRSDSGYLPESMFAEVPIVFD
FT                   SLLKTDPDLRPIVDLLDRNQRSRAWNDSKVTAHHGIIPTLEPANLAAMSDKERAVYTLI
FT                   RTHYLAQFLPHHEFDHTTAYLSCAGEMLQAVGKQVVLVGWRRVLTEPKPDDDGDTTSRS
FT                   QVLPPLNEGLSCQITGIDCKALKTSPPRPYTQGELVKSMKSVAKLVSDPRLKQTLKDTT
FT                   GIGTEATRANIIKGLLDRGYLLKKGRSVRASDAAFTLIDAVPGAIADPGMTAIWEQALD
FT                   MIESGQLTLDVFIDKQSAWIAQLIQQYRGASLSIQMPLGPACPECGTPMHQRPGKNGAF
FT                   WSCPRYPDCRGSLPIDSGKRKRTTPRKRNSSLQAS"
FT   gene            536253..536393
FT                   /pseudo
FT                   /locus_tag="Dd1591_0467"
FT   gene            536742..536996
FT                   /locus_tag="Dd1591_0468"
FT   CDS_pept        536742..536996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05354"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIX5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05354.1"
FT                   /translation="MAFYSSTNAVRLTDHAEQYERLRRVGTKPGSPGIYECQNCGFEDV
FT                   INRECEKLPPCSNCREESHDWKMIVKAVDADKKPNGPRG"
FT   gene            537161..537264
FT                   /pseudo
FT                   /locus_tag="Dd1591_0469"
FT   gene            537627..538796
FT                   /locus_tag="Dd1591_0470"
FT   CDS_pept        537627..538796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0470"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05355"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIX6"
FT                   /inference="similar to AA sequence:KEGG:XAC2263"
FT                   /protein_id="ACT05355.1"
FT                   /translation="MDKLSEKLPFDASKLFEALTYQLVVALEYCHKLEKGKRLWVEVYG
FT                   DVTLEDVAQVEVKLYADTLRDGHQNIWNTLNNWLNNAFDHQAYESLILLTNQEYSPKST
FT                   LTDWNSATAAEKLALLSAIYDDAEQRFAASKATEPSETLKLQRSVMGLAVRDELLEVLE
FT                   RAVFITGSPSLNERLHAYEVDKLRVIRESKRQTFIDEILGFIGSTRYINTGWEITCEEF
FT                   TAKFVELTKRYMKHSSIFPEVDTDSLKQKIDLDEIAGRHFVKKIREIGGETLVKKAALQ
FT                   LLIAGEVIDQLYSDNLASEFDVKRYQENHLVRHQNGRQSAMIDCMGETSPIQLQRQSLK
FT                   FFHNQHAATVVQLNTFEDTTVDFRNGIYHMLADVKTDDEDKAFYWRLWP"
FT   gene            538793..539254
FT                   /locus_tag="Dd1591_0471"
FT   CDS_pept        538793..539254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xac:XAC2262 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05356"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIX7"
FT                   /inference="similar to AA sequence:KEGG:XAC2262"
FT                   /protein_id="ACT05356.1"
FT                   /translation="MNLNAADHIYTLRRTPFALAPIIHSFYDHWDPIEKDILLSYLVLP
FT                   LVTYKPMHRFLHYAGKNSSLRTLMQEPSRVLGLEARIEEYKPITNASLLILTSEKSVKI
FT                   NDDMSVEPQGKIREENADAQLIKYARKLAIVFSGENVVSVYRSLGMKSL"
FT   gene            539251..541245
FT                   /locus_tag="Dd1591_0472"
FT   CDS_pept        539251..541245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppu:PP_4535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05357"
FT                   /db_xref="InterPro:IPR022205"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIX8"
FT                   /inference="similar to AA sequence:KEGG:PP_4535"
FT                   /protein_id="ACT05357.1"
FT                   /translation="MNCYVRYIGVVDKDDQLHAVEFTRGLNIITGKSSTGKSAILEIFD
FT                   YCLGSSEDTIPDGKLTERGKTFFTVLQFPTLTLVTGRAAASKRCFLREVTGPEADNILE
FT                   LMEHVEYFFDERHYIHKDPFLKNLGKFFGITLENIDTDPMYKQVTGAKGATPSVRSFPS
FT                   FMLQHQNLVANKHAIFYRFDEKVKRDQAIDHFKILMGIVKEDYFDVYKDLTEASYELRR
FT                   VKLKIPKDDKARDEIIAKFNRLLEQYQALAGKPLFDMTADEIFLKPKEALRLMLATPVS
FT                   VDGLADDYEKTLNSLRDQKAKLVAELRSAIGRLNLLERSVEQVKGIGTSYASLTVPRST
FT                   SFDHTFCPVCESHSDIPEDQANKLTLAIEWLNTELKLSSYARESLGQESRDLRNEIKEI
FT                   RQKLKNVQNSLKPFEEHEKRVAEASSLEDAPKKAKLLLEIAIDKFIENPPSDLKKMEEY
FT                   WAGQVKKYQELLDKYDVEIELDRLARDINKKMKEIGQRFHFEATYKKGALRFDVNTFDL
FT                   WHEKEAHKKVFLRSMGSGANWVYSHLTLFMALHYQFAAWGDKCAIPPILFLDQPTQVYF
FT                   PSKDEGEEFEAENLRAEDTQGVELHDDIDAVSNMFTQMAKFCDDTARETGVMPQIIVCD
FT                   HADGLDLGQDYNFKDFVRAKWRHRGFIAD"
FT   gene            complement(541353..541754)
FT                   /locus_tag="Dd1591_0473"
FT   CDS_pept        complement(541353..541754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0473"
FT                   /product="single-strand binding protein/Primosomal
FT                   replication protein n"
FT                   /note="PFAM: single-strand binding protein/Primosomal
FT                   replication protein n; KEGG: xac:XAC2211 single-strand
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05358"
FT                   /db_xref="GOA:C6CIX9"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIX9"
FT                   /inference="protein motif:PFAM:PF00436"
FT                   /protein_id="ACT05358.1"
FT                   /translation="MGTHFSGEGNIGSAPEFHEYPNDNEEPRRVLRLNVYFNNPVPGKD
FT                   GTFEDHGGFWQPVDWWHRDAEQFAELFQKGMRVVVSGRVERDDWTDENNNPRTTYRVNA
FT                   RSVGILPYRIEAIILSPKPGSADPLQPNE"
FT   gene            complement(541845..542375)
FT                   /locus_tag="Dd1591_0474"
FT   CDS_pept        complement(541845..542375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tmz:Tmz1t_0992 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05359"
FT                   /db_xref="InterPro:IPR021502"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIY0"
FT                   /inference="similar to AA sequence:KEGG:Tmz1t_0992"
FT                   /protein_id="ACT05359.1"
FT                   /translation="MITSTRFTMLEHTTFQQLEHAGYLKGLLKPFKGKGALDDWASQCE
FT                   ALRNNVIVLAQRQVLAQARSHPFNLLPVQLAQQATGAGTTFLRWRNLDRSSMGVALWQE
FT                   MMANPATPPGLIDDLYAIEVQRAVLNMQISLLHTLARQARDCASKLADADDAYLRRTGH
FT                   QAELNHPHPKGAT"
FT   gene            complement(542372..543190)
FT                   /locus_tag="Dd1591_0475"
FT   CDS_pept        complement(542372..543190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0475"
FT                   /product="Domain of unknown function DUF1845"
FT                   /note="PFAM: Domain of unknown function DUF1845; KEGG:
FT                   bpt:Bpet1294 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05360"
FT                   /db_xref="InterPro:IPR014996"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIY1"
FT                   /inference="protein motif:PFAM:PF08900"
FT                   /protein_id="ACT05360.1"
FT                   /translation="MASENSATEYLQLNLGSLRSAMSLTLHTHHASRIWHGRAATEGKP
FT                   GIVGLNGFVSIMNKLKRGAEQDDPYSDWWMLCIEDKLALTKEQLQILRQQVDQALADVP
FT                   PALSLGENMNVQPVKLPLFVSSQLGFMAVYLLADYDDLARRLILAHHTALIDRSTLEHW
FT                   LNDGAHALRSLFSLAQQYRYSGTRRDDFAANNAAARAAVEKFGELPQDVLEGTRRSRFA
FT                   PPLIRRGQTNTAQSGTTNQTPSQVDEAADTPADDSENPTEGVKDSEGDHV"
FT   gene            complement(543374..544588)
FT                   /locus_tag="Dd1591_0476"
FT   CDS_pept        complement(543374..544588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet1293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05361"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIY2"
FT                   /inference="similar to AA sequence:KEGG:Bpet1293"
FT                   /protein_id="ACT05361.1"
FT                   /translation="MTGGQPRTNGPIRLNELFDQAFAHLQPQSAKPVQSTSSPAATDGF
FT                   LFSGNHHDSVPRALLMDRRLTPLERNGWQVFRLMLAEDGITAMPTYDQLAPWLASMPCA
FT                   ARASHETVARTLTMLRLTRWISLVRRRRDPRTGRILGNLYVLHDDPLTPYEAIQLDADY
FT                   LALVSQSLTHTSKSIQRVGVYTLREISQDPMLSGQVLPTRLQVLTQRLAAQGWSMEPGY
FT                   PQNMNDRDSEEGTTSPLRNDGGQTSDSEAGLSARDINTLRNPKSISTVHTKENNKKILT
FT                   VPRAQGLGMLRLPERFMALRVEQQSGALTALQSVEPTLHQAVLDEWDARCTTTTIRNPA
FT                   GYLFGIIQKALRDDFRAWAGQKDSPQKTLATKPHNVPTPPQPPTVNRDVALAHLARLRK
FT                   LLDTP"
FT   gene            complement(544588..545148)
FT                   /locus_tag="Dd1591_0477"
FT   CDS_pept        complement(544588..545148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0477"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet1292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05362"
FT                   /db_xref="InterPro:IPR021364"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIY3"
FT                   /inference="similar to AA sequence:KEGG:Bpet1292"
FT                   /protein_id="ACT05362.1"
FT                   /translation="MTGPHPLNQAVIAQALHDLRNGQLRKAKSMGFDDTDLDALKHPAM
FT                   ASVLANANVSWCSVVVNRDVLRRLLHHVDHVTEEIVKIDRLLRLGASTELIGKFFGLTH
FT                   QEIALRRSVLGLPKRKGRHPVMTEEQDTDLWHRWAAAMKSQQVALNDDMHMLGIAADLA
FT                   EATDLPLSVIWSAIRGWIDEGQT"
FT   gene            complement(545160..546884)
FT                   /locus_tag="Dd1591_0478"
FT   CDS_pept        complement(545160..546884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet1291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05363"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR022304"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIY4"
FT                   /inference="similar to AA sequence:KEGG:Bpet1291"
FT                   /protein_id="ACT05363.1"
FT                   /translation="MPDISVQDLAGKLLNEGFTSKVQIAEVLSAPVAETAMIVTLDELS
FT                   PYEFNPRLTRNPLYDEIKASIRERGLDSPPTITQRPGAKGYIIRTGGNTRLSILRELWS
FT                   ETKDERFYRIPCLFRPWSERGEIIALTGHLAEDELHGGLSFIERALGVNKARELYEQEA
FT                   GKTLSQSELARRLKADGYPVSQPHISRMQEAIQYLLPAIPTVLYAGLGRHQVEQLTSLR
FT                   HAAERVWSACSTSAHHHINFITLFQDVLVMFDSTPENFSVQRVQDELIGQMADLLEMEY
FT                   DTLAFEITDSDRRWQLLSNEALLAESGVSTLQGKPPLSAATHEATSGPTQFSDAVSLTN
FT                   NKKSAPSASPPTEPVGHPPQGKSATENGGHAALLQQHVVSPASTTKRLQSIQRLVANHT
FT                   GETLPDFERNVLQSIPIQADSLYPITDIWYIETALDEPARLRTHIAQFAAEIAHEVGAK
FT                   DAIEPYENGIGFSCQYADDRVNTNTSASMALALLHALSTPYLPATHPISDTTSMMSFGQ
FT                   LGYLLQGIPDASNDANAAPQRLNDSALVKLFRLLRLARRLIDMENGRQDDNDGMSGS"
FT   gene            complement(546892..547137)
FT                   /locus_tag="Dd1591_0479"
FT   CDS_pept        complement(546892..547137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0479"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:ig_0609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05364"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIY5"
FT                   /inference="similar to AA sequence:KEGG:ig_0609"
FT                   /protein_id="ACT05364.1"
FT                   /translation="MSNASELARGHKQLLPLIEYALKEGWEVERTSGGHLKFTKPGMPP
FT                   IFTGSTASDYCAGRNARALLRRTRHQFATDESSPKK"
FT   gene            complement(547121..547828)
FT                   /locus_tag="Dd1591_0480"
FT   CDS_pept        complement(547121..547828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpt:Bpet1290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05365"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIY6"
FT                   /inference="similar to AA sequence:KEGG:Bpet1290"
FT                   /protein_id="ACT05365.1"
FT                   /translation="MQVIAVISTNGDVGKTAIAANPGSFVADAGLRVLLLNLDMQPTLP
FT                   SYYEMLSHVPGDIDELPAFNRQDLGKTVSRITINRLDLVLSNDDYPHLYTPLLHDPDGR
FT                   LRLYYLLLLLPVFQPHYDLVVIDTQRVRTVLLELELLMWQQAISPVTPEIPTAIPAEQV
FT                   GIHILDAGISAIKVFPRAATLCLPAHRVDANQTRFAREIMCHLATKLYPQWHEPLIQVT
FT                   GKTSGGYAYVKCQ"
FT   gene            complement(547862..548074)
FT                   /locus_tag="Dd1591_0481"
FT   CDS_pept        complement(547862..548074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0481"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG: bpt:Bpet1289
FT                   putative transcriptional regulator (phage-related)"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05366"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIY7"
FT                   /inference="protein motif:PFAM:PF05930"
FT                   /protein_id="ACT05366.1"
FT                   /translation="MFQQNTNLVPERRILRRAEVEAKTGFKRAHIYNLMKEGKFPKALH
FT                   LGVRAVGWDSAEIDQWITDRLKERT"
FT   gene            548271..548553
FT                   /pseudo
FT                   /locus_tag="Dd1591_0482"
FT   gene            548644..548748
FT                   /pseudo
FT                   /locus_tag="Dd1591_0483"
FT   gene            548778..548978
FT                   /pseudo
FT                   /locus_tag="Dd1591_0484"
FT   gene            549326..550252
FT                   /locus_tag="Dd1591_0485"
FT   CDS_pept        549326..550252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0485"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: eca:ECA3947 putative D-isomer specific
FT                   2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05367"
FT                   /db_xref="GOA:C6CIY8"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIY8"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACT05367.1"
FT                   /translation="MTPILLLDSRADELRDVLHDAAPDLTLFIGSGEPEQAAACDIWVG
FT                   EPDKAARLLAQGVKPRWLQSTWAGYRPLLATELPRDYRLSRAVGVFGQPIAEYVIAYLL
FT                   QHELHLSQRERSQQRGEWKKRLPGSLFGRRVLIVGAGDIGREVATFLQPFGVVLQGIAH
FT                   SPRALPMFERVEGLPALEQAVASADYVVNILPDTSATKDIYHAGIFAAMKPSALFINVG
FT                   RGTAVVDADLCTALHEGQIAGAVLDVFRQEPLPAAHPFWRTPNLTITPHVAGPLVPARL
FT                   GALFLDNLPRFQQGLALAGEVDFSRSY"
FT   gene            550466..550541
FT                   /locus_tag="Dd1591_R0019"
FT                   /note="tRNA-Gly3"
FT   tRNA            550466..550541
FT                   /locus_tag="Dd1591_R0019"
FT                   /product="tRNA-Gly"
FT   gene            complement(550826..551965)
FT                   /locus_tag="Dd1591_0486"
FT   CDS_pept        complement(550826..551965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0486"
FT                   /product="iron-sulfur cluster binding protein"
FT                   /note="TIGRFAM: iron-sulfur cluster binding protein; PFAM:
FT                   domain of unknown function DUF1730; 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain protein; KEGG: eca:ECA3940
FT                   putative 4Fe-4S binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05368"
FT                   /db_xref="GOA:C6CIY9"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIY9"
FT                   /inference="protein motif:TFAM:TIGR00276"
FT                   /protein_id="ACT05368.1"
FT                   /translation="MAYPYDLNELALLIKQWGLELGFQHVGICDTDLSHEEPRLQAWLD
FT                   KQYHGEMEWMARHGMMRARAHELLPGTLRVISVRMNYLPAKAAFASTLKNPHLGYVSRY
FT                   ALGRDYHKLLRQRLKKLGDRIQAHCGELQFRPFVDSAPIMERPLAAKAGLGWVGKHSLV
FT                   LNREAGSWFFLGELLIDLPLPVDQPVEEQCGKCVACMTTCPTGAIVEPYTIDARRCISY
FT                   LTIELEGAIPEGLRPLMGNRIYGCDDCQLICPWNRFSQLTDEPDFSPRAALHAPELLEL
FT                   FSWDEARFLRVTEGSAIRRIGHERWLRNIAVALGNAPYEDKIVLALQNRLGESVLLDEH
FT                   IQWAIRQQRARREQHTVDVQLPQKKRLIRAVEKGLPRDA"
FT   gene            552176..553717
FT                   /locus_tag="Dd1591_0487"
FT   CDS_pept        552176..553717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0487"
FT                   /product="carbohydrate kinase, YjeF related protein"
FT                   /note="TIGRFAM: carbohydrate kinase, YjeF related protein;
FT                   PFAM: protein of unknown function UPF0031; YjeF-family
FT                   domain protein; KEGG: eca:ECA3939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05369"
FT                   /db_xref="GOA:C6CIZ0"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIZ0"
FT                   /inference="protein motif:TFAM:TIGR00196"
FT                   /protein_id="ACT05369.1"
FT                   /translation="MHQDQRVYQPGGSSPDLPHTVFLPDWLRREEPQAAESVGVSLHRL
FT                   MQRAGDAAFRIARRQYPAARHWLILCGHGNNGGDGYVVAALARAAGITVTVIAASSERP
FT                   LPPQAYLARQAWRDTNGSEQPGDAPWPDGVDLIIDGLLGTGLTSAPRAPYDALIVQANR
FT                   HPAPIVALDIPSGLNAQTGVYAGAVIHAAHTVTFIALKPGLLTGQARDVVGRLHFHDLG
FT                   LSDWLAQQTAPITRLSAASLTQWLKPRRPGAHKGEHGRLLIIGGDDGTGGAVFMAGEAA
FT                   LRSGAGLVRVLTHKNYLAALLVSRPELMAQELTTDTVKAGIAWADVVVIGPGLGQREWG
FT                   KNALRIVENCNKSMLWDADALNLLAISPYKRQNRVLTPHPGEAARLLNCRVADIESDRL
FT                   LAAQRLVKRYGGVVVLKGAGTVLASEQGALSIADVGNPGMATGGMGDVLAGMIGAMLAQ
FT                   GLSLYDAACAGCVAHGAAADWLAQRQGTRGMLATDLMAVLPQYVNPERISLENTE"
FT   gene            553714..554196
FT                   /locus_tag="Dd1591_0488"
FT   CDS_pept        553714..554196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0488"
FT                   /product="protein of unknown function UPF0079"
FT                   /note="PFAM: protein of unknown function UPF0079; KEGG:
FT                   spe:Spro_0427 putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05370"
FT                   /db_xref="GOA:C6CIZ1"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIZ1"
FT                   /inference="protein motif:PFAM:PF02367"
FT                   /protein_id="ACT05370.1"
FT                   /translation="MKTLLLPLPDEAATIALGAALAKACERATIIYLLGDLGAGKTTLS
FT                   RGFLQALGHQGNVKSPTYTLVEPYALLPRPVYHFDLYRLADPEELEFMGIRDYLSQDAL
FT                   CLIEWPQQGAGILPDADVELLLSYQGAGRQAEITARTPQGERMMATLIAQSEQDAS"
FT   gene            554193..555875
FT                   /locus_tag="Dd1591_0489"
FT   CDS_pept        554193..555875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0489"
FT                   /product="cell wall hydrolase/autolysin"
FT                   /note="PFAM: cell wall hydrolase/autolysin;
FT                   Peptidoglycan-binding LysM; SMART: cell wall
FT                   hydrolase/autolysin; Peptidoglycan-binding LysM; KEGG:
FT                   eca:ECA3937 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05371"
FT                   /db_xref="GOA:C6CIZ2"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIZ2"
FT                   /inference="protein motif:PFAM:PF01520"
FT                   /protein_id="ACT05371.1"
FT                   /translation="MTVRLINALSGLLLVLSWPLWASSLTDIRVNNAAGEAVVTLSFSG
FT                   QPVYEYFSLDNPSRIVIDISQSGVIKGLPLAFNGQNLISRIRSSNAKDPKSLRLVLDLT
FT                   QKVQVKSAKEGNGAVFTLTGERKPSARKPVVQSAQPSAQAGRNPLVPQSSSAAVAAAPT
FT                   RVSGRAGNGEKIIVAIDAGHGGQDPGASGPGGLHEKNVTISIARKLRAIMSADPAFKPV
FT                   LTRDGDYFISVMGRSDVARKQGANLLVSIHADAAPNRGATGASVWVLSNRRANSEMANW
FT                   LEQHEKQSELLGGAGDLLANSAADPYLSQAVLDLQFGHSQRVGYDVAVKVLRELQRVGS
FT                   LHKRRPEHASLGVLRSPDIPSLLVETGFISNPSEERLLGSNEYQEKIANAVYQGLRSYF
FT                   QTHPLQNVPKQENRPLAPQTVKQTTTAEPAQIATGTTLRHTVATGETLSGIATRYGVSM
FT                   DAIREINRLKKDVVWVGQRLKIPAGASSVATAKAASKGKNAATAPAPQAKKSATVIKHK
FT                   VVRGDTLSDIAARYGVSMKAIQQANNLSSGTVQLGQTLIIPSA"
FT   sig_peptide     554193..554261
FT                   /locus_tag="Dd1591_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            555899..557848
FT                   /locus_tag="Dd1591_0490"
FT   CDS_pept        555899..557848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0490"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /note="TIGRFAM: DNA mismatch repair protein MutL; PFAM: DNA
FT                   mismatch repair protein domain protein; ATP-binding region
FT                   ATPase domain protein; MutL dimerisation; KEGG: eca:ECA3936
FT                   DNA mismatch repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05372"
FT                   /db_xref="GOA:C6CIZ3"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIZ3"
FT                   /inference="protein motif:TFAM:TIGR00585"
FT                   /protein_id="ACT05372.1"
FT                   /translation="MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDID
FT                   IERGGAKLIRIRDNGCGIGKADLALALARHATSKIATLDDLEAIVSLGFRGEALASISS
FT                   VSRLTLTSRTEAQAEAWQAYAEGREMAVTVKPAAHPVGTTLEVLDLFYNTPARRKFLRT
FT                   EKTEFMHIDEVVRRIALARFDVAITLHHNGKLIRQYRAVSEPAQRERRLGSICGAAFLQ
FT                   HALAVSWQHGDLNIHGWVADPVGSRQLPEMQYCYVNQRMMRDRLINHAIRQAYQDQLRD
FT                   EQQPAYVLYLEVDPHQVDVNVHPAKHEVRFHQARLVHDFIYQAVMTVLQQAASPRLSGV
FT                   GDAQAAAATWQPENRIAAGENHFARPAVQKQDMPEAVPPAKTAGAAGRQVREPQPPRTQ
FT                   ATGYQKKQGELYQQLLHTESSRPHSVARDTSPEKDSPAKDSPAVRRETPEKTAVAAESL
FT                   SLESHALGLGRVLAVYPPAYALVEYRQGPALLSLTVAERYLRQAQLTPSASGEGLRPQP
FT                   LLIPQRLTLNASELAVMQQQLPLLTLMGIEVELSPPRATLRAVPLPLRQQNLQNLISDL
FT                   LGYLADSHDVKPDAVAAWIAGQLGSERENWTLAQAVQLLADVERLCPLLVKTPPSELLY
FT                   VMDIESAVRALKHE"
FT   gene            557841..558782
FT                   /locus_tag="Dd1591_0491"
FT   CDS_pept        557841..558782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0491"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /EC_number="2.5.1.75"
FT                   /note="KEGG: eca:ECA3935 tRNA
FT                   delta(2)-isopentenylpyrophosphate transferase; TIGRFAM:
FT                   tRNA delta(2)-isopentenylpyrophosphate transferase; PFAM:
FT                   tRNA isopentenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05373"
FT                   /db_xref="GOA:C6CIZ4"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIZ4"
FT                   /inference="protein motif:TFAM:TIGR00174"
FT                   /protein_id="ACT05373.1"
FT                   /translation="MNEFETAQHPPAIFIMGPTASGKTALAMALREHLPVELISVDSAL
FT                   IYRGMDIGTAKPSQEELARAPHRLLDILDPAEAYSAADFRRDALQAMAEVTAAGRIPLL
FT                   VGGTMLYFKALLEGLSPLPSADARVRQEIEERARNEGWEALHRQLSVIDPVAAARIHPN
FT                   DPQRLSRALEVFFVSGNTLTELTKTSGEALPYRVHQFAIAPATRELLHERIALRFRQML
FT                   ESGFEAEARALFARPDLNPALPSIRCVGYRQMWSYLSGEIDYDEMVYRGICATRQLAKR
FT                   QMTWLRGWEAVRWLDSDQPVEALRTVIQVVSA"
FT   gene            558909..559208
FT                   /locus_tag="Dd1591_0492"
FT   CDS_pept        558909..559208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0492"
FT                   /product="RNA chaperone Hfq"
FT                   /note="TIGRFAM: RNA chaperone Hfq; PFAM: Like-Sm
FT                   ribonucleoprotein core; KEGG: yen:YE0377 RNA-binding
FT                   protein Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05374"
FT                   /db_xref="GOA:C6CIZ5"
FT                   /db_xref="InterPro:IPR005001"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIZ5"
FT                   /inference="protein motif:TFAM:TIGR02383"
FT                   /protein_id="ACT05374.1"
FT                   /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVIL
FT                   LKNTVSQMVYKHAISTVVPSRPVSHHSNNPGPNNYHANNQAAQQQPQQESDDAE"
FT   gene            559298..560599
FT                   /locus_tag="Dd1591_0493"
FT   CDS_pept        559298..560599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0493"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: GTP-binding proten HflX; PFAM: GTP-binding
FT                   protein HSR1-related; KEGG: eca:ECA3933 putative GTPase
FT                   HflX"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05375"
FT                   /db_xref="GOA:C6CIZ6"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIZ6"
FT                   /inference="protein motif:TFAM:TIGR03156"
FT                   /protein_id="ACT05375.1"
FT                   /translation="MFDRYEAGEQAILVHIYFSQEKDTEDLLEFESLVSSAGIDALQVV
FT                   TGSRKAPHSKYFVGEGKAEEIAQAVKETGAFVVLFNHALTPAQERNLERLCECRVIDRT
FT                   GLILDIFAQRARTHEGKLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQLETD
FT                   RRLLRNRISQILSRLERVEKQREQGRRARTRAEVPTVSLVGYTNAGKSTLFNRMTSADV
FT                   YAADQLFATLDPTLRRIDVDDVGDTVLADTVGFIRDLPHDLVAAFKATLQETREATLLL
FT                   HVVDASDTRVDENIDAVNEVLTEIEADDIPFLLVMNKIDQLENITPRIDRDEENRPVRV
FT                   WLSAQTGEGIPLLLQALTERLSGEIAHYSLHLPPHAGRLRSRFYQLQAIEKEWIEEDGS
FT                   VGLVVRMPIIDWRRLCKQEQKLQDYIVSSTQTVS"
FT   gene            560651..561913
FT                   /locus_tag="Dd1591_0494"
FT   CDS_pept        560651..561913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0494"
FT                   /product="HflK protein"
FT                   /note="KEGG: eca:ECA3932 FtsH protease regulator HflK;
FT                   TIGRFAM: HflK protein; PFAM: band 7 protein; SMART: band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05376"
FT                   /db_xref="GOA:C6CIZ7"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR010201"
FT                   /db_xref="InterPro:IPR020980"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIZ7"
FT                   /inference="protein motif:TFAM:TIGR01933"
FT                   /protein_id="ACT05376.1"
FT                   /translation="MAWNQPGNNGQDRDPWGSSNNNSGNSGGNNKGGRDQGPPDLDDIF
FT                   RKLSKKLGELGGKPSGTGTGSQGNGNGSRILGLVVAAALVVWGVSGFYTIKEAERGVVT
FT                   RFGKFSHLVGPGLNWKPTFVDSVRAVNVESVRELATSGVMLTSDENVVRVEMNVQYRVT
FT                   QPDKYLFSVTNADDSLRQATDSALRGVIGKYTMDKILTEGRTIVRTDTQRVLEETVRPY
FT                   DMGITLLDVNFQTARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQPRANGQAQRI
FT                   LEESRAYKDRTVLEAQGEVSRFSRLLPEYKAAPEITRERLYIETMERVLSHTNKVLVSD
FT                   KSNNLMVLPLDQLMRGQGGVSTNAPTGGNAMNPAPLRLPSTSSGNSGVGYAPRSSVNNG
FT                   NIMDQRRANAQRDEIIRVGRE"
FT   gene            561917..562912
FT                   /locus_tag="Dd1591_0495"
FT   CDS_pept        561917..562912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0495"
FT                   /product="HflC protein"
FT                   /note="KEGG: eca:ECA3931 FtsH protease regulator HflC;
FT                   TIGRFAM: HflC protein; PFAM: band 7 protein; SMART: band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05377"
FT                   /db_xref="GOA:C6CIZ8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR010200"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIZ8"
FT                   /inference="protein motif:TFAM:TIGR01932"
FT                   /protein_id="ACT05377.1"
FT                   /translation="MRKSVLFILALLLLVVYASLFVVQEGQRGIVMRFGKVLRDNENKP
FT                   LVYLPGLHVKIPFLESVKMLDARIQTMENQADRFITKEQKDLIVDSYIKWRISDFSRYY
FT                   LATGGGDVSQAEVLLKRKFSDRLRSEIGRLDVKGIVTDSRGQLMSDVREALNAGTGETT
FT                   EADNAIASAAARVERETSGDMPRVNPNSMAALGIEVIDVRIKQINLPTEVSDAIFQRMR
FT                   AEREAVARRHRSQGQEQAEKIKAAADYEVTRTLAEAERQGRIMRGEGDGEAAKLFAAAF
FT                   SQDPAFYGFIRSLRAYENSFNSTNQDVLVLSPDSDFFRYMKSPEKSLSTR"
FT   sig_peptide     561917..561973
FT                   /locus_tag="Dd1591_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.448 at
FT                   residue 19"
FT   gene            562976..563176
FT                   /locus_tag="Dd1591_0496"
FT   CDS_pept        562976..563176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA3930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05378"
FT                   /db_xref="GOA:C6CIZ9"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:C6CIZ9"
FT                   /inference="similar to AA sequence:KEGG:ECA3930"
FT                   /protein_id="ACT05378.1"
FT                   /translation="MNVSIWLALGLVLIMEGLGPLLFPRIWRRMILTMAKLPDNILRRF
FT                   GGGIVVAGCVIYYMLRSRTGG"
FT   gene            563276..564574
FT                   /locus_tag="Dd1591_0497"
FT   CDS_pept        563276..564574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0497"
FT                   /product="adenylosuccinate synthetase"
FT                   /EC_number="6.3.4.4"
FT                   /note="KEGG: eca:ECA3929 adenylosuccinate synthetase;
FT                   TIGRFAM: adenylosuccinate synthetase; PFAM:
FT                   adenylosuccinate synthetase; SMART: adenylosuccinate
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05379"
FT                   /db_xref="GOA:C6CJ00"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ00"
FT                   /inference="protein motif:TFAM:TIGR00184"
FT                   /protein_id="ACT05379.1"
FT                   /translation="MGKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLV
FT                   INGEKTVLHLIPSGILRENVISIIGNGVVLAPDALLKEMTALEARGVPVRERMLLSEAC
FT                   PLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDRESFAIKLK
FT                   EIMEYHNFQLVHYYKADAVDYQKTLNDVLAVADILTGMVVDVSDLLYKAHQRGDYVMFE
FT                   GAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPT
FT                   ELFDEVGEHLSQKGNEFGATTGRRRRTGWLDAVAVRRAVQINSLSGFCLTKLDVLDGLN
FT                   EVKICIGYRMPDGSNVDVTPLAADGWEGIEPIYETLPGWSESTFGVKEYSKLPQAALNY
FT                   IKRIEEVTGVPVDIISTGPDREETMILRDPFDA"
FT   gene            complement(564685..566067)
FT                   /locus_tag="Dd1591_0498"
FT   CDS_pept        complement(564685..566067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0498"
FT                   /product="UDP-N-acetylmuramate"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate; PFAM: cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase middle
FT                   domain protein; KEGG: eca:ECA3928
FT                   UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-me
FT                   so-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05380"
FT                   /db_xref="GOA:C6CJ01"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ01"
FT                   /inference="protein motif:TFAM:TIGR01081"
FT                   /protein_id="ACT05380.1"
FT                   /translation="MRIHILGICGTFMGGLALLARSQGHQVTGSDANVYPPMSTLLEEQ
FT                   GITLIQGYDPAQLDPAPDLVIIGNAMTRGNPCVEAVLEQNIPYMSGPQWLHDHVLRERW
FT                   VIAVAGTHGKTTTAGMVTWILEDCGYQPGFVIGGVPGNFTVSARLGDSPFFVVEADEYD
FT                   CAFFDKRSKFVHYSPRTLILNNLEFDHADIFDDLKAIQKQFHHLVRLVPGKGRIIVPTH
FT                   DLHLKQVMGMGCWSEQELVGEEGIWKAKKVTTDASVFQVYLNDQIVGEVDWNLVGEHNM
FT                   HNGLMAIAAARHVGVTPAEACRALGGFINARRRLELRGTAHGVSVYDDFAHHPTAILAT
FT                   LAALRSKVGGTARILAVLEPRSNTMKMGHCKNELAPALGRADGVFLFQPQHIPWQVAEV
FT                   ADACVQPAWWSADIDTLVEMINKTAQPGDHILVMSNGGFGNIHNKLLDALNAKAQAASN
FT                   ED"
FT   sig_peptide     complement(566005..566067)
FT                   /locus_tag="Dd1591_0498"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.405 at
FT                   residue 21"
FT   gene            566238..567242
FT                   /locus_tag="Dd1591_0499"
FT   CDS_pept        566238..567242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0499"
FT                   /product="Fructose-bisphosphatase"
FT                   /EC_number="3.1.3.11"
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: spe:Spro_0464
FT                   fructose-1,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05381"
FT                   /db_xref="GOA:C6CJ02"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ02"
FT                   /inference="protein motif:PRIAM:3.1.3.11"
FT                   /protein_id="ACT05381.1"
FT                   /translation="MKTLGEFIVEKQHDFSHATGELTALLSAIKLGAKIIHRDINKAGL
FT                   VDILGTSGVSNVQGEVQMKLDLYANEKLKAALKARGEVAGIASEEEDEIVIFDGERAEN
FT                   AKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRITPLGMPVREEDFLQPGHKQVAAGYIVY
FT                   GSSTMLVYTTGHGVHAFTYDPSLGVFCLSHERVRFPEKGNMYSINEGNYIKFPQGVKKY
FT                   IKYCQEQDEATQRPYTTRYIGSLVADFHRNLLKGGIYLYPSTASYPEGKLRLLYECNPM
FT                   AFLAEQAGGKASDGKNRILDITPQKLHQRAPFFVGNTSMVEDLEGFLRDYPDA"
FT   gene            complement(567322..567753)
FT                   /locus_tag="Dd1591_0500"
FT   CDS_pept        complement(567322..567753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0500"
FT                   /product="Holliday junction resolvase YqgF"
FT                   /note="PFAM: Holliday junction resolvase YqgF; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: eca:ECA3926
FT                   Holliday junction resolvase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05382"
FT                   /db_xref="GOA:C6CJ03"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ03"
FT                   /inference="protein motif:PFAM:PF03652"
FT                   /protein_id="ACT05382.1"
FT                   /translation="MGNRTLLAFDFGTRSIGVAIGQEITGTARPLTSLKAQDGIPDWQK
FT                   VEKLLNEWQPALVIVGLPLNMDGTEQPLTARARKFSQRLHGRFGVNVELHDERLSTVEA
FT                   RADLFERGGFRALDKGSVDAASAVIILESWFEQQLARPQ"
FT   gene            complement(567753..568316)
FT                   /locus_tag="Dd1591_0501"
FT   CDS_pept        complement(567753..568316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0501"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   eca:ECA3925 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05383"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ04"
FT                   /inference="protein motif:PFAM:PF02622"
FT                   /protein_id="ACT05383.1"
FT                   /translation="MNLQHHFLIAMPSLQDSVFRRTVIYLCEHNEDGAMGLIINKPMEQ
FT                   FTVENILKKLKITPTPRDMAIRLDKPVFSGGPLADDRGFILHSPCPGFASSISISDETM
FT                   ITTSKDVLETLGTPEQPRNTLVALGYSAWESGQLENELLENAWLTVPADHHLLFNTPIA
FT                   DRWRAAARKLGVDIHNIAAEAGHA"
FT   gene            complement(568444..569397)
FT                   /locus_tag="Dd1591_0502"
FT   CDS_pept        complement(568444..569397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0502"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: eca:ECA3924 glutathione synthetase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase
FT                   ATP-binding; RimK domain protein ATP-grasp; glutathione
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05384"
FT                   /db_xref="GOA:C6CJ05"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ05"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ACT05384.1"
FT                   /translation="MIKLGIVMDPISSINIKKDTSFAMLQEAQRRGWEVHYMEMGDLYL
FT                   HAGEARATTRTLSVQYDYDHWYDFGATQDIALHELDVVLMRKDPPFDTEFIYATYILER
FT                   AEEKGTLIVNKPQSLRDCNEKLFTAWFPQLTPDTLVTRNADRLRAFHQRHSDVILKPLD
FT                   GMGGASIFRLKPEDANVSVIIETLTEHGNRYCMAQNYLPAIKDGDKRVLVVDGEPVPYC
FT                   LARIPKSGETRGNLAAGGRGEARPLSESDWQIARTVAPVLKQKGLIFVGLDIIGDRLTE
FT                   INVTSPTCVREIEAAYPDVSITGMLMDAIERRLAQR"
FT   gene            complement(569409..570143)
FT                   /locus_tag="Dd1591_0503"
FT   CDS_pept        complement(569409..570143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0503"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   eca:ECA3923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05385"
FT                   /db_xref="GOA:C6CJ06"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ06"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACT05385.1"
FT                   /translation="MRIPRIFHPDTLALLGGEMDLSEDAANHVGRVLRMSAGQALQLFD
FT                   GSNQVFDAEIIQAGKKSVRVRYAAGQTENRESPLHLHLGQVMSRGEKMEFTIQKSIELG
FT                   VNIITPLLSERCGIKLDGERLEKKISQWQKIAIAACEQCGRNRVPEIRPVQTLESWCAE
FT                   SDNGLKLNLHPRATQSINTLPLPVSRIRLLIGPEGGLSADEIAMTATQGFTDILLGPRV
FT                   LRTETTALTAITALQVRFGDLG"
FT   gene            complement(570275..570976)
FT                   /locus_tag="Dd1591_0504"
FT   CDS_pept        complement(570275..570976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0504"
FT                   /product="Deoxyribonuclease I"
FT                   /EC_number="3.1.21.1"
FT                   /note="PFAM: Endonuclease I; KEGG: eca:ECA3922
FT                   endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05386"
FT                   /db_xref="GOA:C6CJ07"
FT                   /db_xref="InterPro:IPR007346"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ07"
FT                   /inference="protein motif:PRIAM:3.1.21.1"
FT                   /protein_id="ACT05386.1"
FT                   /translation="MLRNLVVFVVLGAGLTIPALSAAQDINNFTQAKAAAVKIHQDAPG
FT                   SFYCGCTINWQGKKGTPDLASCGYQVRKDANRASRIEWEHVVPAWQFGHQRQCWQDGGR
FT                   KNCTKDDVYRQMETDLHNLQPSIGEVNGDRGNFMYSQWNGGERQYGQCEMKIDFKNQLA
FT                   EPPERARGAIARTYFYMRDRYSLNLSRQQTQLFDAWNKQYPVTAWECTREKRIAAVQGN
FT                   RNPYVQQACQP"
FT   sig_peptide     complement(570905..570976)
FT                   /locus_tag="Dd1591_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.674 at
FT                   residue 24"
FT   gene            complement(571075..571587)
FT                   /locus_tag="Dd1591_0505"
FT   CDS_pept        complement(571075..571587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0505"
FT                   /product="protein of unknown function DUF335 SprT"
FT                   /note="PFAM: protein of unknown function DUF335 SprT;
FT                   SMART: protein of unknown function SprT; KEGG: eca:ECA3921
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05387"
FT                   /db_xref="GOA:C6CJ08"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023483"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ08"
FT                   /inference="protein motif:PFAM:PF03926"
FT                   /protein_id="ACT05387.1"
FT                   /translation="MNTPRLPIALQQAVMRCLREKLQQANTALGSDYPEPVINYQQRGS
FT                   TAGSAWLKEWEIRLNPVLLQENQQPFIDEVVPHELAHLLVYARFGKTAPHGREWRWMME
FT                   SVLSVPARRTHQYALASVQGKTFPYQCACRRHELTLRRHNRVVRGESEYRCRACGERLR
FT                   PLVIHSV"
FT   gene            complement(571700..572854)
FT                   /locus_tag="Dd1591_0506"
FT   CDS_pept        complement(571700..572854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0506"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="KEGG: eca:ECA3920 S-adenosylmethionine synthetase;
FT                   TIGRFAM: S-adenosylmethionine synthetase; PFAM:
FT                   S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05388"
FT                   /db_xref="GOA:C6CJ09"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ09"
FT                   /inference="protein motif:TFAM:TIGR01034"
FT                   /protein_id="ACT05388.1"
FT                   /translation="MAKHLFTSESVSEGHPDKIADQISDAVLDAILEQDPKARVACETY
FT                   VKTGMVLVGGEITTSAWVDIEEITRRTVRDIGYVNSEMGFDANSCAVLSAIGKQSPDIN
FT                   QGVDRKDPLEQGAGDQGLMFGYATNETDVLMPAPITYAHRLVQRQSEVRKNGTLPWLRP
FT                   DAKSQVTFAYDNGKIVGIDAVVLSTQHSESIAQKDLQEAVMEEIIKPVLPSEWLSANTK
FT                   YFINPTGRFVIGGPMGDCGLTGRKIIVDTYGGAARHGGGAFSGKDPSKVDRSAAYAARY
FT                   VAKNIVAAGLADRCEIQVSYAIGVAEPTSIMVETFGTEKIASDRLVELVRQFFDLRPYG
FT                   LIQMLDLLHPIYQQTAAYGHFGRAEFPWEKTDVAEKLRDAAGLK"
FT   gene            573631..573789
FT                   /locus_tag="Dd1591_0507"
FT   CDS_pept        573631..573789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05389"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT05389.1"
FT                   /translation="MFYTNKSHKTAAYYCPSGFSLPASHAFAVSPVFVAGKNVIIHLEV
FT                   EEGDRHV"
FT   sig_peptide     573631..573717
FT                   /locus_tag="Dd1591_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.900 at
FT                   residue 29"
FT   gene            573782..575758
FT                   /locus_tag="Dd1591_0508"
FT   CDS_pept        573782..575758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0508"
FT                   /product="arginine decarboxylase"
FT                   /note="TIGRFAM: arginine decarboxylase; PFAM: Orn/DAP/Arg
FT                   decarboxylase 2; KEGG: eca:ECA3918 arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05390"
FT                   /db_xref="GOA:C6CJ11"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ11"
FT                   /inference="protein motif:TFAM:TIGR01273"
FT                   /protein_id="ACT05390.1"
FT                   /translation="MSDDMIQPYSSATGKHDHLRSMQEVAMNDRDASEMLRTYNIAWWG
FT                   NNYYDVNELGHISVCPDPDVPEARVDLAKLVKTRQQDNQRLPALFCFPQILQHRLRSIN
FT                   AAFKRARESFGYEGGYFLVYPIKVNQHRRVIESLINSGEPLGLEAGSKAELMAVLGHAG
FT                   MTRTVIVCNGYKDREYIRLALIGEKLGHKVYLVIEKMSEIKLVLEEAERLNVVPRLGVR
FT                   ARLASQGSGKWQSSGGEKSKFGLAATQVLQLVELLRNANRLDSLQLLHFHLGSQLANIR
FT                   DIATGVRESARFYVELHKLGVNIQCFDVGGGLGVDYEGTRSQSDCSVNYGLNEYANNVI
FT                   WGIGDACNEYGLPHPMVITESGRAVTAHHTVLVSNIIGVERNEFSEPVAPDEDAPRALE
FT                   SLWSTWQEIQEPGNRRSLREWLHDSQMDLNDVHTQYTHGMLDLTQRAQAEQLYLNICQR
FT                   LQQQLDPSNRAHRPIIDELQERMADKLYVNFSLFQSMPDAWGIDQLFPVLPLEGLDKPP
FT                   QRRAVLLDITCDSDGTIDHYVDGDGVATTMPMPPYDPENPPLLGFFMVGAYQEILGNMH
FT                   NLFGDTSTVDVFVFQDGTVELEESDEGNTVADMLEYVQLDPNVLMSRFRDQVKETDLAP
FT                   ELQAQFLEEFETGLYGYTYLEDE"
FT   gene            575985..577178
FT                   /locus_tag="Dd1591_0509"
FT   CDS_pept        575985..577178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0509"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   spe:Spro_4593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05391"
FT                   /db_xref="GOA:C6CJ12"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ12"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACT05391.1"
FT                   /translation="MSDLNRQRLFFTSCFSYALTGALVIVTGMVMGDIAQYFNVPIANM
FT                   SNTFTFLNAGILLSIFLNVWLMDIFPLKKQLVFGFILIVLSIIGLFVGKSLAVFSACMF
FT                   TLGVVSGITMSIGTFLITQLYSGRQRGARLLFTDSFFSMAGMIFPIVAAALLSRHFGWY
FT                   WIYACIGLLYVAILVLTLLSDFPAIGADKASARNVAAETEKWGFGVVFLSIAALCYILG
FT                   QLAFIQWVPEYVTKSFGLSIGDAGELVSSFWTSYMIGMWVFSFVLKFFDLQRVVTVLAI
FT                   LATGAMYLFVSSDQPQLLKYFIFGLGFISSAIYTTLITLGSQQTKVPSPKLVNFILTCG
FT                   TVGTMLTFIVTGPIVEHFGVHAALVTANGLYFVVFVMCLLLGFVTRHRLHGHEAAAH"
FT   sig_peptide     575985..576083
FT                   /locus_tag="Dd1591_0509"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.921) with cleavage site probability 0.911 at
FT                   residue 33"
FT   gene            577557..579551
FT                   /locus_tag="Dd1591_0510"
FT   CDS_pept        577557..579551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0510"
FT                   /product="transketolase"
FT                   /note="TIGRFAM: transketolase; PFAM: Transketolase central
FT                   region; Transketolase domain protein; KEGG: eca:ECA0861
FT                   transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05392"
FT                   /db_xref="GOA:C6CJ13"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ13"
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /protein_id="ACT05392.1"
FT                   /translation="MSSRKELANAIRALSMDGVQKAKSGHPGAPMGMADIAEVLWRDHL
FT                   NHNPANPHWANRDRFVLSNGHASMLIYSLLHLTGYSLPIEELKNFRQLHSRTPGHPEVG
FT                   YTPGVETTTGPLGQGIANAVGMAIAERTLAAQFNRPGHDIVDHHTYVFLGDGCMMEGIS
FT                   HEACSLAGTLKLGKLIAFYDDNGISIDGHIEGWFTDDTAARFESYGWHVVRGIDGHDAD
FT                   AIQRAINEAQGVTDKPSLLLCKTVIGFGSPNKAGTHDSHGAPLGDAEVAATREQLGWKY
FT                   GPFEIPAEIYAAWDARKAGESKEAAWQQAFNAYASAYPELAAEFTRRVNGELPANWQAE
FT                   STKVIEQLQANPAKIASRKASQNALEAYGKLLPEFLGGSADLAPSNLTIWSGSKALNED
FT                   PAGNYIHYGVREFGMTAIANGITLHGGFLPYTATFLMFVEYARNAVRMAALMKVRSIYV
FT                   YTHDSIGLGEDGPTHQPVEQLASLRVTPNMSTWRPADQVETAVAWKYAIERKDGPTALI
FT                   LSRQNLAQQERTAQQLADVAKGAYVLKDGGGQPQLILIATGSEVELAVAAWQKLTDEGV
FT                   KARVVSMPSTDAFDKQDAAYREAVLPSAVAARVAIEAGIADYWYKYVGLNGAIVGMESF
FT                   GESAPAEKLFDVFGFTTDNVVAKAKALLK"
FT   gene            complement(579611..580936)
FT                   /locus_tag="Dd1591_0511"
FT   CDS_pept        complement(579611..580936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0511"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   vha:VIBHAR_05087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05393"
FT                   /db_xref="GOA:C6CF98"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024473"
FT                   /db_xref="UniProtKB/TrEMBL:C6CF98"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACT05393.1"
FT                   /translation="MSEHDMDFVVDAFSSERDAFSRSLDPAWIHQALNACHKASIRRRR
FT                   LPAEQAVWLVLMMGLLRDLSIKDVCHHLDIVLQPDEGYQPLAPSVLTAARQRLGEAPLR
FT                   YLFHACNEGWLPTVLGSDTFHGLHVLSVDGTLFRTPDSPDNAAAFGFIDPVHGTFPQVR
FT                   MVGLMATHSHMLLDAAFGGVAEGELTLAHRLVSSAPDHSLTLFDRCYFSASFLLEWRQA
FT                   GVETHWLTPVKRKLRYRVIERYSDYDMLIEMPVSPQARKAAPHLPAVWQARMVSYINGS
FT                   GKGKITGFLTSMTDPVAYPLEDLLRIYWTRWEIELGYGELKQRQLKGEVTLRSRFPEGV
FT                   KQELWGILVSYNLLRKEMADIAGEAGVQPTRISFIAALNILVSQVRVSGKGAAGNIPKH
FT                   LKGMRNNVKAFILPEKRKHRRYDRSVLYVPPKYPFSFKSREA"
FT   gene            581313..582329
FT                   /locus_tag="Dd1591_0512"
FT   CDS_pept        581313..582329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0512"
FT                   /product="D-erythrose-4-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.72"
FT                   /note="KEGG: eca:ECA3913 erythrose 4-phosphate
FT                   dehydrogenase; TIGRFAM: D-erythrose-4-phosphate
FT                   dehydrogenase; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05394"
FT                   /db_xref="GOA:C6CJ15"
FT                   /db_xref="InterPro:IPR006422"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ15"
FT                   /inference="protein motif:TFAM:TIGR01532"
FT                   /protein_id="ACT05394.1"
FT                   /translation="MTIRIAINGFGRIGRSVLRALYESGRRAEITVVAINELANAEGIA
FT                   HLLKYDSSHGRFSWDIRQECDRLSVGDDAIRLLHESDLRSLPWGELGVDIVLDCSGAYG
FT                   SRADGEAHLAAGAKKVLFSHPGAPDLDATIVYGVNHQDLRPTHRVVSNASCTTNCIIPI
FT                   IKLLDDAYGIESGTVTTIHASMNDQPVIDAYHHDLRRTRAASQSIIPVDTKLAVGITRF
FT                   FPKFEDRFEAISVRVPTINVTAIDLSVSVKNSVNVSEINTLFRQSAQNTFRGIVDYTDL
FT                   PLVSVDFNHDPHSAIVDGTQTRVSGGHLIKTLVWCDNEWGFANRMLDTTRAMAACGF"
FT   gene            582396..583559
FT                   /locus_tag="Dd1591_0513"
FT   CDS_pept        582396..583559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0513"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: eca:ECA3912
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05395"
FT                   /db_xref="GOA:C6CJ16"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ16"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ACT05395.1"
FT                   /translation="MAVIKMTDLDLAGKRVLIRADLNVPVKDGKVTSDARIRASLPTIE
FT                   IALKQGARVMVTSHLGRPTEGEYNEEFSLLPVVNYLKDRLSSPVRLAKDYLDGVDVAEG
FT                   ELVVLENVRFNKGEKKDDEVLSKKYAALCDVFVMDAFGTAHRAQASTHGVGKFAPIACA
FT                   GPLLSDELEALGKALGNPARPMVAIVGGSKVSTKLTVLDSLSKIADQLIVGGGIANTFV
FT                   AAQGHNVGKSLYEAELIPEAKKLLETCDIPVPSDVRVATEFSETAAATLKSVAAIKDDE
FT                   QILDLGDVSAERLAEILKNAKTILWNGPVGVFEFPNFRKGTEIIANAIANSDAFSIAGG
FT                   GDTLAAIDLFGIADKISYISTGGGAFLEFVEGKKLPAVVMLEERARQ"
FT   gene            583746..584822
FT                   /locus_tag="Dd1591_0514"
FT   CDS_pept        583746..584822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0514"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /note="TIGRFAM: fructose-bisphosphate aldolase, class II;
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II; KEGG: plu:plu0957 fructose-bisphosphate
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05396"
FT                   /db_xref="GOA:C6CJ17"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006411"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ17"
FT                   /inference="protein motif:TFAM:TIGR01520"
FT                   /protein_id="ACT05396.1"
FT                   /translation="MSKIFDFVKPGVITGDDVQKVFAIAKENNFALPAVNCVGTDSINA
FT                   VLEAAAKVRAPVIVQFSNGGAVFTAGKGLKAEGQQAAILGAISGAHHVHQMAEHYGIPV
FT                   ILHTDHCAKKLLPWLDGLLDAGEKHYAATGKPLFSSHMIDLSEESLEENIEICSKYLAR
FT                   MAKLDMTLEIELGCTGGEEDGVDNSHLDNSALYTQPEDVAYAYEKLNAISPRFTIAASF
FT                   GNVHGVYKPGNVQLTPKILHNSQEYVSKKFNLPHNSLDFVFHGGSGSSAEEIAEAVSYG
FT                   VVKMNIDTDTQWATWEGILNYYKKNEAYLQGQLGNPEGDDKPNKKYYDPRVWLRAGQVS
FT                   MVARLEQAFKELNAVDVL"
FT   gene            584949..585827
FT                   /locus_tag="Dd1591_0515"
FT   CDS_pept        584949..585827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0515"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; Conserved
FT                   TM helix repeat-containing protein; KEGG: eca:ECA3910
FT                   putative mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05397"
FT                   /db_xref="GOA:C6CJ18"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR006686"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ18"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACT05397.1"
FT                   /translation="MEELNVAESVGRLQSWLVDNQHILLQYGVNVVASLVILCAGMLIA
FT                   RMMSNTMNRLMVARGIDVTVADFLSALVRYGIIAFTLIAALSRVGVQTASVIAVLGAAG
FT                   LAVGLALQGSLSNFAAGVLLVMFRPFRTGESVDLGGIAGTVTQVQIFSTTLLTADGKVI
FT                   VVPNGKIIVGNIINSSREPNRRTEIIVGVAYDADIDVVKNVLGDIVAADNRILRDKDVT
FT                   IRLNEMGPSSLNFVVRVWTTNGDAAVVYWDLLENFKRALDEHRIGIPYPQMDVHLHHAC
FT                   NRTGSQETPTL"
FT   gene            585959..586777
FT                   /locus_tag="Dd1591_0516"
FT   CDS_pept        585959..586777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0516"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: Transcriptional regulator IclR; regulatory
FT                   protein IclR; SMART: regulatory protein IclR; KEGG:
FT                   spe:Spro_3928 IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05398"
FT                   /db_xref="GOA:C6CJ19"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ19"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ACT05398.1"
FT                   /translation="MINEHSIDDEVKAEKPLGSQSLFRGLQLIEILSDYPNGCPLARIA
FT                   ELSGMNKSTVHRLLQGLAGCGYVVPARQPGSYRLTTKFIAIGQKALSSLNVLHVAVPHL
FT                   EALNLTVGETVNFSTREDDHAILIYKLEPTTGMMRTRAYIGQHMPLHTSAMGKIFMAYG
FT                   TDDYPAEYWRTHQNSICPLTDNTIVELSAMRQELAEIRRQGLAMDREENELGVSCISAP
FT                   VFDIQHRVPYAVSISLSMARLQQIGIETLVAPLRETARNISLELGFTPPT"
FT   gene            586863..587618
FT                   /locus_tag="Dd1591_0517"
FT   CDS_pept        586863..587618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0517"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   eca:ECA3908 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05399"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ20"
FT                   /inference="protein motif:PFAM:PF04402"
FT                   /protein_id="ACT05399.1"
FT                   /translation="MSFTHKEKGDTVKLKVLALSALLGLSSMAVQAGNELPGGPHIVTS
FT                   GTASVDATPDIARLAIEVNVSSKEVSDAKKQVDERVAQYFAFLDKSGIDKKDINAANLR
FT                   TQPEYDYLKNGGSVLKGYRAVRQVEVTLRQLDKLNELLDGALKSGLNEIRSVELGVANP
FT                   DVYREQARKKAIEQATLQAQSLAAGFNASLGPVYSIRYHVANYQPVPVARMFKTADMVA
FT                   QSEVSQTYEQRTIHFDDQVDVVFELQRAP"
FT   sig_peptide     586863..586961
FT                   /locus_tag="Dd1591_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 33"
FT   gene            complement(587642..588535)
FT                   /locus_tag="Dd1591_0518"
FT   CDS_pept        complement(587642..588535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0518"
FT                   /product="transcriptional regulator, ArgP, LysR family"
FT                   /note="TIGRFAM: transcriptional regulator, ArgP family;
FT                   PFAM: regulatory protein LysR; LysR substrate-binding;
FT                   KEGG: eca:ECA3907 chromosome replication initiation
FT                   inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05400"
FT                   /db_xref="GOA:C6CJ21"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR023490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ21"
FT                   /inference="protein motif:TFAM:TIGR03298"
FT                   /protein_id="ACT05400.1"
FT                   /translation="MKRPDYRTLQALDAVIRERGFERAAQKLCITQSAVSQRIKQLENL
FT                   FGQPLLVRTIPPRPTEQGQKLLALLHQVELLEEEWLGNENSNETPLLLSLAVNADSLAT
FT                   WLLPALQPVLVDSPIRLNLQVEDETRTQERLRRGEVVGAVSIQPQPLPSCLVDKLGALD
FT                   YLFVASPGFADRYFPNGVTRSALLRAPVVAFDHLDDMHQAFLQQNFDLPPGSVPCHIVN
FT                   SSEAFVQLARQGTTCCMIPHLQIERELANGELIDLTPGLFQRRMLYWHRFAPESRMMRQ
FT                   VTDALLTHGRQVLRQS"
FT   gene            588732..589394
FT                   /locus_tag="Dd1591_0519"
FT   CDS_pept        588732..589394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0519"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="KEGG: eca:ECA3906 ribose-5-phosphate isomerase A;
FT                   TIGRFAM: ribose 5-phosphate isomerase; PFAM: Ribose
FT                   5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05401"
FT                   /db_xref="GOA:C6CJ22"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ22"
FT                   /inference="protein motif:TFAM:TIGR00021"
FT                   /protein_id="ACT05401.1"
FT                   /translation="MTQDELKKAVGWAALDYVRPGTIVGVGTGSTAAHFIDALGSIKHQ
FT                   IEGAVSSSDASTAKLKSLGIPVFDCNDVDALDVYVDGADEINPHMQMIKGGGAALTREK
FT                   IIAAIARQFVCIVDASKQVDVLGRFPLPVEVIPMARAYVARELVKLGGQPVYRDGVVTD
FT                   NGNIILDVHNMDLSDAVAMESRINGLAGVVTVGLFANRGADVALVGTADGVKIVRLK"
FT   gene            589747..590979
FT                   /locus_tag="Dd1591_0520"
FT   CDS_pept        589747..590979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0520"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; amino acid-binding ACT domain protein;
FT                   KEGG: eca:ECA3905 D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05402"
FT                   /db_xref="GOA:C6CJ23"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ23"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACT05402.1"
FT                   /translation="MAKVSLEKDKIKFLLLEGVHPNALENLRAAGYTNIEYHKGALDPE
FT                   ALKASIRDAHFVGIRSRTHLTEEIFAAAEKLVAVGCFCIGTNQVELSAATKRGIPVFNA
FT                   PFSNTRSVAEMVIGELLLLMRGIPMANAKAHRGIWHKQAVGCFEARGKKLGIIGYGHIG
FT                   TQLGILAESLGMHVYFYDIESKLPLGNAQQVRHLSDLLNMSDVVSLHVPETDSTQNMIG
FT                   ADELALMKPGSILINASRGTVVDIPALSNALASKHLSGAAIDVFPQEPATNSDPFLSPL
FT                   CEFDNVILTPHIGGSTEEAQENIGEEVAGKLVKYSDNGSTLSAVNFPEVSLPTHSDRAS
FT                   RLLHIHENRPGIMTQINNIFAEQGINIAAQYLQTSPTIGYVVIDVETDGADTALQLMKA
FT                   IPGTIRARLLF"
FT   gene            complement(591072..592073)
FT                   /locus_tag="Dd1591_0521"
FT   CDS_pept        complement(591072..592073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0521"
FT                   /product="zinc-binding alcohol dehydrogenase family
FT                   protein"
FT                   /note="TIGRFAM: zinc-binding alcohol dehydrogenase family
FT                   protein; PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   eca:ECA3904 putative zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05403"
FT                   /db_xref="GOA:C6CJ24"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ24"
FT                   /inference="protein motif:TFAM:TIGR02817"
FT                   /protein_id="ACT05403.1"
FT                   /translation="MTVRAIAVDPRKPENFVEITAELPQPGEHDLLVAVKAVSVNPVDT
FT                   KVHARLCRDGLEHPRILGWDASGIVVKTGSAVQGFKAGDEVWYAGDITRSGSNSTHQLI
FT                   DARLAAHKPASLDWAEAAALPLTALTAWEGLFEHLNIQNAAKGKTLLIIGGAGGVGSLA
FT                   ISLAAQRSEVTVIATASRPDSAQWCRERGAHRVVDYRHLVDELKKQNIEQVDYIFCLND
FT                   TDGHWDAISRLIAPMGHICTIVENTQPLDQNLLKLKSAALHWEFMFTRSMFSTPDMARQ
FT                   GEILHEVAHWIDSGTLQGTLSQTFSGLTAETLKQAHEAVLDGHMRGKVVITL"
FT   gene            592184..593080
FT                   /locus_tag="Dd1591_0522"
FT   CDS_pept        592184..593080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0522"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: eca:ECA3903 LysR family transcriptional
FT                   activator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05404"
FT                   /db_xref="GOA:C6CJ25"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ25"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACT05404.1"
FT                   /translation="MFKQLQDMALFALVAECGSFTEAARQAGMAKSSLSLRISQLEQAL
FT                   GLRLFNRTTRKLNLTFAGERYLVHCREMRQASERAEMAMLHLRNNPSGRLRITAPAGLG
FT                   ATLLARLTAEFQLRFPAVSLDIVVADRVIDLVEEGFDVALRTGKPQDSSLIGRSLGQVP
FT                   HYLVASTAYLAGFAPIMHPRDLQSHRCITHRAWPEWGFHRETEYFLWRLPQSHITDNLL
FT                   YARACALADGGITLLPTFLCREPLDRGELVCLLPEWQADTNDLYLIYPGRKLNSPALNC
FT                   FIDFAVGFDALCDYSSH"
FT   gene            593514..595220
FT                   /locus_tag="Dd1591_0523"
FT   CDS_pept        593514..595220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0523"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: eca:ECA3902 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05405"
FT                   /db_xref="GOA:C6CJ26"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ26"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACT05405.1"
FT                   /translation="MAEQKGNISSINNIRLVTLFITLLTIILALFALSIGTASYFLKQS
FT                   NASLERANLVSEIRAGISSSMDNFRVSRQLLIQAVASSRIGDTDSFKQAFAEGAERIKS
FT                   SQKRFDDYMARTDKSSEEKSLDSDLTTHYIAYRDKVMVPMVDFVRNGEFENTIELETTL
FT                   ARQLDTNYAVQVRKEVKYLTDHANNINAQAAGNARLGNILMGVSFILAIILAALTYLII
FT                   RRAILVPIHVLIARIQRIAQGDLTQPAEDLGRNEIGILGQNLHHMQASLTNTVTVVREG
FT                   ADSIYQGASEISAGNVDLSSRTEQQAAALEQTAASMEELTSTVKQNSDNANHASQLARN
FT                   ASSKAEQGGSIVQDVVKTMGDISSSSKKISEITSVINSIAFQTNILALNAAVEAARAGE
FT                   QGRGFAVVAGEVRNLAQRSAQAAKEIESLIGESGKLVENGSVLVAKAGDTMDEIVKAVV
FT                   SVTDIMGEIASASDEQSRGIGQVNQAVLEMEGTTQQNAALVQEASAAAASLESQAERLT
FT                   QAVAVFKLRHRRENESVRASLPSRPVVQAIPAVAAIGVGKGGRSDQNWETF"
FT   sig_peptide     593514..593618
FT                   /locus_tag="Dd1591_0523"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.829) with cleavage site probability 0.379 at
FT                   residue 35"
FT   gene            complement(595350..597014)
FT                   /locus_tag="Dd1591_0524"
FT   CDS_pept        complement(595350..597014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0524"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: plu:plu0555 putative ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05406"
FT                   /db_xref="GOA:C6CJ27"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ27"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT05406.1"
FT                   /translation="MAQYVYTMHRVGKVVPPKRHILKNISLSFFPGAKIGVLGLNGAGK
FT                   STLLRIMAGIDKDIEGEARPQPGIKIGYLPQEPQLNLEHTVREAIEEAVSEVKRALTRL
FT                   DEVYAAYADPDADFDKLAKEQGELEAIIQAHDGHNLDNQLERAADALRLPPWDAKIANL
FT                   SGGERRRVAICHLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDYEGTVVAITHDRYFL
FT                   DNVAGWILELDRGEGIPWEGNYSSWLEQKDQRLAQEASTEAARRKSIEKELEWVRQNPK
FT                   GRQAKGKARLARFDELNSVEYQKRNETSELFIPPGPRLGDKVLDVENLTKSYGDRVLID
FT                   NLSFSIPKGAIVGIIGPNGAGKSTLFRMLSSQEQPDSGAISLGETVQLASVDQFRDKMD
FT                   NSKTVWEEISGGQDIMRIGNFELPSRAYVGRFNFKGVDQGKRIGELSGGERGRVHLAKL
FT                   LQVGGNMLLLDEPTNDLDIETLRALENALLEFPGCAMVISHDRWFLDRIATHIIDYQDE
FT                   GKVEFFEGNFTEYEEYKKRTLGAEALEPHRIKYKKMA"
FT   gene            597474..599405
FT                   /locus_tag="Dd1591_0525"
FT   CDS_pept        597474..599405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0525"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   eca:ECA3900 lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05407"
FT                   /db_xref="GOA:C6CJ28"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR008939"
FT                   /db_xref="InterPro:IPR012289"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023800"
FT                   /db_xref="InterPro:IPR037061"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ28"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACT05407.1"
FT                   /translation="MFKIGYWRYVAAVLCLVGASCQVLADSLDEQRQRYQQIKSAWDNN
FT                   QMDVVSQLMPTLRDYPLYPYLEYRALTQDLSTLSAAQVRQFIAAHPTLPAVRTLNNSFI
FT                   NELARRQDWNGLLAFSPNQPKPVASLCNYLYAKVMVGQSQGVWEQTRDIWLTGRSLPPT
FT                   CDKLFSNWQQQGGQTSIMVLERMRLAMDAGSAGLVNHLARQLPAEYRTITDALLKLQSN
FT                   PKTIERFARSVGPTDFTRRAVLSAFGRIARQDPDEARALLPQLVRLQKMRPQERQSMEE
FT                   DVVWRMMGSDVTDEQARWRDAVILRSTSAPLLERRVRMALGQGDKAGLAQWIARLPADV
FT                   QQKDEWRYWRASLLLDQGQQQEGENQLRELMKIRGFYPMAAAQKLNVNYPLTVVIAAKP
FT                   ERTIGQLPEVARVRELMFWGLESLARSEWSGLVASRERPQQEALARFAFEQRWYDLSVQ
FT                   ATIVAKLWDNLEERFPLAWNDDFRQATQGKGISQSYAMAIARQESAWNPQARSTVGASG
FT                   LMQLMPATAQHTAEMFNIASYTNSNQLLDPQMNIQIGTSYLDYVYNAFGQNRILASAAY
FT                   NAGPSRVSSWLKDSNGQIDAIAFVESIPFSETRGYVKNVLAYDVFYRSLMQQRQTALLM
FT                   DNEWRRRY"
FT   sig_peptide     597474..597551
FT                   /locus_tag="Dd1591_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            599586..599918
FT                   /locus_tag="Dd1591_0526"
FT   CDS_pept        599586..599918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0526"
FT                   /product="Trp operon repressor"
FT                   /note="TIGRFAM: trp operon repressor; PFAM: Trp repressor;
FT                   KEGG: eca:ECA3899 Trp operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05408"
FT                   /db_xref="GOA:C6CJ29"
FT                   /db_xref="InterPro:IPR000831"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013335"
FT                   /db_xref="InterPro:IPR038116"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ29"
FT                   /inference="protein motif:TFAM:TIGR01321"
FT                   /protein_id="ACT05408.1"
FT                   /translation="MTLPSSHDPGFSEQDDVHWQAFVSLLQQAIAEGLEQPLLLLLLTP
FT                   DERASLGTRVRIIQELMRGEMSQRELKNELGAGIATITRGSNSLKSAPARLKIWLEEQL
FT                   LPENKA"
FT   gene            complement(599933..600472)
FT                   /locus_tag="Dd1591_0527"
FT   CDS_pept        complement(599933..600472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0527"
FT                   /product="protein of unknown function DUF84"
FT                   /note="PFAM: protein of unknown function DUF84; KEGG:
FT                   eca:ECA3898 NTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05409"
FT                   /db_xref="GOA:C6CJ30"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ30"
FT                   /inference="protein motif:PFAM:PF01931"
FT                   /protein_id="ACT05409.1"
FT                   /translation="MYHVVASTTNPAKISAITLAFADVFGADNCRIEGVDVDSGVPSQP
FT                   LGSVETRTGARNRVMRARQVRPEADFWVGVEAGIEESMTFAWMVIENATIRGESRSASL
FT                   VLPESILRGIGEGRELGDEMARITGIQDIKRQGGAIGVFTDGKLSRTSVYYQALLLALV
FT                   PFHNPVYQHPIHTASV"
FT   gene            600524..601174
FT                   /locus_tag="Dd1591_0528"
FT   CDS_pept        600524..601174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0528"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: spe:Spro_0678
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05410"
FT                   /db_xref="GOA:C6CJ31"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR023086"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ31"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACT05410.1"
FT                   /translation="MLQVYLVRHGETEWNAARRIQGQSDSPLTPGGEHQARLVADRVKK
FT                   LGITHIFTSDLGRTRHTAEIISQACVGCSVILEPGLRELNMGVLEERLIDSLSPEEERW
FT                   RKQLVDGTQDGRIPGGESMSELARRMHLVLERCLALPEGSRPLLVSHGIALGCLLSTLL
FT                   GLPAWAERRLRLRNCSLSRVDYQQSPWLAPGWIVETAGDVSHLDAPALDELQR"
FT   gene            complement(601171..602037)
FT                   /locus_tag="Dd1591_0529"
FT   CDS_pept        complement(601171..602037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0529"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: transcription activator effector binding;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: eca:ECA3896 right origin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05411"
FT                   /db_xref="GOA:C6CJ32"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ32"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ACT05411.1"
FT                   /translation="MDQASIIRDLLNWLEGHLDQPLSLDNVAAKAGYSKWHLQRMFKDV
FT                   TGHAIGSYIRARRLTKAAVALCLTSRPILDIALQYRFDSQQTFTRAFKKQFAQTPASYR
FT                   RADDWNTFGIHPPIRLGTFTMPQPQFITMPETQLVGLTQSYTCNLEEITCFRTEIRIHF
FT                   WRQYLGEVKQVPPVLYGLHHSRPSTEKDDEHEVLYTTALEPHHVPEGVHPGEPVTFPGG
FT                   DYALFIYEGPADDLQDFIITLYDTCLPTYKLTRRKGFDAERFHPKGDADAEPPKIIRCE
FT                   YLIPIQR"
FT   gene            602237..602713
FT                   /locus_tag="Dd1591_0530"
FT   CDS_pept        602237..602713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0530"
FT                   /product="CreA family protein"
FT                   /note="PFAM: CreA family protein; KEGG: eca:ECA3894
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05412"
FT                   /db_xref="InterPro:IPR010292"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ33"
FT                   /inference="protein motif:PFAM:PF05981"
FT                   /protein_id="ACT05412.1"
FT                   /translation="MMKKRVVLTFAALLCGVTSAWAEEIGSVDTVFKLLGPDHKIIVEA
FT                   FDDPDVANVTCYLSRAKTGGIKGGLGLAEDTSDAAISCQQVGPITLSDKITGSKGKGNV
FT                   VFQQRTSLIFKKLQVVRFYDAKRNALVYLTYSDRLVEGSPKNALSAVPILPWSK"
FT   sig_peptide     602237..602305
FT                   /locus_tag="Dd1591_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(602787..603503)
FT                   /locus_tag="Dd1591_0531"
FT   CDS_pept        complement(602787..603503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0531"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: eca:ECA3893 two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05413"
FT                   /db_xref="GOA:C6CJ34"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ34"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACT05413.1"
FT                   /translation="MQTPHILIVEDELVTRNTLKSIFEAEGYVVHEATDGAEMHNILSE
FT                   HDINLVIMDINLPGKNGLLLARELREQASVALMFLTGRDNEVDKILGLEIGADDYITKP
FT                   FNPRELTIRARNLLSRTMNLGGGTEERRLVESYRFNGWELDINSRSLVSPNGEQYKLPR
FT                   SEFRAMLHFCENPGKIQSRAELLKKMTGRELKPHDRTVDVTIRRIRKHFESTADTPEII
FT                   ATIHGEGYRFCGDLED"
FT   gene            604071..604772
FT                   /locus_tag="Dd1591_0532"
FT   CDS_pept        604071..604772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0532"
FT                   /product="RNA methyltransferase, TrmH family, group 1"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   1; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   eca:ECA3892 putative RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05414"
FT                   /db_xref="GOA:C6CJ35"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ35"
FT                   /inference="protein motif:TFAM:TIGR00050"
FT                   /protein_id="ACT05414.1"
FT                   /translation="MQFYIILVAPARAENVGAAARAMKTMGFGRLRIVDSTAHLEPAAR
FT                   WVAHGSGDILDGAEVFPTLTDALADVEFTVATTARSRARFHYYCSPAQLLGVLEEKRQW
FT                   VKSAALVFGREDSGLTNEELALADILTGVPMAADYPSLNLGQAVMVYCYQLASLMQVAA
FT                   AEPTPAESGQLSALRDRFARLLVRVGAQQDEKLRDWLQQRLGLLEQRDNAMLHTLLHDV
FT                   EKTLSAEDKEE"
FT   gene            605210..607666
FT                   /locus_tag="Dd1591_0533"
FT   CDS_pept        605210..607666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0533"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /note="KEGG: eca:ECA3891 bifunctional aspartokinase
FT                   I/homeserine dehydrogenase I; TIGRFAM: aspartate kinase;
FT                   PFAM: homoserine dehydrogenase; amino acid-binding ACT
FT                   domain protein; homoserine dehydrogenase NAD-binding;
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05415"
FT                   /db_xref="GOA:C6CJ36"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ36"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACT05415.1"
FT                   /translation="MRVLKFGGTSVANAERFARVADIIESNARQGQVATVLSAPAKITN
FT                   HLVAMIEKTVAKQDIQPNIIEAEVIFADLLQGLAQSQPGFAYDRLKARVDEEFAQLKQV
FT                   LHGIALLGQCPDSVNAAIICRGEKLSIAIMEAVFQARGYQVSVIDPVRRLLAQGHYLES
FT                   TVDIAESTRRINEQAIPADHVILMAGFTAGNDKGELVVLGRNGSDYSAAVLAACLRADC
FT                   CEIWTDVDGVYTCDPRQVPDARLLKSMSYQEAMELSYFGAKVLHPRTIAPIAQFQIPCL
FT                   IKNTENPQAPGTLIGLESNDTQYPVKGITNLNNMAMINVSGPGMKGMVGMAARVFAAMS
FT                   RAGISVVLITQSSSEYSISFCVSQNELPRARKTLEDEFYLELKEGVLEPLDVVQRLAII
FT                   SVVGDGMRTLRGLSARLFTALASANINIVAIAQGSSERSISVVVNNDVATTGVRVAHQM
FT                   LFNTNQALDVFVIGVGGVGGALLEQIQRQQSWLKQKHIDVRVCGIANSKAMLTNMHGIP
FT                   MDRWRDELARAREPFSPAALSRLVKEYHLLNPVIIDCTSSQAVADQYVDFLAEGFHVVT
FT                   PNKKANTGTLRYYHQLRQVAAKSRRKFLYDTNVGAGLPVIENLQNLLNAGDELIRFNGI
FT                   LSGSLSFIFGKLDEGMSLSAATLLAKEKGFTEPDPRDDLSGMDVARKLLILAREAGYEL
FT                   ELDDIQVDSVLPPEYAQGDVAGFLSRLPELDAEFARRVEAARAEGKVLRYVGKIEDGKC
FT                   QVTISAVGSNDPLFKVKDGENALAFYSRYYQPLPLVLRGYGAGNDVTAAGVFADLLRTL
FT                   SWKVGV"
FT   gene            607669..608598
FT                   /locus_tag="Dd1591_0534"
FT   CDS_pept        607669..608598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0534"
FT                   /product="homoserine kinase"
FT                   /note="TIGRFAM: homoserine kinase; PFAM: GHMP kinase; GHMP
FT                   kinase domain protein; KEGG: eca:ECA3890 homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05416"
FT                   /db_xref="GOA:C6CJ37"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ37"
FT                   /inference="protein motif:TFAM:TIGR00191"
FT                   /protein_id="ACT05416.1"
FT                   /translation="MVKIYAPASIGNVSVGFDVLGAAVSPVDGSLLGDCVTVRQADLFS
FT                   LHNEGRFVSKLPDNPKENIVYQCWERFCQEIGKTVPVAMTLEKNMPIGSGLGSSACSVV
FT                   AGLMAMNEFCGKPLDDTRLLTLMGELEGRISGSVHYDNVAPCFLGGIQLMVEEMGIISQ
FT                   PVPGFDDWLWVMAYPGIKVSTAEARAILPAQYRRQDCISHGRYLAGFIHACHTGQAELA
FT                   VKLMKDVIAEPYRTRLLPGFAEARQAADELGALACGISGSGPTLFSVCNDMGVAQRLAS
FT                   WLRENYLQNDEGFVHICRLDTAGARQLG"
FT   gene            608602..609891
FT                   /locus_tag="Dd1591_0535"
FT   CDS_pept        608602..609891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0535"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="KEGG: eca:ECA3889 threonine synthase; TIGRFAM:
FT                   threonine synthase; PFAM: Pyridoxal-5'-phosphate-dependent
FT                   protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05417"
FT                   /db_xref="GOA:C6CJ38"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ38"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ACT05417.1"
FT                   /translation="MKLYNLKDHNEQVNFAEAIRKGLGSNQGLFFPLELPEFDRTTIDE
FT                   LLEQDFVTRSSRILSAFIGDEMSEETVYQRVKAAFRFPAPVVPVSEDIAALELFHGPTL
FT                   AFKDFGGRLMAQMLAEVAGDEQITILTATSGDTGAAVAHAFYGLKNVRVVILYPNGKIS
FT                   PLQEKLFCTLGGNIHTIAIDSDFDACQALVKQAFDDEELKRTIGLNSANSINISRLLAQ
FT                   ISYYFEAVAQLPQEARNQLVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPR
FT                   FLQSGAWQPNPTVATLSNAMDVSQPNNWPRVEELFRRKNWQLKELAFGAVSDETTKTTM
FT                   LELDALGYTSEPHAAIAYRLLRDQLQPGEYGLFLGTAHPAKFKESVEAILGKTLPLPPA
FT                   LAERAEQALLSHYFAPDFAQLRKFLMELPR"
FT   gene            complement(609984..610766)
FT                   /locus_tag="Dd1591_0536"
FT   CDS_pept        complement(609984..610766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0536"
FT                   /product="protein of unknown function DUF328"
FT                   /note="PFAM: protein of unknown function DUF328; KEGG:
FT                   eca:ECA3888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05418"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ39"
FT                   /inference="protein motif:PFAM:PF03883"
FT                   /protein_id="ACT05418.1"
FT                   /translation="MLITLSPAKTLDYTSPLPTQRYTQPALLAYSLRLIQHCKQLTPAE
FT                   IASLMGISDKLADLNAARFQEWAPEFSLDNARQALLAFKGDVYTGLAAEEFDEADFDFA
FT                   QQHLRILSGLYGVLRPLDLMRPYRLEMGIRLKNDVGNDLYQFWGDTITETLNQALAAQN
FT                   DDVLINLASDEYFKSVKPARLQARLIKPVFLDEKNGKFKVISFYAKKARGLMSRFIIQN
FT                   RLTQPEQLKEFDSEGYYFDAAASSADELIFRRHERNAE"
FT   gene            611069..612022
FT                   /locus_tag="Dd1591_0537"
FT   CDS_pept        611069..612022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0537"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: eca:ECA3887 transaldolase B; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05419"
FT                   /db_xref="GOA:C6CJ40"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ40"
FT                   /inference="protein motif:TFAM:TIGR00874"
FT                   /protein_id="ACT05419.1"
FT                   /translation="MTDKLTSLRQFTTVVADTGDIAAMKLYQPQDATTNPSLILNAAQI
FT                   PEYRALIDDAVVWARAQSSKREQQLVDATDKLAVNIGLEILKLIPGRISTEVDARLSYD
FT                   TEASVAKAKRLIKLYNDAGISNDRILIKLASTWQGIRAAEQLEKEGINCNLTLLFSFAQ
FT                   ARACAEAGVFLISPFVGRILDWYKANGDKKEFAPHEDPGVISVTEIYEYYKEHGYETVV
FT                   MGASFRNVGEILELAGCDRLTIAPALLKELAESQGDVVRKLSYQGEVKARPAKLTESEF
FT                   YWQHNQDPMAVDKLADGIRKFAVDQEKLEKMIVELL"
FT   gene            complement(612049..613194)
FT                   /locus_tag="Dd1591_0538"
FT   CDS_pept        complement(612049..613194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0538"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: eca:ECA3886 hypothetical protein; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05420"
FT                   /db_xref="GOA:C6CJ41"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ41"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACT05420.1"
FT                   /translation="MNIIKSHVVRLFANPFSAFVLFGLFSVALISLLLLNSHQKDWQEE
FT                   KRNFDNIIRLYESYNAVSDVTESDQYYKVGNAMLSQVRTMAFNTRDASHECINRLSELN
FT                   LPLSDMAIIRVCQNLLSSSGNAQEKDQLITIMPILSPTDKLIGARIRITTLSPAPGVGT
FT                   LLTSSPEIITLGCISLMIAVMGSLLSLVAKKYLIELPTTARYDDLTGFLRRDAFYQLSQ
FT                   RALKTADQENSPLCAMLIDIDHFKQVNDSLGHAAGDKALKAVADIIRHSFRNRDIICRL
FT                   GGDEFAVVLPNITQENAIRVAERVREGIYEFGQSASSISPGISVSIGLVAAELPDEELD
FT                   EIIRRADVNLYRAKRTRNCTITTPPTLARQDMTETKTASIG"
FT   sig_peptide     complement(613075..613194)
FT                   /locus_tag="Dd1591_0538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.832) with cleavage site probability 0.518 at
FT                   residue 40"
FT   gene            613589..614176
FT                   /locus_tag="Dd1591_0539"
FT   CDS_pept        613589..614176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0539"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; KEGG:
FT                   eca:ECA3885 molybdenum cofactor biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05421"
FT                   /db_xref="GOA:C6CJ42"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ42"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACT05421.1"
FT                   /translation="MNGLRVGLVSISDRASSGVYQDEGIPALQAWLTEALTTPFEVQTR
FT                   LVPDEQPLIEQTLCELVDECGCHLVLTTGGTGPARRDVTPDATLAVADREMPGFGEQMR
FT                   QISLRFVPTAILSRQVGVIRKQALILNLPGQPKSIRETLSGLKDSTGQVIVPGIFASVP
FT                   YCIQLLEGPYIETNPDVVAAFRPKSAIRDIKD"
FT   gene            614306..615643
FT                   /locus_tag="Dd1591_0540"
FT   CDS_pept        614306..615643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0540"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: eca:ECA3884 putative transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05422"
FT                   /db_xref="GOA:C6CJ43"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ43"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACT05422.1"
FT                   /translation="MAGEQHRRLNRHDYQTLSLAALGGALEFYDFIIFVFFAAVIGDLF
FT                   FPADIPEWLRQVQTFGIFAAGYLARPLGGIVMAHFGDRVGRKKMFSLSILLMALPTLGM
FT                   GMLPTYASIGIAAPLLLLLMRVLQGAAIGGEVPGAWVFVAEHVPRSRIGIACGTLTAGL
FT                   TLGILFGSMIATLLNTLLPPAQISAGGWRIPFFIGGIFGLVALYLRRWLQETPIFREMQ
FT                   ARKALAAELPLKTIVFRHKKAVLVSMLLTWILSAGIVVVILMAPVYLQKLHGIPAALTL
FT                   QANSLATVTLMVGCILAGVAADRLGVGRTFVIGSLLFAVTSWFFYSYAAQSHYLLFISY
FT                   ALAGLGVGVVGAVPYVMVRAFPAAVRFSGISFSYNMAYAIFGGMTPIFVTLLMKLTPLA
FT                   PAFYVLALCSLGLVLGIYLQSHTHREVEAKAEEVEAKAEMASPASV"
FT   gene            complement(615732..616304)
FT                   /locus_tag="Dd1591_0541"
FT   CDS_pept        complement(615732..616304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0541"
FT                   /product="GPR1/FUN34/yaaH family protein"
FT                   /note="PFAM: GPR1/FUN34/yaaH family protein; KEGG:
FT                   eca:ECA3883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05423"
FT                   /db_xref="GOA:C6CJ44"
FT                   /db_xref="InterPro:IPR000791"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ44"
FT                   /inference="protein motif:PFAM:PF01184"
FT                   /protein_id="ACT05423.1"
FT                   /translation="MHVKTLANPGPLGLMGFGMTTILLNLHNAGFFPLTSIILSMGIFY
FT                   GGIAQILAGLLEYKKGNTFGVTAFTSYGAFWLTLVAIIMLPKLGLAEAADAQFLGVFLA
FT                   LWGIFTLFMFFGTLGANRALQFVFASLTVLFALLAIGNITGNHALLTFAGYEGIICGAS
FT                   AIYLAMAEVLNEQYGRTVLPIGARGAH"
FT   gene            616690..618600
FT                   /locus_tag="Dd1591_0542"
FT   CDS_pept        616690..618600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0542"
FT                   /product="chaperone protein DnaK"
FT                   /note="TIGRFAM: chaperone protein DnaK; PFAM: Heat shock
FT                   protein 70; KEGG: eca:ECA3882 molecular chaperone DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05424"
FT                   /db_xref="GOA:C6CJ45"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ45"
FT                   /inference="protein motif:TFAM:TIGR02350"
FT                   /protein_id="ACT05424.1"
FT                   /translation="MGKIIGIDLGTTNSCVAIMDGTQVKVLENSEGDRTTPSIIAYTQD
FT                   GETLVGQPAKRQAVTNPKNTLFAIKRLIGRRFQDEEVQRDTNIMPYRIIPADNGDAWVE
FT                   VKDQKLAPPQISAEVLKKMKKTAEDYLGETITEAVITVPAYFNDAQRQATKDAGRIAGL
FT                   EVKRIINEPTAAALAYGLDKGVGNRTIAVYDLGGGTFDISIIEIDDVDGEKTFEVLATN
FT                   GDTHLGGEDFDSRMINYLVDEFKKEQGFDLRNDPLAMQRLKEAAEKAKIELSSAQQTDV
FT                   NLPYITADATGPKHLNIKVTRAKLESLVEDLVTRSLEPLKVALQDAGLSVSEIHDVILV
FT                   GGQTRMPLVQKKVADFFGKEPRKDVNPDEAVAVGAAVQGGVLAGDVKDVLLLDVTPLSL
FT                   GIETMGGVMTPLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAHDNKSLGQFN
FT                   LDGIQPAPRGMPQIEVTFDIDADGILHVSAKDKNSGREQKITIKASSGLNEEEIQKMVR
FT                   DAEANAEADRKFEELVQARNQGDHLLHSTRKQLEETGDKLAAADKTAIEDALKALETAL
FT                   KGEDKADIDAKIQKLAEVSTKLLEAAQQQQAQAGAAGADNAARQDDDVVDAEFEEVKDK
FT                   K"
FT   gene            618711..619844
FT                   /locus_tag="Dd1591_0543"
FT   CDS_pept        618711..619844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0543"
FT                   /product="chaperone protein DnaJ"
FT                   /note="KEGG: eca:ECA3881 chaperone protein DnaJ; TIGRFAM:
FT                   chaperone protein DnaJ; PFAM: chaperone DnaJ domain
FT                   protein; heat shock protein DnaJ domain protein; DnaJ
FT                   central domain protein; SMART: heat shock protein DnaJ
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05425"
FT                   /db_xref="GOA:C6CJ46"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ46"
FT                   /inference="protein motif:TFAM:TIGR02349"
FT                   /protein_id="ACT05425.1"
FT                   /translation="MAKQDYYEILGVAKGADERDIKKAYKRLAMKYHPDRNPGDKEAEA
FT                   KFKEVKEAYEILTDAQKRAAYDQYGHAAFEQGGMGGGGAGGFGGADFGDIFGDVFGDIF
FT                   GGGRRQRASRGSDLRYTMELTLEEAVRGVTKEIRIPTLQECDVCHGSGAKPGSNAVTCP
FT                   TCHGNGQVQMRQGFFTVQQTCPHCHGRGKIIKDPCTKCHGHGRVEKSKTLSVKIPAGVD
FT                   TGDRIRLAGEGEAGEFGAPAGDLYVQVQVREHPIFQREDNNLYCEVPINFAMAALGGEI
FT                   EVPTLDGRVMLKVPPETQTGKLFRMRGKGVKSVRGGVQGDLLCRVVVETPVNLNDRQKQ
FT                   LLQELQESFGGPTGESNSPRSKSFFDGVKKFFDDLTR"
FT   gene            620009..621214
FT                   /locus_tag="Dd1591_0544"
FT   CDS_pept        620009..621214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0544"
FT                   /product="Na+/H+ antiporter NhaA"
FT                   /note="TIGRFAM: Na+/H+ antiporter NhaA; PFAM: Na+/H+
FT                   antiporter NhaA; KEGG: eca:ECA3880 Na(+)/H(+) antiporter 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05426"
FT                   /db_xref="GOA:C6CJ47"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ47"
FT                   /inference="protein motif:TFAM:TIGR00773"
FT                   /protein_id="ACT05426.1"
FT                   /translation="MPADAVREKNVIKLFRYLTGQEAAAGMILIIATLLALLVANIPAT
FT                   LSWYQSFLAMPVIMGIGALEINKPLLLWVNDGLMALFFLQVGLEVKRELVIGALASRRQ
FT                   AILPVVAAFGGMLVPALFFLLFNATEAETRSGWAIPTATDIAFAVGILVLLGKRVPTGL
FT                   KVFLLALAIIDDLGAIVIIALFYTQQLHWMALSGALAAIVVLAYMNHQQVMKTSAYLLV
FT                   GIVLWVCILKSGVHATLAGVIVGFFIPLRVPSGHPSPAGTLEHGLASWVAFLVIPLFAF
FT                   ANAGITLQGVAAEHLLSPLTLGIASGLLLGKPIGVSLFSWLVIRLGLGRLPAGVDFRQV
FT                   MAVSVLCGIGFTMSIFITLLAFGEVAEQDILYAKLAILLTSLTTAVLGYLTLRSVLPAA
FT                   QR"
FT   gene            621237..622127
FT                   /locus_tag="Dd1591_0545"
FT   CDS_pept        621237..622127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0545"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: eca:ECA3879 transcriptional
FT                   activator NhaR"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05427"
FT                   /db_xref="GOA:C6CJ48"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ48"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACT05427.1"
FT                   /translation="MSHINFNHLYYFWQVCKTGSVAGAAERLFLTPQTITGQIKLLEER
FT                   LQGKLFKRKGRGLEPTELGQLVFRYADKMFALSQEMLDIVNYRKESSLLFDVGVADALS
FT                   KRLVSRVLETVVNEQMPIHLRCFESTHEMLIEQLSQHKLDMILSDCPVDSGQQAGLFSR
FT                   KLGECGVSFYCRRPGPEVPFPACLSQSKLLIPARRTMLGRKLLSWFSEQNLPVDIMGEF
FT                   DDAALMTAFGMSHDAIFIAPSLHADEMAAQGEIMEIGRIDNIQDEYYVIFAERMIQHPA
FT                   VQRVCNEDFSSLFRE"
FT   gene            complement(622204..622467)
FT                   /locus_tag="Dd1591_0546"
FT   CDS_pept        complement(622204..622467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0546"
FT                   /product="ribosomal protein S20"
FT                   /note="TIGRFAM: ribosomal protein S20; PFAM: ribosomal
FT                   protein S20; KEGG: eca:ECA3878 30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05428"
FT                   /db_xref="GOA:C6CJ49"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ49"
FT                   /inference="protein motif:TFAM:TIGR00029"
FT                   /protein_id="ACT05428.1"
FT                   /translation="MANIKSAKKRAVQSEKRRKHNASRRSMMRTFIKKVYAAIATGDKE
FT                   AAQKAFNDMQPIVDRQASKGLIHKNKAARHKSNLTAQINAMQ"
FT   gene            622865..623806
FT                   /locus_tag="Dd1591_0547"
FT   CDS_pept        622865..623806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0547"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /EC_number="2.7.7.2"
FT                   /EC_number="2.7.1.26"
FT                   /note="KEGG: eca:ECA3877 bifunctional riboflavin kinase/FMN
FT                   adenylyltransferase; TIGRFAM: riboflavin biosynthesis
FT                   protein RibF; cytidyltransferase-related domain protein;
FT                   PFAM: FAD synthetase; cytidylyltransferase; Riboflavin
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05429"
FT                   /db_xref="GOA:C6CJ50"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ50"
FT                   /inference="protein motif:TFAM:TIGR00083"
FT                   /protein_id="ACT05429.1"
FT                   /translation="MQLIRGIHNLQACHYGCVLTIGNFDGVHRGHQALLERLKQEGQAR
FT                   GLPVMVMIFEPQPLELFAPEKAPARLTRLRDKVKYLAQAGVDYLLCVTFDAGFAANHAD
FT                   TFISSLLVEKLGVKFLVVGDDFRFGAGREGDFLLLQKAGAEQNFEVISTATFCSSGKRV
FT                   SSTAVREALAQDNLALAQELLGHPFSISGRVVHGNELGRTIGFPTANLPLKRQVSPVSG
FT                   VYAVQVYGLGETPLPGVANIGTRPTVTGDKRQQLEVHLLDVTLDLYGRHIDVVMCKKLR
FT                   SEQRFASLDALKQQIADDVVAAREFFGLKAPV"
FT   gene            623841..626666
FT                   /locus_tag="Dd1591_0548"
FT   CDS_pept        623841..626666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0548"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   eca:ECA3876 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05430"
FT                   /db_xref="GOA:C6CJ51"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ51"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ACT05430.1"
FT                   /translation="MSDYKTTLNLPETGFPMRGDLAKREPDMLKRWYEQDLYGIIRGAK
FT                   KGKKTFILHDGPPYANGNIHIGHSVNKILKDIIIKSKGLSGYDSPYVPGWDCHGLPIEL
FT                   KVEQLVGKPGEKVSAAQFRAECRKYAAEQVAGQKKDFIRLGVLGDWDRPYLTMDFKTEA
FT                   NIIRALGRIIENGHLHKGAKPVHWCADCGSALAEAEVEYYDKTSPAIDVAFNAVDRAAV
FT                   LAKFGLTADAVDGDVALVIWTTTPWTLPANRAIALNADIDYVLIQVAGKAIIVAQGLAD
FT                   AVIKRVAGNDASLLLGHTVKGSDLELLRFRHPFMGFDVPAILGDHVTLDAGTGAVHTAG
FT                   GHGPDDYVISQKYQLEIANPVGPNGCYLAGTFPELDGLFVFKANDKIVELLRERGALLH
FT                   HEKLQHSYPCCWRHKSPILFRATPQWFVSMDQNGLRKQSLSEIKGVQWIPDWGQARIES
FT                   MVANRPDWCISRQRTWGVPMSLFVHKETQALHPRTAELIEAVAKRVEQDGIQAWWDLNP
FT                   ADLLGAEAAEYEKVPDTLDVWFDSGSTHASVVDVRPEFSGHAADMYLEGSDQHRGWFMS
FT                   SLMISTAIKGKAPYRQVLTHGFTVDGQGRKMSKSIGNTVSPQDVMDKLGADILRLWIGS
FT                   TDYSGEIAVSDEILKRSADAYRRIRNTARFLLANLNGFDPAQHSVKPEDMVVLDRWAVG
FT                   CAKAAQDEIVDAYESYDFHHVVQRLMQFCSIEMGSFYLDIIKDRQYTAKHDSVARRSCQ
FT                   TALFHIAEALVRWMAPIMSFTADEIWAYLPGERAQFVFTEEWYDGLFGLADSESMNDTF
FT                   WADMLNVRGEVNKVIEQARNDKRIGGSLEAAVTLYADDALFAQLGRLQGELHFALLTSK
FT                   AHLAHYEDAPADAQQSELPGLKVVLTKADGEKCPRCWHYETDIGSDAAHPDVCGRCATN
FT                   VGGNGEERKFV"
FT   gene            626666..627178
FT                   /locus_tag="Dd1591_0549"
FT   CDS_pept        626666..627178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0549"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="KEGG: spe:Spro_0699 lipoprotein signal peptidase;
FT                   TIGRFAM: lipoprotein signal peptidase; PFAM: peptidase A8
FT                   signal peptidase II"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05431"
FT                   /db_xref="GOA:C6CJ52"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ52"
FT                   /inference="protein motif:TFAM:TIGR00077"
FT                   /protein_id="ACT05431.1"
FT                   /translation="MSKSTGTTATGLRWLWLAALVLVVDLGSKQWVMTHFQLGESIPLV
FT                   PFFNFTYAHNYGAAFSFLADKGGWQRWLFAAIALVIIVALLAMMYRSSASQKLNNIAYS
FT                   LIIGGAIGNLADRLVHGYVIDFLDFYAGGWHYPTFNLADSAIVVGALLIVLEGFLASPQ
FT                   KKQAEGK"
FT   gene            627182..627640
FT                   /locus_tag="Dd1591_0550"
FT   CDS_pept        627182..627640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0550"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   eca:ECA3874 FkbP-type 16 kDa peptidyl-prolyl cis-trans
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05432"
FT                   /db_xref="GOA:C6CJ53"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ53"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ACT05432.1"
FT                   /translation="MTEFVTNGSGVLVHFTLMLEDGSVAEATRDSGKPAMFRLGDGSLS
FT                   AALEAQLLGLQAGDKRQFSLPPESAFGPSNPDLVQFFLRRDFAQTGVPEVGTIMLFSGM
FT                   AGNDMPGIIREVAEESVTVDFNHPLAGHTITFDVEVLEIHPPSDGGNA"
FT   gene            627637..628587
FT                   /locus_tag="Dd1591_0551"
FT   CDS_pept        627637..628587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0551"
FT                   /product="hydroxymethylbutenyl pyrophosphate reductase"
FT                   /EC_number="1.17.7.4"
FT                   /note="KEGG: eca:ECA3873 4-hydroxy-3-methylbut-2-enyl
FT                   diphosphate reductase; TIGRFAM: hydroxymethylbutenyl
FT                   pyrophosphate reductase; PFAM: LytB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05433"
FT                   /db_xref="GOA:C6CJ54"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ54"
FT                   /inference="protein motif:TFAM:TIGR00216"
FT                   /protein_id="ACT05433.1"
FT                   /translation="MKILLANPRGFCAGVDRAISIVERALEVYGAPIYVRHEVVHNRYV
FT                   VEGLRERGAVFIEQIEDVPDGAILIFSAHGVSQAVRAEAKSRELTIFDATCPLVTKVHM
FT                   EVARASRKGTEAILIGHAGHPEVEGTMGQYNNPDGGMYLVEGPEDVWSLQVKDETNLCF
FT                   MTQTTLSVDDTSAVIDALRARFPQIIGPRKDDICYATTNRQEAVRNLAAEANVVLVVGS
FT                   KNSSNSNRLAELAQRVGKPSYLIDSADDIQEQWLKDVACVGVTAGASAPDVLVQQVIKR
FT                   LQAMGGKVAMEMQGREENIVFEVPKELRMDVREVE"
FT   gene            628659..629576
FT                   /locus_tag="Dd1591_0552"
FT   CDS_pept        628659..629576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0552"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: esa:ESA_03308 ribonucleoside hydrolase
FT                   RihC"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05434"
FT                   /db_xref="GOA:C6CJ55"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ55"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ACT05434.1"
FT                   /translation="MNRLPIILDTDPGIDDAVAIAAALFAPELDLQLITTVAGNVDVEK
FT                   TTRNALQLLHFWDAEVPVAKGAATPLVRPVRDAAYVHGESGMEGYDFVAHERTALEKSA
FT                   VQAIYDCLNRSPEPVTLVTIGPLTNIALLLTLYPQCKRQIKRLVMMGGSSGRGNFTPNA
FT                   EFNIAIDPEAAGRVFGSGIDIVMCGLDVTNDAMLSPEYLAALPGMNRTGAMLHALFSHY
FT                   RSGSMATGLRMHDLCAIAYLVKPSLFTLQHCFVAVETQGEYTAGTTVVDLEHRLNRPAN
FT                   AQVALALDVAGFRAWVAQVLALAP"
FT   gene            629781..630602
FT                   /locus_tag="Dd1591_0553"
FT   CDS_pept        629781..630602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0553"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="KEGG: kpn:KPN_00039 dihydrodipicolinate reductase;
FT                   TIGRFAM: dihydrodipicolinate reductase; PFAM:
FT                   dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05435"
FT                   /db_xref="GOA:C6CJ56"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ56"
FT                   /inference="protein motif:TFAM:TIGR00036"
FT                   /protein_id="ACT05435.1"
FT                   /translation="MRDAQIRVAIAGAGGRMGRQLIQAALQMEGVVLGAALEREGSSLL
FT                   GSDAGELAGAGKTDVTVQSSLEAVVNDFDVFIDFTRPEGTLKHLAFCRQHGKGMVIGTT
FT                   GFDEQGKAAIQQAATDIGIVFAANFSVGVNVLLKLLEKAAKVMGDYTDIEIIEAHHRHK
FT                   VDAPSGTALAMGEAIAGALGRDLKECAVYAREGYTGERDPKSIGFATIRAGDIVGEHTA
FT                   MFADVGERIEITHKASSRMTFANGAVRSALWVSARKHGLFDMRDVLGLDDI"
FT   gene            631057..632202
FT                   /locus_tag="Dd1591_0554"
FT   CDS_pept        631057..632202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0554"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, small
FT                   subunit; PFAM: Carbamoyl-phosphate synthase small chain;
FT                   glutamine amidotransferase class-I; KEGG: eca:ECA3871
FT                   carbamoyl phosphate synthase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05436"
FT                   /db_xref="GOA:C6CJ57"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ57"
FT                   /inference="protein motif:TFAM:TIGR01368"
FT                   /protein_id="ACT05436.1"
FT                   /translation="MIKSALLVLEDGTQFHGRAIGAEGAAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGANKADEESPAVHAQGLVIRDLPLIASNYRSEESLSDYLKR
FT                   NNIVAIADIDTRKLTRLLREKGAQNGCIIAGDAPDAALALEKAKAFPGLKGMDLAKEVT
FT                   TRSSYSWLQGSWTLEGELPAAKEESELPYHVVAYDYGVKRNILRMLVDRGCRLTVVPAQ
FT                   TPAEEVLKLNPDGVFLSNGPGDPEPCDYAIKAIKAFLETDIPVFGICLGHQLLALASGA
FT                   KTVKMKFGHHGGNHPVKDLDGNRVMITAQNHGFAVDETSLPATLRATHKSLFDGSLQGI
FT                   HRTDKAAFSFQGHPEASPGPHDAAPLFDHFIELIESYRNTK"
FT   gene            632290..635514
FT                   /locus_tag="Dd1591_0555"
FT   CDS_pept        632290..635514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0555"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; protein of unknown function DUF201; MGS domain
FT                   protein; Carbamoyl-phosphate synthetase large chain
FT                   oligomerisation; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; KEGG: yen:YE0622 carbamoyl phosphate
FT                   synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05437"
FT                   /db_xref="GOA:C6CJ58"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ58"
FT                   /inference="protein motif:TFAM:TIGR01369"
FT                   /protein_id="ACT05437.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVV
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLAEFGVTMIGATADAIDKAEDRRRFDIAMKKIGLETARSGIAHNMDEALAVAADVG
FT                   YPCIIRPSFTMGGTGGGIAYNREEFEEICTRGLDLSPTKELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCSIENLDAMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKTGRLIVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGATGFDPKVSLDDPEALTKIRRELKDAGGDRIWYLADAFRAGMSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEQVAEQGANGLTLEFLRVLKRKGFADARLAKLAGVSEGEIRKLR
FT                   YKYNLHPVYKRVDTCAAEFATDTAYMYSTYDEECEANPNQDRDKIMVLGGGPNRIGQGI
FT                   EFDYCCVHAALALREDGYETIMVNCNPETVSTDYDTSNRLYFEPVTLEDVLEIVRIEQP
FT                   KGVIVQYGGQTPLKLARQLEAAGVPVIGTSPDAIDRAEDRERFQQAVNRLGLKQPANAT
FT                   VSTIDQAVEKAVGIGYPLVVRPSYVLGGRAMEIVYDEVDLRRYFQTAVSVSNDAPVLLD
FT                   RFLDDAVEVDVDAICDGERVLIGGIMEHIEQAGVHSGDSACSLPAYTLSKEIQDEMRRQ
FT                   VEKLAFELSVRGLMNVQFAVKNNEVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMVG
FT                   QTLAQQGVTKEVIPPYYSVKEVVLPFNKFPGVDPILGPEMRSTGEVMGVGRTFAEAFAK
FT                   AMLGSNSPMKKTGRALLSVREGDKARVVDLAAKLLKHGFELDATHGTAVVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIVNTTAGRQAIEDSKLIRRSALQYKVHYDTTMNGGF
FT                   ATAMSLNADPTEQVISVQEMHGRIQG"
FT   sig_peptide     632290..632361
FT                   /locus_tag="Dd1591_0555"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.643) with cleavage site probability 0.569 at
FT                   residue 24"
FT   gene            complement(635619..636233)
FT                   /locus_tag="Dd1591_0556"
FT   CDS_pept        complement(635619..636233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0556"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   spe:Spro_0717 lysine exporter protein LysE/YggA"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05438"
FT                   /db_xref="GOA:C6CJ59"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ59"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACT05438.1"
FT                   /translation="MLETSLFVATIAALGMISPGPDFFLVIKNAIRYPRLAAMMTAIGV
FT                   IAGVATHMAYCVAGLAVVITTTPWLFSLLKYVGAAYLIWLGIQALRSRGGSKLDLSGLT
FT                   PQRIGLWKAFMQGYLCNLLNPKATLFFLAVFTQVLGLDSSMGEKLWYAGIILGLTLIWW
FT                   PLLIVLIQSEPVRRGLSKAQKLIDKLLGGVLITLGIKVALS"
FT   gene            636395..637177
FT                   /locus_tag="Dd1591_0557"
FT   CDS_pept        636395..637177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0557"
FT                   /product="protein of unknown function DUF1212"
FT                   /note="PFAM: protein of unknown function DUF1212; KEGG:
FT                   eca:ECA3866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACT05439"
FT                   /db_xref="GOA:C6CJ60"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:C6CJ60"
FT                   /inference="protein motif:PFAM:PF06738"
FT                   /protein_id="ACT05439.1"
FT                   /translation="MVNETTQQRDITRLCIQCALLLLQHGAESMLVEQLSSRLGVALGM
FT                   DSVESSISANAIVLTTIMQGHCLTSTRKNVDRGINMHVVTEVQHVVIMAEHKLLDVAGV
FT                   AKRFSHIKPLRYPRWLMVTIVALSCGCFSRLNGGGWDAFLVTLIASGMAMYVRQVLTAR
FT                   HLNPLINFCITAFVATSASGLLMRVPGLEQSSSVAMAASVLLLVPGFPLINAVADMFKG
FT                   HVNTGLARWTMASLLTLATCIGVVTAMAIWGLHGWSLN"
FT   gene            637162..637632
FT                   /locus_tag="Dd1591_0558"
FT   CDS_pept        637162..637632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dd1591_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA3865 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dd1591_0558"
FT