(data stored in ACNUC1104 zone)

EMBL: CP001656

ID   CP001656; SV 1; circular; genomic DNA; STD; PRO; 7184930 BP.
XX
AC   CP001656; ABKS01000000-ABKS01000068;
XX
PR   Project:PRJNA20399;
XX
DT   03-JUL-2009 (Rel. 101, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 4)
XX
DE   Paenibacillus sp. JDR-2 chromosome, complete genome.
XX
KW   .
XX
OS   Paenibacillus sp. JDR-2
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Paenibacillaceae; Paenibacillus.
XX
RN   [1]
RP   1-7184930
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Shanmugam K.T., Ingram L.O., Preston J.;
RT   "Complete sequence of Paenibacillus sp. JDR-2";
RL   Unpublished.
XX
RN   [2]
RP   1-7184930
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Shanmugam K.T., Ingram L.O., Preston J.;
RT   ;
RL   Submitted (30-JUN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; f804fd6b89fb69846cf8e445b439d3c4.
DR   BioSample; SAMN00000047.
DR   EnsemblGenomes-Gn; EBG00001446200.
DR   EnsemblGenomes-Gn; EBG00001446201.
DR   EnsemblGenomes-Gn; EBG00001446202.
DR   EnsemblGenomes-Gn; EBG00001446203.
DR   EnsemblGenomes-Gn; EBG00001446204.
DR   EnsemblGenomes-Gn; EBG00001446205.
DR   EnsemblGenomes-Gn; EBG00001446206.
DR   EnsemblGenomes-Gn; EBG00001446207.
DR   EnsemblGenomes-Gn; EBG00001446208.
DR   EnsemblGenomes-Gn; EBG00001446209.
DR   EnsemblGenomes-Gn; EBG00001446210.
DR   EnsemblGenomes-Gn; EBG00001446211.
DR   EnsemblGenomes-Gn; EBG00001446212.
DR   EnsemblGenomes-Gn; EBG00001446213.
DR   EnsemblGenomes-Gn; EBG00001446214.
DR   EnsemblGenomes-Gn; EBG00001446215.
DR   EnsemblGenomes-Gn; EBG00001446216.
DR   EnsemblGenomes-Gn; EBG00001446217.
DR   EnsemblGenomes-Gn; EBG00001446218.
DR   EnsemblGenomes-Gn; EBG00001446219.
DR   EnsemblGenomes-Gn; EBG00001446220.
DR   EnsemblGenomes-Gn; EBG00001446221.
DR   EnsemblGenomes-Gn; EBG00001446222.
DR   EnsemblGenomes-Gn; EBG00001446223.
DR   EnsemblGenomes-Gn; EBG00001446224.
DR   EnsemblGenomes-Gn; EBG00001446225.
DR   EnsemblGenomes-Gn; EBG00001446226.
DR   EnsemblGenomes-Gn; EBG00001446227.
DR   EnsemblGenomes-Gn; EBG00001446228.
DR   EnsemblGenomes-Gn; EBG00001446229.
DR   EnsemblGenomes-Gn; EBG00001446230.
DR   EnsemblGenomes-Gn; EBG00001446231.
DR   EnsemblGenomes-Gn; EBG00001446232.
DR   EnsemblGenomes-Gn; EBG00001446233.
DR   EnsemblGenomes-Gn; EBG00001446234.
DR   EnsemblGenomes-Gn; EBG00001446235.
DR   EnsemblGenomes-Gn; EBG00001446236.
DR   EnsemblGenomes-Gn; EBG00001446237.
DR   EnsemblGenomes-Gn; EBG00001446238.
DR   EnsemblGenomes-Gn; EBG00001446239.
DR   EnsemblGenomes-Gn; EBG00001446240.
DR   EnsemblGenomes-Gn; EBG00001446241.
DR   EnsemblGenomes-Gn; EBG00001446242.
DR   EnsemblGenomes-Gn; EBG00001446243.
DR   EnsemblGenomes-Gn; EBG00001446244.
DR   EnsemblGenomes-Gn; EBG00001446245.
DR   EnsemblGenomes-Gn; EBG00001446246.
DR   EnsemblGenomes-Gn; EBG00001446247.
DR   EnsemblGenomes-Gn; EBG00001446248.
DR   EnsemblGenomes-Gn; EBG00001446249.
DR   EnsemblGenomes-Gn; EBG00001446250.
DR   EnsemblGenomes-Gn; EBG00001446251.
DR   EnsemblGenomes-Gn; EBG00001446252.
DR   EnsemblGenomes-Gn; EBG00001446253.
DR   EnsemblGenomes-Gn; EBG00001446254.
DR   EnsemblGenomes-Gn; EBG00001446255.
DR   EnsemblGenomes-Gn; EBG00001446256.
DR   EnsemblGenomes-Gn; EBG00001446257.
DR   EnsemblGenomes-Gn; EBG00001446258.
DR   EnsemblGenomes-Gn; EBG00001446259.
DR   EnsemblGenomes-Gn; EBG00001446260.
DR   EnsemblGenomes-Gn; EBG00001446261.
DR   EnsemblGenomes-Gn; EBG00001446262.
DR   EnsemblGenomes-Gn; EBG00001446263.
DR   EnsemblGenomes-Gn; EBG00001446264.
DR   EnsemblGenomes-Gn; EBG00001446265.
DR   EnsemblGenomes-Gn; EBG00001446266.
DR   EnsemblGenomes-Gn; EBG00001446267.
DR   EnsemblGenomes-Gn; EBG00001446268.
DR   EnsemblGenomes-Gn; EBG00001446269.
DR   EnsemblGenomes-Gn; EBG00001446270.
DR   EnsemblGenomes-Gn; EBG00001446271.
DR   EnsemblGenomes-Gn; EBG00001446272.
DR   EnsemblGenomes-Gn; EBG00001446273.
DR   EnsemblGenomes-Gn; EBG00001446274.
DR   EnsemblGenomes-Gn; EBG00001446275.
DR   EnsemblGenomes-Gn; EBG00001446276.
DR   EnsemblGenomes-Gn; EBG00001446277.
DR   EnsemblGenomes-Gn; EBG00001446278.
DR   EnsemblGenomes-Gn; EBG00001446279.
DR   EnsemblGenomes-Gn; EBG00001446280.
DR   EnsemblGenomes-Gn; EBG00001446281.
DR   EnsemblGenomes-Gn; EBG00001446282.
DR   EnsemblGenomes-Gn; EBG00001446283.
DR   EnsemblGenomes-Gn; EBG00001446284.
DR   EnsemblGenomes-Gn; EBG00001446285.
DR   EnsemblGenomes-Gn; EBG00001446286.
DR   EnsemblGenomes-Gn; EBG00001446287.
DR   EnsemblGenomes-Gn; EBG00001446288.
DR   EnsemblGenomes-Gn; EBG00001446289.
DR   EnsemblGenomes-Gn; EBG00001446290.
DR   EnsemblGenomes-Gn; EBG00001446291.
DR   EnsemblGenomes-Gn; EBG00001446292.
DR   EnsemblGenomes-Gn; EBG00001446293.
DR   EnsemblGenomes-Gn; EBG00001446294.
DR   EnsemblGenomes-Gn; EBG00001446295.
DR   EnsemblGenomes-Gn; EBG00001446296.
DR   EnsemblGenomes-Gn; EBG00001446297.
DR   EnsemblGenomes-Gn; EBG00001446298.
DR   EnsemblGenomes-Gn; EBG00001446299.
DR   EnsemblGenomes-Gn; EBG00001446300.
DR   EnsemblGenomes-Gn; EBG00001446301.
DR   EnsemblGenomes-Gn; EBG00001446302.
DR   EnsemblGenomes-Gn; EBG00001446303.
DR   EnsemblGenomes-Gn; EBG00001446304.
DR   EnsemblGenomes-Gn; EBG00001446305.
DR   EnsemblGenomes-Gn; EBG00001446306.
DR   EnsemblGenomes-Gn; EBG00001446307.
DR   EnsemblGenomes-Gn; EBG00001446308.
DR   EnsemblGenomes-Gn; EBG00001446309.
DR   EnsemblGenomes-Gn; EBG00001446310.
DR   EnsemblGenomes-Gn; EBG00001446311.
DR   EnsemblGenomes-Gn; EBG00001446312.
DR   EnsemblGenomes-Gn; EBG00001446313.
DR   EnsemblGenomes-Gn; EBG00001446314.
DR   EnsemblGenomes-Gn; EBG00001446315.
DR   EnsemblGenomes-Gn; EBG00001446316.
DR   EnsemblGenomes-Gn; EBG00001446317.
DR   EnsemblGenomes-Gn; EBG00001446318.
DR   EnsemblGenomes-Gn; EBG00001446319.
DR   EnsemblGenomes-Gn; EBG00001446320.
DR   EnsemblGenomes-Gn; EBG00001446321.
DR   EnsemblGenomes-Gn; EBG00001446322.
DR   EnsemblGenomes-Gn; EBG00001446323.
DR   EnsemblGenomes-Gn; EBG00001446324.
DR   EnsemblGenomes-Gn; EBG00001446325.
DR   EnsemblGenomes-Gn; EBG00001446326.
DR   EnsemblGenomes-Gn; EBG00001446327.
DR   EnsemblGenomes-Gn; EBG00001446328.
DR   EnsemblGenomes-Gn; EBG00001446329.
DR   EnsemblGenomes-Gn; EBG00001446330.
DR   EnsemblGenomes-Gn; EBG00001446331.
DR   EnsemblGenomes-Gn; EBG00001446332.
DR   EnsemblGenomes-Gn; EBG00001446333.
DR   EnsemblGenomes-Gn; EBG00001446334.
DR   EnsemblGenomes-Gn; EBG00001446335.
DR   EnsemblGenomes-Gn; EBG00001446336.
DR   EnsemblGenomes-Gn; EBG00001446337.
DR   EnsemblGenomes-Gn; EBG00001446338.
DR   EnsemblGenomes-Gn; EBG00001446339.
DR   EnsemblGenomes-Gn; EBG00001446340.
DR   EnsemblGenomes-Gn; EBG00001446341.
DR   EnsemblGenomes-Gn; EBG00001446342.
DR   EnsemblGenomes-Gn; Pjdr2_R0001.
DR   EnsemblGenomes-Gn; Pjdr2_R0002.
DR   EnsemblGenomes-Gn; Pjdr2_R0003.
DR   EnsemblGenomes-Gn; Pjdr2_R0004.
DR   EnsemblGenomes-Gn; Pjdr2_R0005.
DR   EnsemblGenomes-Gn; Pjdr2_R0006.
DR   EnsemblGenomes-Gn; Pjdr2_R0007.
DR   EnsemblGenomes-Gn; Pjdr2_R0008.
DR   EnsemblGenomes-Gn; Pjdr2_R0009.
DR   EnsemblGenomes-Gn; Pjdr2_R0010.
DR   EnsemblGenomes-Gn; Pjdr2_R0011.
DR   EnsemblGenomes-Gn; Pjdr2_R0012.
DR   EnsemblGenomes-Gn; Pjdr2_R0013.
DR   EnsemblGenomes-Gn; Pjdr2_R0014.
DR   EnsemblGenomes-Gn; Pjdr2_R0015.
DR   EnsemblGenomes-Gn; Pjdr2_R0016.
DR   EnsemblGenomes-Gn; Pjdr2_R0017.
DR   EnsemblGenomes-Gn; Pjdr2_R0018.
DR   EnsemblGenomes-Gn; Pjdr2_R0019.
DR   EnsemblGenomes-Gn; Pjdr2_R0020.
DR   EnsemblGenomes-Gn; Pjdr2_R0021.
DR   EnsemblGenomes-Gn; Pjdr2_R0022.
DR   EnsemblGenomes-Gn; Pjdr2_R0023.
DR   EnsemblGenomes-Gn; Pjdr2_R0024.
DR   EnsemblGenomes-Gn; Pjdr2_R0025.
DR   EnsemblGenomes-Gn; Pjdr2_R0026.
DR   EnsemblGenomes-Gn; Pjdr2_R0027.
DR   EnsemblGenomes-Gn; Pjdr2_R0028.
DR   EnsemblGenomes-Gn; Pjdr2_R0029.
DR   EnsemblGenomes-Gn; Pjdr2_R0030.
DR   EnsemblGenomes-Gn; Pjdr2_R0031.
DR   EnsemblGenomes-Gn; Pjdr2_R0032.
DR   EnsemblGenomes-Gn; Pjdr2_R0033.
DR   EnsemblGenomes-Gn; Pjdr2_R0034.
DR   EnsemblGenomes-Gn; Pjdr2_R0035.
DR   EnsemblGenomes-Gn; Pjdr2_R0036.
DR   EnsemblGenomes-Gn; Pjdr2_R0037.
DR   EnsemblGenomes-Gn; Pjdr2_R0038.
DR   EnsemblGenomes-Gn; Pjdr2_R0039.
DR   EnsemblGenomes-Gn; Pjdr2_R0040.
DR   EnsemblGenomes-Gn; Pjdr2_R0041.
DR   EnsemblGenomes-Gn; Pjdr2_R0042.
DR   EnsemblGenomes-Gn; Pjdr2_R0043.
DR   EnsemblGenomes-Gn; Pjdr2_R0044.
DR   EnsemblGenomes-Gn; Pjdr2_R0045.
DR   EnsemblGenomes-Gn; Pjdr2_R0046.
DR   EnsemblGenomes-Gn; Pjdr2_R0047.
DR   EnsemblGenomes-Gn; Pjdr2_R0048.
DR   EnsemblGenomes-Gn; Pjdr2_R0049.
DR   EnsemblGenomes-Gn; Pjdr2_R0050.
DR   EnsemblGenomes-Gn; Pjdr2_R0051.
DR   EnsemblGenomes-Gn; Pjdr2_R0052.
DR   EnsemblGenomes-Gn; Pjdr2_R0053.
DR   EnsemblGenomes-Gn; Pjdr2_R0054.
DR   EnsemblGenomes-Gn; Pjdr2_R0055.
DR   EnsemblGenomes-Gn; Pjdr2_R0056.
DR   EnsemblGenomes-Gn; Pjdr2_R0057.
DR   EnsemblGenomes-Gn; Pjdr2_R0058.
DR   EnsemblGenomes-Gn; Pjdr2_R0059.
DR   EnsemblGenomes-Gn; Pjdr2_R0060.
DR   EnsemblGenomes-Gn; Pjdr2_R0061.
DR   EnsemblGenomes-Gn; Pjdr2_R0062.
DR   EnsemblGenomes-Gn; Pjdr2_R0063.
DR   EnsemblGenomes-Gn; Pjdr2_R0064.
DR   EnsemblGenomes-Gn; Pjdr2_R0065.
DR   EnsemblGenomes-Gn; Pjdr2_R0066.
DR   EnsemblGenomes-Gn; Pjdr2_R0067.
DR   EnsemblGenomes-Gn; Pjdr2_R0068.
DR   EnsemblGenomes-Gn; Pjdr2_R0069.
DR   EnsemblGenomes-Gn; Pjdr2_R0070.
DR   EnsemblGenomes-Gn; Pjdr2_R0071.
DR   EnsemblGenomes-Gn; Pjdr2_R0072.
DR   EnsemblGenomes-Gn; Pjdr2_R0073.
DR   EnsemblGenomes-Gn; Pjdr2_R0074.
DR   EnsemblGenomes-Gn; Pjdr2_R0075.
DR   EnsemblGenomes-Gn; Pjdr2_R0076.
DR   EnsemblGenomes-Gn; Pjdr2_R0077.
DR   EnsemblGenomes-Gn; Pjdr2_R0078.
DR   EnsemblGenomes-Gn; Pjdr2_R0079.
DR   EnsemblGenomes-Gn; Pjdr2_R0080.
DR   EnsemblGenomes-Gn; Pjdr2_R0081.
DR   EnsemblGenomes-Gn; Pjdr2_R0083.
DR   EnsemblGenomes-Gn; Pjdr2_R0084.
DR   EnsemblGenomes-Gn; Pjdr2_R0085.
DR   EnsemblGenomes-Gn; Pjdr2_R0086.
DR   EnsemblGenomes-Gn; Pjdr2_R0087.
DR   EnsemblGenomes-Gn; Pjdr2_R0088.
DR   EnsemblGenomes-Gn; Pjdr2_R0089.
DR   EnsemblGenomes-Gn; Pjdr2_R0090.
DR   EnsemblGenomes-Gn; Pjdr2_R0091.
DR   EnsemblGenomes-Gn; Pjdr2_R0092.
DR   EnsemblGenomes-Gn; Pjdr2_R0093.
DR   EnsemblGenomes-Gn; Pjdr2_R0094.
DR   EnsemblGenomes-Gn; Pjdr2_R0095.
DR   EnsemblGenomes-Gn; Pjdr2_R0096.
DR   EnsemblGenomes-Gn; Pjdr2_R0097.
DR   EnsemblGenomes-Gn; Pjdr2_R0098.
DR   EnsemblGenomes-Gn; Pjdr2_R0099.
DR   EnsemblGenomes-Gn; Pjdr2_R0100.
DR   EnsemblGenomes-Gn; Pjdr2_R0101.
DR   EnsemblGenomes-Gn; Pjdr2_R0102.
DR   EnsemblGenomes-Gn; Pjdr2_R0103.
DR   EnsemblGenomes-Gn; Pjdr2_R0104.
DR   EnsemblGenomes-Gn; Pjdr2_R0105.
DR   EnsemblGenomes-Gn; Pjdr2_R0106.
DR   EnsemblGenomes-Gn; Pjdr2_R0107.
DR   EnsemblGenomes-Gn; Pjdr2_R0108.
DR   EnsemblGenomes-Gn; Pjdr2_R0109.
DR   EnsemblGenomes-Gn; Pjdr2_R0110.
DR   EnsemblGenomes-Gn; Pjdr2_R0111.
DR   EnsemblGenomes-Gn; Pjdr2_R0112.
DR   EnsemblGenomes-Gn; Pjdr2_R0113.
DR   EnsemblGenomes-Gn; Pjdr2_R0114.
DR   EnsemblGenomes-Gn; Pjdr2_R0115.
DR   EnsemblGenomes-Gn; Pjdr2_R0116.
DR   EnsemblGenomes-Gn; Pjdr2_R0117.
DR   EnsemblGenomes-Gn; Pjdr2_R0118.
DR   EnsemblGenomes-Gn; Pjdr2_R0119.
DR   EnsemblGenomes-Gn; Pjdr2_R0120.
DR   EnsemblGenomes-Gn; Pjdr2_R0121.
DR   EnsemblGenomes-Gn; Pjdr2_R0122.
DR   EnsemblGenomes-Gn; Pjdr2_R0123.
DR   EnsemblGenomes-Gn; Pjdr2_R0124.
DR   EnsemblGenomes-Gn; Pjdr2_R0125.
DR   EnsemblGenomes-Gn; Pjdr2_R0126.
DR   EnsemblGenomes-Gn; Pjdr2_R0127.
DR   EnsemblGenomes-Tr; EBT00001600129.
DR   EnsemblGenomes-Tr; EBT00001600130.
DR   EnsemblGenomes-Tr; EBT00001600131.
DR   EnsemblGenomes-Tr; EBT00001600132.
DR   EnsemblGenomes-Tr; EBT00001600133.
DR   EnsemblGenomes-Tr; EBT00001600134.
DR   EnsemblGenomes-Tr; EBT00001600135.
DR   EnsemblGenomes-Tr; EBT00001600136.
DR   EnsemblGenomes-Tr; EBT00001600137.
DR   EnsemblGenomes-Tr; EBT00001600138.
DR   EnsemblGenomes-Tr; EBT00001600139.
DR   EnsemblGenomes-Tr; EBT00001600140.
DR   EnsemblGenomes-Tr; EBT00001600141.
DR   EnsemblGenomes-Tr; EBT00001600142.
DR   EnsemblGenomes-Tr; EBT00001600143.
DR   EnsemblGenomes-Tr; EBT00001600144.
DR   EnsemblGenomes-Tr; EBT00001600145.
DR   EnsemblGenomes-Tr; EBT00001600146.
DR   EnsemblGenomes-Tr; EBT00001600147.
DR   EnsemblGenomes-Tr; EBT00001600148.
DR   EnsemblGenomes-Tr; EBT00001600149.
DR   EnsemblGenomes-Tr; EBT00001600150.
DR   EnsemblGenomes-Tr; EBT00001600151.
DR   EnsemblGenomes-Tr; EBT00001600152.
DR   EnsemblGenomes-Tr; EBT00001600153.
DR   EnsemblGenomes-Tr; EBT00001600154.
DR   EnsemblGenomes-Tr; EBT00001600155.
DR   EnsemblGenomes-Tr; EBT00001600156.
DR   EnsemblGenomes-Tr; EBT00001600157.
DR   EnsemblGenomes-Tr; EBT00001600158.
DR   EnsemblGenomes-Tr; EBT00001600159.
DR   EnsemblGenomes-Tr; EBT00001600160.
DR   EnsemblGenomes-Tr; EBT00001600161.
DR   EnsemblGenomes-Tr; EBT00001600162.
DR   EnsemblGenomes-Tr; EBT00001600163.
DR   EnsemblGenomes-Tr; EBT00001600164.
DR   EnsemblGenomes-Tr; EBT00001600165.
DR   EnsemblGenomes-Tr; EBT00001600166.
DR   EnsemblGenomes-Tr; EBT00001600167.
DR   EnsemblGenomes-Tr; EBT00001600168.
DR   EnsemblGenomes-Tr; EBT00001600169.
DR   EnsemblGenomes-Tr; EBT00001600170.
DR   EnsemblGenomes-Tr; EBT00001600171.
DR   EnsemblGenomes-Tr; EBT00001600172.
DR   EnsemblGenomes-Tr; EBT00001600173.
DR   EnsemblGenomes-Tr; EBT00001600174.
DR   EnsemblGenomes-Tr; EBT00001600175.
DR   EnsemblGenomes-Tr; EBT00001600176.
DR   EnsemblGenomes-Tr; EBT00001600177.
DR   EnsemblGenomes-Tr; EBT00001600178.
DR   EnsemblGenomes-Tr; EBT00001600179.
DR   EnsemblGenomes-Tr; EBT00001600180.
DR   EnsemblGenomes-Tr; EBT00001600181.
DR   EnsemblGenomes-Tr; EBT00001600182.
DR   EnsemblGenomes-Tr; EBT00001600183.
DR   EnsemblGenomes-Tr; EBT00001600184.
DR   EnsemblGenomes-Tr; EBT00001600185.
DR   EnsemblGenomes-Tr; EBT00001600186.
DR   EnsemblGenomes-Tr; EBT00001600187.
DR   EnsemblGenomes-Tr; EBT00001600188.
DR   EnsemblGenomes-Tr; EBT00001600189.
DR   EnsemblGenomes-Tr; EBT00001600190.
DR   EnsemblGenomes-Tr; EBT00001600191.
DR   EnsemblGenomes-Tr; EBT00001600192.
DR   EnsemblGenomes-Tr; EBT00001600193.
DR   EnsemblGenomes-Tr; EBT00001600194.
DR   EnsemblGenomes-Tr; EBT00001600195.
DR   EnsemblGenomes-Tr; EBT00001600196.
DR   EnsemblGenomes-Tr; EBT00001600197.
DR   EnsemblGenomes-Tr; EBT00001600198.
DR   EnsemblGenomes-Tr; EBT00001600199.
DR   EnsemblGenomes-Tr; EBT00001600200.
DR   EnsemblGenomes-Tr; EBT00001600201.
DR   EnsemblGenomes-Tr; EBT00001600202.
DR   EnsemblGenomes-Tr; EBT00001600203.
DR   EnsemblGenomes-Tr; EBT00001600204.
DR   EnsemblGenomes-Tr; EBT00001600205.
DR   EnsemblGenomes-Tr; EBT00001600206.
DR   EnsemblGenomes-Tr; EBT00001600207.
DR   EnsemblGenomes-Tr; EBT00001600208.
DR   EnsemblGenomes-Tr; EBT00001600209.
DR   EnsemblGenomes-Tr; EBT00001600210.
DR   EnsemblGenomes-Tr; EBT00001600211.
DR   EnsemblGenomes-Tr; EBT00001600212.
DR   EnsemblGenomes-Tr; EBT00001600213.
DR   EnsemblGenomes-Tr; EBT00001600214.
DR   EnsemblGenomes-Tr; EBT00001600215.
DR   EnsemblGenomes-Tr; EBT00001600216.
DR   EnsemblGenomes-Tr; EBT00001600217.
DR   EnsemblGenomes-Tr; EBT00001600218.
DR   EnsemblGenomes-Tr; EBT00001600219.
DR   EnsemblGenomes-Tr; EBT00001600220.
DR   EnsemblGenomes-Tr; EBT00001600221.
DR   EnsemblGenomes-Tr; EBT00001600222.
DR   EnsemblGenomes-Tr; EBT00001600223.
DR   EnsemblGenomes-Tr; EBT00001600224.
DR   EnsemblGenomes-Tr; EBT00001600225.
DR   EnsemblGenomes-Tr; EBT00001600226.
DR   EnsemblGenomes-Tr; EBT00001600227.
DR   EnsemblGenomes-Tr; EBT00001600228.
DR   EnsemblGenomes-Tr; EBT00001600229.
DR   EnsemblGenomes-Tr; EBT00001600230.
DR   EnsemblGenomes-Tr; EBT00001600231.
DR   EnsemblGenomes-Tr; EBT00001600232.
DR   EnsemblGenomes-Tr; EBT00001600233.
DR   EnsemblGenomes-Tr; EBT00001600234.
DR   EnsemblGenomes-Tr; EBT00001600235.
DR   EnsemblGenomes-Tr; EBT00001600236.
DR   EnsemblGenomes-Tr; EBT00001600237.
DR   EnsemblGenomes-Tr; EBT00001600238.
DR   EnsemblGenomes-Tr; EBT00001600239.
DR   EnsemblGenomes-Tr; EBT00001600240.
DR   EnsemblGenomes-Tr; EBT00001600241.
DR   EnsemblGenomes-Tr; EBT00001600242.
DR   EnsemblGenomes-Tr; EBT00001600243.
DR   EnsemblGenomes-Tr; EBT00001600244.
DR   EnsemblGenomes-Tr; EBT00001600245.
DR   EnsemblGenomes-Tr; EBT00001600246.
DR   EnsemblGenomes-Tr; EBT00001600247.
DR   EnsemblGenomes-Tr; EBT00001600248.
DR   EnsemblGenomes-Tr; EBT00001600249.
DR   EnsemblGenomes-Tr; EBT00001600250.
DR   EnsemblGenomes-Tr; EBT00001600251.
DR   EnsemblGenomes-Tr; EBT00001600252.
DR   EnsemblGenomes-Tr; EBT00001600253.
DR   EnsemblGenomes-Tr; EBT00001600254.
DR   EnsemblGenomes-Tr; EBT00001600255.
DR   EnsemblGenomes-Tr; EBT00001600256.
DR   EnsemblGenomes-Tr; EBT00001600257.
DR   EnsemblGenomes-Tr; EBT00001600258.
DR   EnsemblGenomes-Tr; EBT00001600259.
DR   EnsemblGenomes-Tr; EBT00001600260.
DR   EnsemblGenomes-Tr; EBT00001600261.
DR   EnsemblGenomes-Tr; EBT00001600262.
DR   EnsemblGenomes-Tr; EBT00001600263.
DR   EnsemblGenomes-Tr; EBT00001600264.
DR   EnsemblGenomes-Tr; EBT00001600265.
DR   EnsemblGenomes-Tr; EBT00001600266.
DR   EnsemblGenomes-Tr; EBT00001600267.
DR   EnsemblGenomes-Tr; EBT00001600268.
DR   EnsemblGenomes-Tr; EBT00001600269.
DR   EnsemblGenomes-Tr; EBT00001600270.
DR   EnsemblGenomes-Tr; EBT00001600271.
DR   EnsemblGenomes-Tr; Pjdr2_R0001-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0002-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0003-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0004-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0005-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0006-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0007-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0008-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0009-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0010-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0011-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0012-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0013-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0014-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0015-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0016-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0017-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0018-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0019-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0020-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0021-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0022-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0023-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0024-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0025-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0026-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0027-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0028-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0029-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0030-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0031-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0032-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0033-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0034-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0035-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0036-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0037-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0038-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0039-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0040-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0041-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0042-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0043-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0044-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0045-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0046-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0047-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0048-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0049-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0050-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0051-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0052-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0053-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0054-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0055-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0056-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0057-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0058-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0059-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0060-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0061-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0062-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0063-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0064-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0065-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0066-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0067-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0068-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0069-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0070-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0071-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0072-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0073-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0074-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0075-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0076-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0077-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0078-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0079-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0080-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0081-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0083-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0084-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0085-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0086-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0087-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0088-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0089-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0090-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0091-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0092-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0093-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0094-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0095-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0096-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0097-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0098-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0099-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0100-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0101-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0102-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0103-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0104-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0105-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0106-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0107-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0108-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0109-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0110-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0111-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0112-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0113-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0114-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0115-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0116-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0117-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0118-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0119-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0120-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0121-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0122-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0123-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0124-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0125-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0126-1.
DR   EnsemblGenomes-Tr; Pjdr2_R0127-1.
DR   EuropePMC; PMC5104742; 27891120.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00516; ylbH.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01735; epsC.
DR   RFAM; RF01749; pan.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02162; XIST.
DR   SILVA-LSU; CP001656.
DR   SILVA-SSU; CP001656.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4043135
CC   Source DNA and bacteria available from James Preston
CC   (jpreston@ufl.edu)
CC   Contacts: James Preston (jpreston@ufl.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Paenibacillus sp. JDR-2
CC   GOLD Stamp ID         :: Gi02023
CC   Greengenes ID         :: 270979
CC   Isolation Site        :: Sweet gum stem wood buried in surface soil
CC   Oxygen Requirement    :: Aerobe
CC   Cell Shape            :: Rod-shaped
CC   Sporulation           :: Sporulating
CC   Temperature Range     :: Mesophile
CC   Temperature Optimum   :: 30 C
CC   Gram Staining         :: gram+
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Host, Wood
CC   Phenotypes            :: Methylglucuronoxylan utilization
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7184930
FT                   /organism="Paenibacillus sp. JDR-2"
FT                   /strain="JDR-2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:324057"
FT   gene            27..1379
FT                   /locus_tag="Pjdr2_0001"
FT   CDS_pept        27..1379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bsu:BSU00010 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98681"
FT                   /db_xref="GOA:C6CSZ7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSZ7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACS98681.1"
FT                   /translation="MDSHTYDLWQQVLSIIQTKLSKPSFDTWFKATKASFVNDSLLEVT
FT                   APTTFAAEWLEGRYTKLIRNTLFEFLGRQVDVRFSIEEAKPAEPAPPILPKAAEAPIIQ
FT                   EETFNHMLNPKYTFDTFVIGANNRFAHAASLAVAEAPAKAYNPLFLYGGVGLGKTHLMH
FT                   AIGHYIMDHNPSTKIMYISSEKFTNEFINAIRDNRGESFRNKYRNIDVLLIDDIQFLAG
FT                   KDGTQEEFFHTFNALHEERKQIVISSDRTPKEIPTLEERLRSRFEWGLITDIQAPDLET
FT                   RIAILRKKAKAENLDIPNEAMVYIANQIDTNIRELEGALIRVVAYSSLINQDITSHLAA
FT                   EALKDIIPSSRPKMITINDIQQKVGEFYGLRLEEFKARKRTKAVAYPRQIAMYLSRELT
FT                   DYSLPKIGEAFGGRDHTTVIHAHEKISQQLKQDQDLYKILQNLTEKIKNHT"
FT   gene            1618..2760
FT                   /locus_tag="Pjdr2_0002"
FT   CDS_pept        1618..2760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: baa:BA_0597 DNA polymerase III beta subunit;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98682"
FT                   /db_xref="GOA:C6CSZ8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSZ8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACS98682.1"
FT                   /translation="MKLSISKHELNEAIQQVAKAASSRPTIPILGGIKIEVTHQGVTLT
FT                   ASDTDISIQSFIPVERDDLVIANVDKPGNVVLPAKFFVEIVKKLPSDNVEIEVGAHFQT
FT                   LIRSGSTDIQMVGLDPEEFPVLPSIEQNELFQMPGDLLKAMIRQTVLAASVNEQTPILT
FT                   GVLWSLQDKQLKFVATDRHRLASRIAQAETAADYRFNNVVIAAKTLVELSKLVPDQHGL
FT                   VDIVVADNQVLFKIGNVLFYTRVLDGTYPDTSKIIPSVFKTELVLDTKKLTDAIDRAYL
FT                   MSREEKTNIVRLATMEDGSIEISSSSTELGRVTEQLEPKQFDGEPLKIAFNSKYMLDVL
FT                   KVIDSEHIFIGFTGAMSPIVIRPTDHSYNTYVILPYRTTN"
FT   gene            2808..3023
FT                   /locus_tag="Pjdr2_0003"
FT   CDS_pept        2808..3023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="TIGRFAM: S4 domain protein YaaA; KEGG: baa:BA_0598
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98683"
FT                   /db_xref="GOA:C6CSZ9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSZ9"
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /protein_id="ACS98683.1"
FT                   /translation="MKEIAIRDEYITLGQFLKLADCISTGGHAKFFLQENEVHINGVVD
FT                   NRRGRKLYVGDRVEVEGCGVFTVTGA"
FT   gene            3062..4171
FT                   /locus_tag="Pjdr2_0004"
FT   CDS_pept        3062..4171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: baa:BA_0599 RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98684"
FT                   /db_xref="GOA:C6CT00"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C6CT00"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACS98684.1"
FT                   /translation="MFLKSIQLQNYRNYKELELVTDNKVNLFVGPNAQGKTNLLEAIFA
FT                   LALTKSHRTSKDKELIGWEADSARIHGEVEKRYGTLKLDLMYSSQGKKAKINGLEQRKL
FT                   SDFIGSLNVVMFAPEDLEIVKGTPGIRRRFLDMEIGQVQPGYLHTLTQYTKVLAQRNNY
FT                   LKTATPGGSQQAMLEIWNMQLAEHGVKIMKKRKHFIHKLQRWAEHIHSGITAGGERLTI
FT                   EYRPSFDGGASEDETVLFEQFMLKLSQVKDQEIRRGMSLVGPHRDDMAFFINGKEAAVY
FT                   GSQGQQRTTALSLKLAEIELICEEIGEYPLLLLDDVLSELDQNRQTQLIETFQSKVQTF
FT                   ITTTGLESVNVSKLQGAGIYDVREGRVTR"
FT   gene            4201..4452
FT                   /locus_tag="Pjdr2_0005"
FT   CDS_pept        4201..4452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98685"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:C6CT01"
FT                   /inference="similar to AA sequence:KEGG:BH0005"
FT                   /protein_id="ACS98685.1"
FT                   /translation="MYIHLGGEKIIRAAELVAIFDISIEQSSKLSKQFVAGARKRKDVE
FT                   TIGEEEPKSIVVTKQKIYYSPISSSTLKKRAHHFAANG"
FT   gene            4494..6401
FT                   /locus_tag="Pjdr2_0006"
FT   CDS_pept        4494..6401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: baa:BA_0600 TOP2c, topoisomeraseII; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA topoisomerase type IIA
FT                   subunit B region 2 domain protein; DNA gyrase subunit B
FT                   domain protein; TOPRIM domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98686"
FT                   /db_xref="GOA:C6CT02"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CT02"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACS98686.1"
FT                   /translation="MSQQNTYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEVV
FT                   DNSIDEALAGYCTKIQVRVHEDNSITVIDNGRGIPVGENAKLKKSTLEVVMTVLHAGGK
FT                   FGGEGYKVSGGLHGVGVSVVNALSEHVTVTVKLHGNVYQQEYRRGVPQYDVKIIGESDE
FT                   TGTTVKFKPDPEIFTDTTVYEYETLQSRIRELAFLNKGLEIELIDERTGTSNSFKYDGG
FT                   IIEFVKHLNRNKEVMHEEPIYVEGSKDHIQVEVSLQYNDGYTENIHSFANNINTHEGGT
FT                   HESGFKSALTRIINDYARKTGLIKDNDSNFSGDDVREGLTAIISVKIPEPQFEGQTKTK
FT                   LGNSEVRGIVESFFAEKLQEFLDENPSVSRKIVEKGLQAARAREAARKARELTRRKSAL
FT                   EVSSLPGKLADCSSKDASISELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNVERAR
FT                   LDRILGNAEIRAIITALGTGIGDDFDLAKARYHKVIIMTDADVDGAHIRTLMLTFFFRY
FT                   MRKIIEAGYIYIAQPPLFKIERNKVIRYAQSEKEREEIIAEFGEGAKVNVQRYKGLGEM
FT                   NATQLWETTMDPESRTMLQVSIEDAIEADVIFDTLMGDNVEPRRDFIQQFAKDVKNLDI
FT                   "
FT   gene            complement(6429..7190)
FT                   /locus_tag="Pjdr2_0007"
FT   CDS_pept        complement(6429..7190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98687"
FT                   /db_xref="GOA:C6CT03"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:C6CT03"
FT                   /inference="similar to AA sequence:KEGG:PHYPADRAFT_103108"
FT                   /protein_id="ACS98687.1"
FT                   /translation="MSIQLVYSKWEKTNVLLHSPALREYIPSTRLFNKENLQLMLAEYG
FT                   MVYVKPVNGTFGKGVMRVERLKQAAKGYKYQLNTTIRTFPTLELLHQSLAKRINGRRYL
FT                   VQRGIDLLRHKNRRFDIRVMVQRNENNHWEATGIIGRLAHPAKVVTNYHNGGTPMSFER
FT                   LLSSHQSPTQKMIYAMRLKQISLDIAKELEKHYPGIKELGIDIAIDQQQRPWILEVNTK
FT                   PDAFIFRKLEDKSMFRKIYQYAVSYGRYKKK"
FT   gene            7486..9993
FT                   /locus_tag="Pjdr2_0008"
FT   CDS_pept        7486..9993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0008"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.6.2.3"
FT                   /note="KEGG: bha:BH0007 DNA gyrase subunit A; TIGRFAM: DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; SMART: DNA
FT                   gyrase/topoisomerase IV subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98688"
FT                   /db_xref="GOA:C6CSZ5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSZ5"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACS98688.1"
FT                   /translation="MAEEQQHSQIKDRDIGTEMRDSFMDYAMSIIVSRALPDVRDGLKP
FT                   VHRRILYAMSELGMSSDKPYKKSARIVGEVIGKYHPHGDSSVYEAMVRMAQDFSMRYML
FT                   VDGHGNFGSIDGDMAAAMRYTEARLSKIAMEMLRDLNKETVDFVPNYDGEEKEPAVLPS
FT                   RFPNLLVNGVTGIAVGMATNIPPHNLTEVIDGIQALIRNPEITPVELIDYVKGPDFPTA
FT                   GIVMGLSGIRQAYLTGRGTVTMRARATIEENGNKARIIVYELPYQVNKARLVEKIAELV
FT                   REKKIEGITDLRDESDRNGMRVVIELRRDVTPSVVLNNLYKQTQMQSNFGINMLALVNG
FT                   EPKTLNIREMLYYYLQHQIEVIRRRTEYDLKKAEARAHILEGLRIALDHLDEVIALIRA
FT                   SQTADIAREGLIERFALSYEQAQAILDMRLQRLTGLERDKIEAEYAELMKKIAEYKAIL
FT                   ADEQLVLNIISDELNEIKERFGDERRTEITVSDEEILDEDLIPREDVIISITHTGYIKR
FT                   LPVTTYRSQKRGGKGVVGMDTKEHDFVEHLFVSNTHHYLLFFTNKGKVYRLKAYEIPDL
FT                   SRTARGTPIINLIQIEQGETINAVIPVESFDSESYLFFATRQGIVKKTPLDDYMNIRKV
FT                   GLIAISIREDDELIGVKLTDGNQEIVMGTAQGMSIRFSEQDVRSMGRSATGVKGIQLDD
FT                   DDTVIDMDVVNPENDVLIVTAKGYGKRTPMSEYRIQNRGGKGIKTLNVTDKNGPIVSLK
FT                   VVLNDEDLMIMTALGTLIRTSMEGISTMGRNTQGVKLINTRDDDTVSTVTRVARSEETD
FT                   ETFEEGEEFEGTAPDAGTEPAEE"
FT   gene            10036..11109
FT                   /locus_tag="Pjdr2_0009"
FT   CDS_pept        10036..11109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0009"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: bha:BH0008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98689"
FT                   /db_xref="GOA:C6CSZ6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSZ6"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACS98689.1"
FT                   /translation="MATVALSQVKLGDKISEDVLTPLGGVLLQKGRIVTPRELDIMQAF
FT                   LVPKVQIEQPANQAEKMQDNATQELQAAAPVVSATPLHDEYDQMIVVLKRVINEIRSGQ
FT                   PIPVMDIRNQLEKMMQHEDSYQVLTFMPRLFAERDYLLHNSILVGLTSYRIAQWCGLPR
FT                   KDWMPVALAGLLHDIGNVKIDTAILAKPTALTSEENEEMKRHTVFGYQLLKNIASLNEG
FT                   VKLAALQHHERIDGSGYPLAIDSSKIHPYAKIVAIADIYHAMTLNRFYRKAASPYFVLE
FT                   QIQSDSFGKLDPAYVRVFVEKVTQFHNGNIVKLSDDRVGEIVFSDSVHPTRPWVSVGGT
FT                   IINLTIERHLHIKEVMG"
FT   gene            11439..12972
FT                   /locus_tag="Pjdr2_R0001"
FT   rRNA            11439..12972
FT                   /locus_tag="Pjdr2_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            13170..13285
FT                   /locus_tag="Pjdr2_R0002"
FT   rRNA            13170..13285
FT                   /locus_tag="Pjdr2_R0002"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            13448..16378
FT                   /locus_tag="Pjdr2_R0003"
FT   rRNA            13448..16378
FT                   /locus_tag="Pjdr2_R0003"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            16452..16567
FT                   /locus_tag="Pjdr2_R0004"
FT   rRNA            16452..16567
FT                   /locus_tag="Pjdr2_R0004"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(16618..17148)
FT                   /locus_tag="Pjdr2_0010"
FT   CDS_pept        complement(16618..17148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98690"
FT                   /db_xref="GOA:C6CRH3"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRH3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98690.1"
FT                   /translation="MRQSLLDQQAATIYQYKLIRRKVIRPELVQSHILIAVILLAFQLL
FT                   MYRMDGLFSWLIGFAIVQVIHLVILLLAFIRVDDAVDRRWVWGITPPWFGFKPANDIRL
FT                   ALYRRVHRHLFWIGLCAVAVMYPWIQPSLLISILCWHLWLIIPRMLLSLAFRKQHKDGI
FT                   LRLQKNEASYYHQ"
FT   gene            17324..17515
FT                   /locus_tag="Pjdr2_0011"
FT   CDS_pept        17324..17515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0011"
FT                   /product="sigma-F transcribed protein"
FT                   /note="KEGG: bha:BH0040 sigma-F transcribed protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98691"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRH4"
FT                   /inference="similar to AA sequence:KEGG:BH0040"
FT                   /protein_id="ACS98691.1"
FT                   /translation="MSEERELHCSICGEHKAEGEGIRIVSGFICESCESEMVRTDVKDA
FT                   KYPFFIHQMKQIFIEKNA"
FT   gene            17606..19078
FT                   /locus_tag="Pjdr2_0012"
FT   CDS_pept        17606..19078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0012"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   bar:GBAA0026 lysine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98692"
FT                   /db_xref="GOA:C6CRH5"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRH5"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ACS98692.1"
FT                   /translation="MNRLQAPLFEALVQHYETEPAGFHVPGHGYGHIYENEQSKAMKWL
FT                   SRVMRLDVTELSSTDDLHHPEASIAEAQKLAAQCFGADETCFLVGGSTSGNLSMILGVC
FT                   EPGNLMIVQRNVHKSVINGLKLAGVRAIFVTPRMDEETGLPTTPSLECIEQALELYPEA
FT                   KAVFLTNPNYYGMTTNLTSYAELVHTYNSLLLVDEAHGAHYGLNPAFPESAIQAGADAV
FT                   VQSTHKTLSALTMGAMLHLKGDRIPRASIKEVLAAIQSSSPSFPIMASLDVARVMVDRY
FT                   GAEWFELGVASVQAFRTWIVKEDGALKVLQADQGSTAYDSLDPLRVVLWDRTGTFTGFE
FT                   LQKLMEEQGCWAEMADIKHVVLVWGCRTGEDARLELQAACKQIEYIIKANSSKRGSVST
FT                   SYYPGNGSPNPLKPVEWSRKKREHQRLPLVESEGYEAAEMVVPYPPGIPILYPGEVLTK
FT                   EMIGYISTLAETGAKFQGAVDSMMQTIAVYPR"
FT   gene            19176..19829
FT                   /locus_tag="Pjdr2_0013"
FT   CDS_pept        19176..19829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0013"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="KEGG: bha:BH0042 thymidylate kinase; TIGRFAM:
FT                   thymidylate kinase; PFAM: thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98693"
FT                   /db_xref="GOA:C6CRH6"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRH6"
FT                   /inference="protein motif:TFAM:TIGR00041"
FT                   /protein_id="ACS98693.1"
FT                   /translation="MNKGIFITIEGGEGAGKTTLIEQLAHTMQQRGKTVITTREPGGIP
FT                   IAEQIRSVILDRNHTGMDARTEALLYAASRRQHLVEKVMPALADGQIVICDRFVDSSLA
FT                   YQGHARGLGMEEVWSINRFAVDGAMPQLTIYMDIDPEVGLARIRAAGEREVNRLDLESL
FT                   AFHQLVREGYQKLLEQFPERIVQIDAGNAANAVLEEVILTIDHRFKGFFAADVQ"
FT   gene            19889..20218
FT                   /locus_tag="Pjdr2_0014"
FT   CDS_pept        19889..20218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0014"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   bha:BH0043 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98694"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRH7"
FT                   /inference="protein motif:PFAM:PF06153"
FT                   /protein_id="ACS98694.1"
FT                   /translation="MKLVIAIVQDKDSNRLSNALVKDGFRATKLASTGGFLRAGNTTFM
FT                   IGIEDERVHEVLQVISSNCKVRDQLVTPVSPIGGSTDSYIPFPVEVQVGGAAVFVVPVE
FT                   RFEHF"
FT   gene            20235..20678
FT                   /locus_tag="Pjdr2_0015"
FT   CDS_pept        20235..20678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0015"
FT                   /product="protein of unknown function DUF327"
FT                   /note="PFAM: protein of unknown function DUF327; KEGG:
FT                   bha:BH1478 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98695"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRH8"
FT                   /inference="protein motif:PFAM:PF03885"
FT                   /protein_id="ACS98695.1"
FT                   /translation="MKIDQSWRPLGQNRAGGDTATKPAPARSFSDALVQQDALRTQEQL
FT                   QQKLTEIHNQGERLARTMTVRELKMYRQMVKRFLEDTVKRGIGLKELRGFDRRGRTKRY
FT                   KLLDEIDSALVSMAEELLETEQGRIELLGRIGEIRGLLINLLF"
FT   gene            20694..21671
FT                   /locus_tag="Pjdr2_0016"
FT   CDS_pept        20694..21671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0016"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: bha:BH0044 DNA polymerase III subunit delta'"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98696"
FT                   /db_xref="GOA:C6CRH9"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRH9"
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /protein_id="ACS98696.1"
FT                   /translation="MSMEQVAGQWKAKRILKHALQSGKVSHAYLFYGPSGTGRKAMARA
FT                   FAKALFCTSGGDDACDHCLECRKFENGNQPDLLTITPDGQSIKIDQIRELQRELAYRGS
FT                   GASRKVYIVERAETMTLQAANSLLKFLEEPLSPIVAILITDNGQAVLPTIRSRAQWVPF
FT                   LPFSASEMLQSLVDEGASPTLARAAVQLSSGLDGAREIIQQNQFAEIRNVVIQLGKESL
FT                   TRFTAGMLTAQQQFFKTDLAGEAQLMLSLLVLWFKDMIQFQAGRQESIVYIDQLDWISK
FT                   HAFNRPIESWIACIEHTLEAGKKIRSNVSPQLAVEQLLVNLQEG"
FT   gene            21676..22485
FT                   /locus_tag="Pjdr2_0017"
FT   CDS_pept        21676..22485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0017"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: baa:BA_0620
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98697"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRI0"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ACS98697.1"
FT                   /translation="MYNVVGVRFKKAGKIYYFDPALHPVDKDQHVIVETARGIEYGKVV
FT                   VGQKEVGEEDVVLPLKKVIRIASEVDAKVVEENRAAAKNAFATCLDKIRDHQLKMKLVD
FT                   VEFTFDRNKIIFYFTAEGRVDFRELVKDLASVFRTRIELRQIGVRDEAKMLGGIGPCGR
FT                   VLCCSSWLGDFEPVSIKMAKDQNLSLNPTKISGLCGRLMCCLKYEHDNYESVREELPSV
FT                   GKIVVTSYGEGKVTGINASTKSVYVQLFDVSGKPKELPLDDVVVKEI"
FT   gene            22518..22934
FT                   /locus_tag="Pjdr2_0018"
FT   CDS_pept        22518..22934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0018"
FT                   /product="protein of unknown function DUF972"
FT                   /note="PFAM: protein of unknown function DUF972; KEGG:
FT                   baa:BA_0621 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98698"
FT                   /db_xref="GOA:C6CRI1"
FT                   /db_xref="InterPro:IPR010377"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRI1"
FT                   /inference="protein motif:PFAM:PF06156"
FT                   /protein_id="ACS98698.1"
FT                   /translation="MENKEIFNQMDELESRMGDFHVHLGVLKQRVKELLEENQQLSMEN
FT                   EQLRKILKRETSPKPKTAANRQGGQAVQPARREVAVHAEEDTVNDTSQQAGLVGEAHDN
FT                   LARLYHEGFHICNVYYGHLRTEGDCLFCLSFLNK"
FT   gene            23006..23701
FT                   /locus_tag="Pjdr2_0019"
FT   CDS_pept        23006..23701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0019"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: bsu:BSU00340
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98699"
FT                   /db_xref="GOA:C6CRI2"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRI2"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ACS98699.1"
FT                   /translation="MQEVKLEPNERIDDLMTETGLHIIQSREVFSFSLDAVLLSKFATI
FT                   PKRGRILDLCTGNGVIPMLLTTRTDARIDAVEIQPRLADMARRSVAMNNLSEQVSIIEG
FT                   DLKIFMKEAGNGIYDAVTVNPPYMAVKAGDSNENDHYAIARHEIHCTLDDVVHACARLV
FT                   RSGGKVAMVHRPSRFIDIMETMRKYRLEPKRVQFIHPNAQGEANMVLIEAIRDGKPELR
FT                   LLPPVFVYE"
FT   gene            23732..24619
FT                   /locus_tag="Pjdr2_0020"
FT   CDS_pept        23732..24619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0020"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: bha:BH0049
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98700"
FT                   /db_xref="GOA:C6CRI3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRI3"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACS98700.1"
FT                   /translation="MIQIQKSFKDQANNDYGILYLVGTPIGNLEDMTYRAIRTLKEVQL
FT                   IAAEDTRQTRKLLTHFEISTRLVSYHEHNKQASGSELIRLLIEGQSIALVSDAGLPAVS
FT                   DPGADLVKDAVEAGIKVVPIPGANAALSALIISGLPTDRFVFTGFPPRDKKPLAEWLTR
FT                   LVRQEGTLMMYESPHRLKKTLDAMLEHWGDRRIAMVRELTKRHEEAARGSISECLAFLE
FT                   ENPPLGEYCLIIEGAAAGAGDSGDNGETWWASLELEEHVAHYENEGIDRKEAIKKAAQD
FT                   RGLPKREVYNAVNR"
FT   gene            complement(24743..24997)
FT                   /locus_tag="Pjdr2_0021"
FT   CDS_pept        complement(24743..24997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0021"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: baa:BA_0625
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98701"
FT                   /db_xref="GOA:C6CRI4"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRI4"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ACS98701.1"
FT                   /translation="MMKSTGIVRKVDELGRVVIPIELRRTLGIGEKDALEIYVDGERIM
FT                   LKKYEPACIFCGNAENVSYFKGKIVCHICLSEMPSPVTK"
FT   gene            25282..26577
FT                   /locus_tag="Pjdr2_0022"
FT   CDS_pept        25282..26577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0022"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: bha:BH3818 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98702"
FT                   /db_xref="GOA:C6CRI6"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRI6"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACS98702.1"
FT                   /translation="MNQQLTEEKVFKDPVHKYIYVQDQTVWDLINTKEFQRLRRIRQLG
FT                   TSYLTFHGAEHSRFSHSLGVYEITRKIISQFERNEYPGWPMEERLLALCAALLHDVGHG
FT                   PFSHSLEQVFDTHHEQWTCAILLEDTEVNRVLRRVSEDFPEKVASVISKTYPNPIVVSL
FT                   ISSQMDADRMDYLLRDAYFTGVNYGNFDLERILRVLRPVQGKIVVKDSGMHAIEHYLMS
FT                   RYQMYWQIYFHPVTRSSEIILRQITRRAKELYDSGYAFSWMPGPINRLLDGNITVPDYL
FT                   KLDEAYMQTIFSLWTEEKDALLAELCDRFLNRQLYKYITLDDPGDSLLEEAALEFIAIG
FT                   LNPDYHMEIDFPFDQPYDIYRPDAKKGGKEDKAPILLLSDDNSLSEISVKSDIVRSISG
FT                   LHQGQYHVYYPIEPLLAAADRLSPAVRKLFKI"
FT   gene            26608..27381
FT                   /locus_tag="Pjdr2_0023"
FT   CDS_pept        26608..27381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0023"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: baa:BA_0627 TatD related DNase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98703"
FT                   /db_xref="GOA:C6CRI7"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRI7"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ACS98703.1"
FT                   /translation="MISLFDTHTHLDSPQFDNDRAEVIERARAAGVDLMINIGFNRETI
FT                   PTTMELAEKYDFIYAAVGWHPVDSVFMEPGDLEWIEQLCSHPKVVAIGEIGLDYHWDNS
FT                   PKDVQHRVFREQIRLARKLGKPIVIHNRDAHEDIVRILREEKASEVGGVMHCYSGSWET
FT                   AKMCLDMNFYISFGGPVTFKNARVPKEVLAKVPLDRLLIETDSPYLSPHPFRGKRNESA
FT                   YVSLVAEAAAEITGKSKEEIAVITSANGKKCFGIV"
FT   gene            28019..29152
FT                   /locus_tag="Pjdr2_0024"
FT   CDS_pept        28019..29152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0024"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; protein of unknown function
FT                   DUF348; G5 domain protein; KEGG: bsu:BSU00400 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98704"
FT                   /db_xref="GOA:C6CRI8"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRI8"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ACS98704.1"
FT                   /translation="MGMIQAKGTHGKRSSSMTFAMRWKHENLRLIVLSAIISIAMTFMF
FT                   LVLLYGSADKSVSVVVNGQETVVKTKQWVLQRLLDEQAITVGPYDEVSHPLNASIKDGD
FT                   RIEIKYAVPVTVKADGKTSTVYTTEKTVQAAIGKLNIPVRDQDKVTPSLDSQISKALTV
FT                   TVTRIDTKVAENERTLPFSIVKKQDPTLEKGKEKLVQSGKNGLVIERVEKKYENGVLVS
FT                   SKLVDKVVQKHTVSQVVAIGSKKDVHTLSATSTASYTKSGVTFKPKKVLKNVTLTAYSA
FT                   GIESTGKDESHPGYGITASGAKVKEGRTIAVDPDVIPIGWWVYIEGIGFRRAEDTGSAI
FT                   NGNKIDVYFDSTSYANKFGRKKGYTVYVLGPTKPTAS"
FT   gene            29308..29853
FT                   /locus_tag="Pjdr2_0025"
FT   CDS_pept        29308..29853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0025"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="KEGG: baa:BA_0628 the topoisomerase- primase domain-
FT                   a nucleotidyl transferase/hydrolase domain; TIGRFAM:
FT                   primase/topoisomerase like protein; PFAM: TOPRIM domain
FT                   protein; SMART: Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98705"
FT                   /db_xref="GOA:C6CRI9"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRI9"
FT                   /inference="protein motif:TFAM:TIGR00334"
FT                   /protein_id="ACS98705.1"
FT                   /translation="MIKEIIVVEGKDDTVAVKRAVEADTIETNGSAVGEEVLRRIELAM
FT                   ERRGVIIFTDPDHAGERIRKIVARRVPGCKHAFLPQEKAMYKGDIGIENASPEAIRQAL
FT                   SELRTEMVAGEGDITWEDLMEAGLIVHPDAANRRLQMGKLLGIGYANGKQFFKRCTSFR
FT                   ISREEFAEALRTMEQGQE"
FT   gene            29859..30755
FT                   /locus_tag="Pjdr2_0026"
FT   CDS_pept        29859..30755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0026"
FT                   /product="dimethyladenosine transferase"
FT                   /note="KEGG: bsu:BSU00420 dimethyladenosine transferase;
FT                   TIGRFAM: dimethyladenosine transferase; PFAM: ribosomal RNA
FT                   adenine methylase transferase; SMART: ribosomal RNA adenine
FT                   methylase transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98706"
FT                   /db_xref="GOA:C6CRJ0"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRJ0"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ACS98706.1"
FT                   /translation="MSGNDMKAIEVATPKRTKEIIAKYGFSFKKSLGQNFLIDQNILHK
FT                   IVSAAGLDKTKGALEIGPGIGALTQHLAAAAGTVTAIEIDNRLIPILGDILAGEEHVKV
FT                   VHGDVLKLDLKKLFEERFADVAGVSVVANLPYYVTTPILMKLLEERLPLENIVVMIQKE
FT                   VAERMAAKPGGKEYGSLSVAVQYYCEPQLVCIVPHTVFIPQPNVDSAVIKLAVREKPPV
FT                   EVEDEAHFFRIVQASFAQRRKTLANNLTAFVGKERREEMTQLLISCEIDPVRRGETLSL
FT                   DEFARISRAFLAAGWRG"
FT   gene            complement(31805..32002)
FT                   /locus_tag="Pjdr2_0027"
FT   CDS_pept        complement(31805..32002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98707"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRJ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98707.1"
FT                   /translation="MCGENCADGLGQGHMDSGCRIEGRGNSQRPLLPVHCLNLCHMGGN
FT                   VQTTADVPLLMGVTPYPLCG"
FT   gene            32047..32940
FT                   /locus_tag="Pjdr2_0028"
FT   CDS_pept        32047..32940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0028"
FT                   /product="sporulation peptidase YabG"
FT                   /note="TIGRFAM: sporulation peptidase YabG; PFAM: peptidase
FT                   U57 YabG; KEGG: bsu:BSU00430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98708"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRJ2"
FT                   /inference="protein motif:TFAM:TIGR02855"
FT                   /protein_id="ACS98708.1"
FT                   /translation="MKQGDLVVRNSYGGDVLFRVEEMRSDQALLKGTDYRLLADAPIPD
FT                   LSVVRDPESTSARQQVKIKVNDSLKRMRQEKAHLTVLSSPDRAALQQQSQSYFELPGKV
FT                   LHLDGDGNYLRKSMQLYQTMKVPAHGVHAHESQMAQLLYRLLPQVKPDIVVITGHDGVL
FT                   KNREGEDLYSLSSYKNSQHFVNAVRVARQYEKNMDGLVVVAGACQSHFEALLQSGSNFA
FT                   SSPGRILIHALDPVYIAIKASYTSVRESINLSDVIHGTISGIDGVGGIETMGRHRMGLP
FT                   KPKKVTHSTASMKITS"
FT   gene            33096..33371
FT                   /locus_tag="Pjdr2_0029"
FT   CDS_pept        33096..33371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0029"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   bha:BH0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98709"
FT                   /db_xref="GOA:C6CRJ3"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRJ3"
FT                   /inference="protein motif:PFAM:PF06257"
FT                   /protein_id="ACS98709.1"
FT                   /translation="MAKNALLEIKRNLEAHVGSKIRLRANGGRRKTIERTGTLEEIYPS
FT                   VFIVKLDQESHAFKRVSYSYADILTESVEVTVCNDEGQVRITHIQQ"
FT   gene            33528..33713
FT                   /locus_tag="Pjdr2_0030"
FT   CDS_pept        33528..33713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0030"
FT                   /product="small acid-soluble spore protein (alpha/beta-type
FT                   SASP)"
FT                   /note="KEGG: bsu:BSU00450 small acid-soluble spore protein
FT                   (alpha/beta-type SASP)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98710"
FT                   /db_xref="GOA:C6CRJ4"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRJ4"
FT                   /inference="similar to AA sequence:KEGG:BSU00450"
FT                   /protein_id="ACS98710.1"
FT                   /translation="MGRRRSVMSEQLKYELAKDLGFINKVEQEGWGGISTKDAGNMVKR
FT                   AIQLAEQAAARNHGQQ"
FT   gene            33840..34694
FT                   /locus_tag="Pjdr2_0031"
FT   CDS_pept        33840..34694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0031"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: bsu:BSU00460
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98711"
FT                   /db_xref="GOA:C6CRJ5"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRJ5"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACS98711.1"
FT                   /translation="MKIYEKAPAKINLLLDVLRKREDGFHEVEMIMTMVDLADRLELEE
FT                   LPRDTIIISSQAGYIPLDEKNLAFQAARLIKERYDVRKGVYIHLDKKIPVAAGLAGGSS
FT                   DAAAALRGLNRLWQLNISEDELCRLGAELGSDVPFCVTGGTAIARGRGEKLERISNPPQ
FT                   CWVVLAKPPINVSTADVYGKLRANELKNHPSTKDMVSAIERGSFSDICAGLGNVLENVT
FT                   LDLYPEVLQLKESMQKLGADGVLMSGSGPTVFGLVSKEAKLPRIYNGLRGFCKEVYVVR
FT                   MLT"
FT   gene            34776..35600
FT                   /locus_tag="Pjdr2_0032"
FT   CDS_pept        34776..35600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0032"
FT                   /product="purine operon repressor, PurR"
FT                   /note="TIGRFAM: pur operon repressor; PFAM: purine
FT                   repressor; phosphoribosyltransferase; KEGG: bsu:BSU00470
FT                   pur operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98712"
FT                   /db_xref="GOA:C6CRJ6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR010078"
FT                   /db_xref="InterPro:IPR015265"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRJ6"
FT                   /inference="protein motif:TFAM:TIGR01743"
FT                   /protein_id="ACS98712.1"
FT                   /translation="MKKLKRSARLVEMTQYLLSRPHTLISLTAFADRYQSAKSSISEDL
FT                   AIIKEVFEEEGFGELNTLAGAAGGVKYTPKMHTSTALSIMDNICRQLEQPERVLPGGYL
FT                   YMTDMLGQPELLADVGRMFATAFADRNIDVIMTVETKGIPLAYATAACLNLPVVIVRRD
FT                   NKVTEGSAVSINYVSGSNKRIQTMSLARRALKEQSRVLIIDDFMKAGGTIQGMMDLLYE
FT                   FKATVAGVGVFVESGEVEHEERLLEDYVSLATLTAVDLKTKQTKVIPGNYFK"
FT   gene            35663..36058
FT                   /locus_tag="Pjdr2_0033"
FT   CDS_pept        35663..36058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0033"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="TIGRFAM: endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: bha:BH0063 translation
FT                   initiation inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98713"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRJ7"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ACS98713.1"
FT                   /translation="MTDKKLQVIATDKAPAAIGPYSQAIKVGDLLFTSGQIPLDASGQL
FT                   VEGGIEEQTHQVFRNLQAVLEEAGVTLNNVVKATVFMKDMNQFAIVNGIYSSYFGEHKP
FT                   ARSAVEVARLPKDVLVEIELIASTVVE"
FT   gene            36188..36472
FT                   /locus_tag="Pjdr2_0034"
FT   CDS_pept        36188..36472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0034"
FT                   /product="SpoVG family protein"
FT                   /note="PFAM: SpoVG family protein; KEGG: bha:BH0064
FT                   regulatory protein SpoVG"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98714"
FT                   /db_xref="GOA:C6CRJ8"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="InterPro:IPR036751"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRJ8"
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /protein_id="ACS98714.1"
FT                   /translation="MQITDVRLRRVNSEGRMKAIASITIDNEFVVHDIRVIDGNNGMFV
FT                   AMPSKRTPDGEFRDIAHPISSTTREKIQAAVLAEYERAAVEEVAIEEGA"
FT   gene            36846..38246
FT                   /locus_tag="Pjdr2_0035"
FT   CDS_pept        36846..38246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0035"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /EC_number="2.3.1.157"
FT                   /note="KEGG: bsu:BSU00500 UDP-N-acetylglucosamine
FT                   pyrophosphorylase; TIGRFAM: UDP-N-acetylglucosamine
FT                   pyrophosphorylase; PFAM: Nucleotidyl transferase;
FT                   transferase hexapeptide repeat containing protein;
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98715"
FT                   /db_xref="GOA:C6CRJ9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRJ9"
FT                   /inference="protein motif:TFAM:TIGR01173"
FT                   /protein_id="ACS98715.1"
FT                   /translation="MKVMTIVLAAGQGKRMKSKLYKVLHQVSGKPMVGHVLDTVNEAKS
FT                   ERTVVIVGHGAEMVKGFLGDRAEYVLQEQQLGTGHAVRQAEALLGSEEGTTIVICGDTP
FT                   LVRAETIQSMLALHTSSGAAATVLTASFDNPAGYGRVIRGADGAVLRIVEQKDCSAEEA
FT                   AVKEINTGTYCFDNKKLFAALAEVKNENAQGEYYLTDVIGIFRGAGDTVQAYCTPDLAE
FT                   AIGVNDRVALADAERFMRERINRKHLIEGVTIIDPANTYIEADVRIGADTIIYPGTVLR
FT                   GKTVIGEDCVIGPQADITDSEIQNGAAVKYSTIADSVVGKDSTVGPYANLRPGSKLGEG
FT                   CKVGDFVELKNATLGDGSKVSHLSYVGDAVVGKDVNIGCGAITVNYDGFNKAITEIGDN
FT                   AFVGSNVNLIAPVKLGEGAYVVAGSTITHDVPSGDLAIARQRQENKAGYADKIRARAKA
FT                   KKERSKKE"
FT   gene            38306..38959
FT                   /locus_tag="Pjdr2_0036"
FT   CDS_pept        38306..38959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0036"
FT                   /product="ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /note="TIGRFAM: ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5; PFAM: ribosomal protein L25; KEGG:
FT                   dol:Dole_2818 ribosomal 5S rRNA E-loop binding protein
FT                   Ctc/L25/TL5"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98716"
FT                   /db_xref="GOA:C6CRK0"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRK0"
FT                   /inference="protein motif:TFAM:TIGR00731"
FT                   /protein_id="ACS98716.1"
FT                   /translation="MSIPMMAEQRTTTMKSELRSLRESGRVPGIVYGKQLASPASVAIQ
FT                   EKELLALLRTHPNAVIDLDIPGAGKQSVMIAEIQREKLSRKLIHVDFQQINMNEEVTTH
FT                   VRIDLVGDSQGEREGGIVQALLHELEVRCLPGSIPDSIPVDVTGLLMGSSYLVGDVQAP
FT                   AGVTIVTDPSAVLVTVLVPQKDLTAEEAEAQEIEAKEAVSRSTEAQMHEVDFAK"
FT   gene            39086..39646
FT                   /locus_tag="Pjdr2_0037"
FT   CDS_pept        39086..39646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0037"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="KEGG: baa:BA_0639 peptidyl-tRNA hydrolase; TIGRFAM:
FT                   peptidyl-tRNA hydrolase; PFAM: peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98717"
FT                   /db_xref="GOA:C6CRK1"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRK1"
FT                   /inference="protein motif:TFAM:TIGR00447"
FT                   /protein_id="ACS98717.1"
FT                   /translation="MKWIVGLGNPGTTYQSTRHNVGFMVIDELARRWNIQVTQSKCKAL
FT                   IGEGNVQGTKVVLIKPMTYMNLSGESVRGFMDYFKADLEDGLIVYDDMDTEVGKVRLRY
FT                   QGSAGGHNGIKSLIQHLGTQQFNRIRMGVSRPQPGRNIADYVLDNFPKSEQEALKSMIE
FT                   QACDAVEYSLKASFDNTMAKFNK"
FT   gene            39710..39940
FT                   /locus_tag="Pjdr2_0038"
FT   CDS_pept        39710..39940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0038"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU00540 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98718"
FT                   /db_xref="GOA:C6CRK2"
FT                   /db_xref="InterPro:IPR020115"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRK2"
FT                   /inference="similar to AA sequence:KEGG:BSU00540"
FT                   /protein_id="ACS98718.1"
FT                   /translation="MAVNYICRHCRTPMGTIEEKEISESRLGFHFLTPEERSDIIAYNS
FT                   NGDITVKVVCDYCREALEANPELLLVVNPLQ"
FT   gene            40067..43594
FT                   /locus_tag="Pjdr2_0039"
FT   CDS_pept        40067..43594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0039"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: bsu:BSU00550 transcription-repair coupling
FT                   factor; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: transcription factor CarD; helicase domain protein;
FT                   TRCF domain protein; DEAD/DEAH box helicase domain protein;
FT                   type III restriction protein res subunit; SMART: DEAD-like
FT                   helicase; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98719"
FT                   /db_xref="GOA:C6CRK3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRK3"
FT                   /inference="protein motif:TFAM:TIGR00580"
FT                   /protein_id="ACS98719.1"
FT                   /translation="MKALVQAFAADPDVQSIIAGVRKGMREQMISGLAGSSRQVLVAAV
FT                   KDDLDRPLLVVTHNMYAAQKIAEDLQECISADDVLLYPANELVAAEAAISSPETLAQRM
FT                   DVLIKLSEGFRGIVVVPFSGIRRYQPIKGVMSDAKILIKVGDTIELDGFLRQMTGLGYI
FT                   RADRVESKGEMSVRGGIVDFYPLTAELAYRIEWFGDEVDSIRTFDPSDQRSLDNLQTFT
FT                   VTPCQEIVADQRRFSAAAEHAATLLAQQLDKMTDRMAKDRLRQEIGGEIEKLREHVYFP
FT                   EIYKYISLLYPERQTILDYMPDDTVLILDEPTRLIETGRQLERDEAEWSTHLLSNGKSL
FT                   PSFMLARESDEILHHRKFQTLFMSLFLRQIPHSQPQNILNMTSRAMQNFHGQMNVLKAE
FT                   MERWKKTGAKVMMLGGNAERLDRIRRVLQDYHIEPPILIEGNLQSGFELPSSHLVIITE
FT                   GEMFSQKQRKARRMDKKIDNAERIKSYTELKVGDYVVHQNHGIGKYVGIGTLEIGGIHK
FT                   DYLHILYAGGDKLSVPVEQVDMIQKYVGSEEKEPKINKLGGSEWIRAKNKVRASVQDIA
FT                   DDLIKLYAERQSAPGFAFGQDTAYQNEFEAIFPYDETRDQLRAIEEIKKDMQKPQPMDR
FT                   LLCGDVGYGKTEVAVRAAFKAAIEGKQVAILVPTTILAQQHYETFRERFSGYPFNIQVL
FT                   SRFRSRKEQNDTMKGLKAGTVDVVIGTHRLLSQDVIFKDLGLLIVDEEQRFGVSHKEKL
FT                   KKLKTNVDVLTLTATPIPRTLHMSMLGVRDLSVIETPPENRFPVQTYVVEYSTSLVREA
FT                   IERELARGGQVYYLYNRVQGIYQMAEQINALVPDAKVAVGHGQMSEQELEKTILDFLDG
FT                   ESDVLVSTSIIETGVDIPNVNTLIVHDADKMGLSQLYQLRGRVGRSNRIAYAYFTYQRD
FT                   KVLTEVAEKRLQSIKEFTELGSGFKIAMRDLSIRGAGNLLGAEQHGFIASVGFDLYSQM
FT                   LADEIAKRKAEMEGVEVKEERRVSTLIDVSIDAYLPSDYIYDSIQKIEIYKKVATVTSI
FT                   DEAEDLAEELIDRFGNLPQAVDNLLSVARLKVYGTQYGIEQISQKSDDLIVRFGEREKK
FT                   RIDRKLVDQLCVQYENRFRQGAIQDEYPTLLLRGKGLEMDQKVQLLEGFLKKFKDARKG
FT                   EEALQDAKG"
FT   gene            43756..44862
FT                   /locus_tag="Pjdr2_0040"
FT   CDS_pept        43756..44862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0040"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: bar:GBAA2336 peptidylprolyl isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98720"
FT                   /db_xref="GOA:C6CRK4"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRK4"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACS98720.1"
FT                   /translation="MLHTKRKSTWRRSALLVIAAVLVMTIMAACGGKKENEGGSTGLTF
FT                   AGAGKGTVVATYKDGTVTEAEFNKYLDIFNIMQPGYEQVIAIPQFKEQLLQQFVSYKIL
FT                   AKQATEATLKKADDETNDQMKSFEDTLKTNADVKKTLDDKKVSTADVRTYLNLMLVVVE
FT                   HMNSKVTDDEMKAEYEKNIGNYNPVTVRHILVATTDPADSTKTLRTKEEALARAKEAKA
FT                   KLDAGGDWTALAKEYSDDTGSKDSGGEYKDAKASDWVEGFKNAALTQPVGKIGDPVETE
FT                   YGYHVILVEKRDQVTYDKITDEQKQEVQSVVAYNHMNTFMTDEMPKQDVKITLPEASTS
FT                   PDASASPGASESPAASESPAASESPAAK"
FT   sig_peptide     43756..43851
FT                   /locus_tag="Pjdr2_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.479 at
FT                   residue 32"
FT   gene            44987..45859
FT                   /locus_tag="Pjdr2_0041"
FT   CDS_pept        44987..45859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0041"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; SMART: band 7 protein; KEGG:
FT                   baa:BA_0873 Band_7, SPFH domain / band 7 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98721"
FT                   /db_xref="GOA:C6CRK5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRK5"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACS98721.1"
FT                   /translation="MKEYKAWHVNGFLALLAAIVSFAGGIALIIFGSDQLDPNVFLIVL
FT                   GILLEVVFIVAVSSLTIVQPNEAKVITFFGTYVGTVRLSGLWIVVPFTNKKRVSMKVRN
FT                   FNSQTLKVNDAEGNPVEIGAVVVFKVTETAKASFDVDNYERFVEIQSETAVRHIAAQYP
FT                   YDTFSDTVQQSLRGNADEVAAEMMNELQNRLAVAGVEVLETRLTHLAYAPEIANAMLQR
FT                   QQAIAIVSARQRIVEGAVGMVDSALKQLAENGIELDEERRAAMVNNLMVAIVSDRGATP
FT                   VINTGTLYS"
FT   sig_peptide     44987..45058
FT                   /locus_tag="Pjdr2_0041"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.918) with cleavage site probability 0.473 at
FT                   residue 24"
FT   gene            45872..46057
FT                   /locus_tag="Pjdr2_0042"
FT   CDS_pept        45872..46057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: baa:BA_0872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98722"
FT                   /db_xref="GOA:C6CRK6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRK6"
FT                   /inference="protein motif:COG:COG4877"
FT                   /protein_id="ACS98722.1"
FT                   /translation="MGKEKKAFALRLDPDLHRAIEQWANDEFRSVNGHIEFLLREALGK
FT                   AGRLPKPAPNNPVNNE"
FT   gene            46547..47086
FT                   /locus_tag="Pjdr2_0043"
FT   CDS_pept        46547..47086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0043"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: stage V sporulation protein T;
FT                   transcriptional regulator, AbrB family; PFAM: SpoVT/AbrB
FT                   domain protein; KEGG: bha:BH0070 stage V sporulation
FT                   protein T"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98723"
FT                   /db_xref="GOA:C6CRK7"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR014213"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRK7"
FT                   /inference="protein motif:TFAM:TIGR02851"
FT                   /protein_id="ACS98723.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTLRIREGDPLEIFVDRDGEVI
FT                   LKKYSPIGELGDFAKEYAESLFESTNHVTLITDRDTVIAVAGASKKELLEKQIGSILEG
FT                   CMDNRKTTEGASGTYEIVKDLHDTYSAYVAAPIVAGGDPIGTVVLLSKDDAVKMSQMET
FT                   KMVETAAGFLAKQMEQ"
FT   gene            complement(47159..48013)
FT                   /locus_tag="Pjdr2_0044"
FT   CDS_pept        complement(47159..48013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0044"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AraC protein arabinose-binding/dimerisation;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: spe:Spro_3104 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98724"
FT                   /db_xref="GOA:C6CRK8"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRK8"
FT                   /inference="protein motif:PFAM:PF02311"
FT                   /protein_id="ACS98724.1"
FT                   /translation="MPLSEIYLPSPATERYMDLSLLFWGKQDCDPGHYWGPGLRDMYII
FT                   HYVHSGTGQFRLGELSYELHAGQGFLIIPGSLVYYKADEDNPWTYSWVGLKGLHAKSLL
FT                   QRAGLSPANPIFDATEQKDFFESVYEQCHQALEDHPGSGDLFSQSLLYQYMARLVACNK
FT                   QPSAPAHAVNTKEAYINKAVAFIENSYSLPISVQDIANFVGLDRTYLSGLFKAQLGVSL
FT                   QAFLLRFRMNRAVELLHHQELTIGDIARSVGYTDPFLFSKMFKRVIGSSPRTSRDHINR
FT                   TAT"
FT   gene            48200..49498
FT                   /locus_tag="Pjdr2_0045"
FT   CDS_pept        48200..49498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0045"
FT                   /product="glycoside hydrolase family 4"
FT                   /note="PFAM: glycoside hydrolase family 4; KEGG: bha:BH2228
FT                   melibiase (alpha-galactosidase)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98725"
FT                   /db_xref="GOA:C6CRK9"
FT                   /db_xref="InterPro:IPR001088"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR019802"
FT                   /db_xref="InterPro:IPR022616"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRK9"
FT                   /inference="protein motif:PFAM:PF02056"
FT                   /protein_id="ACS98725.1"
FT                   /translation="MSKITFLGAGSTVFAKNVLGDVMLTEPLQGFELALFDIDAGRLRD
FT                   SEQLLLNMKQSLGSNCVVKAYSDRKEALRGAKYVINAIQVGGYDPCTITDFEIPKKYGL
FT                   RQTIADTVGIGGIFRNLRTIPVVLDFAKDMREVCPDALFMNYTNPMAVLTNVLSTAGGV
FT                   RTVGLCHSVQACVSDLFKSLEMDATGVESKIAGINHMAWLLEVKKDGVDLYPEIKRRAA
FT                   EKQKEKHHDMVRFEMMLKFGYYITESSEHNAEYHPYFIKRNYPELVDRFNIPLDEYPRR
FT                   CIEQIKGWNSMRESLLANSNIEHKRSHEYASHIMEAIETGKTFKIGGNVMNTGLITNLP
FT                   KEACVEVPCLVDRSGINPTYVGDLPPQLAALNRTNINTQLLTIEAALTQKKEHIYHAAM
FT                   LDPHTSAELSMDDIVALCDDLIEAHGDWLPAYK"
FT   sig_peptide     48200..48262
FT                   /locus_tag="Pjdr2_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.750) with cleavage site probability 0.439 at
FT                   residue 21"
FT   gene            complement(50005..50628)
FT                   /locus_tag="Pjdr2_0046"
FT   CDS_pept        complement(50005..50628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swd:Swoo_2851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98726"
FT                   /db_xref="InterPro:IPR008319"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRL0"
FT                   /inference="similar to AA sequence:KEGG:Swoo_2851"
FT                   /protein_id="ACS98726.1"
FT                   /translation="MKYEWKKNDKSLYLPKNVPTVIEVPPMNYFTLKGKGNPNYPEFAE
FT                   AVGVLYSLSYTVKMLPKKGAAPEGYYDYAVFPLEGIWDLDEEARQAAVLDKDKLIYSLM
FT                   IRQPDFITETLAQEVIETVCKKKPHPLLSNVTFGKLDEGLCVQMMHHGPYDDEPASFDK
FT                   MEQYCEEQGLKRLSKLHKEIYISDARKTQPEKLKTVLRFQAGRN"
FT   gene            complement(50650..51789)
FT                   /locus_tag="Pjdr2_0047"
FT   CDS_pept        complement(50650..51789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0047"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="KEGG: tmz:Tmz1t_0151 glycerate kinase; TIGRFAM:
FT                   glycerate kinase; PFAM: glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98727"
FT                   /db_xref="GOA:C6CRL1"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRL1"
FT                   /inference="protein motif:TFAM:TIGR00045"
FT                   /protein_id="ACS98727.1"
FT                   /translation="MKIVIAPDSFKGSLSAAAAAEAIAQGISRCVPDADIVKLPIADGG
FT                   EGTLDSLLAAASGERITVNVTGPLGTSVSASYGIIGQTAVVEMAEASGLCLLTEEQRNP
FT                   ALTTTYGTGELIRHALDHGCRRFLLTVGGSSTNDGGTGMLQALGMRLLDQQGNSVPPGG
FT                   RALADIATIDDSLWHPRIADSSFVIATDVQNPLIGEQGASRVFGPQKGASHEMVDQLEQ
FT                   GMTVWADLIEAKTGIRLHEYPGAGAAGGLCGAYLAFFPASIRRGIDVVLEHVHLEEHID
FT                   GADLVITGEGRIDHQTASGKAPMGVAQLAKKHGISAIALAGSVGSGIDVLHAEGISSVH
FT                   SIMNTPMTLQEAMEHAPILLEQTAEQVFRTFLAGRVSKR"
FT   gene            51965..53443
FT                   /locus_tag="Pjdr2_0048"
FT   CDS_pept        51965..53443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0048"
FT                   /product="MazG family protein"
FT                   /note="TIGRFAM: MazG family protein; PFAM: MazG nucleotide
FT                   pyrophosphohydrolase; Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: baa:BA_0644
FT                   tetrapyrrole (Corrin/Porphyrin) Methylases"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98728"
FT                   /db_xref="GOA:C6CRL2"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR024180"
FT                   /db_xref="InterPro:IPR035013"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRL2"
FT                   /inference="protein motif:TFAM:TIGR00444"
FT                   /protein_id="ACS98728.1"
FT                   /translation="MAQTITVVGLGSGDPDQLTLGVWRRLQEAEAIYVRTEQHPVMSLL
FT                   REHQLAYTSFDSVYEQHDTFPEVYDTIADTLVRKAQEASAPVLYAVPGHPMVAERTVQL
FT                   LRERCSPADIRLEIIGGESFLDQAFIRLGIDPIEGFALLDAAELKAAHVQPRVHTIIGQ
FT                   VYDAYTASDVKLALMERYPDDYEVVVGHALGVTGEEQILKVPLYELDRTPGFGNLSLIW
FT                   VPRTEEDAVLNRTFDRLHEIVAILRSPEGCPWDREQTHQSIRKNFIEELYEALEAIDND
FT                   DPDNMREEFGDVILQVMLHSQMEEETGAFSVYDVIEGLNEKLIFRHPHVFGDRSAGDAS
FT                   EALGNWEQMKAEEKKRKGEADARKSQLDGIPKDLPALMKAYQLQKKAAKVGFDWEELGP
FT                   VLTKIEEELRELREAIDSKDSEEQAGELGDLLFAVVNASRFIHADPEEALSRTNAKFKS
FT                   RFSYIEEQLRINGKTFDQTDLIEMDRWWEEAKRQ"
FT   gene            53646..53918
FT                   /locus_tag="Pjdr2_0049"
FT   CDS_pept        53646..53918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0049"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; KEGG:
FT                   bsu:BSU22790 non-specific DNA-binding protein HBsu; signal
FT                   recognition particle-like (SRP) component"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98729"
FT                   /db_xref="GOA:C6CRL3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRL3"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ACS98729.1"
FT                   /translation="MNKTDLINNIATKSGLTKRDVEAVLNGFLGEVTDALAGGDKVQLI
FT                   GFGTFETRKRSGRVGRNPQTGKEISIPESKVPAFKAGNKLKDAIK"
FT   gene            53922..54200
FT                   /locus_tag="Pjdr2_0050"
FT   CDS_pept        53922..54200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0050"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein; KEGG: bsu:BSU00590
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98730"
FT                   /db_xref="GOA:C6CRL4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRL4"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACS98730.1"
FT                   /translation="MRLDKFLKVSRLIKRRTVAKDVSEQGRVWINGREAKASSTVKAGD
FT                   ELTIQYGQKTVTVRVERIAETTRKDEAGELYTLIKEEQRPREDNLGW"
FT   gene            54308..55048
FT                   /locus_tag="Pjdr2_0051"
FT   CDS_pept        54308..55048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0051"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_4131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98731"
FT                   /db_xref="GOA:C6CRL5"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98731.1"
FT                   /translation="MIPAMTNLPEIRPSKGGGVLGLTFSLFIKNAAVLMLITAITIVPV
FT                   ELIICYGFSNLSIDNILKDIIISQLFLTLLTPVVVYYLIERLRGGKGRVTDAYRWGLRK
FT                   WLRMIMYNFLQCVIFSAGLLLFVIPGLFMYVRLLLLPAVVSIENTSVTNPLESSRNMAE
FT                   GQFWRFLGLGVVINLFSFLLGLGASKLLLESGVINGITVTLYYLFIDWVSLIGVILSLV
FT                   LYLKIRTEQYAAAAQAAEEAAVTA"
FT   gene            55207..56022
FT                   /locus_tag="Pjdr2_0052"
FT   CDS_pept        55207..56022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0052"
FT                   /product="protein of unknown function DUF817"
FT                   /note="PFAM: protein of unknown function DUF817; KEGG:
FT                   bar:GBAA3535 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98732"
FT                   /db_xref="GOA:C6CRL6"
FT                   /db_xref="InterPro:IPR008535"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRL6"
FT                   /inference="protein motif:PFAM:PF05675"
FT                   /protein_id="ACS98732.1"
FT                   /translation="MELQPLLNVVWIRRIWQLFIFGYQQAMSCIFPVIIFASLALTKVI
FT                   SVPYVHRYDLLLLICLFAQVGMVVFKLETIDELKVICMFHIIGLMLELYKVHMGSWSYP
FT                   GEGWSKLFGVPLYSGFMYASVASYICQAWRRLSISVYGWPRQRYAVMVCAAIYLNFFTH
FT                   HYMWDLRWLLTLLLIIVFYRTSFAYKVGGREYRMHVVLSFLLIGFFIWLAENISTFMGA
FT                   WAYPDQEHTWRIVHLGKISSWFLLVVISVIIVAQLKRVKSARDGGNPAL"
FT   gene            56132..56416
FT                   /locus_tag="Pjdr2_0053"
FT   CDS_pept        56132..56416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0053"
FT                   /product="sporulation protein YabP"
FT                   /note="TIGRFAM: sporulation protein YabP; PFAM: YabP family
FT                   protein; KEGG: bha:BH0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98733"
FT                   /db_xref="InterPro:IPR012504"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR038705"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRL7"
FT                   /inference="protein motif:TFAM:TIGR02892"
FT                   /protein_id="ACS98733.1"
FT                   /translation="MVEQSKGQKRQEVKMLNRKLLEITGVLNVESFDSEEFLLDTELGF
FT                   LMIKGQNLHIKHLNLEQNLVAIEGYVHSLAYLDANTSTKTKGLFGKLFK"
FT   gene            56413..57018
FT                   /locus_tag="Pjdr2_0054"
FT   CDS_pept        56413..57018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0054"
FT                   /product="spore cortex biosynthesis protein YabQ"
FT                   /note="TIGRFAM: spore cortex biosynthesis protein YabQ;
FT                   KEGG: bar:GBAA0058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98734"
FT                   /db_xref="GOA:C6CRL8"
FT                   /db_xref="InterPro:IPR014242"
FT                   /db_xref="InterPro:IPR019074"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRL8"
FT                   /inference="protein motif:TFAM:TIGR02893"
FT                   /protein_id="ACS98734.1"
FT                   /translation="MTSLSLQFLTMGMMLLSGIGMGVIFDGYRVVSNELRFPRWTLPVL
FT                   DMAYWLAASLLVFRVLYASNYGEVRAYVFLGLLIGVLCYYWLLSKPVIRTVKWLIDAVR
FT                   ALIRFTLRTFDLLIVKPIVLLYRLIRVLIGFGTALTIFLLKIVLQLVRPFWLLLRFMLG
FT                   PLTRPLWRWLGPKLSSLQLKERWDKILSGVIKLWKRLF"
FT   sig_peptide     56413..56481
FT                   /locus_tag="Pjdr2_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.756) with cleavage site probability 0.754 at
FT                   residue 23"
FT   gene            57105..57416
FT                   /locus_tag="Pjdr2_0055"
FT   CDS_pept        57105..57416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0055"
FT                   /product="Septum formation initiator"
FT                   /note="PFAM: Septum formation initiator; KEGG: baa:BA_0648
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98735"
FT                   /db_xref="GOA:C6CRL9"
FT                   /db_xref="InterPro:IPR007060"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRL9"
FT                   /inference="protein motif:PFAM:PF04977"
FT                   /protein_id="ACS98735.1"
FT                   /translation="MTTATANPSTGNAGSKRRLRIWAMCITLFLCWAAYTFIGQIKDAR
FT                   ATQAQLTEIKKQVDDSTLQSKQLQQQIDRLNDPEYIRQLATKEQGMVTPGEQQIQVIK"
FT   gene            57514..58002
FT                   /locus_tag="Pjdr2_0056"
FT   CDS_pept        57514..58002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0056"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART: RNA
FT                   binding S1 domain protein; KEGG: bar:GBAA0060 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98736"
FT                   /db_xref="GOA:C6CRM0"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRM0"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACS98736.1"
FT                   /translation="MAIEVGAKLEGKVTGITHFGAFVDLSGGVTGLVHISEIADNYVKD
FT                   VKDHLKIDDVVKVKVINVDKDGKIGLSIKQAVDRPEGQQAAPQREPRAGGGGGFNRGGG
FT                   GQDRGGRPFNKQSAGRPSYNKPSFEDKMSRFLKDSEERISSLKKNTEGKRGGRGAKRV"
FT   gene            complement(58322..58414)
FT                   /locus_tag="Pjdr2_0057"
FT   CDS_pept        complement(58322..58414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98737"
FT                   /db_xref="GOA:C6CRM1"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRM1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98737.1"
FT                   /translation="MRKFVALYGMIFITLLEIFINIKFEGGVLR"
FT   gene            58857..61349
FT                   /locus_tag="Pjdr2_0058"
FT   CDS_pept        58857..61349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0058"
FT                   /product="stage II sporulation protein E, protein
FT                   serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: bha:BH0078 stage II sporulation protein E;
FT                   TIGRFAM: stage II sporulation protein E; PFAM: Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98738"
FT                   /db_xref="GOA:C6CRM2"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014221"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRM2"
FT                   /inference="protein motif:TFAM:TIGR02865"
FT                   /protein_id="ACS98738.1"
FT                   /translation="MKKENVIMFPAGEQQMGWGHSMMEKSRGWLSSRRLVQLVLAKKWT
FT                   IMLVGLGFLLGRAVILESLMPFAAAYFAVVYFLRKDAFAWTAVSLVAGSWFAVTPAPLW
FT                   IGMELAVLFLLFKGLEAYEKAELGTAPLLVFISTLLVQLFGLFIGDTMSWYGFMMVVVE
FT                   AALSFVLTLVFIQAIPVLTMAKKTASLKNEEIICLMILLASVMTGAVGWQIYGLSVEHI
FT                   MSRFLLLLFALAGGAPLGACVGVVAGLILSLADFNAVVQMSLLAFAGLLAGLLREGGKA
FT                   AVAFGMLLGTSILAIYVGSGSDVMTSTWESVTAAVLLMLTPKIMIRTIARYVPGTNEHA
FT                   KSQHEYAKRVRDVTAERVSQYSEVFRQLSKSFGQLNNTAGAVKQEEELNHFMQAVSARS
FT                   CADCHRNKACWEGKYFQTYQMMKDMISAVDEDRIPTHNMPRTWASHCAKPAQVLGIIEQ
FT                   EYELYKNDMHWKKQIFDSRQLVADQLSGVSQVMEDLAHEIKREGQTLHLQEEQIREALE
FT                   GLGLSIQEIEVINLEEGNVEIELYHHFARGYDECRKIIAPLLSDILGEHVAVKTERPAE
FT                   KNGEPTLVVFGSAKEFEVETGIAGAAKGGDLLSGDSFSMLELGNGKFAVAISDGMGNGE
FT                   RARQESSAALSILQQLLKSGMDEKLAIKSVNSILLLRSPDEVFATIDLAMIDLYTARTT
FT                   FMKIGSTPSFIKRGNEVIPVTANNLPVGILQDIEFDLISMPLQPGDTIVMMSDGIYDAP
FT                   GHAVNKEMWMKRMIQELKTDEPQEMADALLETVVRYHEGDIKDDMTVLVARIDKHLPEW
FT                   ASFRWPGINRLERPRTVS"
FT   gene            61576..62304
FT                   /locus_tag="Pjdr2_0059"
FT   CDS_pept        61576..62304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0059"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98739"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRM3"
FT                   /inference="similar to AA sequence:KEGG:BH0079"
FT                   /protein_id="ACS98739.1"
FT                   /translation="MKQILLVTDGCSNVGMSPVVAAAHAKAEGIAVNVVGILDYGDVGE
FT                   LGASEIEEIARAGGGLSRLVNMRQLSQTVQMMTRKTAVQTIQLAVQKELKQVLGNGSIE
FT                   ALPPEKRSEVVRVIDELGETSKLQVALLIDASASMKPKLRAVEEAIHDLMLSLQARQGK
FT                   SEIAVFHFPSSKHGEDCKLDLDWTDNLKGISSIFTKFPMSGTTPTGPAMMQVIDFYRQG
FT                   DYGKKSRNDETDGMMSDYVV"
FT   gene            62288..63205
FT                   /locus_tag="Pjdr2_0060"
FT   CDS_pept        62288..63205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0060"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   bha:BH0080 serine/threonine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98740"
FT                   /db_xref="GOA:C6CRM4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRM4"
FT                   /inference="protein motif:SMART:SM00220"
FT                   /protein_id="ACS98740.1"
FT                   /translation="MTTSFKLNLRRGAVVTGKWKQSRYRVERLLGEGANGKVYLVHADR
FT                   GWCALKVGMDAIDLQSEINVLQTLEKQDRKQTYLYEVDDLLGEGGKEYPFYIMRYVRGV
FT                   TISEFLEKNGPEWFPLIGLNLLGKLAELHRRGWVFGDLKIDNVLVADYGYVELVDYGGV
FT                   TAMGKGIRQFTEIYDRGFWNAGSRSADARYDLFSFAVLCIMLHEPKKLHALTGGLPQIR
FT                   STEELERLISECKGLAPVAGWLKQALGGQFFDASEGAEAWRRLLHRRDTRVKSAKTPGW
FT                   LKGLAAVSAVVLGISVYWLLRSGI"
FT   gene            63259..64686
FT                   /locus_tag="Pjdr2_0061"
FT   CDS_pept        63259..64686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0061"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; ExsB family protein; KEGG:
FT                   bsu:BSU00670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98741"
FT                   /db_xref="GOA:C6CRM5"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRM5"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ACS98741.1"
FT                   /translation="METGDHKLLTDMMKYRATEQLWSKGDRIVAAVSGGPDSMALLHLL
FT                   WQAARQEQLTVIAAHVNHGFRKDASRQEAEVVRQYAEKLGVPFEMIELDMPAYIEETGI
FT                   NAQSAAREKRYAFLHETAVKYGASAIALAHHADDQAETVLMRVIRGAGLTGLAGMAPKR
FT                   KEKNVELIRPLLRMNKSDIVRYCSERDVPYCLDSSNNERYYFRNVVRLDVIPYLSQFNP
FT                   QLNHSLRRIADVAGAEDDWMELEGQRLFTSLVTLSPDECKLNAGELIGLHVALQRRLIK
FT                   LILNYLSKDAEIASFDAIETMRLAAAPAAPSTWRYDAGSGVRCIREYSSIRWVRVLNAS
FT                   GTSEDSYAFSISGDSKSAFITAGGRALHIERLKRGEAVKPAGRSEVCFDADRLVFPLMV
FT                   RNRQPGDRIQVLGLNGSKKVQDMFVDEKIAPSERERYPLLVDANNRLLWIPGIRRSSHA
FT                   QTGHETTDFLFIRMENE"
FT   gene            64741..65280
FT                   /locus_tag="Pjdr2_0062"
FT   CDS_pept        64741..65280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0062"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: bha:BH0084 hypoxanthine-guanine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98742"
FT                   /db_xref="GOA:C6CRM6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRM6"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ACS98742.1"
FT                   /translation="MLNDIKEVLYDEGQIKAKVKELGETLSRDFDGRNPLVICVLKGAF
FT                   IFMSDLVKEMPIKLEIDFMAVSSYGASTKSSGVVKIIKDLDASVEGRDVLIVEDIIDSG
FT                   LTLSYLIDVLERRNAKSVTVATLFDKPARRSVDLEADYTGFSLPDEFVVGYGLDYAEKY
FT                   RNLPFIGILKPEVYEK"
FT   gene            65384..67396
FT                   /locus_tag="Pjdr2_0063"
FT   CDS_pept        65384..67396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0063"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="5.6.1.1"
FT                   /note="KEGG: baa:BA_0654 peptidase_M41, peptidase family
FT                   M41; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; peptidase M41 FtsH extracellular; AAA ATPase
FT                   central domain protein; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98743"
FT                   /db_xref="GOA:C6CRM7"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRM7"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ACS98743.1"
FT                   /translation="MNRIIRNTGFYLIIFLVTVGIIQFISSQNNTTVGIRYDQLRQAIS
FT                   SNNVEELSVKYDGYTYLVSGKYKEPPADSKNGEKNFSSRIGLEAGQDILDAEKQYGFKL
FT                   NYKPMDTPSIWLTFLTSIIPFVIIFILFFFLMNQAQGGGGKVMNFGKSRARLYNEEKKR
FT                   ITFEDVAGADEEKQELVEVVDFLKDPRKFNLVGARIPKGVLLVGPPGTGKTLLARAVAG
FT                   EAGVPFFSISGSDFVEMFVGVGASRVRDLFENAKKNAPCIIFIDEIDAVGRQRGAGLGG
FT                   GHDEREQTLNQLLVEMDGFGANEGIIIVAATNRPDILDPALLRPGRFDRQITVDRPDVK
FT                   GREAVLKVHARNKPLNKDVKLDVIAKRTTGFTGADLENLLNEAALLAARRNKKDIAMQE
FT                   VDEAIDRVIVGTEKKSRVISDREKRIVAYHEAGHTIVGYFLEHADMVHKVTIIPRGRAG
FT                   GYVIMLPKEDRMLVTKQELLDKVTGLLGGRVAEELFIGEIGTGAYSDFKQATGIVRSMI
FT                   MEYGMSDKLGPMQFGQSQGQVFLGRDLGHEQNYSDKIAYEIDQEMQNFINDCYTRAKQL
FT                   LTEKSREVHLIAQTLLKEETLELEQIKKLIESGALEGGDEPAGEGSGAAESSSEPIVDT
FT                   IGGVKVRIQTRDAGEITPPELDEQKPDDEDPNKGS"
FT   gene            67728..68795
FT                   /locus_tag="Pjdr2_0064"
FT   CDS_pept        67728..68795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0064"
FT                   /product="basic membrane lipoprotein"
FT                   /note="PFAM: basic membrane lipoprotein; KEGG: bar:GBAA3927
FT                   Bmp family lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98744"
FT                   /db_xref="GOA:C6CRM8"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRM8"
FT                   /inference="protein motif:PFAM:PF02608"
FT                   /protein_id="ACS98744.1"
FT                   /translation="MKKQVGLMLMIILALTFVLSACGSKSHDNSNNSNKGSNEGAASPG
FT                   TSGAASKLKIGMATDVGGVNDKSFNQSAWEALKKVTADTGAETKYLESKGDADMEPNLK
FT                   AFVSEKYDLTWGIGFLFTDAMTKVATENPNSKFALIDAEVDLPNVESVSFAENEGSFLV
FT                   GVVAGLMTKTNKIGFVGGMEIPVIKKFEAGFKAGVEAVNPEAAKSMKINYVGDFSKPDL
FT                   GKQAAATMYDAGVDIIFHASGASGNGVFNEAKSRKDAGKDVWVIGVDKDQSLEFGDAIT
FT                   LTSMMKGVEAAVYKVSTDLINGTWQGGQVVTLGLKDNGVGLPETSTKNVPADVLAKVEE
FT                   YKQKIISGEITVPVK"
FT   sig_peptide     67728..67793
FT                   /locus_tag="Pjdr2_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.589 at
FT                   residue 22"
FT   gene            68906..70450
FT                   /locus_tag="Pjdr2_0065"
FT   CDS_pept        68906..70450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0065"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bsu:BSU31550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98745"
FT                   /db_xref="GOA:C6CRN0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRN0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS98745.1"
FT                   /translation="MDRSTTAVELKGITKRFPGLVANDNINFELKKGEIHALLGENGAG
FT                   KSTLMNILFGLYQPEEGEIWVNGNKTVIDGAGKAIELGIGMVHQHFKLVQPFTVAENIV
FT                   LGNEPSKFGFLKYRQANQRVRELSERYGLKVDPQMRIQDITVGMQQRVEILKTLYRGAD
FT                   ILIFDEPTAVLTVQEIEELIEILRNLSAEGKSIILITHKLKEVMALADSVTVIRRGKVI
FT                   RTLPTSETNERHLAELMVGRDVTFEVEKSKKEPGDVVLSVDSLRMKGDQGKQVLDGISF
FT                   DVRAGEILGIAGVDGNGQSELIYAITGMRGVNGGSVNLNGKDITNRTPREVSLAGVSHI
FT                   PEDRHKHGLVLDFTLSENMILGSYFDPQFGKNGFIDFKAMDTLADKLVNEFDVRGSGIH
FT                   AKARSLSGGNQQKAIIARELWKNPDLLIAVQPTRGLDIGAIEYVHKRLVEARNEGKAIL
FT                   LVSFELDELYSLSDRITVMYEGRLMGEVDADHRDDQQLGLMMAGDASAAATAEGGK"
FT   gene            70457..71551
FT                   /locus_tag="Pjdr2_0066"
FT   CDS_pept        70457..71551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0066"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bsu:BSU31560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98746"
FT                   /db_xref="GOA:C6CRN1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRN1"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS98746.1"
FT                   /translation="MNTMRKIFDKSSFLVPLVAIILGLICGALAMLAGGYDPWMAYTAL
FT                   VKKLFGSPYDIGEAIRAITPLIFTGISVAFAFRTGLFNIGADGQFLMGMTGATIIGVTM
FT                   DLPWYIHAPLAIIVGGLFGGLWAALAGYLKAARGVNEVISSIMLNWIALFLSNYIVGTY
FT                   LVMEGQQKSKPIHESALVSIKWLSESMGNARMHWGTLFAIIGLIVFYVILWRTKKGYEL
FT                   RAVGLNPNAALYAGMNVNRTIITSMFISGVFAGLGGVFEILGVFGYQTVMAASWGYGFD
FT                   GIAVALLGGNTPIGVFLGAVLFGGLSYGSAGMSFGANVPPEIVRIVIGSIIFFVASHGL
FT                   VKFFLKPFMARRSNKGKSEGGSAL"
FT   sig_peptide     70457..70564
FT                   /locus_tag="Pjdr2_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.477 at
FT                   residue 36"
FT   gene            71548..72510
FT                   /locus_tag="Pjdr2_0067"
FT   CDS_pept        71548..72510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0067"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bsu:BSU31570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98747"
FT                   /db_xref="GOA:C6CRN2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRN2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACS98747.1"
FT                   /translation="MNALDTIGQLISITLVFSTALIFTGLGGVFSERSGVVNIGLEGLM
FT                   IAGAFGAAVFADQAIQGGMKHGAPWIGLLAGLVLGLVVSLLHAVATITFKADQTIVGVV
FT                   INILAAGLAIYLTKSLYEGSGQTPTLEYVFNPVAIPGLSDIPLLGKGIFTAYPTTYIVI
FT                   GVVILSYIVLYRTTFGLRLRAVGEHPSSADTVGISVTKYRYIGVMLSGALAGLGGATIA
FT                   LTTTSNFAHNTISGQGFIAIAAVIFGKWNPLGVAGAAIFFGMAQALRNWAQLFEWSHHI
FT                   PNEFFYMLPYLLTLIVLAGAVGRSAAPGALGEPYDPAKR"
FT   gene            72761..73699
FT                   /locus_tag="Pjdr2_0068"
FT   CDS_pept        72761..73699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0068"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: pca:Pcar_0092
FT                   quinolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98748"
FT                   /db_xref="GOA:C6CRN3"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRN3"
FT                   /inference="protein motif:TFAM:TIGR00550"
FT                   /protein_id="ACS98748.1"
FT                   /translation="MEALALERKAEQNRELRERLMQLKKERNAIILAHYYQRDEIQEVA
FT                   DFRGDSFLLAQKAAQTDADVIVFCGVHFMGESAKILAPNKTVIIPDERAGCPMADMVNV
FT                   DGLRKLKAQHPNATVVTYINSSAEIKAETDICCTSANAVKVVNSVEGDEVIWVPDKNLG
FT                   HYVQQNTDKKMIIWEGYCNTHDMLTVKDVEEMKAKYPNAQFVVHPECRPEVVELGDFVG
FT                   STTAIIKYCKESDCQEFIVGTEDGTGYQLRLDSPNKTFHFASKYLVCPNMKVNNLKKLV
FT                   KCLETMQPQIYVPDHVADEARKSLERMLLVK"
FT   gene            73743..75362
FT                   /locus_tag="Pjdr2_0069"
FT   CDS_pept        73743..75362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0069"
FT                   /product="L-aspartate oxidase"
FT                   /EC_number="1.4.3.16"
FT                   /note="KEGG: aba:Acid345_2250 L-aspartate oxidase; TIGRFAM:
FT                   L-aspartate oxidase; PFAM: fumarate reductase/succinate
FT                   dehydrogenase flavoprotein domain protein; FAD dependent
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98749"
FT                   /db_xref="GOA:C6CRN4"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRN4"
FT                   /inference="protein motif:TFAM:TIGR00551"
FT                   /protein_id="ACS98749.1"
FT                   /translation="MMIPRYLVDLSLEDLPVIEKDVIVIGAGIAGLFTALRASENNQSV
FT                   LMITKKSLLDSNTRYAQGGIAAVISDDDSPAYHREDTLIAGAGLCSEDAVNVLVHEGPE
FT                   GVNNLISMGTQFDLENGEFALTKEGAHSQRRILHANGDATGYEIVRALSEKATADPGID
FT                   VWDDHFVIDLVTQDGECCGAIVQKPDGHRLYVRGKATILCSGGTGQLYRYTTNPDVATG
FT                   DGIAMAYRAGALIQDMEFVQFHPTSLCYPGAPRFLISEAVRGEGAYLRNIRGERFMDRY
FT                   HHQLELAPRDVVARAIVSEMEETKSTFVYLDITHESPEMVKHRFPTIYEFCLQYGLDLT
FT                   TDWIPVAPAAHYMMGGVKTDLFGETNIRRLFACGEVSSTGVHGANRLASNSLSEAIVFG
FT                   KRIVDSIMKLSDLETKPVIEKDKLRTSAPMQAVVEKRLKLQKVMVRYAGLRRDALGLER
FT                   GLDELKRQLPFFQSVLAKREEYEFANLLTCAILTTESALQREESRGGHFREDFPEKNDE
FT                   VWRKHTVMHRLQGTTEERIIHV"
FT   gene            75355..76239
FT                   /locus_tag="Pjdr2_0070"
FT   CDS_pept        75355..76239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0070"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: glo:Glov_1316 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98750"
FT                   /db_xref="GOA:C6CRN5"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRN5"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ACS98750.1"
FT                   /translation="MFDTTFGTYNHALREQIRSWLAEDIGSGDITTATTIPMGSHSTAV
FT                   IHVKESGIIAGLPVAQIVFEIVDPELQFEAKVQDGEHVEKGTVIATVEGSTHSLLTGER
FT                   LALNLMQRLSGIATKTNAFVAALEGLPVRLVDTRKTTPGHRMLEKYAVRVGGGANHRFG
FT                   LYDAVMIKDNHIKGAGGIRQAVEASRAAIPHTMKIEVEAESLGQVEEALASGADIIMLD
FT                   NMASTLMTEAVSLIKSRSPHVIVEASGNVRLDTVRAIAACGVDVISVGGLTYSFNALDI
FT                   SLDLNEKKGGARA"
FT   gene            76236..77006
FT                   /locus_tag="Pjdr2_0071"
FT   CDS_pept        76236..77006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0071"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: bha:BH0086 pantothenate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98751"
FT                   /db_xref="GOA:C6CRN6"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRN6"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACS98751.1"
FT                   /translation="MILVIDVGNTNIVLGVYKGKDLLHHWRLSTNRSATVDEYGMNIHN
FT                   LFHYAGIRMEQIEGVIISSVVPPLMRALEQLCMKYLRKTPLVVGPGIKTGLNIRYENPR
FT                   EVGADRIVNSVAGIVKYGSPLIVVDFGTATTFDYIDASGSYLGGAIVPGIGISTEALYQ
FT                   RAAKLPRIELVKPKSVIGRNPVTSMQAGIIYGYAGQVDGIVNRIRKEFQVSPRVVATGG
FT                   LAELISTESETIEEVDPLLTLEGLRIIYERNQEG"
FT   gene            77009..77908
FT                   /locus_tag="Pjdr2_0072"
FT   CDS_pept        77009..77908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0072"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: bsu:BSU00710 HSP33-like
FT                   chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98752"
FT                   /db_xref="GOA:C6CRN7"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRN7"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ACS98752.1"
FT                   /translation="MEQLPDVLVRGTAWGGKIRVFAACTTQLVNELQWRHQTLPTATAA
FT                   FGRTATAAAIMGAMLKGEEQLTVKVKGDGPIGQIVVDANAHGEVRGYVDNPDVLLPSNE
FT                   HGKIDVAGGVGRNGYLHIIKDLGLKDPYLGSVPIISGELGEDFTYYFAVSEQTPSAVGL
FT                   GVLVEPDGRVTHAGGFILQLLPGLTDEEITRLEQAIGSIPHVTKLMEQGETPEGILRLL
FT                   VGDDLHIHDSLELKFQCKCSRDRVEQTLISLGVSELEQIIEEDGKAEVVCHYCNEAYTF
FT                   DGEQLQELIDQAKPNLVQ"
FT   gene            77928..78902
FT                   /locus_tag="Pjdr2_0073"
FT   CDS_pept        77928..78902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0073"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: bsu:BSU00720 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98753"
FT                   /db_xref="GOA:C6CRN8"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRN8"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACS98753.1"
FT                   /translation="MKKYGVLKAVVVLQAICMIVLSVAVIVKLSPFSDDPDKHDPDSET
FT                   KAQAGDTPSDSDHAYSDGIAATVGGFPITAEDLAEQLKRQYGDNVLRTMMVHKAIDLEA
FT                   EAQQLSLSSEEEERELTSMMDGYDSEEVFYEVMKDQLGMTKSDVEEDVKYRLLLEKIAI
FT                   LTVNLSEVEIENYIAAHPEQFADRLRLHVQWIVTDTEKEADDVLDKLTAGDSFEQLALE
FT                   YSKDANTSDAGGDLGLIDSDDPFYDAEMMEEASRLQTGESTGPIKVPEGYAVIRVLERQ
FT                   KTEGLSGHVLYDTARKELALSKAKPLNEIEDGLLEKYNAEITP"
FT   gene            79064..80002
FT                   /locus_tag="Pjdr2_0074"
FT   CDS_pept        79064..80002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0074"
FT                   /product="cysteine synthase A"
FT                   /note="TIGRFAM: cysteine synthase A; cysteine synthase;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: bsu:BSU00730 cysteine synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98754"
FT                   /db_xref="GOA:C6CRN9"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRN9"
FT                   /inference="protein motif:TFAM:TIGR01139"
FT                   /protein_id="ACS98754.1"
FT                   /translation="MARIVNSVTELIGDTPLVRLNRLVPEDSAEIYVKLEYQNPGASVK
FT                   DRIAISMIEVAEQEGVLKPGDTIVEPTSGNTGIGLAMVAAAKGYKAILVMPETMSIERR
FT                   NLLRAYGAELVLTPGSEGMNGAVRKAEELAKENPSYFIPQQFKNQANVKVHRETTGPEI
FT                   VEAINSLDGKLDAFVAGIGTGGTISGTGEVLKKNFEGIKIYAVEPAASPILSGGNPGPH
FT                   KIQGIGANFVPDILNREIYDGVITVENEEAFEYARRAAKEEGLLVGISSGAAIYAALKV
FT                   AKELGKGKRVIAIIPSNGERYLSTPLFNFEN"
FT   gene            80105..81670
FT                   /locus_tag="Pjdr2_0075"
FT   CDS_pept        80105..81670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0075"
FT                   /product="Anthranilate synthase"
FT                   /EC_number="4.1.3.27"
FT                   /note="PFAM: Chorismate binding-like; Anthranilate synthase
FT                   component I domain protein; KEGG: baa:BA_0658
FT                   para-aminobenzoate synthetase component I"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98755"
FT                   /db_xref="GOA:C6CRP0"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRP0"
FT                   /inference="protein motif:PRIAM:4.1.3.27"
FT                   /protein_id="ACS98755.1"
FT                   /translation="MFTAVGQWALWQAERKYTTLPLLKRIPLHAITVDSWESAWGAASQ
FT                   HAFVLESGKDGRYTYLGLHPEGVIRGKGYNAHSSEWDREGQVLSEQLWEGKPLEVVRRW
FT                   MEPHRSPKLADGPKWTGGCIGFWSYDVIRSIERLPELAADDTGLPDYLFLRMNRIWIVD
FT                   QQEKMLYCAVHTAVTGEESEAHLQAKYDEAVAQAEEMAAFWQQHIQSQAGEASAVREER
FT                   RLFTESDSLHIDVESVEGITSPFRKEAFMEAVSRIQQYISQGDVFQVNLSQRQSRKVSS
FT                   SPEELYEWLRIFNPSPYMGFLRCPDFQLVSASPELLVEQNGDKLATRPIAGTRRRGRSE
FT                   EEDRIMAEELRTSEKERAEHIMLVDLERNDLGRISEFGTVKVEELMVIEYYSHVMHLVS
FT                   QVEGLLAEGKDAYDVIAATFPGGTITGAPKIRTMEIIEELEPVRRGAYTGSLGWIDYNG
FT                   DMEFNIIIRTMAVKDGIVNIQAGAGIVIDSDPEREYYESLSKAKALWKAIQYSERFAKR
FT                   TSRT"
FT   gene            81704..82285
FT                   /locus_tag="Pjdr2_0076"
FT   CDS_pept        81704..82285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0076"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   bha:BH0091 para-aminobenzoate/anthranilate synthase
FT                   glutamine amidotransferase component II"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98756"
FT                   /db_xref="GOA:C6CRP1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRP1"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACS98756.1"
FT                   /translation="MILVIDNYDSFTYNLVQYLGELGEEVVVKRNDEIDLAGIEALKPD
FT                   HILISPGPCSPNEAGISLSVIEHFKGIIPIFGVCLGHQSIGQAFGGDVVRAEKLMHGKT
FT                   SEILHDGKTIFEGIPSPYTATRYHSLIVKRETLPDCLEISAETAEGEIMGLRHKEYPIE
FT                   GVQFHPESIITQHGHDMLRNFLKIRTGAAR"
FT   gene            82282..83163
FT                   /locus_tag="Pjdr2_0077"
FT   CDS_pept        82282..83163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0077"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: baa:BA_0660
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98757"
FT                   /db_xref="GOA:C6CRP2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRP2"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACS98757.1"
FT                   /translation="MKIGLNQAVMESGEAVISVYDHGFLYGMGLFETFRTYGGKPYLLE
FT                   RHMKRLAEGCEAIGIRYKPDLDALRQMIATLLRENGLTEGYIRLTVTAGTGELGLPSGD
FT                   YEQPTEFMLVKALPPHNESLYSEGKELRLLKTARNTPEGAIRLKSLHYMNNIIAKRELL
FT                   ASGASPSAEGLMLSHEGLLAEGVVSNLFFVQEDKIYTPSTDIGILPGITRQRVIELARG
FT                   LGYTVREGHYLFEELLDANEIWLTTSIQELVPVTLVTDHHGGSTVVGSGTAGPVLRELL
FT                   LAYREDTEEQQR"
FT   gene            83160..84047
FT                   /locus_tag="Pjdr2_0078"
FT   CDS_pept        83160..84047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0078"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: bha:BH0093 dihydropteroate synthase
FT                   (dihydropteroate pyrophosphorylase); TIGRFAM:
FT                   dihydropteroate synthase; PFAM: dihydropteroate synthase
FT                   DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98758"
FT                   /db_xref="GOA:C6CRP3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRP3"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ACS98758.1"
FT                   /translation="MSEQERGQGLTGYKPTFWNRSYELDGGIKLELGKRTLIMGILNAT
FT                   PDSFSDGGRYNHAEAAAARAAAMVEEGVDIIDIGAESTRPGFEPVSVEEELRRLLPVIR
FT                   AVREAAPHVPISIDTYKAETARQALEAGAHIINDIWGLKYDPFMAAVAAEYGCPVVISH
FT                   NRPARDYGDLVPDVLADLQASVAIALQAGVEASEIWLDPGLGFAKDHDDNLELMGRLSE
FT                   LTALGYPVLLGTSRKRFIRQTLDLPVDELAEGTAATTALGIAQGCQIVRVHDVRANKRT
FT                   AMMTDAIMYNSKNL"
FT   gene            84163..84549
FT                   /locus_tag="Pjdr2_0079"
FT   CDS_pept        84163..84549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0079"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="KEGG: bsu:BSU00780 dihydroneopterin aldolase;
FT                   TIGRFAM: dihydroneopterin aldolase; PFAM: dihydroneopterin
FT                   aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98759"
FT                   /db_xref="GOA:C6CRP4"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRP4"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ACS98759.1"
FT                   /translation="MDSMIMKGMQFYGYHGVFPEENRLGQKFIVDLDLKLDLEKAAATD
FT                   DLGATINYAELYEQIKSVVQGEPYKLIEALAGGIATRVLEAYTMINEVTVRVTKPNPPF
FT                   EIHFDGVTIELRRKRDGNGRVVRA"
FT   gene            84527..85078
FT                   /locus_tag="Pjdr2_0080"
FT   CDS_pept        84527..85078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0080"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: bsu:BSU00790 7,8-dihydro-6-hydroxymethylpterin
FT                   pyrophosphokinase; TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98760"
FT                   /db_xref="GOA:C6CRP5"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRP5"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ACS98760.1"
FT                   /translation="MGVLSVPNTLAEAYIALGSNLNDREELLQQAVEHLRQQSGVQVLG
FT                   ISGIYETDPVGYTDQPAFLNMAMAVKTTLSPIELLHVLFKVEQLLGRVRDIRWGPRTID
FT                   LDLLLYGDVTMDDEELTLPHPRMMERAFVLVPLADVIDSSHPLQDRVSNTAAAALQDGK
FT                   EGITLWKITNWLSGSGHSGS"
FT   gene            85030..85239
FT                   /locus_tag="Pjdr2_0081"
FT   CDS_pept        85030..85239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0081"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bha:BH0096
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98761"
FT                   /db_xref="GOA:C6CRP6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRP6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACS98761.1"
FT                   /translation="MENHQLAQRVRAFRKLKGYTQQELAKVLGVSVAVLGSLERGTRKP
FT                   DARLMMNIANTLGISYEELMDTES"
FT   gene            85329..86345
FT                   /locus_tag="Pjdr2_0082"
FT   CDS_pept        85329..86345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0082"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: bha:BH0097 nitrogen
FT                   regulation transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98762"
FT                   /db_xref="GOA:C6CRP7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRP7"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ACS98762.1"
FT                   /translation="MLKIGDIEMKNKVVLAPMAGVCNPAFRLIAKEFGTGLVCAEMVSD
FT                   KAILHGNKRTMEMLFVDEREKPLSLQIFGGDRESLVEAAKVVDQQTNADIIDINMGCPV
FT                   PKVTKCDAGARWLLDPNKIYEMVSAVTAAVSKPVTVKMRIGWDDEHIYAVDNAKAVESA
FT                   GGKAVSVHGRTREQQYTGKANWDIIRDVKQAVSIPVIGNGDVFSPEDARRMLDHTGCDG
FT                   VMIGRGALGNPWMLYRTIQYLESGELLPDPLPREKLEVAILHMDRLVALRGEAAAVREM
FT                   RKHMAWYLKGLPGAARVKDVIMEETGRDKLVEVMENYIASLDEEALAGMAGSSNNSH"
FT   gene            86607..87083
FT                   /locus_tag="Pjdr2_0083"
FT   CDS_pept        86607..87083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0083"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98763"
FT                   /db_xref="GOA:C6CRP9"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRP9"
FT                   /inference="protein motif:TFAM:TIGR01462"
FT                   /protein_id="ACS98763.1"
FT                   /translation="MSDKEIILTQDGLKKLEEELENLKSVKRREVAERIKVAIGYGDIS
FT                   ENSEYEDAKNEQAFIEGRIITLEKMLRNARIINNDEIDTDTVSIGSVVTVEDLEFGDTM
FT                   EYAIVGSAESDPLRNKISNESPVGKAILGKKRGTVVDVSVPAGIIQYKIVDIKK"
FT   gene            87275..88792
FT                   /locus_tag="Pjdr2_0084"
FT   CDS_pept        87275..88792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0084"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: bsu:BSU00820 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98764"
FT                   /db_xref="GOA:C6CRQ0"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRQ0"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACS98764.1"
FT                   /translation="MDQQNTGVEQEQELSELLQIRRDKLDELRALGVDPFGVKFERTHN
FT                   AKDIVSAYEELSKEELEEKAIKVSVAGRIMQKRGMGKASFAHIQDLSGKIQIYVRKDTV
FT                   EANKYAAFEMLDIGDIVGITGVVFKTNTGEVSVKAYEVEVLTKSLLPLPDKYHGLKDVE
FT                   LRYRQRYVDLIVNPDVQQTFITRSRIIQSMRRYLDSKGYLEVETPTLHSIAGGAAARPF
FT                   ITHHNALDMQLYMRIAIELHLKRLIVGGLEKVYEIGRVYRNEGISTRHNPEFTMIELYE
FT                   AYADYKDIMALTENLIAHIAQEVLGTMKISYQGQEIDLTPQWRRVSMVDLVKEVTGVDF
FT                   SVEMSDEEAHALAKVHKVPVEPHMTFGHILNAFFETHCEHTLIQPTFVTGHPVAISPLA
FT                   KKNPVDPRFTDRFELFVVAREHANAFTELNDPIDQRQRFEAQLVEKEQGNDEAHEMDDD
FT                   FIRALEYGMPPTGGLGIGVDRLVMLLTDAPSIRDVLLFPHMRERAGE"
FT   gene            89360..92482
FT                   /locus_tag="Pjdr2_0085"
FT   CDS_pept        89360..92482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0085"
FT                   /product="glycosyl transferase family 39"
FT                   /note="PFAM: glycosyl transferase family 39; KEGG:
FT                   geo:Geob_0316 glycosyl transferase family 39"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98765"
FT                   /db_xref="GOA:C6CRQ1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="InterPro:IPR032421"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRQ1"
FT                   /inference="protein motif:PFAM:PF02366"
FT                   /protein_id="ACS98765.1"
FT                   /translation="MNGKPLAAGGKPSLNGLWIALLAAFAFRFYIAATNPGYTNDVNTF
FT                   IYWANHAFKDGLGNFYQEGLFADYPPGYIYVLYVMGALQSWFGIGSTSDAAIVFYKLPA
FT                   IFTDLITGYLIYRTAVKKLDHRAAFGLAMIFVWNPAVWINSAGWGQVDSFFALILVLAI
FT                   RAITDGKLERGSIWFALAVLVKPQALIFTPVMLLAYGYNLKHWKRVAAGIGYGAVAFLL
FT                   LAAPFIWKNGGLSALYHLYKSTLSSYPYATLNAFNLYALTGGNWAKLDAHWLGLEYSVW
FT                   GNIGIVFATVVSVLFFAFRKQQKDLTGSFYMALILIVTVFMFAAKMHERYMFPALLLMI
FT                   FAYIEAKDRRILHLLFGFSITHFINVGYVLAFSQENTFLPSSNGIMIVTSLVNIGLYLY
FT                   MIYIGYDRYIKGRLQPVPAVTKDELAMSEERLLQSVRAQEQPARRLQRKDWLWMSVITG
FT                   IYAVIALVNLGSTVSFDSGWKADRDGQSFYVDFGKPVQVGQINSFNGVGVGKYKWEFSN
FT                   STPDQWSNPIEIEQKVGDDLKWTVNPVNQTVRYAKLTVTQWGFSMQEVAFYPEGSNNPI
FT                   PVEQVVDLGDASEGQKDAALAGSRLFDEQQDAVYKPNYLNSSYFDEIYHARTAYENLHG
FT                   MKAYENTHPPLGKLLIAVGIKLFGLSPFGWRIVGTLFGIAMLPIIYLFALQLFRKTGFA
FT                   ATATILFAADFMHFTQTRIATIDVYGVFFIMLMFYFMNKYREMSFYRSPLRKTLVPLFW
FT                   AGLLFGIGVASKWIVIYGGAGLAVMLALVLIERYREHAAAKRILAGGEESYPYTDNEAY
FT                   QRASRGFMRNTLLTLASCLVFFVAIPLVIYCLSYIPVLHVKGDTYTAERLIEYQEHMYD
FT                   YHSKLVATHPYSSQWWEWPFMKRPVWYYNGKNLEPGMVSSISAFGNPLIWWTGIFAVIA
FT                   AFYISVKRKDKRMYVLWIAYLSQYLPWMLVPRLTFLYHYFAMVPFMIMAIVYIFTRIED
FT                   GRENKKWIRWVYAGIAVVLFIMYYPVISGMEVSKEYVMIALRHFDSWVFYS"
FT   gene            92505..93488
FT                   /locus_tag="Pjdr2_0086"
FT   CDS_pept        92505..93488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0086"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   geo:Geob_0317 glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98766"
FT                   /db_xref="GOA:C6CRQ2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRQ2"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACS98766.1"
FT                   /translation="MKARYSIIVPMYNEEEVIRHTYAKLKEVMDGYGEPYELVFVNDGS
FT                   KDRTVEIVEGVCQQDSNVRLVNFSRNFGHQIAITAGMDYAQGDAIIIIDADLQDPPEVM
FT                   LEMIAKWKEGYEVVYGKRLKRKGETFFKKITAMMFYRTMRSLTNFDIPMDTGDFRLIDR
FT                   KVCDVLRGLKEKNRFVRGLVSWVGFRQTMVEYVREERFAGETKYPLKKMINFAVDGITS
FT                   FSYKPLKIASYIGFTLSATSFVYLLVVLCQRLFTSSTVAGWTTIVAINLLFNGIILMLL
FT                   GLIGEYIGRIYDESKNRPLYIVREARGFSEEKEQEEKREKEREYVH"
FT   gene            93478..93924
FT                   /locus_tag="Pjdr2_0087"
FT   CDS_pept        93478..93924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0087"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: bsu:BSU18170
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98767"
FT                   /db_xref="GOA:C6CRQ3"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRQ3"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ACS98767.1"
FT                   /translation="MSIEQPRQQISPRKQKLGALKQFVVFNMVGLLNTLVDFVVYGILV
FT                   WAGLYVLPAQVISYSAGMVNSYVLNSLITFKGASKREGEYKADRGRAVRFILLNAAVLG
FT                   VSMLLLYELTEAAGLGPLTAKLLATGVTVVLNFAGSKWWVFKQS"
FT   gene            94139..95672
FT                   /locus_tag="Pjdr2_R0005"
FT   rRNA            94139..95672
FT                   /locus_tag="Pjdr2_R0005"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            95801..95877
FT                   /locus_tag="Pjdr2_R0006"
FT                   /note="tRNA-Ile1"
FT   tRNA            95801..95877
FT                   /locus_tag="Pjdr2_R0006"
FT                   /product="tRNA-Ile"
FT   gene            95912..95987
FT                   /locus_tag="Pjdr2_R0007"
FT                   /note="tRNA-Ala1"
FT   tRNA            95912..95987
FT                   /locus_tag="Pjdr2_R0007"
FT                   /product="tRNA-Ala"
FT   gene            96064..98993
FT                   /locus_tag="Pjdr2_R0008"
FT   rRNA            96064..98993
FT                   /locus_tag="Pjdr2_R0008"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            99091..99206
FT                   /locus_tag="Pjdr2_R0009"
FT   rRNA            99091..99206
FT                   /locus_tag="Pjdr2_R0009"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            99331..100512
FT                   /locus_tag="Pjdr2_0088"
FT   CDS_pept        99331..100512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0088"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bar:GBAA2952 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98768"
FT                   /db_xref="GOA:C6CRQ4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRQ4"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS98768.1"
FT                   /translation="MTKETRLLTMDQFDDMIELSQFAFQYEIPPAKLAESRERFEREET
FT                   DRWGIYIDGKLAAQLAILDLFTYIGDKRFAMGGIAGVSTWPEYRRQGLVAELLHHSLQK
FT                   MKEKGQTLSFLHPFSIGFYRKFGWEVYTDLKTYRIDVGHLPARTPYSGTIKRVEQSYEL
FT                   LNPIYNVYAKKVNGALDRSVAWWNYRISSRKKGQTCVFFDSAGEAQGYVIYEVKNRELF
FT                   VHELIDLTEEARRALWSFLGQHDSMIDRLEIKVATDDGLAYLLNNPRIKQEIEPYFMAR
FT                   IVDAEAFLKEYPFEAGDEESFLFDIQDDHAAWNNGRFEVRIAADGTANVQRLSGETNKE
FT                   SIRTGIGSLAAMLTGYKRPAELLRYGLIQGQSLQMKQLERRIPVRTTFLPDFF"
FT   gene            100679..102136
FT                   /locus_tag="Pjdr2_0089"
FT   CDS_pept        100679..102136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0089"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /note="KEGG: bha:BH0020 inosine 5'-monophosphate
FT                   dehydrogenase; TIGRFAM: inosine-5'-monophosphate
FT                   dehydrogenase; PFAM: IMP dehydrogenase/GMP reductase; CBS
FT                   domain containing protein; SMART: CBS domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98769"
FT                   /db_xref="GOA:C6CRQ5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRQ5"
FT                   /inference="protein motif:TFAM:TIGR01302"
FT                   /protein_id="ACS98769.1"
FT                   /translation="MWETKFAKEGLTFDDVLLVPRKSVVLPRESDVSTKLSEGIKLNIP
FT                   LISAGMDTVTESALAIAIAREGGVGIIHKNMSVAQQAEEVDRVKRSESGVITNPFSLTP
FT                   DHHVYDAEELMGKYRISGVPIVDSEQKLVGILTNRDLRFVHDYSIKINEVMTRTDLVTA
FT                   PVGTTLQEAEGLLQKHKIEKLPLVDENNTLKGLITIKDIEKAIQFPNAAKDKHGRLLCG
FT                   AAVGIGKDTADRADALVQAGIDVLVVDSAHGHHINILEAVRKLRAKYPDLTIIAGNVAT
FT                   GEATRDLIEAGASVVKVGIGPGSICTTRVIAGIGVPQITAIYDCATVAREYNVPVIADG
FT                   GIKYSGDITKAIAAGASAIMIGSLFAGTAESPGETEIFQGRSFKVYRGMGSLGAMKEGS
FT                   KDRYFQENESKLVPEGIEGRVPFKGPLADTVHQLLGGLRSGMGYCGTKNLDELRNDTQF
FT                   IRITGSGLRESHPHDVQITKEAPNYSL"
FT   gene            102423..103709
FT                   /locus_tag="Pjdr2_0090"
FT   CDS_pept        102423..103709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0090"
FT                   /product="Serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /EC_number="3.4.16.4"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; beta-lactamase; Penicillin-binding
FT                   protein 5 domain protein; KEGG: baa:BA_0604 peptidase_S11,
FT                   D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98770"
FT                   /db_xref="GOA:C6CRQ6"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRQ6"
FT                   /inference="protein motif:PRIAM:3.4.16.4"
FT                   /protein_id="ACS98770.1"
FT                   /translation="MKVLPVRLRSLVVAFVAGIVALSLGTSSVNAAGTKGGEWVENSLG
FT                   LELSSAILIDADTGQVVYEVNADEPRPPASMTKMMTEYIVLEQIKSKALNWDEMITVSE
FT                   EAANTPKDGSQVYLAQGEQYKVKDLYMAMAVGSANDATIALASAIGGSEQGFVEKMNET
FT                   AQKLGLTSAHYTSATGLADTTVISAKDQAKLAQIIIKNDPEFLEYASTTEYKFRPRDDK
FT                   PIVNINWMLASNKSNTYLKAFAYDGVDGMKTGYISAAGYTFTGTVKRGDQRYISVVMNT
FT                   KSKEARFNETAKLYNYAFNSLEKKTVIPAKSVVEKAESVKIKKGVKKSVPIITESDISL
FT                   IVKKGADPKVELTGYELKKPEELVAPIKAGQVVGTATYKYTDEQGKALEKTVNLIASKD
FT                   VKKASWFALMFRGIGGFFSGLFNGIVDLF"
FT   sig_peptide     102423..102518
FT                   /locus_tag="Pjdr2_0090"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 32"
FT   gene            103888..104769
FT                   /locus_tag="Pjdr2_0091"
FT   CDS_pept        103888..104769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0091"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="TIGRFAM: pyridoxine biosynthesis protein; PFAM:
FT                   Vitamin B6 biosynthesis protein; thiazole biosynthesis
FT                   family protein; KEGG: bha:BH0022 pyridoxal biosynthesis
FT                   lyase PdxS"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98771"
FT                   /db_xref="GOA:C6CRQ7"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRQ7"
FT                   /inference="protein motif:TFAM:TIGR00343"
FT                   /protein_id="ACS98771.1"
FT                   /translation="METGTSRVKRGMAEMQKGGVIMDVMNAEQAKIAEAAGATAVMALE
FT                   RVPSDIRAAGGVARMADPTIVEEVMKVVSIPVMAKARIGHIVEARVLESMGVDYIDESE
FT                   VLTPADEVFHISKNEFTIPFVCGAKDLGEALRRIQEGAAMLRTKGEPGTGNIVEAVRHL
FT                   RLINGQIRKVQNLSKDELYNEAKVLGVPYDLLLQVHESGKLPVVNFAAGGVATPSDAAL
FT                   MMELGADGVFVGSGIFKSDSPEKFARAIVEATTHYKDYKLIAEVSKNLGTPMKGIEISK
FT                   LQAAERMQDRGL"
FT   gene            104802..105389
FT                   /locus_tag="Pjdr2_0092"
FT   CDS_pept        104802..105389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0092"
FT                   /product="SNO glutamine amidotransferase"
FT                   /note="PFAM: SNO glutamine amidotransferase; CobB/CobQ
FT                   domain protein glutamine amidotransferase; KEGG: bha:BH0023
FT                   glutamine amidotransferase subunit PdxT"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98772"
FT                   /db_xref="GOA:C6CRQ8"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRQ8"
FT                   /inference="protein motif:PFAM:PF01174"
FT                   /protein_id="ACS98772.1"
FT                   /translation="MKIGVLALQGAVAEHIRSLEAAGAEAVAVKRIEELAELDGIVIPG
FT                   GESTTIGKLIRKYDFLEALKEFSKQGKPLFGTCAGLIILARKIEGQDDAHLELMDMVVA
FT                   RNAFGRQRESFETDLPIQGIDEPIRAVFIRAPLIKEVGSSVEVLSVYNDEIVAARQGHL
FT                   LACSFHPELTDDYRLHAYFVDMVKEAAKTTTK"
FT   gene            105426..106709
FT                   /locus_tag="Pjdr2_0093"
FT   CDS_pept        105426..106709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0093"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: baa:BA_0607 tRNA synthetase class II core
FT                   domain (G, H, P, S and T); TIGRFAM: seryl-tRNA synthetase;
FT                   PFAM: tRNA synthetase class II (G H P and S); Seryl-tRNA
FT                   synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98773"
FT                   /db_xref="GOA:C6CRQ9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRQ9"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ACS98773.1"
FT                   /translation="MLDVKWLRNEYEQVEKALKNRSASLDLISGFPELDVKRRALLVET
FT                   DNLKTRRNTVSQEVAKLKKSGGDAEALIIEMREVGDRIKELDEEIRTVEAQVEELMLAI
FT                   PNLPHESVPVGSSEEDNVEIRRNGEQTTFDFEPKAHWDLAQDLGILDFERAGKVTGSRF
FT                   TFYRGLGARLERALISFMMDLHSDQHGYEEVLPPYLVNRDSLIGTGQLPKFEEDLFKIS
FT                   DSDYFLIPTAEVPVTNLHREEILSIEELPKHFVAYSSCFRSEAGAAGRDTRGLIRQHQF
FT                   NKVELIKLAKPEESYDELEKMTANAEKVLQLLGLPYRVLALCTGDMGFTAAKTYDLEVW
FT                   LPSAGTYREISSCSNVEDFQARRAGIRFRRDAKSKPEFVHTLNGSGLAVGRTFAAILEN
FT                   YQQADGTIVVPEVLRPYMGGLEKISPRV"
FT   gene            106790..106878
FT                   /locus_tag="Pjdr2_R0010"
FT                   /note="tRNA-Ser1"
FT   tRNA            106790..106878
FT                   /locus_tag="Pjdr2_R0010"
FT                   /product="tRNA-Ser"
FT   gene            107139..107483
FT                   /locus_tag="Pjdr2_0094"
FT   CDS_pept        107139..107483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98774"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRR0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98774.1"
FT                   /translation="MANDKLQIDQNQLVAAWQRTLPEWIKDADNCEVFADESDPNALRV
FT                   TISTAGHQAYSFDFKVCYVDSREVKVEVIDVDKNKVSIDERTDPMQQLIQDYTRHLHEC
FT                   AQALHQLTHA"
FT   gene            107496..107672
FT                   /locus_tag="Pjdr2_0095"
FT   CDS_pept        107496..107672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98775"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRR1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98775.1"
FT                   /translation="MTKAKGSLDKNLSNVIDDLAQTPVNSHQAQQLNQDANDRRHQDAL
FT                   NHDQPTDLHHQRS"
FT   gene            107696..107848
FT                   /locus_tag="Pjdr2_0096"
FT   CDS_pept        107696..107848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0096"
FT                   /product="small acid-soluble spore P family protein"
FT                   /note="PFAM: small acid-soluble spore P family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98776"
FT                   /db_xref="GOA:C6CRR2"
FT                   /db_xref="InterPro:IPR012614"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRR2"
FT                   /inference="protein motif:PFAM:PF08179"
FT                   /protein_id="ACS98776.1"
FT                   /translation="MSKPDSYPVPEAQENGGRQRQNQGRQQEPLSGSKKVKQRNHVRHN
FT                   NPEGS"
FT   gene            107978..109036
FT                   /locus_tag="Pjdr2_0097"
FT   CDS_pept        107978..109036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0097"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98777"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRR3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98777.1"
FT                   /translation="MKMVQRLAYLALIAVLLIIAGCSSGDAPPKQALQDAMKNMEKLDS
FT                   YSAKMSLGIDNLELPASTAQNGIDMTTVITGMMKGAKLDIKMVYAKEPKRTDMELNLQL
FT                   SGTTITIPMIMTAEKLYMKLPALPMLQLPESAAGKFVELDLKALAQQQGAAATTLDAAA
FT                   QQQLVQDLGAVVLKHFDEKTYFKSVKAKDAGVPDGVKAEQVVQFKMDESNYKQSVDTIV
FT                   NEMVPELLTVIASNESYMQAIQKSKEDVEKMKTDWEADKAAKIDYLNQNVKVNELSVTG
FT                   AINKDKILAYQAGKVNVELTDKETGGATKVNVHYDMTYGDLNGNPKFLYEVPTDAVKFE
FT                   DLMKQMQLPLGL"
FT   sig_peptide     107978..108055
FT                   /locus_tag="Pjdr2_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.916 at
FT                   residue 26"
FT   gene            109059..109784
FT                   /locus_tag="Pjdr2_0098"
FT   CDS_pept        109059..109784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0098"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: gdj:Gdia_0941 DsbA
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98778"
FT                   /db_xref="GOA:C6CRR4"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRR4"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ACS98778.1"
FT                   /translation="MKIEVWSDFACPFCYIGKRRLEQALSEFEHGDQVEVEFRSFELDP
FT                   NAPVEIGHDVYDYLSNKYGMSRQQAISNNVQLTQQAKTLGLDYHFDTMILTNTFDAHQL
FT                   THFAAKYGKREEMAERLFKAYFTDSKHLGRKEVLADLAAEIGLDREEALKALEAGTYKQ
FT                   EVRTNEQEAGQLGVRGVPFFVIDRKYAVSGAQPSEVFLQAVSKAWEENKPLTVIGGDSG
FT                   ANGADDACVDGVCAPKSDK"
FT   gene            109827..110252
FT                   /locus_tag="Pjdr2_0099"
FT   CDS_pept        109827..110252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0099"
FT                   /product="nuclease"
FT                   /note="KEGG: bsu:BSU03430 nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98779"
FT                   /db_xref="InterPro:IPR029476"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRR5"
FT                   /inference="similar to AA sequence:KEGG:BSU03430"
FT                   /protein_id="ACS98779.1"
FT                   /translation="MKKLLAILFVAIMIYVVPHLDDWQGQPSAEPASSSNYTLEFPADR
FT                   YPETAQHIREAMASGESKICTIDRENAEENRKESLKDIPTKKGYDRDEWPMAMCKEGGD
FT                   GADIAYIAPSDNRGAGAWVSNQLDTFPDGTRVEFIVK"
FT   gene            110485..111252
FT                   /locus_tag="Pjdr2_0100"
FT   CDS_pept        110485..111252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0100"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cko:CKO_02892 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98780"
FT                   /db_xref="GOA:C6CRR6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRR6"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACS98780.1"
FT                   /translation="MSAADARGVTIITSTMRPQHINQLFQNYARQDWTNKELIIIVNKD
FT                   RAGLQQYQNKAKSFPNVRVFRMSEKSKLGACLNYGASLAKYDYIAKFDDDDYYGPNYIS
FT                   EAMTMFQTSKADIVGKLEIYYFFPHRSTLMLRRRGKSWYTPVSKVAGATIMFHKRVLEK
FT                   VSFNTKVRQGSDVRFIKGALGHKFRVYTTSPYNFTAMRRADRSSHTWKITDQNLLRSKG
FT                   AVLTRTDSYRKRVNRSLQQLHGMGLRRPSSNAQ"
FT   gene            111356..112141
FT                   /locus_tag="Pjdr2_0101"
FT   CDS_pept        111356..112141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0101"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: yen:YE3253 DL-methionine transporter ATP-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98781"
FT                   /db_xref="GOA:C6CRR7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRR7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS98781.1"
FT                   /translation="MITFREVSKRYKAGRQWVEAVKPTSLHIEKGQIQGMIGFSGAGKS
FT                   TLLRMANLLETPTSGEVYIDGQELTRLSAGELREARRSIGMIFQHYNLLSNETCAANVE
FT                   FVLKAAKLPSRERKRRVEECLEIVGLADKARQYPAQLSGGQKQRVAIARALANNPKVLL
FT                   CDEPTSALDPVTTLSILEFLEKINREFQVTIMLVTHEIQVAKRLCSRIAVMENGRITEQ
FT                   LDMMNLSGVKPVTPLGQILFDTAEGSSSSVWQRGEGYRG"
FT   gene            112134..112796
FT                   /locus_tag="Pjdr2_0102"
FT   CDS_pept        112134..112796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0102"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dac:Daci_4597
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98782"
FT                   /db_xref="GOA:C6CRR8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRR8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS98782.1"
FT                   /translation="MDSVLALKSEIIKAIQQTLTMVSISVAAAVIIGLPIGIFLFLTAP
FT                   GHLRANRPLYSIVSYAVNLVRSFPFLILLVALIPFSRMIVGTAIGPLAASVSLSVAAIP
FT                   FYARLAEQSLREVPKGVIEAAVASGAPMKHIIWGVLLSEARPGLVSGLTVTIISFISYS
FT                   AAAGTVGGGGIGDLAIRYGYQRFDTEVMAACIVILVVLVQLVQWTGSFAATLLDKRK"
FT   gene            complement(112798..113316)
FT                   /locus_tag="Pjdr2_0103"
FT   CDS_pept        complement(112798..113316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bar:GBAA2721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98783"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRR9"
FT                   /inference="similar to AA sequence:KEGG:GBAA2721"
FT                   /protein_id="ACS98783.1"
FT                   /translation="MLERPQASEYNEFFTRYIGLVPEGNLIALLEEQQAETNRIYSALS
FT                   AEQADYRYGEGKWSLKEVLGHVTDTERIMSYRLLRIARGDQTPLPGFDQDAYMEGSPFS
FT                   GLTVTDLLENYNAVRHATIVLLKQLSAEAFTRSGFANQSPLTARAIAYIMYGHERNHLS
FT                   IVQERYLNN"
FT   gene            complement(113772..114092)
FT                   /locus_tag="Pjdr2_0104"
FT   CDS_pept        complement(113772..114092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0104"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="SMART: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: swd:Swoo_3901 low molecular weight
FT                   phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98784"
FT                   /db_xref="InterPro:IPR016919"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRS0"
FT                   /inference="protein motif:SMART:SM00226"
FT                   /protein_id="ACS98784.1"
FT                   /translation="MFICSRNKWRSLTAEKVFESYSMYEVRSAGTEENARIKVNAGHVG
FT                   WADLIFAMEKKHLRRLQAKFASELIGKQVICLGIPDEYGFMDAELIDLLKSTVSDYIEV
FT                   PE"
FT   gene            114241..114966
FT                   /locus_tag="Pjdr2_0105"
FT   CDS_pept        114241..114966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0105"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bar:GBAA2405 hydrolase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98785"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRS1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACS98785.1"
FT                   /translation="MRIADGIEMLELDLGPMTVWPTVLFDKDEWVLVDTGMPGSASTII
FT                   ELAKLAGIVEQKLNTILLTHQDLDHIGGLPGFKADNPELVIYAHEDDRAVIDGKKPMLK
FT                   ASPERIAALLGALPEVARSQFEATFIHPTGANVDRTMADGENLPFGGGVTVIHTPGHTP
FT                   GHVSLYHQSSKTLIAGDAMVVDNGELKGPREAVTPDMASALQSLKKLKDFDIETVICYH
FT                   GGVFKGDVQGRIAALTEGL"
FT   gene            complement(115081..115158)
FT                   /locus_tag="Pjdr2_R0011"
FT                   /note="tRNA-Arg6"
FT   tRNA            complement(115081..115158)
FT                   /locus_tag="Pjdr2_R0011"
FT                   /product="tRNA-Arg"
FT   gene            complement(115635..116105)
FT                   /locus_tag="Pjdr2_0106"
FT   CDS_pept        complement(115635..116105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0106"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   baa:BA_0612 dCMP_cyt_deam, cytidine and deoxycytidylate
FT                   deaminase zinc-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98786"
FT                   /db_xref="GOA:C6CRS2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRS2"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACS98786.1"
FT                   /translation="MIREQEDQAWMQLAIEEAKKAEQIGEVPIGAILVKNGEVVGRGYN
FT                   LRETNHDPTAHAEMVAIREACERLGAWRLLDCTLYVTLEPCPMCAGAIVQSRVKRVVYG
FT                   TGDPKAGCAGTLMNLLQEPRFNHETELTSGVLQAECAELLTNFFRNLRNKRK"
FT   gene            116319..118193
FT                   /locus_tag="Pjdr2_0107"
FT   CDS_pept        116319..118193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0107"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: bar:GBAA2636 sensor histidine kinase; TIGRFAM:
FT                   PAS sensor protein; PFAM: ATP-binding region ATPase domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; histidine kinase HAMP region domain protein; PAS
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98787"
FT                   /db_xref="GOA:C6CRS3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRS3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACS98787.1"
FT                   /translation="MSFKAKFSIYIFMIVLAMFILIVILDQYAALRNMNQDMEEVMEQA
FT                   SAKLSESFDQHPGWSSAVASLRDDPEFEPNEMQVLLKKLYPELEEVTVFRPDSTGIMSE
FT                   DKVLLGTYTFRDEAKDMAYAAQAAEKGFQVREVNLNGKEYIKSYYSDASLAPYVIGMVY
FT                   DCEEYNQIMSMKRMDAIAYAGIILLFVLISSYLLAGFMLRPLNAILWKVNEVSLGRFQT
FT                   AIKVRGKDEFGLLALKINAMSQNLSIYMEKLRQAFEDNRQMKEYLQSFIDHTSDAIHVV
FT                   DLQGKFIQVNTAFEQLFGYTSEEVFGAEIELVPDTHRGEMRLIINSLQEGKVLPAQETI
FT                   RLTKSGEIIPVSVTISPIRDTEGVIQAFASITRDMRSRNRMEELLRRSEKLTTVGQLAA
FT                   GVAHEIRNPLTTLRGFLQLQQHTGKMNLEHTGLMLSELDRINLIVGEFLILAKPQATRF
FT                   ATKDVRDVFRSVLSLIDSEGHLHNVAFSTSFTESACLVSCEENQLKQVFINLLKNGIEA
FT                   MPSGGRIHTHIASKNDQITISITDEGIGIPEDMIPKIGNPFFTGKESGTGLGMMISQRI
FT                   IHSHQGLMEIKSQVNVGTTIIITLPALKEGNTNGILGEGLDKRSANVG"
FT   sig_peptide     116319..116408
FT                   /locus_tag="Pjdr2_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.721) with cleavage site probability 0.633 at
FT                   residue 30"
FT   gene            118211..118957
FT                   /locus_tag="Pjdr2_0108"
FT   CDS_pept        118211..118957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0108"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; KEGG: pla:Plav_0855 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98788"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRS4"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS98788.1"
FT                   /translation="MDNIAGTSTYSCLIAGATGLVGSALLEQLLNDPACHSITVLARRP
FT                   IGRIEMEPEARSKLHVIIADFDRMWEALDDVAVDLVYCTLGTTIKTAGSQEEFRKVDYD
FT                   YPLALAEWGQHAGARHFLVITAMGASSSSAFFYNRVKGELEEQLALIPLESVRIFRPSL
FT                   LLGPRQSFRLGETIGAAVSKAVQWGMVGSLRPYRPIAGEAVAKAMRIAAKQAMTEQALE
FT                   RQAEGQPAIHTYSSDRIAEMAAQTTG"
FT   gene            118964..119665
FT                   /locus_tag="Pjdr2_0109"
FT   CDS_pept        118964..119665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0109"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; RNA-binding S4 domain
FT                   protein; SMART: RNA-binding S4 domain protein; KEGG:
FT                   vpa:VP0750 pseudouridine synthase family 1 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98789"
FT                   /db_xref="GOA:C6CRS5"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRS5"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACS98789.1"
FT                   /translation="MRINKFISETGYCSRREADKLVDSGRVTINGAKAELGSQAELGDD
FT                   VRIDGKRIGEQKHHVYIALNKPVGITSTTELHIRGNIVDFVGHKERIFPIGRLDKDSEG
FT                   LILLTNDGDVVNPILRSEGKHEKEYIVTVDRPVTAEFVKGMSSGVRILGSMTLPCQVTR
FT                   VAERVFRIVLTEGKNRQIRRMCEAFGYHVRKLQRIRIMNIHLGQLPTGKWRDLTETEKA
FT                   ELFGSLDYRPS"
FT   gene            complement(119792..120610)
FT                   /locus_tag="Pjdr2_0110"
FT   CDS_pept        complement(119792..120610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0110"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: bsu:BSU13680
FT                   flagellar motor protein MotB"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98790"
FT                   /db_xref="GOA:C6CRS6"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRS6"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACS98790.1"
FT                   /translation="MKKRKHDDHDEHIDESWLIPYADLLTLLLALFIVLYAASSTDARK
FT                   FERMSEAFSAAFNSGAGIMDNPSVIKSGEQPQQQIDDGKKTSKDRHEDTESNLQELIKK
FT                   EQEDLEKLKKQLDQYIKKNGLSSELETKLNQSQLMITISDNALFASGSDALKTESKELA
FT                   ANISKMLEPYTGYEIVVSGHTDDQPIRTQNFKSNWDLSSSRAIRFMDVLLQNSKLKPER
FT                   FSAIGYGEYRPVASNDTTAGRAKNRRVEVSIIRKYVDSGNTQQIPATPKQ"
FT   gene            complement(120597..121394)
FT                   /locus_tag="Pjdr2_0111"
FT   CDS_pept        complement(120597..121394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0111"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   bsu:BSU13690 flagellar motor protein MotA"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98791"
FT                   /db_xref="GOA:C6CRS7"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRS7"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ACS98791.1"
FT                   /translation="MKNSTIIGIILGLVAVLVGMTLKGAALSNLLNPAAYMIIVLGTIA
FT                   SVMIAFPMSELSKVGKLFKIAFKEQPLMPREQLIESFMEWASITRREGLLALEAKVEDI
FT                   EDTFLRNGMRMIIDGNDQDFVRDVLLEDISATEDRHKAGALIFTQAGTYAPTLGVLGAV
FT                   VGLIGALGHMDDMETLAHSIAGAFIATLLGIFTGYVLWHPLANKLKRLSKKEVQLRLMM
FT                   VEGLLSIQSGVSTIAINQKLSVFLTPTERVAMREKEAGAGEKA"
FT   sig_peptide     complement(121314..121394)
FT                   /locus_tag="Pjdr2_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.409 at
FT                   residue 27"
FT   gene            121563..121856
FT                   /locus_tag="Pjdr2_0112"
FT   CDS_pept        121563..121856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH2997 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98792"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRS8"
FT                   /inference="similar to AA sequence:KEGG:BH2997"
FT                   /protein_id="ACS98792.1"
FT                   /translation="MGVRHAREYADILKELTEAVSEVEGSYTFFEMEEEEWAALGSDDR
FT                   HEVMEALADDVFFGLGEQPVIEVGKGAITYHPKHHVIEVSHGDNVTRMIRLT"
FT   gene            121881..123119
FT                   /locus_tag="Pjdr2_0113"
FT   CDS_pept        121881..123119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0113"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; SMART: EAL domain protein;
FT                   KEGG: bsu:BSU14090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98793"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR018842"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRS9"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ACS98793.1"
FT                   /translation="MTNDCLSNTTLPQTLQLDGEQLSAFYQPIIALDTRKVVGYEVLGR
FT                   ACKGDTVRSLGPFFCDAGVPVEDHIAVDRILREQAFQKIGATPQPPMLFINLKPNWMHR
FT                   GVQSGELYTLSLLDKYQIDPRRVVIEITEESFNGEFEELREIIDLYRSKGCLIAIDDVG
FT                   SGFSGMDRIALIQPNILKIDIHVLKRSASHGGYLGTLRSLSALADQLGASLLAEGVETK
FT                   LDLARAIQAGVRYVQGFLFAKAEPDFGESSRFSVLLEEELEDHRQLQLYSENYWRYLSD
FT                   RLSGKIDRIGHLEELEEEDNEWIVRLLQELENNSIRVYLCREDGIQISSNYSRREDGSW
FT                   RREDEYCGANWSWRPYFVPNVVQLNENRRSMVSRAYTDLDSRAWIRTVSVLVKPGVILF
FT                   VDMKDPEPDYYRL"
FT   gene            complement(123125..123643)
FT                   /locus_tag="Pjdr2_0114"
FT   CDS_pept        complement(123125..123643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0114"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   baa:BA_2105 acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98794"
FT                   /db_xref="GOA:C6CRT0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRT0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS98794.1"
FT                   /translation="MTNFTDEVHYKPSLEDMTIQPLEIDHARQICGWQYEFPYDLYHWP
FT                   SWDTMQKDEIEFGDPVLRRMQYAAVVNRNQELIGFAQFFPIVGVIRLGLGLHPALCGKG
FT                   IGPDFLRLLVREALRRAPQNSIDLEVLTWNTRAIRAYERAGFAIEDTYVRPTQQGSAEF
FT                   HCMVYQSTL"
FT   gene            123750..124985
FT                   /locus_tag="Pjdr2_0115"
FT   CDS_pept        123750..124985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0115"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bsu:BSU10520 glucose/mannose:H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98795"
FT                   /db_xref="GOA:C6CRT1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRT1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS98795.1"
FT                   /translation="MRKLIALGCLSYLVIGLAHVVGGSVMEQMLDKYGLSYDDGGQWMM
FT                   NQFFGFLVGVLLSPFITSKLGKRGGVLLSLGLLTLGEAAYSLTPHSWGLMLFIALFAGF
FT                   GFGMTESVIGAMVIDLAEENGKANAMTKLETFFGIGAFLMPTMASILIRYDVWQLSFPI
FT                   LSALAGITFILWMTISFGPIDDKIGFHARVGFHARGKKAAVEREAGDPRPKGWFGYKRA
FT                   AIPFLLLSALFFVIYVGVEMSFSNYLPSIMIERSGMSEANAPSSLSLFWGTMILGRLFA
FT                   GRLADRVGYIRYLFVAIAGACVVILAMGAVGQLSGMMVLVGLSGLFFSGVFGIALVFAN
FT                   GLIPGMTERTTSLLVACGGVGGAIFPKLTGWMMDNYGADRTVWILGAFLIAMFVVLLAM
FT                   LALGRKQQAAAA"
FT   sig_peptide     123750..123812
FT                   /locus_tag="Pjdr2_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.680 at
FT                   residue 21"
FT   gene            complement(125100..125567)
FT                   /locus_tag="Pjdr2_0116"
FT   CDS_pept        complement(125100..125567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0116"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: gbm:Gbem_3368 NLP/P60
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98796"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRI5"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ACS98796.1"
FT                   /translation="MKKVTALLLGLALMLAFQAGSVFADSKMDGIVSNLIGTPYVAGGT
FT                   STKGFDCSGFTSYVFDKMGIDLPRTSTSQSETGKKIAKSDLVAGDLVFFNTNGRGVSHV
FT                   GIYVGDGKFAHASSSKGVTISNLSDSYYVNRYVTARRVMDPSTFDKYADEQ"
FT   sig_peptide     complement(125493..125567)
FT                   /locus_tag="Pjdr2_0116"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 25"
FT   gene            complement(126040..126861)
FT                   /locus_tag="Pjdr2_0117"
FT   CDS_pept        complement(126040..126861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98797"
FT                   /db_xref="GOA:C6CRM9"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98797.1"
FT                   /translation="MKNHMRQGWRLTIKHFYIVILLFLYQLLWGFFLYRFIDSVVAPLL
FT                   RRFPDHSPSKAAVQLFLSEAQFQIMKTDLLTPYLWLLGGLFAARMLLSPLFNAGLLYSL
FT                   QHATDTGGTQFLQGIRRAWKPVTLLYWIETILALAPAWWLLPKGLEALLHSRSIGDLLQ
FT                   QTLPAAGGWLLWGILLHLLFLAMQLGATSGKTGGIVQSLGTAVKHLLPFAGLSLLMWAI
FT                   GSGVGLFVSGFSLVWAGFIALLVHQGYHLVRTLMKVWTLASQYDILRSKEV"
FT   gene            complement(126956..128962)
FT                   /locus_tag="Pjdr2_0118"
FT   CDS_pept        complement(126956..128962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0118"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: scl:sce2422 putative metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98798"
FT                   /db_xref="GOA:C6CRP8"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRP8"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ACS98798.1"
FT                   /translation="MSPRYVKRLLLFTLTAVLLGLSIQQGFGRAWQSQYTYALAPAAKA
FT                   ATDSAPKSAKPPASSQPDNVAPKPQALSKRITEYHINVSLRDDIRYLDGQQTVTWTNPG
FT                   KKTVSELYFHLYPNAFMSDKTTFMKESGGKLRSDKATEASQGYMKLLTLETTEGESLLP
FT                   RLHYVQPDDNNPNDFTLAKLKLPEPVAPGKSVTLEMGFEVKLPEVFARMGYSGNYVMAG
FT                   QWFPKLAVYETAGTRGRTTEGWNTHQYHGNSEFYSDFGIYSVRIQVPESYTVAATGFQT
FT                   KAVEKKDNRAIYQFYADDVHDFAWAASPDFIYYEDTLSGPGIPGVRIKLYLDPAHEDLK
FT                   DRYMHAAKSALSKYGQWYGEYPYSTLSVVVPPKGANGSGGMEYPTLVTAFAAETDNPGY
FT                   SLERTVVHEVGHQYWYGMVASNEFEEAWLDEGFTSYAEDKVMASEYGIEANLPLEASYM
FT                   TDPAPLKQPSWAYPSNNVYAENVYMRAKLVLIGIEKQVGEKMMQKIMRTYFQKYKFKHP
FT                   TTTDFQRVVEQVTKQKWNNYFDQYVYGNQMADVSVESINVHPVEQDGTRMYESVVSLQR
FT                   NGGYNGPVPVVLKFKDGTIVPKSWDPTEAQVQYKVVLSSPLEWVAVDPQHTNVLDNKHI
FT                   NDYMKADLSEVTRTRWSLGTSNVIQGLLGLLGW"
FT   sig_peptide     complement(128870..128962)
FT                   /locus_tag="Pjdr2_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.953) with cleavage site probability 0.359 at
FT                   residue 31"
FT   gene            129066..129587
FT                   /locus_tag="Pjdr2_0119"
FT   CDS_pept        129066..129587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bar:GBAA5624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98799"
FT                   /db_xref="InterPro:IPR014852"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRT2"
FT                   /inference="similar to AA sequence:KEGG:GBAA5624"
FT                   /protein_id="ACS98799.1"
FT                   /translation="MTEQQGQPAEPEKKEKKSLSLNVVSNKQHKGFGAGTIDLSAVSCV
FT                   IIDNGVAYIDDGAMHAKSKVERGIKFSPNKEDCPNGRKCWIVWTAVERGEEGSYYAGAT
FT                   ACEMWIDTEARRGWKILADHVNKLDAAIKRKYKLEELDAEEKAAFRKLLAEHNEEWWNN
FT                   SPEELKEALA"
FT   gene            129672..130286
FT                   /locus_tag="Pjdr2_0120"
FT   CDS_pept        129672..130286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0120"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: bar:GBAA1789 RNA polymerase sigma
FT                   factor SigW"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98800"
FT                   /db_xref="GOA:C6CSR0"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSR0"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACS98800.1"
FT                   /translation="MQGLSAKLSSIIAGREESEIQDEQWITAIKNGGPAAFQTFVDEYG
FT                   PYIYRTVFAVIRSPHDAEDVTQEALLQIYRSLPEFRMDGFKTWITRIAVNKAIDWKRSR
FT                   MRKPEELVDSLTGLEAEGMMAGRGPAVEAAVIDREEQRQVREQVEQLPDNYREVVTAYY
FT                   MENKSYEEIAVQTGLEKKSVESRLYRARNWIKRHWRKEDFE"
FT   gene            130283..130837
FT                   /locus_tag="Pjdr2_0121"
FT   CDS_pept        130283..130837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98801"
FT                   /db_xref="GOA:C6CSR1"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSR1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98801.1"
FT                   /translation="MNEQEWKEHVTAADLAAYIHDELAEHKREEIELHIAACEPCMELF
FT                   MTAIEASEAGESNPASDGPAAARTVIPDMKKLGKRVVDILLAESARKKPVMRAEPARRQ
FT                   SFLQRPVVHFTAAAAITLLLLGTGTFSGISAKLGEMDSHSVPAEQTMEKDAEQPQGPTW
FT                   SDRMVNRTSSWFDKLENDRFK"
FT   gene            130872..132020
FT                   /locus_tag="Pjdr2_0122"
FT   CDS_pept        130872..132020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bar:GBAA1787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98802"
FT                   /db_xref="GOA:C6CSR2"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSR2"
FT                   /inference="similar to AA sequence:KEGG:GBAA1787"
FT                   /protein_id="ACS98802.1"
FT                   /translation="MSKNPVVALLLSFIPGVGHAYLGRPFRCLLYGGGFFGSLMLLFIA
FT                   IQSGDGGDIGLFFLFTAALSWLINMIDMVVTLLSPKPPVVPYNERGDIPFDPGYMAYEQ
FT                   QREKTSTVMLSLIPGLGHMSLGLMQRGITFLVAFLGLFAIVVFIGVVTNTSAFLVFLLG
FT                   LPVIWIYSIFDAIQQLHKKQRGEELNDRPLFEEIENHMGTGRKNKVLAAILSLFPGAGH
FT                   LYLGMQKRGLQLMGGFLIAIYLMDSLRLSIFLFLMPLLWFYAFFDSMQQMSRYERGELH
FT                   DQAVVAQLAPYQKWIGIGLLLLGIYYLGDRVMGGYISQTWPGIYAEYVKLKYNLPTAIV
FT                   AFLMIALGFRLVFGSGSRKSYPAPEPLPPHPAEMMREEEGDR"
FT   sig_peptide     130872..130934
FT                   /locus_tag="Pjdr2_0122"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.987 at
FT                   residue 21"
FT   gene            132017..132649
FT                   /locus_tag="Pjdr2_0123"
FT   CDS_pept        132017..132649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0123"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bar:GBAA1786 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98803"
FT                   /db_xref="GOA:C6CSR3"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSR3"
FT                   /inference="similar to AA sequence:KEGG:GBAA1786"
FT                   /protein_id="ACS98803.1"
FT                   /translation="MREWRVGSLSMGITLLLIGVSIAISIWSGKDALNTLLWVAPVVFI
FT                   LLGAELLIHLKLSGKERPVMRYDWMSMFYVAVIGAGSLLMASFTSTGLLGEVRDQLQMT
FT                   ERTAIVQSDPVKVPDGIKKIVVQSLRPIQLDQGEVRAVQLLGQVQYWSPKPLKQPEKMV
FT                   ATSTVGSTMYVLINSFEHKDGSIGSENINQELTLVLPQEIEVEKRGF"
FT   sig_peptide     132017..132088
FT                   /locus_tag="Pjdr2_0123"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.740) with cleavage site probability 0.640 at
FT                   residue 24"
FT   gene            complement(132702..133427)
FT                   /locus_tag="Pjdr2_0124"
FT   CDS_pept        complement(132702..133427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0124"
FT                   /product="peptidyl-prolyl cis-trans isomerase cyclophilin
FT                   type"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: mag:amb2384 peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98804"
FT                   /db_xref="GOA:C6CSR4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSR4"
FT                   /inference="protein motif:PFAM:PF00160"
FT                   /protein_id="ACS98804.1"
FT                   /translation="MFKRNKGLPVLVLLTAALLLVIAGCGGGSKTSSNSNGTSGSGAAN
FT                   ATATPEATQPPQPDKLLGSDKHPVVTVEMDNGKSFKVELYPEIAPNTVNNFVSLVKKGF
FT                   YDGTIFHRVIPGFMIQGGDPEGTGMGGPGYGIKGEFMSNGFQNDLLHTRGVISMARSGD
FT                   PDSAGSQFFVMVADAPSLDGDYAAFGKVSEGMDTVDEIVNQATEKTGEGSRPVKPMAIK
FT                   KATVDTKGMTFAEPEKVNK"
FT   sig_peptide     complement(133326..133427)
FT                   /locus_tag="Pjdr2_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.271 at
FT                   residue 34"
FT   gene            complement(133549..133881)
FT                   /locus_tag="Pjdr2_0125"
FT   CDS_pept        complement(133549..133881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0125"
FT                   /product="cytochrome o ubiquinol oxidase subunit IV"
FT                   /note="TIGRFAM: cytochrome o ubiquinol oxidase subunit IV;
FT                   PFAM: cytochrome C oxidase subunit IV; KEGG: mms:mma_2637
FT                   cytochrome o ubiquinol oxidase operon protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98805"
FT                   /db_xref="GOA:C6CSR5"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSR5"
FT                   /inference="protein motif:TFAM:TIGR02847"
FT                   /protein_id="ACS98805.1"
FT                   /translation="MANPNTHGHGHDEHESHGSMKSYVIGFVISIVLTILPLVVVLNDM
FT                   MDKTPTLIFILIMAVLQFVVQLFFFMHLREEKKPRYNVMALIFGLVILVTIIAGSIWIM
FT                   AYNTVG"
FT   gene            complement(133883..134509)
FT                   /locus_tag="Pjdr2_0126"
FT   CDS_pept        complement(133883..134509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0126"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /note="TIGRFAM: cytochrome o ubiquinol oxidase, subunit
FT                   III; PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   pfo:Pfl01_4646 cytochrome o ubiquinol oxidase, subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98806"
FT                   /db_xref="GOA:C6CSR6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSR6"
FT                   /inference="protein motif:TFAM:TIGR02842"
FT                   /protein_id="ACS98806.1"
FT                   /translation="MAHTVTPHGGHDHNDHGHHDDHHDHESIKVLGFWMFLITDVILFG
FT                   TLFATFSVLHNSTNGGPTPHEMFEMPGVIAETFILLTSSFTSGIAVLQMHKGNKKGLIG
FT                   WLIITALLGASFIFLEVSEFIKMVDEGVTIGTSGYWSAFFTLVGTHGLHVSVGLCWMVG
FT                   LMIQIGKRGITPVTKRKVTIVSLYWHFLDVVWIFVLTVVYLMGVM"
FT   gene            complement(134510..136486)
FT                   /locus_tag="Pjdr2_0127"
FT   CDS_pept        complement(134510..136486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0127"
FT                   /product="Cytochrome-c oxidase"
FT                   /EC_number="1.9.3.1"
FT                   /note="PFAM: cytochrome c oxidase subunit I; KEGG:
FT                   bsu:BSU38160 cytochrome aa3 quinol oxidase (subunit I)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98807"
FT                   /db_xref="GOA:C6CSR7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSR7"
FT                   /inference="protein motif:PRIAM:1.9.3.1"
FT                   /protein_id="ACS98807.1"
FT                   /translation="MFKEFWDFLMNDFFITGDPLILGAQVSIGLSTVAIVIALTYFKKW
FT                   RWLWTEWLTTVDHKKIGIMYVIAALLMLFRGGVDALLIRTQLAVPQLEFLHAGHYNAIF
FT                   TTHGVIMILFMAMPLMFGLFNIVVPLQIGARDVAFPYLNSLSFWLFFFGAMLFNVSFVI
FT                   GGSPDAGWLAYPPLSELSGSPGLGQDFYIWGIQISGIGSLASGINFVVTILKMRAPGMK
FT                   LMQMPMFTWSVLSSSITIMFAFPILTVTLFLLFIDRYLGAHFFTLDGGGNPMMYVNLIW
FT                   MWGHPEVYIVILPAFGVFSDVVSTFSKKKLFGYKSMVFALMSISFFSFFTWLHHFFTMG
FT                   SGADVNAFFAVTTMLIAIPTGVKVFNWLFTMFRGRITFSQPMLWTIAFIPCFVVGGMTG
FT                   VMLSVAPADFQFHNSYFLIAHFHQVLIGGVVFGYFAGLYYWWPKMFGFKLHDGLGKWAF
FT                   WLWNIGFYVCFMPQYALGLMGMTRRFNEYNFDLGWQPLNIVSTVGAFIMGLGFIFQVWQ
FT                   IAHSIKFLKKEKSGDAWGEGRTLEWSIPSPAPMYNFAHLPEVTSSDEWWEEKQRRAKGI
FT                   QPKPPGPLEPIHMPRNSGIPFIMSVFFFIAGFGFVWHWTWMIVPGLIGVACCMFARSFD
FT                   YDPDYYIPVDEIERTEAALKGVR"
FT   gene            complement(136508..137461)
FT                   /locus_tag="Pjdr2_0128"
FT   CDS_pept        complement(136508..137461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0128"
FT                   /product="quinol oxidase AA3, subunit II"
FT                   /note="TIGRFAM: quinol oxidase AA3, subunit II; ubiquinol
FT                   oxidase, subunit II; PFAM: COX aromatic rich domain
FT                   protein; cytochrome c oxidase subunit II; KEGG:
FT                   sfr:Sfri_0224 ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98808"
FT                   /db_xref="GOA:C6CSR8"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006332"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSR8"
FT                   /inference="protein motif:TFAM:TIGR01432"
FT                   /protein_id="ACS98808.1"
FT                   /translation="MRKYIRFLVPLMIMLIAVMLSGCSDQYVVLDPKGPIGESQKDLIW
FT                   ITVWLCAIILVPVLILTAIIVWRYRDKKDNKAGYQPNWEHSTKLETIWWAIPIIIIAIL
FT                   ATVTIKYTYDLEPSKPLESAKQPITIEATSLDWKWLFTYPDEGISTVNYLQIPEDTPIR
FT                   FRVTADQAMNSFWIPQLGGQIYAMSGMAMTLYLQADEVGDFLGMGANFTGEQFAKMMFN
FT                   VKATSDADYHAWVDSVKQTSPALTEEGFKELKLPGSSEQQSFSAFPKGLFDQVVMQYVG
FT                   PNGADAPNSGQKSKPIHDAEGGHDTESASTSNEVKS"
FT   sig_peptide     complement(137387..137461)
FT                   /locus_tag="Pjdr2_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.513 at
FT                   residue 25"
FT   gene            complement(137684..137992)
FT                   /locus_tag="Pjdr2_0129"
FT   CDS_pept        complement(137684..137992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0129"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98809"
FT                   /db_xref="GOA:C6CSR9"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSR9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98809.1"
FT                   /translation="MATKTATVSNVKSDSEVTAASVKRLVTLMTIFAWTCLTVGVLLCL
FT                   IKISHFSDKNTTLMIGVGCLVGSVFIYTIGTAIGLVHARIHQAKEDEQKDDPSNPIL"
FT   gene            complement(138120..140213)
FT                   /locus_tag="Pjdr2_0130"
FT   CDS_pept        complement(138120..140213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0130"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: baa:BA_0478 transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98810"
FT                   /db_xref="GOA:C6CSS0"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSS0"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ACS98810.1"
FT                   /translation="MKKQQIRPGKPRRKYAFPIITERFLPHVMRFKKSLRLTAAISAVV
FT                   VLGIVSMLLYLKFQSLPVTSISQSSRMLDLQGQVIDTFHTGENRSSVPLKEISPYLVEA
FT                   TLAIEDHRFYEHRGFDMKGMARAVLVNVETMSAKQGASTLTQQLARNLYLTHEKTWQRK
FT                   MKEAMYTVQLEMNYSKDEILALYLNQIYYGHGAYGIEAASQLYFKKHASQLTLAESAML
FT                   AGIPKGPKYYSPFMDMKNAKDRQLTILHAMTESGDITQEQADAAYKEVLNFQPLGSGEQ
FT                   AGFAPYFRDYIRYIAVDKLGINEQLFNEGGVTIYTTLDSAAQRAAEDAVKNGLAGSGEQ
FT                   QAALVSIDPRNGYIKAMIGGRDYKTNQFNRALAQTRQPGSSFKPVLYLTALHSGFMTPV
FT                   TRFKSEPTAFTYDEGRKKYEPHNYNDKYFNDFIDMRTAIASSDNIYAVNTIMTVGADRV
FT                   IETARKLGITSPMNPVPSLALGTFPVSPLEMASAFSVIANGGVKVEPVAILRITDKSGH
FT                   IIYEAEHHEEQVINPAEAYVMTSLMESVFEGGGTANRVSSIIKRPVAGKTGTTSTDAWL
FT                   VGYTPELATAVWVGYDKNRKLTVTEAHRAAPIFAQFTEQALTAIPPKIFPIPDGVVNVY
FT                   VDPTSGKLAAATCANKRLESFVAGTEPTEVCGGPASKDTPADNATKDNSQTWWNDLKRW
FT                   WKN"
FT   gene            140365..141192
FT                   /locus_tag="Pjdr2_0131"
FT   CDS_pept        140365..141192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0131"
FT                   /product="spermidine synthase"
FT                   /note="TIGRFAM: spermidine synthase; PFAM: Spermine
FT                   synthase; KEGG: bsu:BSU37500 spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98811"
FT                   /db_xref="GOA:C6CSS1"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSS1"
FT                   /inference="protein motif:TFAM:TIGR00417"
FT                   /protein_id="ACS98811.1"
FT                   /translation="MELWYTEKQTENFGITAKITKTYVNEQTEFQQLDMIETEEFGTML
FT                   VLDGMVMTTVKDEFVYHEMVAHPVLFTHPNPEHVLVVGGGDGGVIREIMKHPKVKKAVL
FT                   VDIDGKVIEYSKKYLPTIAGELDNPRVEVLVNDGFMHIHDHKNTYDVIMVDSTEPVGPA
FT                   ANLFTRGFYQGIYEALKEDGIFVAQTDNPWFKADLIQSVNKDVKEVFPIVRVYGANIPT
FT                   YPSGLWTFTMGSKKYDPLEVDEASITEIPTKYYTPRLHKAAFVLPKFVEDLVK"
FT   gene            141347..141880
FT                   /locus_tag="Pjdr2_0132"
FT   CDS_pept        141347..141880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo3603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98812"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR026353"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSS2"
FT                   /inference="similar to AA sequence:KEGG:azo3603"
FT                   /protein_id="ACS98812.1"
FT                   /translation="MEQDQAERIYSFPPVIDERARVLVLGTAPSVKSLEHRQFYGHPRN
FT                   YFWGMVYGLFGAGVPDEDYGKRLSFLQDHHMAVFDVIKSCERPGSLDVNIKNEEPNDLP
FT                   ALAGEYPELKCFAFNGSKAYDTFRKYYRDHPALQHLALLKMPSTSPIPTQKMRNLEDRI
FT                   EAWKAILPYLELSE"
FT   gene            141960..142406
FT                   /locus_tag="Pjdr2_0133"
FT   CDS_pept        141960..142406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0133"
FT                   /product="Domain of unknown function DUF1934"
FT                   /note="PFAM: Domain of unknown function DUF1934"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98813"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSS3"
FT                   /inference="protein motif:PFAM:PF09148"
FT                   /protein_id="ACS98813.1"
FT                   /translation="MQDRMAVKITLTSTQDGESVVHTYTGEWFRKERSVYIRYEEPVEG
FT                   SASPIRTLVRYREDELSITRRGVVESEQLFVPGEMRRNGYYRSPFTSFQMETATAFIEL
FT                   KGVDGEKPASAEPPCAIEWQYELWMNEHLSGRFLNRLHIQEEKQ"
FT   gene            142403..144082
FT                   /locus_tag="Pjdr2_0134"
FT   CDS_pept        142403..144082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0134"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="KEGG: bha:BH3808 arginyl-tRNA synthetase; TIGRFAM:
FT                   arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98814"
FT                   /db_xref="GOA:C6CSS4"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSS4"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ACS98814.1"
FT                   /translation="MSTNVLEQMYEKVKEAIADAAVAGGLAAREELPAFVLEVPKDKAH
FT                   GDLATNAAMQLTKLAKKNPRQIAETIIANLNGEKFGIQSAEIAGPGFINFRMDKSYLYS
FT                   VVGEITAAGDDYGRTKEGSGQRVEVEFVSANPTGNLHLGHARGAAVGDALCNVLDFAGY
FT                   EVTREYYINDAGNQVNNLARSIEARYRQALGQDAEMPEDGYHGEDIVGFGKLLAEEKGD
FT                   SLLSLSDEERFAFFRQFGLEKELDKIKRDLGLFRVNFDIWYSETSLYESGQVETALEAL
FT                   KAKGQVYEEEGATWLSTMPYGDDKNRVLVKNDGSYTYLTPDIAYHQDKFSRGYDKMINI
FT                   WGADHHGYIPRVKAAMAALGNDPDKLVVLIAQMVSLFQDGEKVKMSKRTGKAVTMQDLM
FT                   DEVGVDAIRYFFTMRSMDSHLDFDMDLAISTSNENPVFYVQYAHARICSIFRQAEEQSV
FT                   AILPIGDIDFGKLSSEAEFDLLRKLGELPQEVSEAAAQYAPHRLIRYVYELASQFHSYY
FT                   KAERVITEDAAQTQARIALLGAVRIVIANTLRLVGVSAPERM"
FT   gene            complement(144743..145873)
FT                   /locus_tag="Pjdr2_0135"
FT   CDS_pept        complement(144743..145873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0135"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: bsu:BSU10300 serine alkaline protease
FT                   (subtilisin E)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98815"
FT                   /db_xref="GOA:C6CSS5"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR034202"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSS5"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACS98815.1"
FT                   /translation="MDITAFLHWLKDTMACTGQTTKNRIIRFQQQGDYRRFLQEWSEAS
FT                   TASPELKPVKQMRIIRAISCQLPVEATLSGFSGGVWIEDDRRITVHTAAKTMPLEKGIP
FT                   WGVQQIKAPLAWSTTTGHRIKIGVIDTGVDFSHPDLRQSLSRGINLLNRSMLPHDDNGH
FT                   GTHIAGTIAAANQVQGMIGIAPRAQILPVKAFDHNGSAFVSDIILGIDWCVRNRVNIIN
FT                   MSFGMKTRSKALLNAINNAYNAGVIVVASSGNDGKRRTVDYPARYPQTISVGATNKLRR
FT                   IAPFSNRGTFIDIYAPGDKIFSAWLRGKYHEMSGTSMATSHVSGAIALLLAHKPGLSPA
FT                   EIKAILKKSYLPLRSTKAPRYTGELDVMKMLGAADR"
FT   gene            146244..146825
FT                   /locus_tag="Pjdr2_0136"
FT   CDS_pept        146244..146825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0136"
FT                   /product="DNA-directed RNA polymerase delta subunit"
FT                   /note="PFAM: DNA-directed RNA polymerase delta subunit;
FT                   KEGG: baa:BA_0440 DNA-directed RNA polymerase subunit
FT                   delta"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98816"
FT                   /db_xref="GOA:C6CSS6"
FT                   /db_xref="InterPro:IPR029757"
FT                   /db_xref="InterPro:IPR038087"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSS6"
FT                   /inference="protein motif:PFAM:PF05066"
FT                   /protein_id="ACS98816.1"
FT                   /translation="MSSGNIALKLDPERIKEMPMVDLAFELLKSANTPYYYRDLMMEIA
FT                   KVRGLSADGVNQVIAQVYTEINIDGRFACVGSNMWGLKRWYPVEKNEDPITNAKRPRII
FT                   NDEDDDEDLFADEEDDSYTADEEDYDSYDEDREFGEAEAEEEVDEEVGIEDEELEDDES
FT                   EEEIDADAELDDEDSEDEDFEDDEEEEDDK"
FT   gene            147199..148803
FT                   /locus_tag="Pjdr2_0137"
FT   CDS_pept        147199..148803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0137"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="KEGG: bha:BH3792 CTP synthetase; TIGRFAM: CTP
FT                   synthase; PFAM: CTP synthase-like; glutamine
FT                   amidotransferase class-I"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98817"
FT                   /db_xref="GOA:C6CSS7"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSS7"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ACS98817.1"
FT                   /translation="MTKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVTIQKFDPYIN
FT                   VDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDINLTKYSSVTTGKIYSNVISKERR
FT                   GEYLGGTVQVIPHITNEIKERVYRAGKEAGSDVVITEIGGTVGDIESLPFLEAIRQIKS
FT                   DIGRDNVMYIHVTLIPYIKAAGEVKTKPTQHSVKELRSIGIQPNVIVCRTEHALSEDLK
FT                   RKIGLFCDIDANAVVECIDASTLYEVPLMLREQGLDDIVVNHLKLTTNQPDMTQWEDLV
FT                   NRVKSLHKTTEIAIVGKYVALHDAYLSIVEALGHAGYDADSEVKLRWVNAEEIDDENVS
FT                   EMLKGVHGILVPGGFGDRGIEGKVSAIRYAREQQIPFFGICLGMQVAVIEYARSVAGLF
FT                   NANSAEINPSTPYPVIDLLPDQKDIEDMGGTMRLGLYPCKLKPGSLAATEYNDELVYER
FT                   HRHRYEFNNEYRERIESAGLRISGTSPDGRLVEMVELPEHPWFLAVQFHPEFTSRPNRP
FT                   QPLFRGFVRAALKYSGQ"
FT   gene            148938..149336
FT                   /locus_tag="Pjdr2_0138"
FT   CDS_pept        148938..149336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0138"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: baa:BA_0437 cheY-homologous
FT                   receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98818"
FT                   /db_xref="GOA:C6CSS9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSS9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS98818.1"
FT                   /translation="MEKKKLLIVDDQNGIRVLLMEVFSSEGYNTFQASNGRLALEIVKA
FT                   ENPDLVLLDMKIPGMDGLEILKHVKAINRDIKVIMMTAYGELDMIKEATDLGAVMHFTK
FT                   PFDIDEMRIAVNMQLHGGNSNNRFAVGS"
FT   gene            149666..150919
FT                   /locus_tag="Pjdr2_0139"
FT   CDS_pept        149666..150919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0139"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   bha:BH3784 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98819"
FT                   /db_xref="GOA:C6CST0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:C6CST0"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACS98819.1"
FT                   /translation="MEKLMIRGGRPLRGTVQISGAKNSAVALVPAAILAESEVVLDNLP
FT                   HLSDVVVYSEILQDLGAVVSWQGDVMKIDPSRLESKPMPNGKVKLLRASYYLMGAMLGR
FT                   FGEAIIGLPGGCNFEPRPIDQHIKGFEALGATVTNEHGSMRIHAKELRGAKIYLDVVSV
FT                   GATINIMLAASRAKGSTIIENAAKEPEIIDVATLLNAMGARIKGAGTETIRIEGVDSMH
FT                   GCRHSIIPDRIQAGTYMIAAAATRGDVTIDNVIPKHMEAMTAKLEEMGVTVQEMDESIR
FT                   IIGAPEYTAVDVKALVYPGFATDLQSPMTTLLAQAKGVSILSDYVYSNRFKHVPELNRM
FT                   GANIRVEGRSAIIEGGELFAAKVKAADLRAGAALVIAGLTVKEGITEITGVEYIDRGYD
FT                   NLVDNLRRLGADVWRETE"
FT   gene            151038..152387
FT                   /locus_tag="Pjdr2_0140"
FT   CDS_pept        151038..152387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0140"
FT                   /product="transcription termination factor Rho"
FT                   /note="KEGG: bar:GBAA5575 transcription termination factor
FT                   Rho; TIGRFAM: transcription termination factor Rho; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; Rho termination factor domain protein; Rho
FT                   termination factor RNA-binding; SMART: Cold shock protein;
FT                   AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98820"
FT                   /db_xref="GOA:C6CST1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:C6CST1"
FT                   /inference="protein motif:TFAM:TIGR00767"
FT                   /protein_id="ACS98820.1"
FT                   /translation="MTDLQISDLEEMKLTELYKLAKQYQIPYYGQLKKKELIFAILRAQ
FT                   AEKSGLMFMQGVLETLPEGFGFLRPINYLPSKEDIYISASQIRKFDLRTGDLVSGKCRL
FT                   PKDSEKYFGLLQVNAVNGTDPAQAAERLHFPALTPLYPQKKLVLETASSKLSTRIMDLL
FT                   APVGLGQRGLIVAPPKAGKTLLLKEIANSISTNHPDIELFVLLIDERPEEVTDMQRSVK
FT                   GEVIASTFDEVPENHIKVAELVLERALRLVEHKKDVVILLDSITRLARAYNLVVPPSGR
FT                   TLSGGIDPAAFHRPKRFFGAARNVEEGGSLTILATALIETGSRMDDIIYEEFKGTGNME
FT                   LHLDRKLAERRIFPALDIRRSGTRREEMLLSKEELDKLWVVRRNMTDTPDFVDGFLKKL
FT                   ADSKTNEEFLMSLDTSEEKPAPQQRTSTGTGLKSSAATGRRPAPRTTHGS"
FT   gene            152412..153665
FT                   /locus_tag="Pjdr2_0141"
FT   CDS_pept        152412..153665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0141"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: gsu:GSU0886
FT                   radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98821"
FT                   /db_xref="GOA:C6CST2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:C6CST2"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACS98821.1"
FT                   /translation="MNLVYADEKGNVFDHPDYIALGRSGDMIVELMEEELIPLPRGATL
FT                   VGLPHTRPVFMDPDTGDMKMLSGSYQAVGALLPQGYTRLALPSYVKTDKNEKFPLFGYT
FT                   SVVWKDGGFYVAAEQSDDPYKWDPLNCDRGDVRKGVEQLTAKYPENRLYKHLSHCALGY
FT                   ECLTSSNTFLQRWEGGVPVSYSCNAGCFGCISEQPDDSGFVAPQTRMNFKPTVDEIVEV
FT                   MLEHLKTPESIISFGQGCEGEPSTQAKIIVEAMKIVRSQTNQGYININTNAGLTDFMRA
FT                   IVDAGLDLMRVSTISAIDEHYNAYYKPRAYTLANVEKSLKYATDKGVYTSINYLIFPGV
FT                   TDREEEIEAMIGFAKRTGLKLIQMRNLNIDPESYLQLIPPAKGEIYGMKQMLEIFREEL
FT                   PDVVIGSYTHLPPAAARK"
FT   gene            153775..153972
FT                   /locus_tag="Pjdr2_0142"
FT   CDS_pept        153775..153972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0142"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: bsu:BSU37070 50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98822"
FT                   /db_xref="GOA:C6CST3"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:C6CST3"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACS98822.1"
FT                   /translation="MKQGIHPTYHVSNITCACGNTFETGSIKSNLRVEVCSACHPFFTG
FT                   KQKFLDAGGRVDRFKKKYGI"
FT   gene            154048..154482
FT                   /locus_tag="Pjdr2_0143"
FT   CDS_pept        154048..154482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98823"
FT                   /db_xref="UniProtKB/TrEMBL:C6CST4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98823.1"
FT                   /translation="MLTKKMLRRKLRLIFMGFAIPALVFASLTGCAADGVNNGHRTNDG
FT                   KVETYGHDGYMGYSNSNPNLPNNKTFLNYETDRKLINQVLQPIDGIKSSRVAFNGGDLT
FT                   VHIKAASNLSDAQVEALRAKTEQAVQLNMPRYHVKVKASR"
FT   sig_peptide     154048..154146
FT                   /locus_tag="Pjdr2_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.898 at
FT                   residue 33"
FT   gene            154654..154759
FT                   /gene="ffs"
FT                   /locus_tag="Pjdr2_R0012"
FT   ncRNA           154654..154759
FT                   /gene="ffs"
FT                   /locus_tag="Pjdr2_R0012"
FT                   /product="SRP RNA; RNA component of signal recognitionparti
FT                   cle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            154966..156738
FT                   /locus_tag="Pjdr2_0144"
FT   CDS_pept        154966..156738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0144"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: bha:BH0034 DNA polymerase III gamma and tau
FT                   subunits; TIGRFAM: DNA polymerase III, subunits gamma and
FT                   tau; PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98824"
FT                   /db_xref="GOA:C6CST5"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CST5"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ACS98824.1"
FT                   /translation="MSHIALYRAWRPQTFQDMVGQRHIIQTLQNAIREDRVSHAYLFNG
FT                   PRGTGKTTAAKVLAKAVNCERGPAEEPCNECDACRGITAGHIMDVIEIDAASNRGIDEI
FT                   RDIRDKVRYAPSEVRYKVYIIDEVHMLTSEAFNALLKTLEEPPGHVIFILATTEPHKLP
FT                   ATIISRCQRFDFRQVSLEEQSERLFEICRDEGIEAEEDAIAYIARLSEGGMRDAISLLE
FT                   QVAAFGGSRITLDGAVDVTGGMAADQFYALAEAIRDRNVAAIMPLVEGLTQAGKSADKC
FT                   MENLIFYFRDLLVLKLAPQGAVTERVVDAERFRGMADAFSSERLFKMIDTLNTYQSDMK
FT                   HASQPQTLFEVALMKICTIGNESAGGTGSGGGAATSSPPAASAEVQRLRQQVEILERKL
FT                   EQLIQNGGAAGSGAGDGGAVRQPASQSRRPGFGGGGAAVSRSTVKLDPFVAAAGSPGTG
FT                   QVRMKWNEVLHRVKEARITVHAWLVDGEPVAATDSTILVAFKNTMHRETTERPAHREII
FT                   ERVMQDVFGNPFKLATCMLKEWQNAASRSGEQEGETLELQPDAIDTGEEQRPQWVEEAV
FT                   KLFGEDLVVIKEDN"
FT   gene            156762..157073
FT                   /locus_tag="Pjdr2_0145"
FT   CDS_pept        156762..157073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0145"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bha:BH0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98825"
FT                   /db_xref="GOA:C6CST6"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:C6CST6"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACS98825.1"
FT                   /translation="MNNMNQMMKQVKKMQEQMMKAQEELVNKTVEGTAGGGVVTVVANG
FT                   HKKIISIAIKPEAVDPDDVEMLQDLVLTAVNDVLAKVDEIANQDMGKFTGGMKIPGLF"
FT   gene            157179..157778
FT                   /locus_tag="Pjdr2_0146"
FT   CDS_pept        157179..157778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0146"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: bha:BH0036 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98826"
FT                   /db_xref="GOA:C6CST7"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:C6CST7"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACS98826.1"
FT                   /translation="MFYPEPIAKLIDAFTRLPGVGPKTAARLAFHVLRMKEDDVIDFAK
FT                   ALVSVKRNLTYCSVCCNITDTDPCRICQDKTRDNSVICVVQESKDLVAMERTKEFQGFY
FT                   HVLQGAISPIEGIGPDQIKIAELLRRLSDERVQELILATNPNIEGEATAMYISRLVKPF
FT                   GIRVTRIAHGLPVGGDLEYADEVTLSKALEGRRELR"
FT   gene            157931..158248
FT                   /locus_tag="Pjdr2_0147"
FT   CDS_pept        157931..158248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98827"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:C6CST8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98827.1"
FT                   /translation="MANLWREIKQPNESKHTGGLDMTKTQFQPVPEPDTAEWREHLRAE
FT                   IDEAHKEWTNANRFFNVAVGEDQIDYAIYALITAEKRYEMLIRIAKRTCKVWPEWRGAL
FT                   Q"
FT   gene            158245..158508
FT                   /locus_tag="Pjdr2_0148"
FT   CDS_pept        158245..158508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98828"
FT                   /db_xref="GOA:C6CST9"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:C6CST9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98828.1"
FT                   /translation="MKTLWLAMLVLSSVALVGVLVRQKISWTWLRNFSIHIVLAAAVLY
FT                   VLNFSGLIPNIYIPLNPVTIGTVVVLGVPGIALIAGVQYFIV"
FT   sig_peptide     158245..158298
FT                   /locus_tag="Pjdr2_0148"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.620 at
FT                   residue 18"
FT   gene            158795..160327
FT                   /locus_tag="Pjdr2_R0013"
FT   rRNA            158795..160327
FT                   /locus_tag="Pjdr2_R0013"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            160526..160641
FT                   /locus_tag="Pjdr2_R0014"
FT   rRNA            160526..160641
FT                   /locus_tag="Pjdr2_R0014"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            160804..163733
FT                   /locus_tag="Pjdr2_R0015"
FT   rRNA            160804..163733
FT                   /locus_tag="Pjdr2_R0015"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            163835..163911
FT                   /locus_tag="Pjdr2_R0016"
FT                   /note="tRNA-Met1"
FT   tRNA            163835..163911
FT                   /locus_tag="Pjdr2_R0016"
FT                   /product="tRNA-Met"
FT   gene            163919..163994
FT                   /locus_tag="Pjdr2_R0017"
FT                   /note="tRNA-Val1"
FT   tRNA            163919..163994
FT                   /locus_tag="Pjdr2_R0017"
FT                   /product="tRNA-Val"
FT   gene            164018..164094
FT                   /locus_tag="Pjdr2_R0018"
FT                   /note="tRNA-Asp1"
FT   tRNA            164018..164094
FT                   /locus_tag="Pjdr2_R0018"
FT                   /product="tRNA-Asp"
FT   gene            164116..164191
FT                   /locus_tag="Pjdr2_R0019"
FT                   /note="tRNA-Phe1"
FT   tRNA            164116..164191
FT                   /locus_tag="Pjdr2_R0019"
FT                   /product="tRNA-Phe"
FT   gene            164201..164284
FT                   /locus_tag="Pjdr2_R0020"
FT                   /note="tRNA-Tyr1"
FT   tRNA            164201..164284
FT                   /locus_tag="Pjdr2_R0020"
FT                   /product="tRNA-Tyr"
FT   gene            164299..164374
FT                   /locus_tag="Pjdr2_R0021"
FT                   /note="tRNA-Lys1"
FT   tRNA            164299..164374
FT                   /locus_tag="Pjdr2_R0021"
FT                   /product="tRNA-Lys"
FT   gene            complement(164488..165045)
FT                   /locus_tag="Pjdr2_0149"
FT   CDS_pept        complement(164488..165045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0149"
FT                   /product="FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   bha:BH3321 NADH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98829"
FT                   /db_xref="GOA:C6CSU0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR020048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSU0"
FT                   /inference="protein motif:PRIAM:1.5.1.29"
FT                   /protein_id="ACS98829.1"
FT                   /translation="MMSQVVILSGSPNPGSRLAGITQYVESQLSEKGISFNHITVASLP
FT                   AEDLIHARFDSPAIVEAAAIVEAADVVIIASPVYKASFTGVLKTFLDLLPQKGLTDKFV
FT                   TPLFIGGTIAHLLSIDYALKPVLSSLNAKHFGSGVYAIDSQIARIDAGVGESQFELNEE
FT                   LKQRLDASVAEIVEELRIRKIK"
FT   gene            165229..166176
FT                   /locus_tag="Pjdr2_0150"
FT   CDS_pept        165229..166176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0150"
FT                   /product="glycosyl transferase family 4"
FT                   /note="PFAM: glycosyl transferase family 4; KEGG:
FT                   bsu:BSU35530 teichoic acid linkage unit synthesis
FT                   (synthesis of
FT                   undecaprenylpyrophosphate-N-aetylglucosamine)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98830"
FT                   /db_xref="GOA:C6CSU1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSU1"
FT                   /inference="protein motif:PFAM:PF00953"
FT                   /protein_id="ACS98830.1"
FT                   /translation="MTYWLAVGMSAVLTIVFVPVMQKIALKYGIVDRPNWRKIHNRPIP
FT                   LMGGAALYVACVATIIAFQGITPLSLSIMVGGALLVCIGLMDDASKSKGRDFPIWPRVV
FT                   IYLGVSMIPLFFGIHMDGIMNPANGHFVGFPVWFDALGTIIWIFALINMINFIDGVDGL
FT                   ASGVCTLSSMTLFVTALIKGQGDIGVTAIIIGGACIGFLIYNFHPARIFMGDAGATFLG
FT                   YTLAVIAIDGAFKKATFITILVPLLALGLPILDTVIVMLRRLATGKGLHQADKLHTHHA
FT                   LMRWGLTQVQTVSFMYLIAALFSLLSILLLVMKG"
FT   sig_peptide     165229..165297
FT                   /locus_tag="Pjdr2_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.616) with cleavage site probability 0.615 at
FT                   residue 23"
FT   gene            166253..167392
FT                   /locus_tag="Pjdr2_0151"
FT   CDS_pept        166253..167392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0151"
FT                   /product="putative transcriptional regulator, PucR family"
FT                   /note="KEGG: tmz:Tmz1t_0150 transcriptional regulator,
FT                   CdaR"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98831"
FT                   /db_xref="GOA:C6CSU2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSU2"
FT                   /inference="protein motif:COG:COG2508"
FT                   /protein_id="ACS98831.1"
FT                   /translation="MSTTDWLNPLQHILNCQVRFITFSLSDWKGLVQQADTSWAYDDNR
FT                   DKISEGNRAANNGRTWIVVKVSGNVVETLEIDGELKQAEAELITWTLQWNQAQQQSPKP
FT                   STLSESESFALKLSEWIQQQLESEEPSYSIPDHLTAGGKLFAEMIPFLLVTEYTNGKQA
FT                   SYPELEKLLRSFLAEDILLIPLKNQEWLIWGPVSLLKEADSEFMDDEDEETVEDSLTSI
FT                   CHGLHEMLASEWIGECHLAVAHPVCPAKGIVETTVLLRETINLGRKFHVGTSIHLPWML
FT                   QLERLLNAIPEVQRSRYLEHALKRTELFVEAEMLATLETFFSLDCNVSETAKKLYIHRN
FT                   TLLYRLDKLKQETGLDVRQFRDAVLVKIILLLYKVTKRN"
FT   gene            167480..168601
FT                   /locus_tag="Pjdr2_0152"
FT   CDS_pept        167480..168601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0152"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: bha:BH1140
FT                   sugar ABC transportor ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98832"
FT                   /db_xref="GOA:C6CSU3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSU3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS98832.1"
FT                   /translation="MAGVRLEGIYKKYPGSDKASVTDVNLDIKDKEFLVLVGPSGCGKS
FT                   TTLRMIAGLEEISEGKLYIGDRVVNDVAPKDRDIAMVFQSYALYPHMNVYQNMAFGLKL
FT                   RKFKKADIDKRVREAAKILDIEHLLDRKPKALSGGQRQRVALGRAIVREPQVFLMDEPL
FT                   SNLDAKLRGQMRAEISKLTKRLETTTIYVTHDQIEAMTMGDRIVVMKDGFIQQTASPEE
FT                   LYNHPVNIFVAGFIGAPSMNFITGTLTDQGGTLKFKTTGVDVVVPEGKAATLRSKGYIG
FT                   KEVVLGIRPEDLHEEPVFLEASANTIVNANVEVAENLGHEMYLYLNGIGSDTVIARVDG
FT                   RSTLRDGSSVKLALDMNKVHMFDKESELNIFEN"
FT   gene            168785..169327
FT                   /locus_tag="Pjdr2_0153"
FT   CDS_pept        168785..169327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0153"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   bha:BH0620 RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98833"
FT                   /db_xref="GOA:C6CSU4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSU4"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACS98833.1"
FT                   /translation="MDRDEYAAAAIKGDDDALIARIQMDQNRLYGIAYSYMRNETDALE
FT                   AIQETTVRVWNKRRSLRDPKVFTTWVTRILIRVCLDERKKQLRERPLRNELLERDAQTA
FT                   NEHGIDRMDMAVQLKKLPSKYRMVIVLKYYRDMTITEIAELLEKPDGTIRTWLHQALKQ
FT                   LRTNNTYGKEGMKVEWE"
FT   gene            169314..170708
FT                   /locus_tag="Pjdr2_0154"
FT   CDS_pept        169314..170708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0154"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98834"
FT                   /db_xref="GOA:C6CSU5"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="InterPro:IPR040680"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSU5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98834.1"
FT                   /translation="MSGNKPELEQGLDPFLREDKARVQRILEYASDESFAAAVRIGVQQ
FT                   GRQQLKRRKRSRLTLQMAAAAACVLVLLTACIRVSPAFAELVREIPGLNGVVELIKGDS
FT                   TLTSAMNHEFIQPVNQSQSKNGYTFKVDGIMADQQRIVIFYTAEGPEVSKGANSTEYKI
FT                   ADGNGDPLEAMIGSNYYSIGKTGTEPDTANRIHDMIDIMLVDGVPVPSEIRFSLKLGGE
FT                   WHEVDIAVDRSRFEQLKEDITLNKTIDIGGQKFIIEKALVTPLQASVTIRKVPDSRMRA
FT                   NHFIQLALVDEKGRRWETKGGFGMLDEGTTTLTFQSNYFEKPQHLRLVADGLLLSPKGQ
FT                   KFVINTETRETLETPDDRIQLANVQVTASGIKLSIEAKRLSEPEQGYGYWLLNYKALFH
FT                   DATGAEFMLKDSDGIQSSSRGNADGSGGTYEAYYTIPDKPYKQPLTFELYQYPGYVEQP
FT                   VNVVIK"
FT   gene            170833..171771
FT                   /locus_tag="Pjdr2_0155"
FT   CDS_pept        170833..171771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0155"
FT                   /product="HPr kinase"
FT                   /note="TIGRFAM: HPr(Ser) kinase/phosphatase; PFAM: HPr
FT                   serine kinase domain protein; KEGG: baa:BA_0250 Hpr S
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98835"
FT                   /db_xref="GOA:C6CSU6"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="InterPro:IPR011126"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSU6"
FT                   /inference="protein motif:TFAM:TIGR00679"
FT                   /protein_id="ACS98835.1"
FT                   /translation="MAKKVKVSELVQHFSMEIVSGEDGLKRSILVDDLYRPGLEMAGYF
FT                   DYHPHERVQLLGKTELTFLSTLTSEERRSRFEQLCHESTPCIILTRGLEAPDELVEYSN
FT                   MTQIAVLRSNVATTILQSRITDFLEKKLAPTATIHGVLVDVYGVGMLITGGSGIGKSET
FT                   ALELVKRGHRLVADDAVEIRQTSDGQLFGSAPELIRHLLEIRGLGIINVMTLFGAGAVR
FT                   TSKRITLVIKLENWQQDKQYDRLGLDEEKTRIIDTDVPLVTVPVRPGRNLAVIIEVAAM
FT                   NFRLKRMGYNAALQFTNKLTETIAEDTDDFD"
FT   gene            171827..172789
FT                   /locus_tag="Pjdr2_0156"
FT   CDS_pept        171827..172789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0156"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="TIGRFAM: prolipoprotein diacylglyceryl transferase;
FT                   PFAM: prolipoprotein diacylglyceryl transferase; KEGG:
FT                   bsu:BSU34990 prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98836"
FT                   /db_xref="GOA:C6CSU7"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSU7"
FT                   /inference="protein motif:TFAM:TIGR00544"
FT                   /protein_id="ACS98836.1"
FT                   /translation="MNLLIDPTAFSIGDIHVRWYGIILGTAALVGLLLAVQEGKRFGVK
FT                   PEFFMDLLLLGVPSAVICARIYYVAFTWDEYKNNLVDVFKIWNGGIAIYGALIGAFLCG
FT                   FFYFRYKGYSFWRMVDICAPGLLAGQMIGRWGNFMNQEAYGGPVDESFLRNTLHLPDFI
FT                   VKQMYVASEGVYHHPAFLYESLWSLVGIIILLVIRRQKFLRAGELVAFYFIWYSIGRFF
FT                   IEGIRTDSLAFQGPGALGSLMDALWTPMTWFGFEQGFLDPAYGDVRISQLLAVLLVIAA
FT                   VIFIVVRRVNGWATVRYNDPIVSTKETSAPVSDAKTDNL"
FT   gene            172820..173473
FT                   /locus_tag="Pjdr2_0157"
FT   CDS_pept        172820..173473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0157"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: baa:BA_0248 hydrolase, haloacid dehalogenase-like
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98837"
FT                   /db_xref="GOA:C6CSU8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSU8"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACS98837.1"
FT                   /translation="MTSNIKTMLFDLDGTIMDTNELIIRSFMESLKGLVPEDFGREHII
FT                   PSMGLTLQAQFQNFTGLTDVEHLIKAYRTVNTKLHDELLRPFPYTNEVMKNLHEQGIQI
FT                   GVVTTKIRMSTERGMKFCGLYDYVDAFVTVDDVANPKPHPEPVLMALEMLNADPATTIM
FT                   IGDSTVDMISAKEAGVIPVGVSWSLKGGELLKENGAQYIIDDMRELYAFAGMER"
FT   gene            173478..174005
FT                   /locus_tag="Pjdr2_0158"
FT   CDS_pept        173478..174005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0158"
FT                   /product="transferase hexapeptide domain-containing
FT                   protein"
FT                   /note="KEGG: bar:GBAA5389 transferase hexapeptide
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98838"
FT                   /db_xref="GOA:C6CSU9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSU9"
FT                   /inference="similar to AA sequence:KEGG:GBAA5389"
FT                   /protein_id="ACS98838.1"
FT                   /translation="MRNVERYPVEGPNALWQMYRTVSRFKAVRNFIAIQAARYCPELTV
FT                   KNWIYRNILGMKVGKETAFALMVMVDVFFPERIEVGDNTIIGYNTTILTHEYLIKEYRL
FT                   GSVKIGSNVMIGANSTILPGVTIGDNAVIAAGSVVHKDVSANTFVGGNPIREIRRTDAG
FT                   EHKNEDKRVLLR"
FT   gene            174230..175453
FT                   /locus_tag="Pjdr2_0159"
FT   CDS_pept        174230..175453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0159"
FT                   /product="histidyl-tRNA synthetase 2"
FT                   /EC_number="6.1.1.21"
FT                   /note="KEGG: bha:BH3584 ATP phosphoribosyltransferase
FT                   regulatory subunit; TIGRFAM: histidyl-tRNA synthetase 2;
FT                   PFAM: tRNA synthetase class II (G H P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98839"
FT                   /db_xref="GOA:C6CSV0"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSV0"
FT                   /inference="protein motif:TFAM:TIGR00443"
FT                   /protein_id="ACS98839.1"
FT                   /translation="MSKPKVFEKPIGVKDYLPGAVAKLRHIERDVLACMKGWGYEQIIT
FT                   PTMEYYDTVGVASSTSDQKLFKLLNNRGTTLVLRSDMTAPIARVVSSLLKESQFPLRLS
FT                   YHGNVFRSIEEESGREAEFFQTGVELVGDASAEADAEVVALAIASLKAAGVDRFKIAIG
FT                   HVGFLNGLFEETLAGRVEAQEQLKSCLLNRDYVGYRESLRGLKLEEPVQRELEGILRLR
FT                   GGQEICEQALQLSADATAQKSIRHLCEIWDVLKAYDVCEHVLIDLTMIGDFSYYTGMTF
FT                   EGYAADLGFPVASGGRYDNLLSQFGRPAPATGFALKTTRILELVGAEEDATGTTRVLIG
FT                   YDGEGRAEALAAAQQLREQGAAVITERMTEEDWKELGAGSFTYKGVAYTKGLPYIGGVD
FT                   KATGGSGQ"
FT   gene            175450..176094
FT                   /locus_tag="Pjdr2_0160"
FT   CDS_pept        175450..176094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0160"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="KEGG: bsu:BSU34920 ATP phosphoribosyltransferase
FT                   catalytic subunit; TIGRFAM: ATP phosphoribosyltransferase;
FT                   PFAM: ATP phosphoribosyltransferase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98840"
FT                   /db_xref="GOA:C6CSV1"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSV1"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ACS98840.1"
FT                   /translation="MSEAKKDILKVAMPKGRIYKQASKLFREAGLPIPSDFDDTRKLII
FT                   ELPEVGMEFIMAKPVDVPTYVEYGVADIGIVGKDVLMEENKDVYELLDLGIAKCRMSVI
FT                   GLADWKPVINPRVATKYPNVASQYFRELGQQVEVIKLNGSIELAPLIGLADRIVDMVET
FT                   GQTLRENGLVEMEPIFPITSRLIANRVSYRMKNEAIQSLCDRLQDTIAAKV"
FT   gene            176140..177429
FT                   /locus_tag="Pjdr2_0161"
FT   CDS_pept        176140..177429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0161"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="KEGG: bha:BH3582 histidinol dehydrogenase; TIGRFAM:
FT                   histidinol dehydrogenase; PFAM: histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98841"
FT                   /db_xref="GOA:C6CSV2"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSV2"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ACS98841.1"
FT                   /translation="MRIMKAEQFGLQREVEYGTPEQNETVRQIVEAIKEEGDAALLAYT
FT                   EQLDRVRLDASSLRVTQEEINAAYDRVDAAFLTAIREAAVNIRVFHEKQMRNSWMDLQP
FT                   DGTMLGQILRPLKRVGVYVPGGKAAYPSSVLMNVIPAQVAGVPEIVMVTPPATGGKEGI
FT                   DPYILVAAAEAGVKEMYRVGGAQAIAALAYGTATIAPVDKICGPGNIYVALAKRTVFGA
FT                   VDIDSIAGPSEIVVLADEGANASYIAADLLSQAEHDEMASAILVTPSETLAEAVAAEVE
FT                   RQISTLPREAIARASIDSYGAVLLVESIEAGIDVVNKLAPEHLEVLTADPMSLLGLIEN
FT                   AGAIFLGPYSSEPVGDYFAGPNHIIPTNGTARFSSPVNVDDFLKKSSLIYYSKEALLKN
FT                   GSSIMTLARHEGLEAHARAIQIRLEQEGNQ"
FT   gene            177471..178067
FT                   /locus_tag="Pjdr2_0162"
FT   CDS_pept        177471..178067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0162"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   bsu:BSU34900 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98842"
FT                   /db_xref="GOA:C6CSV3"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSV3"
FT                   /inference="protein motif:PRIAM:4.2.1.19"
FT                   /protein_id="ACS98842.1"
FT                   /translation="MADTKRKAEIARKTNETDIKLSFAVDGSGEAKLETDVPFLNHMLD
FT                   LFAKHGQFDLTVEARGDIDIDDHHTVEDIGICLGQTLREALGDKRGIKRYASVFVPMDE
FT                   ALAQVIIDVSNRPHFEYRAEYPSAQVGSFSTELVHEFLWKLALEARITLHVIVHYGKNT
FT                   HHMIEAVFKALGRAIDEATSIDPRVQGVPSTKGVL"
FT   gene            178069..178692
FT                   /locus_tag="Pjdr2_0163"
FT   CDS_pept        178069..178692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0163"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: bha:BH3580 imidazole
FT                   glycerol phosphate synthase subunit HisH"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98843"
FT                   /db_xref="GOA:C6CSV4"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSV4"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ACS98843.1"
FT                   /translation="MIAIIDYGMGNLHSVSKAVERLGYEAVVTADPAVIASADGAILPG
FT                   VGAFGDAMENLRETKLDEVTKAYAASGKPLLGICLGMQLLFSESEEHGVNEGLNLLPGK
FT                   VIRFQGDYKVPHMGWNKLSFLQSDSPLFKGLEEGHVYFVHSFHAKPEVASDLLATTDYY
FT                   QQVTAIVGRGNVHGMQFHPEKSSDLGIKLLGNFLALTGSPVAQR"
FT   gene            178741..179499
FT                   /locus_tag="Pjdr2_0164"
FT   CDS_pept        178741..179499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0164"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein;
FT                   KEGG: bha:BH3578 imidazole glycerol phosphate synthase
FT                   subunit HisF"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98844"
FT                   /db_xref="GOA:C6CSV5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSV5"
FT                   /inference="protein motif:TFAM:TIGR00735"
FT                   /protein_id="ACS98844.1"
FT                   /translation="MLAKRIIPCLDVKDGRVVKGVNFVNLRDAGDPVELASTYDQEGAD
FT                   ELVFLDISASVEGRATMIEVVKRTAGEITIPFTVGGGISHVDDMKRILRAGADKIAINT
FT                   AAVLNPSLVSDGARKFGSQCIVVAIDAKYNEAWGEWEVFTHGGRKETGIKVLEWAREIE
FT                   RLGAGEILLTSMDADGTKDGFDLKLTRAVSDLVGIPVIASGGAGRIEHFSDVFEQGHAD
FT                   AGLAATIFHYKEMTIREVKDDLRQKGVEVR"
FT   gene            179496..180197
FT                   /locus_tag="Pjdr2_0165"
FT   CDS_pept        179496..180197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0165"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="TIGRFAM: phosphoribosyl-ATP diphosphatase; PFAM:
FT                   phosphoribosyl-AMP cyclohydrolase; phosphoribosyl-ATP
FT                   pyrophosphohydrolase; MazG nucleotide pyrophosphohydrolase;
FT                   KEGG: bha:BH3577 bifunctional phosphoribosyl-AMP
FT                   cyclohydrolase/phosphoribosyl-ATP pyrophosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98845"
FT                   /db_xref="GOA:C6CSV6"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSV6"
FT                   /inference="protein motif:TFAM:TIGR03188"
FT                   /protein_id="ACS98845.1"
FT                   /translation="MTDQLAELIKWSEDGLVPAIVQDAQSKEVLMLAYMNKESLKLSAE
FT                   SGVTWFWSRSRNELWNKGATSGHTQRIRSMSYDCDADTLLVRVDQKGPACHTGSYSCFF
FT                   NEIEVAGAEKSSDSAKASSDDRFGILGELEGVIAQRYAERPEGAYTTYLFGKGLDKILK
FT                   KVGEEATEAIIAAKNGDNDELRSEASDLLFHLLVLLRERGLPLDEVMAELQSRHGKPAT
FT                   NNAMRREQAGK"
FT   gene            180225..181031
FT                   /locus_tag="Pjdr2_0166"
FT   CDS_pept        180225..181031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0166"
FT                   /product="histidinol phosphate phosphatase HisJ family"
FT                   /EC_number="3.1.3.15"
FT                   /note="KEGG: sun:SUN_0354 PHP family histidinol
FT                   phosphatase/hydrolase; TIGRFAM: histidinol phosphate
FT                   phosphatase HisJ family; PFAM: PHP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98846"
FT                   /db_xref="GOA:C6CSV7"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010140"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSV7"
FT                   /inference="protein motif:TFAM:TIGR01856"
FT                   /protein_id="ACS98846.1"
FT                   /translation="MFIDYHTHHARCGHAVGSLEEYVQKGIEIGLAQIGLSDHMPLLHV
FT                   DPATYYPEMAMPMEELPRYVEECLALKEKYKDQIDIRVGLEGDYIEGQEEKIETIINAY
FT                   PFDYVIGSVHFLGEWDITDFRQTHGWEGKNRMKVYEQYYEAVAKAAATGFYDYIGHIDV
FT                   IKRFGFKPEGDVTHLENAALEAVKRHGMAIELNASGLRMPVEEMFPSRRMLEYAKQLSI
FT                   PITIGSDAHQPERLGQYLDQARAVLKDVGFSQLATFERRKLVLVDF"
FT   gene            181175..182128
FT                   /locus_tag="Pjdr2_0167"
FT   CDS_pept        181175..182128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0167"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: bar:GBAA0049 ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98847"
FT                   /db_xref="GOA:C6CSV8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSV8"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACS98847.1"
FT                   /translation="MFSDKLRIFSGSSNPALAQKIAGDLGLTLGAIKMSRFKSGEIYVH
FT                   YEETIRNCDVFLVQSFSHPINEHFVELLVMIDAAKRASAKTINIIMPYYGYARQERKAA
FT                   PREPISAKMVADVLTTVGANRVITIDLHAPAIQGFFNIPVDHMTALDLLSDYLKSKNIQ
FT                   NPVVVSPDAGRASTAEKLANNLDTSFAIMIKKRPAHNESSITHVIGDVEGQTAIIIEDL
FT                   IDTGSTIVNVVESLKERGAKEVYVCATHPLFSGNAIERLNHPHIKEIIVTDSISLPENR
FT                   PDKFTVLSVAPLLAEATRIIIEGGSISTLFKTNGGV"
FT   gene            182265..184010
FT                   /locus_tag="Pjdr2_0168"
FT   CDS_pept        182265..184010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0168"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: bha:BH3572
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98848"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSV9"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACS98848.1"
FT                   /translation="MKEKKREAIEQTAKIIPIQWDATFFFERAVRSLDRYHYDKALKYF
FT                   RRAVEYEPENPVNHCNMAGIMSEMGNYEESNRILKWIVDELDPTMTECHFYMANNYANM
FT                   EMYEAAEGALIHYLEEDADGQYLDEAEEMMELLQYELERPAPLTNIKAREGMVEHDQAR
FT                   KLLEEGKFTEAVRILEKIIEEQPEFLAARNNLALAYYYMGMFDKAMATIREALELEPGN
FT                   LHALCNLGIFYQHAGDKDSLTPLLDLLRKTAPFHQEHVFKLATTMGILGEHESAYRHFT
FT                   RLLKDVELNLDPCLYHYAAVAACQIGRYVEAERLWKQAAKLDPESDIPRYYMEQLTLIK
FT                   DGDQNASVSYHYHLPFEEQFKLWENSSDGLPEHLKRDPLVRSSFFWALRHGDQNTKLQV
FT                   IQALGMIADNEVKDVLRAFLLEADEDDYLKRIAVFVLRTIGVQEPLQAVLEGKATVIEP
FT                   NRVPSRLPVWEDKWQEVVEAAMSRVNKRFDLVQQYDLMTLWVEFLSRLYPEVPKLTKPE
FT                   GWAAALEYLTAKMHRRTTSYPEISERYGVSIATVSKNAKKIDEVCGIKEKMKSISSVFS
FT                   LDHLE"
FT   gene            184416..185345
FT                   /locus_tag="Pjdr2_0169"
FT   CDS_pept        184416..185345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0169"
FT                   /product="thioredoxin reductase"
FT                   /note="TIGRFAM: thioredoxin reductase; PFAM: FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   bba:Bd0373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98849"
FT                   /db_xref="GOA:C6CSW0"
FT                   /db_xref="InterPro:IPR005982"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSW0"
FT                   /inference="protein motif:TFAM:TIGR01292"
FT                   /protein_id="ACS98849.1"
FT                   /translation="MYKSIIIGTGPAGLTAAIYLARANMKPLVIEGPEPGGQLTTTTEV
FT                   ENFPGFPEGIMGPDLMANMRKQAERFGAEFMTGWVNNVDMSERPFKLQVEGKGEFVGET
FT                   IIISTGASARWLGIPGEKDNIGRGVSTCATCDGFFFRNKKIVVIGGGDSAMEEANFLTR
FT                   FATNVELVNRRDELRASKIMQDRARGNEKISWSLNRTPLEVEANGMGVTGLKVRNNATG
FT                   EDETIQTDGVFIAIGHTPNTKFLNGQIDTDEHGYIKVKPGSSETNVPGVFACGDVQDNK
FT                   YRQAITAAGSGCMAALDCERFLENVGSH"
FT   gene            185512..186462
FT                   /locus_tag="Pjdr2_0170"
FT   CDS_pept        185512..186462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0170"
FT                   /product="glucokinase, ROK family"
FT                   /note="TIGRFAM: glucokinase, ROK family; PFAM: ROK family
FT                   protein; KEGG: bar:GBAA4487 glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98850"
FT                   /db_xref="GOA:C6CSW1"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSW1"
FT                   /inference="protein motif:TFAM:TIGR00744"
FT                   /protein_id="ACS98850.1"
FT                   /translation="MSEKIYVGVDVGGTAIKVGICNVEGELLHTYEGPTETSKGTDTIL
FT                   HNIAQYARNIVTESPFDWEQVEGVGVGIAGFLDIPNGIVKFSGNLKIENVHLKEYLEEE
FT                   LQVKVLVNNDANVAALGEAWAGAGKGIDNCVCYTLGTGVGGGIIIGGKIVEGFAGMAGE
FT                   LGHIAIVPDLEAIQCGCGKMGCLESVSSATGIIRMAKDAVERGDRTVLSTVEDIMAKDV
FT                   IDAAKAGDEVASRIVSRAAYYLGKSMALMAVVLNPECFIIGGGVSKAGDFLFDQIREVF
FT                   EKYTQKEAQEGVKIVAATLGNNAGVVGAAGLILRS"
FT   gene            186462..187388
FT                   /locus_tag="Pjdr2_0171"
FT   CDS_pept        186462..187388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bha:BH3569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98851"
FT                   /db_xref="GOA:C6CSW2"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSW2"
FT                   /inference="protein motif:PFAM:PF03668"
FT                   /protein_id="ACS98851.1"
FT                   /translation="MSMNSVTMGKEGTAMETGAMSKLVIITGMSGAGKTIAVQSLEDLG
FT                   FFCVDNLPPVLIPKFAELIEQSNGKIGKVALVIDLRGREFFTALSESLSFIKEHFTISC
FT                   EILFLDATDEVLVQRYKESRRRHPLAPEGMPLEGIRNERRMLEDLKGSASQVIDTSNIK
FT                   PAQLKERIISRFTNLENNSLSVNVTSFGFKYGIPIDADLIYDVRFLPNPHYVDHLRPNT
FT                   GQNPEVYDYVMKWPETQAFLTKLLDMLQFLLPLYHKEGKSQVVIGIGCTGGKHRSVAIA
FT                   EYLGRMLGSSDTERVRVSHRDADRDKH"
FT   gene            187401..188387
FT                   /locus_tag="Pjdr2_0172"
FT   CDS_pept        187401..188387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0172"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: bsu:BSU34760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98852"
FT                   /db_xref="GOA:C6CSW3"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSW3"
FT                   /inference="protein motif:PFAM:PF01933"
FT                   /protein_id="ACS98852.1"
FT                   /translation="MQNRHKIIRRPKIVVIGGGTGLSVMLRGLKEKPLDITAIVTVADD
FT                   GGSSGVLRNELQIPPPGDIRNVIMALADAEPLLTEVLQYRFSSGTGLAGHSLGNLMLAA
FT                   MTDIAGDFVTGVRELSKVLAVRGRVLPAAGRAIVLKAEMTDGTVVVGESMIPKAGKKIK
FT                   RVFIEPDNVEPLPEAIEAIEQADAILIGPGSLYTSIIPNLLVPKLARAILESTAVKLFV
FT                   CNVMTQPGETDGYSVSDHLKAVKDHIGHKIFDYVLVNDGEISPEVAEKYAELGSTQVEL
FT                   DIDEVNRLGYEIISDRLVLYRTFLRHDAERLSHHIYKLVENWMLRKR"
FT   gene            188395..189324
FT                   /locus_tag="Pjdr2_0173"
FT   CDS_pept        188395..189324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0173"
FT                   /product="protein of unknown function DUF199"
FT                   /note="PFAM: protein of unknown function DUF199; KEGG:
FT                   bha:BH3567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98853"
FT                   /db_xref="GOA:C6CSW4"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSW4"
FT                   /inference="protein motif:PFAM:PF02650"
FT                   /protein_id="ACS98853.1"
FT                   /translation="MSFAAQTKKELTMVEADTCCERAELSALIRMNGSVSVSSRKVVLD
FT                   ISTENAAIARRIYSLLKKHFEVHTELLVRKKMRLKKNNVYIVRIPTKVQEILSELRIVS
FT                   EGFVFNLGIDKEIIKKPCCKRSYLRGAFLAGGSVNNPEGSSYHLEISSMYEEHCEALVE
FT                   LANKFGLNARCIERKKGFVFYIKEGEKIIELLNIIGAHQALFKFEDVRIMRDMRNSVNR
FT                   IVNCETANLNKTIGAAVRQIDNIKLLQKEIGLNNLPDKLREVAEIRLQHPDMNLKEVGE
FT                   MLKGTVSKSGVNHRLRKIDELAEKIRNG"
FT   gene            189480..189749
FT                   /locus_tag="Pjdr2_0174"
FT   CDS_pept        189480..189749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0174"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphoryl transfer system HPr; KEGG: bha:BH3566
FT                   phosphocarrier protein Chr"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98854"
FT                   /db_xref="GOA:C6CSW5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSW5"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ACS98854.1"
FT                   /translation="MTRLPVVVRLKTGLHARPAALFVQEANKFSSEVFVEKDDKKVNAK
FT                   SIMGIMSLAISSGTEIHISAEGSDAEQAVNALVALVSKEELENQ"
FT   gene            complement(189887..190474)
FT                   /locus_tag="Pjdr2_0175"
FT   CDS_pept        complement(189887..190474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0175"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   ClpP"
FT                   /EC_number="3.4.21.92"
FT                   /note="KEGG: bha:BH3564 ATP-dependent Clp protease
FT                   proteolytic subunit; TIGRFAM: ATP-dependent Clp protease,
FT                   proteolytic subunit ClpP; PFAM: peptidase S14 ClpP"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98855"
FT                   /db_xref="GOA:C6CSW6"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSW6"
FT                   /inference="protein motif:TFAM:TIGR00493"
FT                   /protein_id="ACS98855.1"
FT                   /translation="MDMNFVPMVIEQSNRGERAYDIYSRLLKDRIIFLGSGVNDVVANS
FT                   IIAQMLFLAAEDPEKDISLYINSPGGSITAGMAIYDTMQYIKPDVSTICVGMAASMGAF
FT                   LLTAGAIGKRYALPNSEVMIHQPLGGAEGQASDIEIRARRIIKMRDKLNGILAERSGQP
FT                   LERIEKDTDRDYFMSAEEARQYGLVDKVIERI"
FT   gene            complement(190640..190714)
FT                   /locus_tag="Pjdr2_R0022"
FT                   /note="tRNA-Arg5"
FT   tRNA            complement(190640..190714)
FT                   /locus_tag="Pjdr2_R0022"
FT                   /product="tRNA-Arg"
FT   gene            190962..192008
FT                   /locus_tag="Pjdr2_0176"
FT   CDS_pept        190962..192008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0176"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: putative sugar-binding domain protein; KEGG:
FT                   bha:BH3561 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98856"
FT                   /db_xref="GOA:C6CSW7"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSW7"
FT                   /inference="protein motif:PFAM:PF04198"
FT                   /protein_id="ACS98856.1"
FT                   /translation="MRHIIELQQQLLPDLLDVMKKRYSILRQVMLSDLIGRRTLANSLG
FT                   MTERVLRAETDFLKSQGLLEIHTAGMRISEAGKQLLEQLEPFYKTLFGLSDLEEKIRSH
FT                   FGLSQVIIVAGDSEESEQSKRELGRAACQVLRKVMEPNDVVAVTGGTTIAQVANQLTST
FT                   TPLKNNWFVPARGGLGESLDYQANTIASTMAKRTGANYRMLHVPDHLGDEAYASMMQEP
FT                   NIRDIVEVVRSARIVVHGIGDAMVMARRRKLNPELVEAMAADGALAEAFGFYFDRNGEV
FT                   VHKMQTVGLRLEDIVKTEVVIGVAGGHSKGEAIAAIMKFGHNDVLVTDEAAALEMSAII
FT                   DEQQQSLS"
FT   gene            192086..193090
FT                   /locus_tag="Pjdr2_0177"
FT   CDS_pept        192086..193090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0177"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase, type I"
FT                   /EC_number="1.2.1.12"
FT                   /note="KEGG: bsu:BSU33940 glyceraldehyde-3-phosphate
FT                   dehydrogenase; TIGRFAM: glyceraldehyde-3-phosphate
FT                   dehydrogenase, type I; PFAM: glyceraldehyde 3-phosphate
FT                   dehydrogenase; dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98857"
FT                   /db_xref="GOA:C6CSW8"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSW8"
FT                   /inference="protein motif:TFAM:TIGR01534"
FT                   /protein_id="ACS98857.1"
FT                   /translation="MVKIGINGFGRIGRNVFRASLNNPNVEVVAVNDLTDTKTLAHLLK
FT                   YDTTHGTLDATVEAQEGAIIVNGKEIKVFAERNPENLAWGSVGAEIVVESTGIFTAKEK
FT                   AELHLKGGAKKVIISAPATNEDITIVMGVNEDKYDAASHTVISNASCTTNCLAPFAKVL
FT                   NDKFGIVKGMMTTIHSYTNDQAVLDVPHKDLRRARAAAENIIPSSTGAAKAVSLVLPEL
FT                   KGKLNGMAMRVPTPNVSVTDLVAELKVNVTVEEVNAALKEASEGALKGILNYNELPLVS
FT                   SDYNSDPASSTIDALSTMVVEGNMVKVISWYDNEWGYSNRVVDLAAFVASKGL"
FT   gene            193290..194471
FT                   /locus_tag="Pjdr2_0178"
FT   CDS_pept        193290..194471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0178"
FT                   /product="Phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: baa:BA_0226
FT                   phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98858"
FT                   /db_xref="GOA:C6CSW9"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSW9"
FT                   /inference="protein motif:PRIAM:2.7.2.3"
FT                   /protein_id="ACS98858.1"
FT                   /translation="MNKKSVRDVEVAGKRVFVRVDFNVPLEDGKITDDKRIRETLPTIN
FT                   YLIEKGAKVILASHLGRPNGEVVEELRHTASAVRLSELLGKPVVKANDSVGEEVKAQIN
FT                   ALNNGDVLLLENVRFHAGEEKNDPELAKQFAELADLFVNDAFGAAHRAHASTEGIAHHL
FT                   PAVSGLLMERELDVLGKALNNPERPFTAIVGGSKVKDKIDVINKMIEIADNIIIGGGLS
FT                   YTFFKAQGHEIGQSLVDNSKLDLALEFIEKAKTLGKNFLIPVDIVVTDEFSKDANTKIV
FT                   DVDGIPADWEGIDIGPKTREIYADVIKNSKLVVWNGPMGVFEIEPFSHGTRAVANACAE
FT                   TAGYTVIGGGDSAAAAEKFGVADKMDHISTGGGASLEFMEGKALPGVVALNDK"
FT   gene            194509..195264
FT                   /locus_tag="Pjdr2_0179"
FT   CDS_pept        194509..195264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0179"
FT                   /product="triosephosphate isomerase"
FT                   /note="TIGRFAM: triosephosphate isomerase; PFAM:
FT                   triosephosphate isomerase; KEGG: bha:BH3558 triosephosphate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98859"
FT                   /db_xref="GOA:C6CSX0"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSX0"
FT                   /inference="protein motif:TFAM:TIGR00419"
FT                   /protein_id="ACS98859.1"
FT                   /translation="MSRTPIIAGNWKMFKTVSEAVSFFSEVKGKAEVAGVESVICAPYT
FT                   TLPALVEAAKGTSIAIGAQNLHFEDNGAFTGEISGVMLKDLGVKYVIIGHSERRAYFAE
FT                   TDEIVNKKMHSAFKHGITPIVCVGEKLEEREANQTKDVCKVQTEAAFEGLSAAQAAEVV
FT                   IAYEPIWAIGTGKSSTSEDAQDVIGYIRSVVADLYDAATAEAVRIQYGGSVKPNNVAEY
FT                   MGQADIDGALVGGASLEPASYIALVEGAK"
FT   gene            195266..196801
FT                   /locus_tag="Pjdr2_0180"
FT   CDS_pept        195266..196801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0180"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: BPG-independent
FT                   PGAM domain protein; metalloenzyme domain protein; KEGG:
FT                   bsu:BSU33910 phosphoglyceromutase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98860"
FT                   /db_xref="GOA:C6CSX1"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSX1"
FT                   /inference="protein motif:TFAM:TIGR01307"
FT                   /protein_id="ACS98860.1"
FT                   /translation="MAPKPVALIILDGFGLRDDVTGNAVAQAKKPNYDRYWSTYPHTTL
FT                   TASGEAVGLPDGQMGNSEVGHLNIGAGRIVYQDLTRISKSIRDGEFFDNETLLGAVRHA
FT                   KANGKKLHLYGLLSDGGVHSHIAHLFALLELAKKEELNEVFIHAFLDGRDVAPDSAKGY
FT                   LEQLQAKIEEVGVGQIATVQGRYYAMDRDKRWERTEKSYRAMVYGDGPKYTDPIKAVVE
FT                   SYEKSVYDEFVMPTVIVGENDKPVGLVESEDSIVFFNFRPDRAIQLGQVFTNEDFRGFD
FT                   RGEKCPKNLHFVCLTLFSETIGGYVAYSPKNLDNTLGEVLVQNNKKQLRIAETEKYPHV
FT                   TFFFSGGRDVELPGETRVLISSPKVATYDLQPEMSAYEVAAAAVREIEADKHDAIILNF
FT                   ANPDMVGHSGMLEPTIKAVEATDECLGQVVEAVLAKGGVAIITADHGNADMVFDENGRP
FT                   FTAHTTNPVPCIVTVAGGELREGGILADLAPTVLDLLELVKPEQMTGTTLIRK"
FT   gene            196880..198172
FT                   /locus_tag="Pjdr2_0181"
FT   CDS_pept        196880..198172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0181"
FT                   /product="enolase"
FT                   /EC_number="4.2.1.11"
FT                   /note="KEGG: bha:BH3556 enolase (2-phosphoglycerate
FT                   dehydratase); TIGRFAM: enolase; PFAM: enolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98861"
FT                   /db_xref="GOA:C6CSX2"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSX2"
FT                   /inference="protein motif:TFAM:TIGR01060"
FT                   /protein_id="ACS98861.1"
FT                   /translation="MSIIVDVYAREVLDSRGNPTVEVEVSLESGGKGRAIVPSGASTGA
FT                   YEAVELRDGDKGRYLGKGVEKAVENVNAIIAPEIIGLDALDQVAIDRKMIELDGTPNKA
FT                   KLGANAILAVSMAVARAAADALNVSLYTYLGGFNAKTLPVPMMNIINGGEHADNNIDVQ
FT                   EFMVLPVGAPTFKEALRIGAEIFHNLKSVLKDKGLNTAVGDEGGFAPNLGSNEEAITTI
FT                   IAAIELAGYKPGVDVFLGMDVASTEFYKDGKYHLEGEGKSFTSAEFVDLLASWVEKYPI
FT                   ITIEDGCSEDDWEGWKLLTDKLGGKVQLVGDDLFVTNTERLSDGIEKGVGNSILVKVNQ
FT                   IGSLTETFDAIEMAKRAGYTAVISHRSGESEDSTIADIAVATNAGQIKTGAPSRTDRVA
FT                   KYNQLLRIEDQLGSVAQYAGKSAFYNLKNFK"
FT   gene            198315..198569
FT                   /locus_tag="Pjdr2_0182"
FT   CDS_pept        198315..198569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0182"
FT                   /product="preprotein translocase, SecG subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecG subunit; PFAM:
FT                   Preprotein translocase SecG subunit; KEGG: bsu:BSU33630
FT                   preprotein translocase subunit SecG"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98862"
FT                   /db_xref="GOA:C6CSX4"
FT                   /db_xref="InterPro:IPR004692"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSX4"
FT                   /inference="protein motif:TFAM:TIGR00810"
FT                   /protein_id="ACS98862.1"
FT                   /translation="MLEVDQMEIFWKILLVIFAVGLIAVVLLQKGKSAGLSGAITGGAE
FT                   HLFGKQKARGLDLFLQRLTVGLASGFFILALVVAYVVKV"
FT   gene            198745..201570
FT                   /locus_tag="Pjdr2_0183"
FT   CDS_pept        198745..201570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0183"
FT                   /product="ribonuclease R"
FT                   /EC_number="3.1.13.1"
FT                   /note="KEGG: baa:BA_0194 RNB-like protein; TIGRFAM:
FT                   ribonuclease R; VacB and RNase II family 3'-5'
FT                   exoribonuclease; PFAM: ribonuclease II; Ribonuclease B OB
FT                   region domain; RNA binding S1 domain protein; SMART: RNA
FT                   binding S1 domain protein; Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98863"
FT                   /db_xref="GOA:C6CSX5"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011805"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR040476"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSX5"
FT                   /inference="protein motif:TFAM:TIGR02063"
FT                   /protein_id="ACS98863.1"
FT                   /translation="MMQEQGLLDFMRETAYKPMTYQELEQHFGINDAAEFKEFLKLLNQ
FT                   LEEEGKVIRTRNERYGVPERMNLLRGKIQAHAKGFAFLLPDEKDHPDVYIHANDQKSAM
FT                   NGDIALVRITSQSEGGGRMEGEVVRIVQRAVTQVVGTFESHEAFGFVVPDDKRINRDIF
FT                   IPKGEFQGAVTGQKVVVKITSYPEGRSAAQGEIIEILGHKNDPGIDILSIIRKHQLPEG
FT                   FSDEVMAEAEAAPDSITEEEIVEQGRRDLRGEVIVTIDGEDAKDLDDAVHVKRLENGNY
FT                   LLGVHIADVGYYVKERSALDQEAFRRGCSVYLVDRVIPMLPHRLSNGICSLNPQVDRLT
FT                   LSCEMEFDSKLKRVRHDIFTSVIKTKERMTYTNVRKILMATEEEPETELKERYADLLDM
FT                   FTLMEELAMKLRKKRMKRGAIDFDFQESKVIVDKEGKAVDIVKRERSVAEQIIEEFMLA
FT                   ANETVAEHFHWLRVPFLYRIHEDPDQEKLLHFMQFASNFGYVVKGKGNSVHPRALQTLL
FT                   EEIHGTKEETVISTVMLRSMKQAKYDAESLGHFGLAAEFYSHFTSPIRRYPDLVIHRVI
FT                   REVLENGGALPEIRNEALAARMPDIAQHSSERERVAVDAERDTDKLKKCEFMLDKVGEE
FT                   FDGIISSVTSFGMFVELDNTVEGLIRLSGLTDDYYHFHELHMVLIGERTSKVYRIGDEV
FT                   KIRVAQVNMDDYTIDFEMVDMKPRSDFRGVADAGFGARNGGGRKRGGFSRGGDTGAVVG
FT                   RGGDKGRRGKESRAGDGRGERNDRGPSKGGRDGAKRAEHSGAQGNAKRKRGGADGGAAG
FT                   GASRAAEGAAERSPWQEQAKPLEQGRQVRGARPRTDMWGLPISGSRGRDADTGEDPDQG
FT                   SAFDGGRGRRGGRGNRSGGGGGQRSDANSSSGVNNSGEEGKNKKRKRNGGGGSGNGGGN
FT                   STAAFVRKKRK"
FT   gene            201858..202058
FT                   /locus_tag="Pjdr2_0184"
FT   CDS_pept        201858..202058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0184"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: bar:GBAA5115 cold shock protein CspD"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98864"
FT                   /db_xref="GOA:C6CSX6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSX6"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACS98864.1"
FT                   /translation="MQQGTVKWFNAEKGFGFIEVEGGNDVFVHFSAIVGEGFKTLEEGQ
FT                   RVEFNVVQGNRGPQAENVVKL"
FT   gene            202221..202703
FT                   /locus_tag="Pjdr2_0185"
FT   CDS_pept        202221..202703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0185"
FT                   /product="SsrA-binding protein"
FT                   /note="TIGRFAM: SsrA-binding protein; PFAM: SmpB protein;
FT                   KEGG: bha:BH3552 SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98865"
FT                   /db_xref="GOA:C6CSX7"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSX7"
FT                   /inference="protein motif:TFAM:TIGR00086"
FT                   /protein_id="ACS98865.1"
FT                   /translation="MGAKKNDGKQLAQNKKASHDYFIEDTYEAGIVLMGTEIKALRMGK
FT                   ANISDAFATIRNGEMFIHNMHISPFDQGNRHNPTDPTRARKLLLHKQQIHKLLGQSKQE
FT                   GYSIVPLKIYVRNGYAKLLIGLGKGKKQYDKRDTAAKRDAQRDIQRALREKQKVAR"
FT   gene            202942..203305
FT                   /gene="ssrA"
FT                   /locus_tag="Pjdr2_R0023"
FT   tmRNA           202942..203305
FT                   /gene="ssrA"
FT                   /locus_tag="Pjdr2_R0023"
FT                   /note="tmRNA as predicted by Rfam (RF00023), score 205.26"
FT   gene            204037..204549
FT                   /locus_tag="Pjdr2_0186"
FT   CDS_pept        204037..204549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0186"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98866"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSX8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98866.1"
FT                   /translation="MHASFFVCATEAYQRKYVDFLLANYENLRLPYPFLVAFGFIASPI
FT                   LMGQECFLCLDNEGEAIGAFGYIHGTGEGNYEDRHIVQLQVALLSESYRFSRLFLRGLQ
FT                   VLAKHLTELKEVVTELVFWTGKDDYAIRLFNKFAERNEVGELAVGYRVTLHHLNAYLAK
FT                   FKRETLA"
FT   gene            204594..205094
FT                   /locus_tag="Pjdr2_0187"
FT   CDS_pept        204594..205094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98867"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98867.1"
FT                   /translation="MGRLFPATCNQDRDYARFARYFLANSCEFDERLLFYDAIAHLTLS
FT                   LNESRLMLFDDENGELQGYIQYRLEAKGYTVFIESAILSSSYRSGMQFYKGFARWTNHV
FT                   MEEYTEINRVRFHVRTDHAYLIKLYSKFAKKIGVTESRGRTELVFETSFDELRCYLRAA
FT                   DMK"
FT   gene            205110..205226
FT                   /locus_tag="Pjdr2_0188"
FT   CDS_pept        205110..205226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0188"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98868"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSY0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98868.1"
FT                   /translation="MIPVNQAQQLKGNGLKKSSILDALKANEQVRASAAAAK"
FT   gene            205582..207115
FT                   /locus_tag="Pjdr2_R0024"
FT   rRNA            205582..207115
FT                   /locus_tag="Pjdr2_R0024"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            207314..207429
FT                   /locus_tag="Pjdr2_R0025"
FT   rRNA            207314..207429
FT                   /locus_tag="Pjdr2_R0025"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            207524..210453
FT                   /locus_tag="Pjdr2_R0026"
FT   rRNA            207524..210453
FT                   /locus_tag="Pjdr2_R0026"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            210607..210682
FT                   /locus_tag="Pjdr2_R0027"
FT                   /note="tRNA-Asn1"
FT   tRNA            210607..210682
FT                   /locus_tag="Pjdr2_R0027"
FT                   /product="tRNA-Asn"
FT   gene            210686..210776
FT                   /locus_tag="Pjdr2_R0028"
FT                   /note="tRNA-Ser2"
FT   tRNA            210686..210776
FT                   /locus_tag="Pjdr2_R0028"
FT                   /product="tRNA-Ser"
FT   gene            210797..210871
FT                   /locus_tag="Pjdr2_R0029"
FT                   /note="tRNA-Glu1"
FT   tRNA            210797..210871
FT                   /locus_tag="Pjdr2_R0029"
FT                   /product="tRNA-Glu"
FT   gene            210949..211024
FT                   /locus_tag="Pjdr2_R0030"
FT                   /note="tRNA-Val2"
FT   tRNA            210949..211024
FT                   /locus_tag="Pjdr2_R0030"
FT                   /product="tRNA-Val"
FT   gene            211042..211118
FT                   /locus_tag="Pjdr2_R0031"
FT                   /note="tRNA-Met2"
FT   tRNA            211042..211118
FT                   /locus_tag="Pjdr2_R0031"
FT                   /product="tRNA-Met"
FT   gene            211155..211231
FT                   /locus_tag="Pjdr2_R0032"
FT                   /note="tRNA-Asp2"
FT   tRNA            211155..211231
FT                   /locus_tag="Pjdr2_R0032"
FT                   /product="tRNA-Asp"
FT   gene            211247..211322
FT                   /locus_tag="Pjdr2_R0033"
FT                   /note="tRNA-Phe2"
FT   tRNA            211247..211322
FT                   /locus_tag="Pjdr2_R0033"
FT                   /product="tRNA-Phe"
FT   gene            211349..211424
FT                   /locus_tag="Pjdr2_R0034"
FT                   /note="tRNA-Thr1"
FT   tRNA            211349..211424
FT                   /locus_tag="Pjdr2_R0034"
FT                   /product="tRNA-Thr"
FT   gene            211432..211515
FT                   /locus_tag="Pjdr2_R0035"
FT                   /note="tRNA-Tyr2"
FT   tRNA            211432..211515
FT                   /locus_tag="Pjdr2_R0035"
FT                   /product="tRNA-Tyr"
FT   gene            211528..211600
FT                   /locus_tag="Pjdr2_R0036"
FT                   /note="tRNA-Lys2"
FT   tRNA            211528..211600
FT                   /locus_tag="Pjdr2_R0036"
FT                   /product="tRNA-Lys"
FT   gene            211617..211701
FT                   /locus_tag="Pjdr2_R0037"
FT                   /note="tRNA-Leu1"
FT   tRNA            211617..211701
FT                   /locus_tag="Pjdr2_R0037"
FT                   /product="tRNA-Leu"
FT   gene            212096..213898
FT                   /locus_tag="Pjdr2_0189"
FT   CDS_pept        212096..213898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0189"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; SMART: histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein; KEGG:
FT                   bsu:BSU06950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98869"
FT                   /db_xref="GOA:C6CSY1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSY1"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACS98869.1"
FT                   /translation="MKLMKWLFVNRSIRTKIVWSSVITSLVPMLVLSYLFYESSTKSLE
FT                   RTMYRSTSQNAQYVAGYLNQYFRDLSSSALQVYGFPRVMNLMEHGRNVNDEDFFALGES
FT                   LKSYYALVSNKNKDNVIKIMIFGKDNKLKEFWSRAASYDAIPLNESIPHYEDMLDLPFQ
FT                   NSLSFSYRDSSFKQDFFVFAITIYDPFYHSKIGTLVFYIQMKELTKVIEANNQSPNVIV
FT                   LRNSRGETFYHTSDKYDGIVPTFDAPDIRMKNKPKELRFEQRQDLLVSTSYLDNGNSTL
FT                   TIIYPNEELARHRNNTLLIAIGAVVFAVVCISLLSLFAQQYLTRPIKRLGQAMKKVRNG
FT                   NFHVTLSQPYRYRDDISELTRSFNFMTEKIRELIEQRYQMQLRNKEAQLLALQMQINPH
FT                   FLYNTLQTIGGKAVLIGDYEIPEMCRSLGDLFRYSFYEGNTESTVRQELAHVGNYLYIQ
FT                   QFRFEESLRMEFDVPESLMEASTIRFVMQPIIENAVIHALGGPDDGQLLIRVKAETDEG
FT                   TIVLSVSDNGPGIAPDKLAVLRNDMEKKSMEVFSGVSIGLKNVHERIRLAYGDSYGLEL
FT                   DSKLGEGTVIRIRIPCRKRGESHV"
FT   sig_peptide     212096..212197
FT                   /locus_tag="Pjdr2_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.785) with cleavage site probability 0.743 at
FT                   residue 34"
FT   gene            213891..215492
FT                   /locus_tag="Pjdr2_0190"
FT   CDS_pept        213891..215492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0190"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   response regulator receiver; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98870"
FT                   /db_xref="GOA:C6CSY2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSY2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS98870.1"
FT                   /translation="MFKVMVVDDEPWGRKSVGKMIDELQLDVEVVAEARNGAEALELIP
FT                   VSKPHIIVTDMNMPVMNGQQFLEQLYHRYNHIKVVVISGHSQFEYMKAAVAYQACEYVL
FT                   KPVSHADLKDAMVKAIQASRSHMSVEQRQQFANEMRKLRTETFLQNVTGRRIVGNADIV
FT                   SQAAELLTSPATGRYRLAVCMLRRFRELAETKFNGNADLLMFSIENMMNELTSGAPLYV
FT                   FKSDDRQRLCLLLSEPSMDGGTVREMLLPFHETTSRMLQLYAVVGLSDPRERLDQLPEA
FT                   FEEASERLYGSTLRGTEFSVMSAGTPHERGEMLGGFDAKLLQQAIVGGQTASVRRMLGE
FT                   FARKAEMSESLTIRSAQKELRKLGAAAGSEWPAITTASPLLADQRAIDSVMTLSALHAY
FT                   VAELSAAIEAHIRARASSSDASNPMSEIVAYLDGHYFEDVGLIDMATRYHMDPSYLSRQ
FT                   FKAATGVNFIEYVTRKRMEKACELLRESDRKVSDIAELVGYENQRYFSQVFKKFTGQTP
FT                   SEFRELPLSVSQPAKN"
FT   gene            215605..216948
FT                   /locus_tag="Pjdr2_0191"
FT   CDS_pept        215605..216948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0191"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: rle:pRL100259 putative substrate-binding component of
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98871"
FT                   /db_xref="GOA:C6CSY3"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSY3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS98871.1"
FT                   /translation="MNKKLGLGLSVAMMTALLSACGGNNGNNAASPANTASAPANSATE
FT                   SASAPATEDTEPVTISFMHFKSDATDGINKIVEQFEAENPNIKVDVQPVKFDDYATLLK
FT                   TKLASGDIVDVFTLNAGSTTKLYKDGGYLEDLTDQEFMKTFDPGVLAEQATDGRNYIMP
FT                   LNAGPIAVFYNKKIFADLGIEIPTTYDALIAAAQKIKDSGKTPFALGWKDGWPLGMWLS
FT                   RDFPSNTVLVDKQTDFFDKLEKGEAKFADNPATKTTIQHALDMFKYGNKDQLGVDYNGA
FT                   VDMFAREEAAMMYMGTWPLPDIEKKNPELFATGMGYFPYPFSNDPALNKLEFNPDASVA
FT                   VNSKSEHKEAAMKFLAYLASVPAANTWVENVKTLTYVKGASADIAPAVSELKPYFDNGQ
FT                   LYNSQVYITTTIDWTTQFSQYVQKVFFNKATADDIIKDLDDWVAKNHK"
FT   sig_peptide     215605..215667
FT                   /locus_tag="Pjdr2_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.556 at
FT                   residue 21"
FT   gene            217018..217896
FT                   /locus_tag="Pjdr2_0192"
FT   CDS_pept        217018..217896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0192"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH2225 sugar transport
FT                   system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98872"
FT                   /db_xref="GOA:C6CSY4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSY4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS98872.1"
FT                   /translation="MEVLKKTIRREMWYILFLVPGVLLFTFAVILPFVTGIRYSFTNWD
FT                   GISRKLTYIGWDNYVNALQDADLWTVLGNTFKYAIILTLLVNLVALLFALLLDSYLPLR
FT                   NLFRTIFFLPSVISVILAGFIWSYNYSQGFPRLLAHLGMDVTSPLGNPDRALYGLIIIA
FT                   VWQGIGAPMIIYIAGLQGIPAELSESARIDGAGPLRVFRNVTLPLLAPSVTINMLLVLT
FT                   GSLKVFDLVLVTTNGGPGFATEVISTFIYKNAFSSFKAGYGMALSMIFFVILVIVTVVQ
FT                   VTIFRKREVEM"
FT   gene            217896..218714
FT                   /locus_tag="Pjdr2_0193"
FT   CDS_pept        217896..218714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0193"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH2224 maltose
FT                   transport system (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98873"
FT                   /db_xref="GOA:C6CSY5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSY5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS98873.1"
FT                   /translation="MRSTRLLVFIAVAAVAAVFLFPLYVAVLMALKSAKQTFDSFYALP
FT                   SSLDLANFYHAWDTSKYPTAFLNSVIITALSVLLILVISALSGYAIARGNKPLYNFFFL
FT                   LFLSGMMVPFQVTMLPLYQLGKSLDMLNNYWGIVVIYGGFGVQSGVLFFTGFVRGISRE
FT                   IEEAARIDGCSTPGIFIRIVMPLLKPVTATVLVLNALYIWNDFLLPLLYLQNKDFRTIP
FT                   LQQYFFFGQYSSDLNLAFAYAVMGLIPIIVFFLFMQRFIIKGIAAGAIKG"
FT   sig_peptide     217896..217973
FT                   /locus_tag="Pjdr2_0193"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.683 at
FT                   residue 26"
FT   gene            218860..221928
FT                   /locus_tag="Pjdr2_0194"
FT   CDS_pept        218860..221928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0194"
FT                   /product="coagulation factor 5/8 type domain protein"
FT                   /note="PFAM: coagulation factor 5/8 type domain protein;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98874"
FT                   /db_xref="GOA:C6CSY6"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR041233"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSY6"
FT                   /inference="protein motif:PFAM:PF00754"
FT                   /protein_id="ACS98874.1"
FT                   /translation="MRKNGMKVMLLLSLLLSVLLPVGTRTTYAAPVSISQTGNIVNATN
FT                   GTITVAYDLSTGKGTFKEGSTTLISDFYSDYAISGSSTRYKSTDSATRTASWTTTGNDG
FT                   YGTSGKLLTITNALASGSTITLRITMYENRSYILSDMTVSKGTSQTIDFLEPIAASNLD
FT                   IGTGSDKRIYTTPYTNNYDFGVAQVNDFGNSQNGDDRPYGAGETWSAFNGKSYWVAAMF
FT                   DNASKKGVVAGAATTKTWKSMQYLAPASTANGPLTGFSVYNAGGKKSGTSVQSDKFFLG
FT                   YFTDYRDGLETFGQAYAVGEPKLNWTGDVPIGFNTWYAYYAYGTADAMLPTTDYFYTHL
FT                   KSLGYNYMNLDCCYKGVPSKTPVQNLKDFADYVHSKGMKAGTYSAPFAIFDPLTDTVPT
FT                   TSYTFGDIALKDASGNPIKSYINTYIVDATHPGGQAYLRWIMQTQHIDPGFDYVKLDFI
FT                   DLGMYEGSFYDSTKNGMEAYRIGMQVMRDTLLAAPQAIYINESIAPLLPSGYAHGRRTG
FT                   VDTTIGLESYPGIERQALNTAASWWTNGTLYSYNDPDMLFPESVIDGFNKVTLNEGTLL
FT                   STAIIMGGGHLLIGDNVPFISEDRMKTLFNSDLLNLVKAGKAARPVSMTNFYHKLEHPP
FT                   TAVYLTAANGDKYVGLSNWDMNNSQNASVAFSDLGLSSSTTYTLTELYSKTKLGTYSGS
FT                   YSRTLKPGESVIVRVSAQSSAWPTATANLASGKAATASSTWSAQAGYEASKVTDGSQAT
FT                   RWSGESGTANNQWIEVDFGSATSVNRVVVNEYAYGSQNFQIDTYALQYWNGSSYVNLTK
FT                   GFTIGDRRVFDFPTVNTSKIRLYINKARFIPSINEIEAYNVSGNTGYVIDQDNSNASYS
FT                   AYSDIRAGIQRMQTFTLTQPSLPRLDVYLYESYVNKVPEDNYYLDIVQLDANNNPVQKL
FT                   FSASLNPNNIPGAATPYAVYPRLTGLDTTKKYGLILRSPQTLDDNSTNNKYGFAYSDSN
FT                   PYAGGLERLSTNGGATWTTENSGNRDLIFTIYK"
FT   sig_peptide     218860..218949
FT                   /locus_tag="Pjdr2_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 30"
FT   gene            222089..222175
FT                   /locus_tag="Pjdr2_R0038"
FT                   /note="tRNA-Leu2"
FT   tRNA            222089..222175
FT                   /locus_tag="Pjdr2_R0038"
FT                   /product="tRNA-Leu"
FT   gene            222179..222253
FT                   /locus_tag="Pjdr2_R0039"
FT                   /note="tRNA-Gly1"
FT   tRNA            222179..222253
FT                   /locus_tag="Pjdr2_R0039"
FT                   /product="tRNA-Gly"
FT   gene            222254..222330
FT                   /locus_tag="Pjdr2_R0040"
FT                   /note="tRNA-Pro1"
FT   tRNA            222254..222330
FT                   /locus_tag="Pjdr2_R0040"
FT                   /product="tRNA-Pro"
FT   gene            222401..224341
FT                   /locus_tag="Pjdr2_0195"
FT   CDS_pept        222401..224341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0195"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: sfu:Sfum_3567 putative PAS/PAC sensor protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98875"
FT                   /db_xref="GOA:C6CSY7"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSY7"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACS98875.1"
FT                   /translation="MQIAEKSNEANPKGFRRNLSNDILSKDRGERGGQVDTRQWMSVLL
FT                   CVATALMLFVAVLSYQRRHMPAARTMICMMVAASFYAIGYAFEILSEDLMNVKLSYQLE
FT                   YLGIPFVSGFWLLIVFQFTGFAARHRKQAALAVFLIPAATYLLYQTNDWHHLVYRQFYP
FT                   NLDGSVPVYNTVKGPWYSVHAVYNYTILLFGILLFIPMYLRAVPIVRKQIVILVVGAAG
FT                   PILFNIAYMFNKEIDFTPLGFALSGLVYAWGIYRFRLLRLTPLAYAKMFDTIRDGVILL
FT                   DYENQIVSRNGAATEVYPELSGMDGASVPARELLGATPALLGRLEETDCLDARFPLERM
FT                   LNGRTRHYICSLTYIYDTGAAPIGKMIMLSDVTELKENEDRLREKSERLTQLNAFKDKL
FT                   FTVMAHDIRDPIALLVSLTELLESEAIEPDLTKNEVLPEIKKQVRETFDLVDNLLDWYR
FT                   SQNGRIAFRPLNWNLQQVVRQALSLSGARAAMKQIRIEERIDEKLAVSADKEMLDLIFR
FT                   NLLANAVKHTGIGGRIEIGAALERDKVTVYVKDNGSGIDEETVMLLRRDELFFKEPGFA
FT                   SGEDGGEMRFGLVLTREFLRMHGGSLWFESRVGEGTTFSFTLPGFASHEESANNADRER
FT                   MAVTINESGIG"
FT   gene            224322..225476
FT                   /locus_tag="Pjdr2_0196"
FT   CDS_pept        224322..225476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0196"
FT                   /product="response regulator receiver and SARP domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: bha:BH2016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98876"
FT                   /db_xref="GOA:C6CSY8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSY8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS98876.1"
FT                   /translation="MKAVLVDDEPVMHLIMRKMLEKYSELTIVGSFSNAKEAEAFLDAN
FT                   EDIDLAFLDISMPGGSGLAIASKLGDKGRKTQVVFVTSHKDFALEAFELSVLDYLVKPV
FT                   TQERLGRTVSRALSSRKPAQLTPASEPSARVNAIPVIITALGDFSVRNDKGRVKWISSK
FT                   SAELFAYLLLNSGKRISRHRLLADIFAGMTGSNAEKYLNTTVYQLRKSLEPIGLREAVR
FT                   SENDGYALELDGAVIDYETFEYRLGELGKLDARNMEEARKAERLYTGDLFGSKSYVWAI
FT                   HETEQLAARYSSFVQEAAQVLLEIGDTAGASKLLLKLRDRNPLDEKPVALLMKKCGMEG
FT                   DKKGLTSHYTDYVKILGKELGIKPSKELLFLYDSLVKEISGQEK"
FT   gene            225667..239589
FT                   /locus_tag="Pjdr2_0197"
FT   CDS_pept        225667..239589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0197"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: lch:Lcho_3430
FT                   filamentous haemagglutinin outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98877"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSY9"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACS98877.1"
FT                   /translation="MGIRKFGSKIKTALAVVLIASQIAGLIQPGLGSSASAAGALPAAL
FT                   PGATATDISGHWAEEELAEWQRLGLINGFPDGTLRPDQVITRIEFVALANRLLAYKGVG
FT                   NTAFSDVPGNAWYSSEVQAAVQAGYINGFPDGTFRPVQPLSRVEAAVMLAKIVPVVERD
FT                   GVHSLDAYKDHGSIPGYGQASFEALIEHGYIQGFSDRTVRPAQQMTRAEAVIMLNRIRQ
FT                   QSSVGESGGIVPAALNLSEAGTYGPEAGTFTVAGDLVVDVPGVTLRNLAVKGNLTIGEG
FT                   VGEGEAFLDHVKVSGSTFIRGGGVNSVHLDDSELGTVVIEKKDGKVRVVVSGTTVVEQM
FT                   DVKSNASVESNGGIGGITITAAGEVLLSGKFTKVELAGEVSVIVSSGTVKSLMVSKEGG
FT                   SSTITLNAGVQVENMELHGTASVKGKGGIAKALVDAPDVLFETAPRMIETTDRAGGSGG
FT                   GGVPIGGGGETPSTISVTAEATDATASGFRLLLNPAVPGLTASGIGVTDSSGAKAAIAS
FT                   AVTLTGGSTFRVAAGLREGETYTVRLTLTGYSFGDDIKFTVPESTPELVTASVSGISAS
FT                   GFTVSLSGAVPGMTADNFSLTKSGTGGPVDVAEAQTADGGLTYAVSALLEEGATYSLSL
FT                   RQLGYSFGDPATVFVPVTDSGTIPVEASVGAIAASGFTVSFGAPVADMTADNFSLTKEG
FT                   GEAIAISDAVTSDEGRTYAVSAELEAGYVYTLVIGKQGYSFGAAQTFSLQGEEKVVVSA
FT                   TVSNASVSGFLLTMDKAVSNLDALNLNLVDQDNQAVSIDMLSAVVVGKQYEVWASLAKN
FT                   KAYSLSLNKEGYAFNQPAEVEVEPVEIPTTVGLVTHGGFKLTFASPVYGLTPDQFSLTD
FT                   PSGTPVAVGSFQLAANAKSAMITADLSKAGIYAYRFETDEAKYDEGTIHVPEAIAIGKY
FT                   TTFEGYSGGYTGLVVHFEQPVPHLTVDAFAVTSLAGTKILLDSIATEDEGRTYKLATSG
FT                   LNSGGPFKLAIAAGGYDFGEPATLINPTLNVWGAGHLPTQFMAGLNPNVSGLTADNFSA
FT                   QDSAGNDVPILDAKYDTTYRMYIVSFGGSGGNDYTVSVHADGYDFGAPKKIHVYSQSDV
FT                   SNVTTSGFTLALVPSVLINTTYGFHLTKTSGEPVTIQSVRTEDQGGTYEIKADLSPGDY
FT                   FLHVDADLDSNGFYISVPAVATLSVDQISNGGLTAKLNYQVDNLNASSFSLTNIDTGEQ
FT                   VGIASAVTDDQGGSYRLIANLPAGHYNLKLNGHLPEEGVGFQVGDTINAGAATVSNVSA
FT                   TGFDLTFENGVAGLLPANLDLRDEQTNKISGIKLTTNDNGLSYRVSATLAANTNYTLSL
FT                   QKDYVVFDSAIAFRVKPVVKGTVTDVKNNGRLILRFSPAFPEVENYLGLSITDPDGQVI
FT                   MPNYFESSDSGASYEIRVPNNGLKPGVTYTIRLNHDSYAMEPVSFTLPGLLSVTEAASS
FT                   GLKVSFETPAAGLTKANFIVKSSSGETYTMSSVATNDGGLTYTIAGKLTEGKTYTLQYK
FT                   PNDLKMSVDPVPFAVTKTVTATLSAISAGGMKVTFSSKVPDLQLLQLRIAKGGVEYPTD
FT                   YYWLKTTDGGFSYQVTFNGLYPGNDYTLNLAREEYKLASPISFTIPSDRTLKLYSTTET
FT                   QIIIDAGVTGLTADQFELFDSKGQKVAITVTQNDSSTAFYVLTGAFDINQTYTLKVTHP
FT                   EYTFAPLAVGFKIEVSAFVFASQNGFKLLLWPGVEGLEPSDFTVTDDQGGTAAVTSLQT
FT                   ADSGWTYYAKVPLASGKNYKVAIADKGPYRFKFASNQSISLNTNGVSVDELTLKGFRLI
FT                   FDKPVYLYAGDIGLVDESGQEVNIRSFYSSDGGLSFYLDAALEAGKNYTLRFNKIGYDF
FT                   GGGIPLSVRSVKTTFEGMESGNNNAFTLSFDQAVPDLKPSDFTIRRYGQKAPIPVLNAT
FT                   TEDGGLTYRIESSFWGSETVTVLPSRNGYDFGGAVQILVPTIVRPIVLRTGANYVDIGV
FT                   NPSVPGLQTKDFVVKNGDGQTLALTSASSYDGGQSYRLTGSFIGGGTYTIALNHAGYDF
FT                   GREKLTAKLAKAVTIEAAEIGESGITILLNPGIAGLAAGNFSLRDNSHQAIPIQGVEEF
FT                   NDGKAYRIRAELTPGLTYSVTASATGFEFGMSASAKVPIPVTVAYEEVSTDGLTVNFGN
FT                   MAIPLSQSSFKLIDERGKNIPVDSAVPIDDGSDYVLKADLPYGHTYSLSIAADGYDFGA
FT                   GQAFYMKEPVTVTARNAMQTGFTLSFDHAVNQLTAANLSLKDGSHGNPVVIQSLTTSDN
FT                   GLTYKANVGLTVGETYTLALSSSTVDFGSPFEIKPQTMITVALSGIGTTGFDAAFSEPV
FT                   PNLQSMETSLVSGDGTVNPVRWVAQSNSNNTRYQAQAALAYGVEYTLTIEGTDRAFEVP
FT                   VKFVMPIEATSKVTGVSDSGISIETSRTDIQLAPSDIELSTSDGDAVRVSAVVPGEKAG
FT                   TFTIRAALAQGKTYSLRINKYTYHFGAAANVYIPYQVSAKIVSMNEGGLTISLSKPVAG
FT                   LDVKLISSANGSDYAGKVTAVDEGLTYVIEAALSYNKAFTLKLSKPGYEFGGDLAVNNA
FT                   SSPPRVATAVTSVDGKSITLTFDKQLSSTEWRSVFSVKINSQWQSNILSVLGTDKRQIV
FT                   LTWDGKVIDANSTVTVASSSVNRVYGVNLTYMAPFEEIAVTNVTTMMGMIQSYAYREDL
FT                   EYPASYPAQVLHGQYGLTSSEAARKLMEGGFKSVVLYRAVIKEYRLEGVQVAELLHSMN
FT                   ADASTVYDVYRTVYPYGFDGATAVAEWSAAGYSALEYGPVLQRMGLSSRNAALALKKAG
FT                   TTANDAAQILGSVFNETSGASAALMKTAAYKPSEIAAGIKSAYALDVPHTVQAMAEGGL
FT                   AVNDIAAVAQSLYGEDAVTNAKLLSGAGFSASAVGAALAQLYSYENDSQALDVFLGAGF
FT                   SATDSYAILRNEYPREAIVSGLLERGYPAKEVGGAVHSAADGAGVMISVMKSRGSTDTE
FT                   ITQLVKDVWLSSGAALSSILAEFAGNGYTYEQRAALLRQQFDADVATAAGAMDASLNNG
FT                   TRGNIYKYMLAGGYDPSELMFYFMSSGVNHFEVYRQFRLAGVSTVDALQSVYDAKLRSN
FT                   AAFGLKDAMEVVLSYYSRPASAAEAISALKTVFAQDGSVTLDAVTLAAASSNYWNKVDI
FT                   AKALKDQLGLTLKDFMDLEGSGGFSKFGCPCSAVTAVRDSLYLFPGLTIQDITAAMSMS
FT                   SAYSLRDVVDANFELNNSQYGRDKNAASPYVLSALKNSGYAFEDIAAEFDRLGLNNWIA
FT                   AFSRNGIAASDVAAYLKSIAVTAPDAVVRLAPYPLKDRALVLREVYGLGSADAIATLVA
FT                   KANEDNEDIGRAVAWAYGGNAIQLWVQTLRQQGGTATSIMNTILARYPGYRDAGTIGPI
FT                   LINAGFSQDEVMEAMITIAYRYYGVIQLKDTIRVLQSLYSQQQVSIGQLLKSASLTTPE
FT                   SGIEFLSYAGYKLPDIAGSLKTYYGLTAGEASALLVKKYPNDKKEIIALLAKLYGQNVS
FT                   ATMAEMLESAGITAADGALDYLRYEGFGIQELAALFKDRFDWTVGQTAWAFSQRNMGGT
FT                   KNVLITAVAAAYELPAEKVIYELLLASGTNTYAGAVSFIYQAPFSLATSVKVAKDGYGI
FT                   SSGEALNALLGTSYYSKSDVVAAVADGYGTPQRTSIVDSLKSKGFDTLASAVTFLGQMG
FT                   FGLNDIARVGKDYYQLTAGDTAAALNGFYNSDDIQIAVASVYGQTMTQTMLDTLTAMGK
FT                   PNYSDGILEMLKLQYALPDIVLAGRDYYSLSAGDATYALLESKKFTTANVLATVAEYYG
FT                   KPITESIEDLLGKSGITGIGDAALLLRSMGYSLQDVAGISMTYYGNSSQATIDALAALG
FT                   SENKEIIEWTVRNVYGEASGGASGSLTPAEALEKAGITEGAAAIDYLWNAGYTVLEITR
FT                   FLKEFHGKPAAEAAGMLLANPLLDQTAVLYGMNGVYGSAYDKAMIDEFKNAGVFDTAET
FT                   AARMLGNSGYRMSYIAETMKESYGKTYAETHEILTGLGLYTASAIEKTIAQVYDSVSTS
FT                   SGTLKQLLDLYRITTKESAITFMKEQGVKVLDIVQYLKDVYDLDADETMELLVPYYPGS
FT                   DLGLAVIEVYYSDNSIYYVTQVISGDGDTPSTVVNAMKGKFTNAQLALALKVMFRLDAL
FT                   GVTDAMTSGGIAVEAVRSAVTNVFGADPLFAYLKRMKDNGKTAYDIAVELNQRGLLEAN
FT                   PAVYLVDLLQQLGYDNGTILQVRYLYYNTGRFNEGTESEQGAQLAQLGVTSPKDIILAL
FT                   KKWTMPTYKVYNIVRAANPNAKAEEIALAMKDYGYWNAVDIVTGVGALGEKTSSLAAKF
FT                   MRLGLNAQQAIRYANDLTYGHMVRNMIANGYPITDYFQYLSISGSSSAGDAIAAFREGG
FT                   YSASDLAKLMSGYKNMDYYWIARYLYDGGFTSISEVGKALLAANCHPRWLIYYMDEVAD
FT                   WTIEGIAKELHDSGVLSLVELVDPIQYANGNRWDNTYSILRGISQKERTAYYDALDSVS
FT                   RKLLSDNDIAMIVMASTLRYANVSLTNVAEQLLYTEHERDLLTAIKIMVYAGFNLGDVL
FT                   STMWDVYRDIIGVTILKAMVAKTASSFITDFKQYYDMATRLYRIVNLTVKMT"
FT   sig_peptide     225667..225780
FT                   /locus_tag="Pjdr2_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.727 at
FT                   residue 38"
FT   gene            239767..241545
FT                   /locus_tag="Pjdr2_0198"
FT   CDS_pept        239767..241545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0198"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98878"
FT                   /db_xref="GOA:C6CSZ0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSZ0"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACS98878.1"
FT                   /translation="MFKSPGTAYKKPGILSMLRNRFLFSSLRKRIMVLLTIGFVGCAIL
FT                   MASVSYNAIYTMQHDKIKTSMAFDLYQQTTKQNQMYNNLLQVTQQMTPEGTVGHLMETY
FT                   VSTADIYSQRLLSRDISYNIGLITFSNPAMQLVMYYNEANGQAALTNLPVRADFKLESL
FT                   PDVAGMGELRYQSPHKSLCRFSDDLVVSVTREVTFSDGTKLVVYVEAKTDIPTDMSSVT
FT                   ESLKMPYSLVFTDPEGYVTYSSNEAAFKAGQHLELKGQSGTTDEYVWNRMTGDYGYDIT
FT                   MLLPVSYYNHELYTWKNHMYWILAIALLMMFMLTLVLRRLINRPFRLIEKEMRTFGKGY
FT                   MGTTQYHTGIDEFDRIFDQFNIMKRQIQKLIIDVEQKEKRRHQLEIEKLAYQINPHFLM
FT                   NTLNSVRWLAVMHKQEEIEKFISSLIILLNYNLGKSEEKATFRSEIQVMRTYLELQQMR
FT                   HDFEVKLDIAEGTYLDSPVARFILQPIVENAVCHGLDDNGMLEISVVPDEAAQMVRITI
FT                   RDDGKGLSQETLALLQRDTPDQQQTGWGIGLRYVRSMLESSYGHKARMGIDSTPNQGTT
FT                   VTLTLPFLEQRKERAM"
FT   sig_peptide     239767..239925
FT                   /locus_tag="Pjdr2_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.648 at
FT                   residue 53"
FT   gene            241542..242627
FT                   /locus_tag="Pjdr2_0199"
FT   CDS_pept        241542..242627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0199"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   response regulator receiver; KEGG: rru:Rru_A0919 two
FT                   component AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98879"
FT                   /db_xref="GOA:C6CSZ1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSZ1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS98879.1"
FT                   /translation="MIRVLIVDDDKLARKGFISIMPWSNHDMVVVGEAANGAKALEFME
FT                   QHEVDLMFVDLSMPVMSGMELLQVTRQRFPGLRSVILSFHEEFENVQTAYRMGVLDYIS
FT                   KVRLESEDDEQILKRIQLQMTGAATQQPSGQPPSALNPAHAPEQDVRTQEEEGWSGLER
FT                   EWRANYWLYNESVFQRLCKQTAQAKVSFRRLEGLFMRVLSQLETDLGLQAELGSDAADV
FT                   RSAVEWMRDFRKRVYAQVAATTDFTNTTTSILKAVLFIREQASGTLHAEGVADHVHMSR
FT                   SYFSQCFKRLTGSTFNDYLKQERIRSAERLLCETNQSIAWVAHAVGYNDSKYFSQLFYE
FT                   QTRLLPSEFRAQFIGGKIDYN"
FT   gene            242755..244491
FT                   /locus_tag="Pjdr2_0200"
FT   CDS_pept        242755..244491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0200"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH1064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98880"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSZ2"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS98880.1"
FT                   /translation="MKRNMALMLSAALLGVSLTACSSSNDSSNNNVKASSSPEASSNAT
FT                   SSESPALSGDDLAFSKFPKPVDVHIGMVVDPTDKTLPEGDSVSNNQYTRYLKDKYNINV
FT                   IVDWTAATGNDFKQKVSLTIASGKLPDGMVVDDRSFMTKAASSGLLYDIGDLFDQYASK
FT                   QVKDIMASTEGRAMENASYKGKMVSLPNITVDTDGVHVMWIRKDWLDKLSLPVPKTTAD
FT                   LEKTAKAFMDNKLGGDKTIGIAGPSKNSFPYSTFLVSSNNMAGFDPIFGAMDAYPGYWL
FT                   DNGDGTVSYGTTSENTKKTLALLADWYKKGLIDPEVGTRDNTGDPINANQTGIFFGPWW
FT                   AGGYGNGDSFKNDPTANWQAYPVYSDDGKWNTHMKTTGSTYTVISKNAKPDVVKAILIM
FT                   NNALVRDEATFDLSVAVGWYPLRNVMAAANETEYEYTELMKVLKGETEPESYNVPNSLY
FT                   KLMYADAKKVRDVVKPPYDELGVTNYSTANFGDFQRLYSLLIGDRPFATTPIDKKVYSV
FT                   TYNQTPTMETKWANLKKMEDETVLKIILGQASLDSFDKFVKDWKAQGGDEITAEVAELL
FT                   KK"
FT   sig_peptide     242755..242823
FT                   /locus_tag="Pjdr2_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.664 at
FT                   residue 23"
FT   gene            244579..245469
FT                   /locus_tag="Pjdr2_0201"
FT   CDS_pept        244579..245469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0201"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH1065 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98881"
FT                   /db_xref="GOA:C6CSZ3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSZ3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS98881.1"
FT                   /translation="MRKLGHQKHYYLMLLPGMVWLVMFSIVPMFGILMAFQNYNPGSGL
FT                   FKSEWVGLENFKYMFQLNDSKTVIRNTLIIAVGKIVLNLIVPLVFAILLNELRNLRYKK
FT                   LVQTVVYLPHFLSWVIMSTIVIGIFGYYGVVNTVFGYFGADPKLFMADAGIFRQLIVGT
FT                   DVWKEFGYNAIIYLAALTGVNPNLYEAAAIDGANRWQLIRHVTLPALITTVVLLGVLSL
FT                   GNVLNANFDQVYNLYNPLVYSTGDVLDTWVYRLGLQNLQFSLATAAGLFKSVISFVLIY
FT                   ISYRLAYRYADYTIF"
FT   sig_peptide     244579..244686
FT                   /locus_tag="Pjdr2_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.816) with cleavage site probability 0.751 at
FT                   residue 36"
FT   gene            245485..246372
FT                   /locus_tag="Pjdr2_0202"
FT   CDS_pept        245485..246372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0202"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH1066 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98882"
FT                   /db_xref="GOA:C6CSZ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSZ4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS98882.1"
FT                   /translation="MVRNTTLGSRAFDIANIILLGLLVISCVYPLWYTFCVSISEKSAA
FT                   NAGLVTIYPIGFSLTPYKEIINDSMFFNAFWISIQRTVLGTSFALLMTVLMAYPLARPQ
FT                   KDFKTRNIFMWILVFCMLFSGGLIPWYLTIQNYHLIDSIWALVLGGGVPVFDVILIMNF
FT                   FRNLPKELNEAAVVDGAGPWSVLFRVYVPCSIPVLAAVALFISVYHWNEFFNGLVLSNT
FT                   QSSYPLQTYIQQLVVNIPVGTNLTPEQYKKLSELSNRTLNSAKVFIAMVPMLVVYPFLQ
FT                   KYFVSGIMLGAVKE"
FT   gene            complement(246409..246918)
FT                   /locus_tag="Pjdr2_0203"
FT   CDS_pept        complement(246409..246918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0203"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98883"
FT                   /db_xref="GOA:C6CSS8"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98883.1"
FT                   /translation="MMESIVYDQQFNSNELYVISLMTVGFTFYRLLPRTPSPLQTCFNM
FT                   LISVTLGLMFDHTIAIPPFDFYDVGDRSSYEFFDFISYLMYAPFGYLYIYGFERFRISG
FT                   IITIGYILVWAAIAILFEWLGVKFGVFHYKHGYCILYSIPIYLVVLSIQLWACRAAFSN
FT                   HRRQKN"
FT   gene            complement(246915..247388)
FT                   /locus_tag="Pjdr2_0204"
FT   CDS_pept        complement(246915..247388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0204"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98884"
FT                   /db_xref="GOA:C6CSX3"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSX3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98884.1"
FT                   /translation="MVIVIFILYAWFCIQVLMNLRLKLPLAANLLLFMAIEVVLTNKLT
FT                   ISSLNMKLFQINQNIPHFIALILHNDLTITFILLAFANVFLMSPKISVRIGITVYAFVI
FT                   QLLLGMELRWNQVLIYREWNYLNESLMILLVMVYTLLCGKVFQWMASKEGWIR"
FT   gene            247498..249246
FT                   /locus_tag="Pjdr2_0205"
FT   CDS_pept        247498..249246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0205"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: periplasmic binding protein; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: bsu:BSU01640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98885"
FT                   /db_xref="GOA:C6CRT3"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRT3"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACS98885.1"
FT                   /translation="MLTVNHIYKGMWFLLLDLYYYATSRVSAYEGLGNYEGERVMEQFD
FT                   LMNTIIEIGEVTYLFESEDWRLEPQEITKPTFLFFEKIQGTFILNGVPIQLNRKSSFML
FT                   EPGMTIEAQSVGGQEVKLYRITFELFQLSEKSASHRMYELASFPVTGSIQQDQYQIQKL
FT                   VFVIAEETTEGKRDASSGRSDSKRAELQMYELLELLLGSTPAVSPGGDKRAIQKTIPYM
FT                   HRAYDSDITLEMLADMAGMHPSYYSQMFKQELNMSPITFLTRIRMNRAKEELLLTGRKM
FT                   GEIASRVGYKDSFYFSRRFKEYTGCAPTMYKEWPKPSIISLSYAYTDHLLTLGITPVAA
FT                   QVYKEIPNTTRTLALPFHGSDVWQVSRQTFLEAKPDLVIGKDNVTSKARELIGDLAPIV
FT                   TIPWGTLPVFEHLRKIGETVNRAEAADAWLAQHERRVLDARRHVKAAIGNATVTICVVG
FT                   DYGIRIYGNRNIGHVFYESLELSMPPRLKQDMEEHAGAKLFNWKAISADQLMEYDSDYL
FT                   LVVLRSGVMARENWRQLATHSGYLQHKAVRRNRVHFLDWDRWVVYAPMSIDNQLDEAVE
FT                   RLTGMH"
FT   gene            249458..250393
FT                   /locus_tag="Pjdr2_0206"
FT   CDS_pept        249458..250393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0206"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bar:GBAA3534 iron compound ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98886"
FT                   /db_xref="GOA:C6CRT4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRT4"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACS98886.1"
FT                   /translation="MFLAISYGAKELTLSTIWTAVFHYDADLTAHQVIHELRLPRVIGA
FT                   AVVGAAFAVAGALMQGVTRNPLADTGILGVNAGATCVVALCFAFLPNMPYLGLIGCSFL
FT                   GALLCTLFIFGMGIRLPGGLTPLRLTIAGSVVAAMLGAISTGIAIYYDLSQDLAFWFSG
FT                   GVSGVKWLHLKLLVPIILSTLILSFALSRNISLLALGEEVGVNLGGRIKQTRILAITAC
FT                   VILAGVSVSAAGSVSFVGLIIPHISRKLVGVDYRAIIPLSAILGATLLVMADLAARMVN
FT                   PPREFALSAMVALLGVPYFLYVARKEKRNL"
FT   gene            250393..251421
FT                   /locus_tag="Pjdr2_0207"
FT   CDS_pept        250393..251421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0207"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bar:GBAA3533 iron compound ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98887"
FT                   /db_xref="GOA:C6CRT5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRT5"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACS98887.1"
FT                   /translation="MGLKTWRFGNKRAGRALFAGMVLMTICVVVLLFSLNTGTIKLSPM
FT                   QVLRTLLGLGTAKEETVLFDYRMPRILITMLAGIGLGISGSILQGIFRNPLADPGVVGL
FT                   NAGSAVGLVIFVSFFQSLEAMSALLIPLFTFSGALLTAILIGLLSYERNQSLQPARVIL
FT                   VGIAVAAGLSALTLFLSLRLDSETYTFAARWLVGNVWSRSWVHVIALLPWIVGFGIYAQ
FT                   LQARSLNALALGDETVISIGLSLQRKRIGLLIAAVSISSASVAMAGGIGFIGFVAPHLA
FT                   RRLVGVSHQYVIPISGMLGLVILVLADTAGRTLFLPSQIPAGVLVAAIGAPYFLYLLLR
FT                   KS"
FT   sig_peptide     250393..250506
FT                   /locus_tag="Pjdr2_0207"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.736) with cleavage site probability 0.287 at
FT                   residue 38"
FT   gene            251459..252415
FT                   /locus_tag="Pjdr2_0208"
FT   CDS_pept        251459..252415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0208"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bar:GBAA3531 iron compound ABC transporter, iron
FT                   compound-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98888"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRT6"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACS98888.1"
FT                   /translation="MMRKKKSTIMLLLMALVIVLSACGQNNNKTSGNNGAASPAAEQSG
FT                   GSGAAATDAVPKIASLSIHVTNDLLALDITAAGSVMGGKAKDFLSHVADRLKNTEKLGV
FT                   AKEVDMEALLQLEPDIIYADEEFAGQDTSKLEAIAPVKMFNLDEGTWRDHLKKLAADLG
FT                   REQKAEQFIADYEEQVKRVKSLIQAKLGDNPKAMAIRVTPKELRVFGTPRPLGPILFDD
FT                   LGFQPASGVEKINSSPYEVISQEVLPDFDADVIFVVVNEEADAKKVYDEMQSSPIWKGL
FT                   KAVKNGNVYVIGEQPWLDYSAIGNKMALDEAEAFFAK"
FT   sig_peptide     251459..251533
FT                   /locus_tag="Pjdr2_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.924 at
FT                   residue 25"
FT   gene            complement(252492..253685)
FT                   /locus_tag="Pjdr2_0209"
FT   CDS_pept        complement(252492..253685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0209"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bsu:BSU05310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98889"
FT                   /db_xref="GOA:C6CRT7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRT7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS98889.1"
FT                   /translation="MTASNEQMLEKNIPAWLTILLATACGMIAANLYYAQPLVGLISSS
FT                   IGLSAGSAGLIVTLTQIGYVVGLLFIVPMGDIVENRKLVITALLLTAVALITASLAKQS
FT                   FLFLTATLVIGLGSVAAQVLVPFASYLASDASRGRVVGNVMSGLLLGIMLARPISSLVA
FT                   DFFGWHAIFAISAVAIVILAIVLAKVLPVRKPTAATSYTALLGSMWRLLRTTPILRRRA
FT                   LYHATLFAAFSLFWTTVPQLLAGPKFHFSQTAIALYALVGVAGAVAAPLAGRLADRGWT
FT                   RPATAIALITVIVSVLLPLLIQTSSPVGVVVLVIAAILLDAGVSANLVLSQRSIFSLGA
FT                   DIRSRLNGLFMAIFFFGGAIGSAAGGWAYAAGGWSSALWLGIAFPTLALLYFATERK"
FT   sig_peptide     complement(253578..253685)
FT                   /locus_tag="Pjdr2_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.724) with cleavage site probability 0.672 at
FT                   residue 36"
FT   gene            253876..254463
FT                   /locus_tag="Pjdr2_0210"
FT   CDS_pept        253876..254463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0210"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bar:GBAA3303
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98890"
FT                   /db_xref="GOA:C6CRT9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRT9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS98890.1"
FT                   /translation="MEAKRGRPRNVETQNAILTASYDLLLESGFEMVTVEKIAERAKVS
FT                   KATIYKWWPNKAAVVMDGFLFAASARLPVPDTGAVFSDVLIHASNVVRFLTSPEGRVIR
FT                   ELVGQGQFDEGLAEAYRTRYFGPRRIEAGSLLERGIQRGELKKDLDIGLAIDLIYGPFF
FT                   YRLLITGEELTEAYVRQLVTAAFDGIRANEGG"
FT   gene            complement(254551..255429)
FT                   /locus_tag="Pjdr2_0211"
FT   CDS_pept        complement(254551..255429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0211"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /note="TIGRFAM: N-carbamoylputrescine amidase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: pst:PSPTO_5394 carbon-nitrogen
FT                   hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98891"
FT                   /db_xref="GOA:C6CRU0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRU0"
FT                   /inference="protein motif:TFAM:TIGR03381"
FT                   /protein_id="ACS98891.1"
FT                   /translation="MRTVKVAATQMSCTSNIEENIRKAEALVREAAAQGAQIILLQELF
FT                   ETPYFCQKEKADYYVYATELEENKAVNHFRGIAKELGVVLPISFYEKKNWARYNSLAVI
FT                   DADGEVLGKYRKSHIPDGPGYEEKFYFNPGDTGFKVWKTKYAKIGVGVCWDQWYPEAAR
FT                   SMALMGAELLFYPTAIGSEPQDGSIDSKDHWQMCMRGHAACNLMPVIASNRIGEEIDED
FT                   SSINFYGSSFIAGPQGNMIAEAGRDEHGVLVAEFDLDQLESQRIEWGIFRDRRPDLYGV
FT                   IASYDGEIPIK"
FT   gene            complement(255499..256533)
FT                   /locus_tag="Pjdr2_0212"
FT   CDS_pept        complement(255499..256533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0212"
FT                   /product="Agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="PFAM: Porphyromonas-type peptidyl-arginine
FT                   deiminase; KEGG: rce:RC1_1456 agmatine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98892"
FT                   /db_xref="GOA:C6CRU1"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRU1"
FT                   /inference="protein motif:PRIAM:3.5.3.12"
FT                   /protein_id="ACS98892.1"
FT                   /translation="MNPKQLNYTMPAEWAAHERTFISWPVQASMVYPEHYEQVSAGYAE
FT                   LVTAIAEFEPITVVVNPADLEKVSALFAGNDAVECLPVEHNDAWLRDNGPTFVVNPEGE
FT                   LAGVNWKFNAWGGKYSPWDLDDAVAPQILKHVGVKQFDAPLVMEGGSIHTDGEGTLLTT
FT                   EECLLNTNRNPELSREQIEGYVKEFVNVDTIVWLKRGLSGDETDGHVDNIACFAAPGKV
FT                   ILQVCNDPSDENYAITEENRRILSEAVDAKGRKLEIIEIDQPPYAEYEDTRLTLSYLNF
FT                   YFVNGGIILPVFGGAAEEADRKAIETLQAAFADRRIRPIDGMAVIREGGNVHCTTQQMP
FT                   ARRA"
FT   gene            complement(256656..257270)
FT                   /locus_tag="Pjdr2_0213"
FT   CDS_pept        complement(256656..257270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0213"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: bar:GBAA4814 TetR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98893"
FT                   /db_xref="GOA:C6CRU2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039532"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98893.1"
FT                   /translation="MTVKHPDRRVRKTKEVLKSSFLTLLQEKSVNHISITELVQLADCT
FT                   RATFYTHYEQKEDLLDEMIEEKFEEMTAAYRKPYVGLSVVDFNELPSASIELFDHFIEN
FT                   RIFYKTMLDPQTGYNYREKLTKRMDRLFRQEFDFMVTEPDTPIDTKLFSTYRIHGIIGL
FT                   ILEWIDSGFEQSTAYMNEQLIQILKFNTPQIFIRQQNGKSR"
FT   gene            257420..258184
FT                   /locus_tag="Pjdr2_0214"
FT   CDS_pept        257420..258184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0214"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bpt:Bpet1512 glucose 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98894"
FT                   /db_xref="GOA:C6CRU3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRU3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS98894.1"
FT                   /translation="MARLQGKVAIVTGAGSGMGRATAILYAKEGARVVLAEFNEASMNE
FT                   TLDQIKAAGGTAVAVKTDVSKEADVDAMIQKALDEYGQLDVLANVAGIFDAMASVENTS
FT                   NELYERVMGVNLTGQFYACRSAIKVFNKQETGGTIVNVASIAGYLGARGGAAYTMSKHA
FT                   VIGLTKNIAAFYGRENGKIRANVIAPGSIATGMTANLGALDPLGAVTFGDLGPFNGGEA
FT                   DDIASTALFLASDESKFINGDVITVDGAWTSR"
FT   gene            complement(258247..259020)
FT                   /locus_tag="Pjdr2_0215"
FT   CDS_pept        complement(258247..259020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0215"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: baa:BA_0894 haloacid dehalogenase-like
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98895"
FT                   /db_xref="GOA:C6CRU4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRU4"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACS98895.1"
FT                   /translation="MSGFPVKGVLFDKDGTLIQFHSFWVPIAEEFTDHLLSSMDANEPT
FT                   SGLRETLLESIGLGPDGKVDSKGYLAGGTTADIAEAYFKVLTGYDYGPEQTAGLLEWMT
FT                   DEIYRLTQVHREQLLPTADLENVLPRLRDKGLKLGIATADDYESTLFFLNKYGIAHYFD
FT                   FIGTSDRYEKKPSPVMMNEFCGLTGLQPSEVAIVGDTLTDMRFAQNSEAGLAIGVLSGT
FT                   SQREELAPYAGLILPSVGELIDEQDQLAWQATRQE"
FT   gene            259210..260571
FT                   /locus_tag="Pjdr2_0216"
FT   CDS_pept        259210..260571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0216"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   vha:VIBHAR_04875 4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98896"
FT                   /db_xref="GOA:C6CRU5"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRU5"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACS98896.1"
FT                   /translation="MYMNNVKAFMRTEGDINLSSERKNWQANHLSEEAMDILDEDSHFF
FT                   VHQSMSTPCLNVLVNAEGIYLEDLDGRKYMDFHGNGVHQVGYKNRYVIDAVKNQLEELP
FT                   FLPRRFTNPVAVKLAKKLAELAPGDLNKVLFTPGGTSAIGMALKLARKATGKFKTISTW
FT                   DSFHGAGLDAISVGGEGVFRNSIGPLLPGTEHMMPYNSYRCFMGDCDSCGLKCLDYLEY
FT                   MLEREGDVGAIVMEPIRSTDVQIPPKAYFKRLRELCDKYGVLLILDEIPTAFGRTGTMF
FT                   VHEHYDIVPDIVAIGKGFGGGIFPMAGILVREGLDAAQDISLGHYTHEKSSVGCAAALA
FT                   TIEYIEQNGLLEHALRMEKVFERHLAEMKSKHLAVGDVRVKGMLAAIELVRDRKTKERA
FT                   SEEAEKVMYRCMERGVSFKVSGGNVLTLVPPLITTEEQLARALNIIDEAIEDIC"
FT   gene            260662..261438
FT                   /locus_tag="Pjdr2_0217"
FT   CDS_pept        260662..261438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0217"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; SMART: regulatory protein DeoR; KEGG:
FT                   baa:BA_1868 bacterial regulatory proteins, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98897"
FT                   /db_xref="GOA:C6CRU6"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRU6"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACS98897.1"
FT                   /translation="MSLAGEERRNRILEMLGIKGKVNVNELARQFEVTTETIRRDLDDL
FT                   EKSGKLKKVYGGAVKLKTEIEPAYSEREIIYAEEKQAIGMLAAGLVEDNDVLVIDEGST
FT                   AMQIIPHLTDKRNLTILVCSIPTLTLLLEYQRNGLIDGRTIFIGGEVNPKHLRVSGPIA
FT                   EKMMEDFYVNKAFVSVDGVSLENGLTGFDYERALFTRKLMLCSQTKVVVADSSKIGKRT
FT                   VARIADLSDVDYVVSNSEPPTGWNGILQDKGVTWLS"
FT   gene            complement(261499..261894)
FT                   /locus_tag="Pjdr2_0218"
FT   CDS_pept        complement(261499..261894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0218"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: abb:ABBFA_002712 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98898"
FT                   /db_xref="GOA:C6CRU7"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRU7"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS98898.1"
FT                   /translation="MGRVVHFEVHVDDMERAKKFYGEVFGWTFEDWSEYAGMPYLGATT
FT                   GDANAMGINGALIKRMGPPPQPGQPVSGFACTMGVEDYDATEAKILSLGGQVALPKYAL
FT                   PGMAWQGYYIDTEGNVIGIHQPDENAK"
FT   gene            262020..262661
FT                   /locus_tag="Pjdr2_0219"
FT   CDS_pept        262020..262661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0219"
FT                   /product="Peptide-methionine (S)-S-oxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="PFAM: Methionine sulfoxide reductase A; KEGG:
FT                   similar to AGAP012394-PA"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98899"
FT                   /db_xref="GOA:C6CRU8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRU8"
FT                   /inference="protein motif:PRIAM:1.8.4.11"
FT                   /protein_id="ACS98899.1"
FT                   /translation="MSDTAENNLCIITLGMGCYWSPEALFGAVPGVIRTRVGFAGGTTA
FT                   EPTYRSMGDHTETVELLFDPALVSYDELLELFWNNHNPYNINGYKDRQYQSLLLYRDEE
FT                   QAEAFRRIKSRMERDKGPLDTELAPFKAFYPAESRHQKYYLKRFPDAVEKLMSLYSSAE
FT                   GLERSTLAARLNGVAKGFLNLERLQHEMKGWPIAEDELKEKLSLIRQIRW"
FT   gene            262886..266128
FT                   /locus_tag="Pjdr2_0220"
FT   CDS_pept        262886..266128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0220"
FT                   /product="glycoside hydrolase family 76"
FT                   /note="PFAM: glycoside hydrolase family 76; Carbohydrate
FT                   binding family 6; Fibronectin type III domain protein;
FT                   SMART: cellulose binding type IV; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98900"
FT                   /db_xref="GOA:C6CRU9"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRU9"
FT                   /inference="protein motif:PFAM:PF03663"
FT                   /protein_id="ACS98900.1"
FT                   /translation="MTGKTRRRSKLIVLPIALALSVSPLIPNGTPRAHAFEAADAKAAI
FT                   EAYNNAFWDASAKYFWKTSKHDGYQDFWVEAELWELVMDAYQEATDPELKAKLRNQIDD
FT                   VFDGAVVKYGQDWTNNTFNDDIMWWAMASARAYQITNDAKYLERAEYYFNYVYDTQWDD
FT                   EFAGGGIWWKSDDRTTKNACINFPAAEAAVFLYNATGNAHYLDAASKIYRWSKTMLTDG
FT                   NGKVFDRIETQKGPVPDATHYNQGTFIGSAVGLYQITGDKVYLDDALKGAAFTKERLVD
FT                   ANGLLRYEGPNGDLKGGKTILMRNLGYLQKVVNASSESKYKTFAESYNEWLAFNTDMAW
FT                   NNRNAANLVDSNWAGQQLSGTFESWSSAAAVQALTSLEPQDAEQLEYAVKNPYNKVEAE
FT                   SFNIVNGPGMEGSIEGSMQLGGIQDGYYAAYKNVDFGSGQGASGFIARASSGTGGGQIE
FT                   VRLDALDGPKVGTLNVEGTGGWNNFIDAVTVLKDEQGNTSNVTGKHDVYLVFKKTNDSY
FT                   LFNLNWFKFTKTDPTRTDAYAKLQAENFASSDGLSVNSSGQFADGIHNNAYASYKDIDF
FT                   GSGAAGVTLHVASGNKGGSIEVKLDSLDGPTAGVIEVPAMGSWNNWVDVTSIIDDSLAV
FT                   GVHDVYLIFHGADGSDYPCNLDWFTFSQIKGTSRDAYGKLEAENFTNSVNVGTENGGNQ
FT                   TYLAGVYGPNNPYAMYNYVDFGDVGPTQFHVQAASATSGGTIEARIDGINGPVIATAEV
FT                   SGTGGWQTFKVFDGSITAPVTGKHLVYLLFKGNDWLYNFDKFTFGDSSVFTAPTLPPDP
FT                   VDDGVPPGEVENVQFTRDNSKLTVQWDGPYAMDGDVVRLKLLQSGQQVGEAAEVKRGVQ
FT                   SAVLSGIEADQSYTLVISAADKSGNVSKGITVEIPAVPVYSLKANGSKLAEGTVLEDDG
FT                   YLSFQAGDGKTAIRSASLAFDGKTYDGNKLNIELAGHLGAKTVVIAVEDAAGNKLRKTI
FT                   HIQVKTSTGSMSKLVDRYKASGEVGKSLASQLSASLKQAQHHLDKGHRDQAVKQMQDFI
FT                   KQLNKAKSGDLKAQAKAVLNADAEALIAGWKK"
FT   sig_peptide     262886..262993
FT                   /locus_tag="Pjdr2_0220"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.943 at
FT                   residue 36"
FT   gene            complement(266401..270789)
FT                   /locus_tag="Pjdr2_0221"
FT   CDS_pept        complement(266401..270789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0221"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /EC_number="3.2.1.8"
FT                   /note="KEGG: hypothetical protein; PFAM: glycoside
FT                   hydrolase family 10; S-layer domain protein;
FT                   Carbohydrate-binding CenC domain protein;
FT                   Carbohydrate-binding family 9; SMART: glycoside hydrolase
FT                   family 10"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98901"
FT                   /db_xref="GOA:C6CRV0"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003305"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR031158"
FT                   /db_xref="PDB:3RDK"
FT                   /db_xref="PDB:3RO8"
FT                   /db_xref="PDB:4E4P"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6CRV0"
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /protein_id="ACS98901.1"
FT                   /translation="MSRSLKKFVSILLAAALLIPIGRLAPVAEAAENPTIVYHEDFAID
FT                   KGKAIQSGGASLTQVTGKVFDGNNDGSALYVSNRANTWDAADFKFADIGLQNGKTYTVT
FT                   VKGYVDQDATVPSGAQAFLQAVDSNNYGFLASANFAAGTAFTLTKEFTVDTSVSTQLRV
FT                   QSSEEGKAVPFYIGDILITANPTTTTNTVYHEDFATDKGKAVQSGGANLAQVADKVFDG
FT                   NDDGKALYVSNRANTWDAADFKFADIGLQNGKTYTVTVKGYVDQDATVPSGAQAFLQAV
FT                   DSNNYGFLASANFAARSAFTLTKEFTVDTSVSTQLRVQSSEEGKAVPFYIGDILITETV
FT                   NSGGGQEDPPRPPALPFNTITFEDQTAGGFTGRAGTETLTVTNESNHTADGSYSLKVEG
FT                   RTTSWHGPSLRVEKYVDKGYEYKVTAWVKLLSPETSTKLELASQVGDGGSANYPSLASK
FT                   TITAADGWVQLQGNYRYNSVGGEYLTIYVQSSNATASYYIDDISFESTGSGPVGIQKDL
FT                   APLKDVYKNDFLIGNAISAEDLEGTRLELLKMHHDVVTAGNAMKPDALQPTKGNFTFTA
FT                   ADAMIDKVLAEGMKMHGHVLVWHQQSPAWLNTKKDDNNNTVPLGRDEALDNLRTHIQTV
FT                   MKHFGNKVISWDVVNEAMNDNPSNPADYKASLRQTPWYQAIGSDYVEQAFLAAREVLDE
FT                   NPSWNIKLYYNDYNEDNQNKATAIYNMVKDINDRYAAAHNGKLLIDGVGMQGHYNINTN
FT                   PDNVKLSLEKFISLGVEVSVSELDVTAGNNYTLPENLAVGQAYLYAQLFKLYKEHADHI
FT                   ARVTFWGMDDNTSWRAENNPLLFDKNLQAKPAYYGVIDPDKYMEEHAPESKDANQAEAQ
FT                   YGTPVIDGTVDSIWSNAQAMPVNRYQMAWQGATGTAKALWDDQNLYVLIQVSDSQLNKA
FT                   NENAWEQDSVEVFLDQNNGKTTFYQNDDGQYRVNFDNETSFSPASIAAGFESQTKKTAN
FT                   SYTVELKIPLTAVTPANQKKLGFDVQINDATDGARTSVAAWNDTTGNGYQDTSVYGELT
FT                   LAGKGTGGTGTVGTTVPQTGNVVKNPDGSTTLKPEVKTTNGNAVGTVTGDDLKKALDQA
FT                   APAAGGKKQVIIDVPLQANAATYAVQLPTQSLKSQDGYQLTAKIANAFIQIPSNMLANT
FT                   NVTTDQVSIRVAKASLDNVDAATRELIGNRPVIDLSLVAGGNVIAWNNPTAPVTVAVPY
FT                   APTAEELKHPEHILIWYIDGSGKATPVPNSRYDAALGAVVFQTTHFSTYAAVSVFTTFG
FT                   DLAKVPWAKEAIDAMASRGVIKGTGENTFSPAASIKRADFIALLVRALELHGTGTTDTA
FT                   MFSDVPANAYYYNELAVAKQLGIATGFEDNTFKPDSSISRQDMMVLTTRALAVLGKQLP
FT                   AGGSLNAFSDAASVAGYAQDSVAALVKAGVVQGSGSKLAPNDQLTRAEAAVILYRIWKL
FT                   Q"
FT   sig_peptide     complement(270697..270789)
FT                   /locus_tag="Pjdr2_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 31"
FT   gene            complement(271170..272429)
FT                   /locus_tag="Pjdr2_0222"
FT   CDS_pept        complement(271170..272429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0222"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bha:BH3482 multidrug-efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98902"
FT                   /db_xref="GOA:C6CRV1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRV1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS98902.1"
FT                   /translation="MKIIQSTAAEWRGWSRNIRLFFLSNMLYQFGMGLFSVLYNLYIHE
FT                   LGYPDAMSGTVVGMQSLATAICFIPIGLFGDRISRKRLLVIGALCSGIVLAGRSLFESE
FT                   SSLVTMAVLTGIFATVFQVLAIPFLADNVDKKDRLRIFSIYSAFVLAAQVAGSLGGGVI
FT                   SDVLQDAGVSTLLSFKLVLLAGSIATIGAFVPLQAMRESKRRTDSAAEKLNQPVAASPP
FT                   APVNKELRFIAAFAAVELLIGIGSGLVIPYLNLYFTNRFEVSLSGMSFLLSLGQVMTIF
FT                   SMLIGPTLASRVGQVKAIVIFQTLSLPFLLITGFTNMLLVASVSFLFRQALMNAANPLL
FT                   SATLMNRVSARSQSLANSVMQTAFMMGWATMGPVQSHIIASHGYYWGYAITFSITGCLY
FT                   VTASLLFLVLFREKRKKLAR"
FT   gene            272556..272918
FT                   /locus_tag="Pjdr2_0223"
FT   CDS_pept        272556..272918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0223"
FT                   /product="protein of unknown function DUF423"
FT                   /note="PFAM: protein of unknown function DUF423; KEGG:
FT                   nmu:Nmul_A1031 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98903"
FT                   /db_xref="GOA:C6CRV2"
FT                   /db_xref="InterPro:IPR006696"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRV2"
FT                   /inference="protein motif:PFAM:PF04241"
FT                   /protein_id="ACS98903.1"
FT                   /translation="MQTFVVLGCILMAAAVAIGAFGAHALKSRIEPDKLKVYETGVQYH
FT                   IIHALGLIGVGLLADRYPDSGIIVTGGWLLAVGIVLFSGSLYVLSLKRVRLLGPVTPLG
FT                   GLSFIVGWVLIAIGVL"
FT   sig_peptide     272556..272633
FT                   /locus_tag="Pjdr2_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.850 at
FT                   residue 26"
FT   gene            complement(272966..273421)
FT                   /locus_tag="Pjdr2_0224"
FT   CDS_pept        complement(272966..273421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0224"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: reu:Reut_B5647
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98904"
FT                   /db_xref="GOA:C6CRV3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRV3"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS98904.1"
FT                   /translation="MSIIGLSHIAIQAKDYEATIAFYTKVLGFKVGHHWSLPSFQIKDA
FT                   SMLISPDGRTCLEIFDNDAVIPAQGKKAQSEDEVAHGALLHLAFYVNNAEEMYAKALAH
FT                   GAKAYVEPASLTLGVPPLIVTNALVHSPNGEVIEFIEDVDFDMSGKV"
FT   gene            273580..274017
FT                   /locus_tag="Pjdr2_0225"
FT   CDS_pept        273580..274017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0225"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: bar:GBAA3205 AsnC
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98905"
FT                   /db_xref="GOA:C6CRV4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRV4"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACS98905.1"
FT                   /translation="MAEYAMDEVDRRIMQLLQLNARMPVSQISKEVSMSQPSVKERIMK
FT                   LEEKGVISGYSAVLNLRNLNRGTTTFILFKTEQCQEFVDFCETAMEVTDLYRISGEYNY
FT                   LIKVQTASIEELALFQDSLTGIGVSKSHISMKNIIENRILL"
FT   gene            complement(274150..274428)
FT                   /locus_tag="Pjdr2_0226"
FT   CDS_pept        complement(274150..274428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0226"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbt:BBta_6235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98906"
FT                   /db_xref="InterPro:IPR018735"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRV6"
FT                   /inference="similar to AA sequence:KEGG:BBta_6235"
FT                   /protein_id="ACS98906.1"
FT                   /translation="MCRNIKTLYNFDPPASDEEIQAAALQFVRKLSGFNTPSKANEEAF
FT                   HLAIGEVAEAARKLLGSLVTNAEPRNREVEIERARIRNAKRFGNGSE"
FT   gene            complement(274609..275238)
FT                   /locus_tag="Pjdr2_0227"
FT   CDS_pept        complement(274609..275238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0227"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: vvy:VV1113 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98907"
FT                   /db_xref="GOA:C6CRV7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRV7"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACS98907.1"
FT                   /translation="MGIHTYFQSLTDLERIIRCPGKFKFQAHSVAEHSWKVVQYAKTLA
FT                   DIEEMNGVAVDWKKLYEITSSHDYGEIFIGDIKTPVKHYSMELRSMLLQVEEGMVAHFI
FT                   DDHIPEEFKPTFRRQLREGKDQSVEGQILEVADKLDQIYEAFIELQLGNTEKEFIVMYR
FT                   SALIKIKEIKLHCVDYFLAHILPDLVAQGVKSPIDIEKITKEALAE"
FT   gene            275464..278241
FT                   /locus_tag="Pjdr2_0228"
FT   CDS_pept        275464..278241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0228"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: pin:Ping_2107 glycoside hydrolase family 3 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98908"
FT                   /db_xref="GOA:C6CRV8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRV8"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ACS98908.1"
FT                   /translation="MNTHGIPLEGFAAFSRKVAAEGAVLLKNDGQVLPVRTGESVAIFG
FT                   RTQVNYYRSGTGSGGSVNVTHTTNLLDGMRSKKNVKVNEELAAVYEKWIEQNPFDNGGG
FT                   GWAAEPWHQKEMPLSAELVSQARSQSDKAIVVIGRTAGEDQDNAVKPGSYLLTDEEIAM
FT                   LQAVTAQFEQTAVVLNVSNIIDMSWLNRNEMKSIPSIIYAWQGGMEGGNAIADVLVGDV
FT                   SPSGKLTDTIAYSIDDYPSTRNYGNELNNLYEEDIYVGYRYFETFAPEKVQFEFGYGLS
FT                   YATFASVPDQAKLTVKGGKEHIELGVTVTNTGSVYSGKETVQVYYEAPQGQLGKPAKAL
FT                   AAFAKTKGLQPGQSQRLTLSFPAHAMASYDDAGVTGHSSAYVLEAGTYRIYVGNSVRNV
FT                   SAVAVDGQEGYIVDALQVVEQLTEAMAPTVGFSRLKPGARKEDGTYELTSAEVPVRKVS
FT                   LAERIENNLPASLAQTGDQGYKLQDVASGQVSMESFIAQLSDEDLAAIVRGEGMSSPKV
FT                   TPGTASAFGGVSENLLAFGIPVACTADGPSGIRMDSGHKATQVAIGTLLAATWNTELVE
FT                   ELYVLEGRELLGNDIDALLGPGLNIRRSPLNGRNFEYFSEDPLVSGAFAAACTRGIMKG
FT                   GSNATLKHFACNNQEQYRHRVNAVVSERALREVYLKGFEIAVKEGGANSIMTSYNPING
FT                   HWAASNYDLNTTILRGEWGFKGIVMTDWWAVMNDVVEGGQADRKFTNWMVRSQNDLYMV
FT                   VSNYGAESNVWGDNTLESLENGTLTRGELQRSAMNICDFIMKAPVFGRELVTEEKAERF
FT                   EPDAELSAPRAQSLTDRAQVTFTAEEPAVMKVEQSGVYRITVHLMSTEFAWAQSACNVL
FT                   INGKLMTTVQTNGTESAWIRQKLVKVELPAGIYELKLDFVKPGMQIDWIEFVQE"
FT   gene            278382..279539
FT                   /locus_tag="Pjdr2_0229"
FT   CDS_pept        278382..279539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0229"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   dvm:DvMF_2873 preprotein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98909"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRV9"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ACS98909.1"
FT                   /translation="MELLIKELQQMNVQYAIKSEVKTGLAEILQLLTKDKLNLLAGNYE
FT                   IKGRSKLKKQELADAVQASIIASEELSMALLMATSQEWELLQKLLAVPSLQDDSLVPGA
FT                   YIFLMNAGLVYSFYDGDKLHYVLPEEVKETYAKVVNPALLKERERCQQVYDYILAAMNL
FT                   YGACSFDQLIEIYNAQNEDQLNEAEFDRICQLLTRREQSWHVAGSRLLADYYDEDNQEE
FT                   LEELLASVAGKPYYIPDKQEFLRYAEYGYYEVTPQLAGLEKYVLQYLCPEIEVARDLIS
FT                   EIQFDCSMAKPLEEIMMGFEARGIEIPSREQLEMVVHLVINVYNNTRMWSNGGFKPNEL
FT                   DSSGAGVASVHNVVPMQQRAGSAKVGRNEPCPCGSGKKYKKCCGA"
FT   gene            279697..281451
FT                   /locus_tag="Pjdr2_0230"
FT   CDS_pept        279697..281451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0230"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: bha:BH3915 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98910"
FT                   /db_xref="GOA:C6CRW0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRW0"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS98910.1"
FT                   /translation="MYMFRSRLILKLSVMILAILVLLSSALIYIQVQNTKKASEEAIGN
FT                   FNIHMAEAYAGQFDVSAYADFVKDQQENDLYWKIREQMNEYRERIGAMYVYTVQINDKG
FT                   EPILLIDGQPKDSDSASPIGEVTDIPLDAIGKLNNGETAKSGIIRNEEYGDYISSYAPL
FT                   RDAGGKMIGVLGIDTDVSVSKTIYKDVIGDSVPLFIIMGVLTLLVFLFIAFFLARTLRP
FT                   LGVIVKGAEAIAHGNLAEARQQLQVTKVKSKDEIGQVYSAMTQMIARLGVTLEDVVRDM
FT                   ALTTQSIVHSTEQFGTEAAQMVAMNEKLEHSVTTMADGARHQRMGAEESASSMEDITQA
FT                   IQRVSEASMQVSSVSHEALESAEHGRESIHGLRQQVELMASVAKQTADSVGLLQSYMQQ
FT                   IEPVLQSITSISDQTKLLALNASIEAARAGEHGSGFAIVAGEVRKLAEASAISASQVTS
FT                   LLEQIGQESVHIGDRMQAGSVEMVKGTELSGRVEALFDRTMDQFIHVNSQIQEISAAAE
FT                   EVLAGSEEVAASVEQIAQISRATADSSATLEQMSKHQLEAAKRIADTTEQLKSRSEGLE
FT                   AAVGKFKL"
FT   sig_peptide     279697..279777
FT                   /locus_tag="Pjdr2_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.796 at
FT                   residue 27"
FT   gene            complement(281492..282352)
FT                   /locus_tag="Pjdr2_0231"
FT   CDS_pept        complement(281492..282352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_0074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98911"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRW1"
FT                   /inference="similar to AA sequence:KEGG:MXAN_0074"
FT                   /protein_id="ACS98911.1"
FT                   /translation="MKIAVAVIHGIGQSRENFHAELASNLCAQMAIVNPSVKLHVEGIY
FT                   WGDIVNRLEERLWSRIRGKPLRWAKWIRLRPFFVNQLGEAIAYQAVPRDNDPTPDDYIY
FT                   DEIHRRFAVCLQRLSDLAGQDAPLCIISHSLGSIISSNFFHDLQNNKLTPKVSEVIGTS
FT                   ESRLVHGETLTHFYTLGSPLAVWALRFKDFGVPIAVPASPLQGLGIGEWVNFYDTDDVI
FT                   AYPIKPLNERYKKVVTADIEVECPGLLSWTPLSHRKYFQTQAVIDRIVHSLSTLQVYYE
FT                   EEARP"
FT   gene            complement(282523..282930)
FT                   /locus_tag="Pjdr2_0232"
FT   CDS_pept        complement(282523..282930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0232"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_2302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98912"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRW2"
FT                   /inference="similar to AA sequence:KEGG:Jann_2302"
FT                   /protein_id="ACS98912.1"
FT                   /translation="MSSAAGTKENPWKLKTPPLTSEYEMYKDEKDGKAIIVCTVGKTVL
FT                   HYDYRCMDDLYAMLKEHGDWIELGSADEQKPAKDGTVEAWGRSPENPVGGWYGLKKGLR
FT                   GRFGMYIPPLMEALGLAEVEHNPRNNRMRAI"
FT   gene            complement(283016..283900)
FT                   /locus_tag="Pjdr2_0233"
FT   CDS_pept        complement(283016..283900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0233"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bar:GBAA5454 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98913"
FT                   /db_xref="GOA:C6CRW3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRW3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS98913.1"
FT                   /translation="MEFLQLKYFQAVARHEHITKAAKELNVSQPSLSNSINRLEKRLGV
FT                   PLFERQGRHVKLNAFGKTYLNRVERAFLELEEGEREITDMAGLEHGTVSISVTLPYVLP
FT                   MMLKEFLTRHPHVRIIQHQLGSVSDMLSELENADIDFCISTTPMNGPDIEWLTLAEEEL
FT                   CLTVPKGHPFASRESISLIEAANEPFISLSSRSNFREITDGFCRKAGFEPRIAFELEEV
FT                   SSIQTLVEMGLGITFTLPLSLGNRASSPGTVQLKISDPVCRRTFGIAWNRKHYLSQAAV
FT                   RFREFVISFFGKM"
FT   gene            283985..285286
FT                   /locus_tag="Pjdr2_0234"
FT   CDS_pept        283985..285286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0234"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bar:GBAA3345 major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98914"
FT                   /db_xref="GOA:C6CRW4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRW4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS98914.1"
FT                   /translation="MIQHIQKVSNRDWRALTLLKEKIWTRNFVTICVSSFFMFLTFYVL
FT                   TTAFPLYVRDSLHGGQQQMGLVITIYVIGGVLIRPFSGQWVDRFGKRKMAIIGMIIFLL
FT                   ACFSYFGTKGIILFLIVRFIHGMSYAVASTAMSTVAATIVPVSRQGEGMGYYTMFMSIA
FT                   MVVGPALGLFLWKDQNINVLLLAICIIAALSLGFAFVLKMPGEKGLKTAVIQASAAEAE
FT                   PLVQEQPEKKGWRLSSFLEPAALPISLVGFILSFAYSSLSSFMASFTDEIHQSQVTGTF
FT                   FMVFAVMIVVFRPVIGKVFDRYKEHYLYYPGIGLFAVGMFLLSQAHSAAMVLSAGVIMG
FT                   IGYGALLPCFQTLAIKLSPEHRRGSANGTFFLMFDLGYGLGSYFMGMIASLTDYRMMYL
FT                   VAGIVAVICAGGYYILHHRPRAKKAVRTQQANVA"
FT   gene            complement(285360..285719)
FT                   /locus_tag="Pjdr2_0235"
FT   CDS_pept        complement(285360..285719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0235"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: bsu:BSU05290
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98915"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRW5"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACS98915.1"
FT                   /translation="MQKNTVQCQFVTALDSIVGKWKPIILYHLLQGKPLRFNELRRLLP
FT                   DITQRMLTLHLRELEEEEIVKRVIYPQIPPKVEYSFTEYGKSLSPILESLHQWGKAHME
FT                   RNQLKQAKNEQTKTD"
FT   gene            285858..286496
FT                   /locus_tag="Pjdr2_0236"
FT   CDS_pept        285858..286496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0236"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   bsu:BSU33540 azoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98916"
FT                   /db_xref="GOA:C6CRW6"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRW6"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ACS98916.1"
FT                   /translation="MATVLYITAHPLDPEQSFSLAVGKEFIEAYREANPTDEVVHLDLY
FT                   KELIPQLDADVLRGWEKLRSGSSFDQLTDAEKTKTARLEELVDQFVAADKYVYVSPMWN
FT                   FTVPPVLKAYTDATSIPGKTFRYTASGPEGLLTGKKALHIQASGSVYSEGPLAPLEMGY
FT                   SYLRKILRFYGIESMEAIFVEGTALQSQEQAPAVKEKAIAHAKEVAKRF"
FT   gene            complement(286543..286908)
FT                   /locus_tag="Pjdr2_0237"
FT   CDS_pept        complement(286543..286908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0237"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: bha:BH1009
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98917"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRW7"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACS98917.1"
FT                   /translation="MADENCSRVETALEILVGKWKPVILYQLFTNGTMRFSELQRALPD
FT                   ITKKMLTSQLRELEYHDIVHRKIYMQIPPKVEYSITDYGMKMTPLLEAINAWGTMHIQH
FT                   LNELYSEGRKPEDAETK"
FT   gene            287044..287397
FT                   /locus_tag="Pjdr2_0238"
FT   CDS_pept        287044..287397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0238"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: bbt:BBta_2759
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98918"
FT                   /db_xref="GOA:C6CRW8"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRW8"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACS98918.1"
FT                   /translation="MNIALWIAQALLALMFIPAGVMKTFQPNKVKSTMPWAKDASTGYV
FT                   AFIGLSELLGGLGLILPWATDIAPVLTPIAAIGIAVIMLFAAVFHARRAEYGSIGMNII
FT                   MLAVALFVAIGRF"
FT   gene            complement(287523..288035)
FT                   /locus_tag="Pjdr2_0239"
FT   CDS_pept        complement(287523..288035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0239"
FT                   /product="protein of unknown function DUF302"
FT                   /note="PFAM: protein of unknown function DUF302; KEGG:
FT                   aca:ACP_1217 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98919"
FT                   /db_xref="InterPro:IPR005180"
FT                   /db_xref="InterPro:IPR035923"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRW9"
FT                   /inference="protein motif:PFAM:PF03625"
FT                   /protein_id="ACS98919.1"
FT                   /translation="MRHGEPITAGYAMIVREDIPTGLSYEALVAAFERQMGRWDPYIGN
FT                   QLVRQQASWEQVEAAVKPMEGPHGLMILSEVNQGELLSLQSGIKQCRLYLVGNPLIAEP
FT                   ILAVDRRASLYVPFRVTLYDNGGPRGAIISFDRPSSFLGALHQPTLAPYGKLLDTKIYS
FT                   VVRSIMM"
FT   gene            complement(288111..288965)
FT                   /locus_tag="Pjdr2_0240"
FT   CDS_pept        complement(288111..288965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0240"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: tgr:Tgr7_3076 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98920"
FT                   /db_xref="GOA:C6CRX0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRX0"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACS98920.1"
FT                   /translation="MDSSQLEAFIAIAHLLNFTKAAEHLHISQSAITARIKALEAAVGK
FT                   ELFQRDNRNVSLTQAGIAFYPYAERMLRLFEESRLTLSDTFEQSVVMSGPGSVWHYRYL
FT                   SRILAFKSDNPQVAVKFFSHIDPSYMVRDLLLDGMVHLAVRFDPPEHPRVTRQLLFEDD
FT                   LLLVSKQPKAGVVQQEDFRSPDYCHLAWGTPFPEWFAELAGTGYVPALEIDHSSIMLTI
FT                   LLQGDRFGFLPRSIAQPYLDSHALFELSCTVKAPSIRAYATYLTDQLQHNSVKLALQML
FT                   GLS"
FT   gene            289100..289609
FT                   /locus_tag="Pjdr2_0241"
FT   CDS_pept        289100..289609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0241"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bar:GBAA2828 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98921"
FT                   /db_xref="GOA:C6CRX1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRX1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS98921.1"
FT                   /translation="MGNDIVIEQLTSLETSLRELADVLVRVVEDGASVGFLPPLSQEEA
FT                   IEYWRSVSDPEVMLFVAKVNGHLAATVQLQLCGKANGSHRAEIAKLMTHPEYRRKGIAR
FT                   QLMLEAEAAALGKNRSLLVLDTREGDPSNLLYMSLGYQLAGRIPNFARSADGSLAATMM
FT                   YYKNIG"
FT   gene            complement(289639..290118)
FT                   /locus_tag="Pjdr2_0242"
FT   CDS_pept        complement(289639..290118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0242"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cak:Caul_2305 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98922"
FT                   /db_xref="GOA:C6CRX2"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRX2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98922.1"
FT                   /translation="MKRITLQQRRILLLLHILFAAIMFGVQVAFIILALTASVTDDAAV
FT                   LRSCYTIMHLLADSSVRASTIGTTVTGIALSVLTSWGLFRYYWVIAKEALTLLAIGIGF
FT                   IGLYEWTLRGLDGNGSLTVHHTWLIIGIALQTISIIIMYILSVWKPGGKRKPPAL"
FT   sig_peptide     complement(290005..290118)
FT                   /locus_tag="Pjdr2_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.976) with cleavage site probability 0.265 at
FT                   residue 38"
FT   gene            complement(290137..290835)
FT                   /locus_tag="Pjdr2_0243"
FT   CDS_pept        complement(290137..290835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0243"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: bar:GBAA4920 DNA-binding response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98923"
FT                   /db_xref="GOA:C6CRX3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRX3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS98923.1"
FT                   /translation="MKRILIIEDDPVIAEVQKDYLLAHSFEVDIAERGDSGLEMELRGE
FT                   YDLILLDLMLPSMDGYEVCRRIREASNVPILIVSAKKEEIDKIRGFGLGADDYILKPFG
FT                   LGELVARVKAHLSRYERLVGQGHNGQHRDELRLNGIRIEKQSRRVFVNEREVSFTAKEY
FT                   DLLFYLVTHPNRVFRKEDLFEQIWGMDAIGSDHATVTVHISKLREKIERDPSKPQYVET
FT                   IWGVGYRFNI"
FT   gene            complement(290832..292337)
FT                   /locus_tag="Pjdr2_0244"
FT   CDS_pept        complement(290832..292337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0244"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase HAMP region domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   bar:GBAA4921 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98924"
FT                   /db_xref="GOA:C6CRX4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRX4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS98924.1"
FT                   /translation="MSIRKKLIFSYAAMIAVPILLFGLTIALLGNLLIKDALPGAGGGD
FT                   GKSGHSFPLSSIRDLFMGRSELSSGLKFIAEHDPKLLSDQAFLTDTGAKLEEVESGMIV
FT                   IRNDEVAYASHGLPADKILADLADGHMKAEHPGPPSGNQWDTIPFLSPDGSSGKLIIVS
FT                   DMKPVADFFKRLVPLVLLTLLGALIVTNGLLTYLVSRSIIKPLYALKEAAGRIREGDLD
FT                   HPIQLRRQDEIGQLGAAFEEMRVRLQASLGTQLELEQGRKELLANISHDLKTPITAIQG
FT                   CTDCLRDGIADTEEKRQKYVQMIAGKTIEMNRMIEELQLYSTLDTGKLPFHWDTVDLTA
FT                   YMIQLVNELRLDPRFSGTEVTFIPSAGTEQVLIQADRQKLHRTLMNLADNSLQYMKGEI
FT                   KKLVFSLDEEPGGIYLLQIHDNGEGIPADALPRVFDRFFRAQSSRSPGKGNSGLGLAIV
FT                   KQIIEAHGGTAAAVSRPGEGTTIQLRFPSWKQDRTKPENGGIQ"
FT   sig_peptide     complement(292254..292337)
FT                   /locus_tag="Pjdr2_0244"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.346 at
FT                   residue 28"
FT   gene            292521..295058
FT                   /locus_tag="Pjdr2_0245"
FT   CDS_pept        292521..295058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0245"
FT                   /product="glycoside hydrolase family 2 immunoglobulin
FT                   domain protein beta-sandwich"
FT                   /note="PFAM: glycoside hydrolase family 2 immunoglobulin
FT                   domain protein beta-sandwich; KEGG: pat:Patl_0128 glycoside
FT                   hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98925"
FT                   /db_xref="GOA:C6CRX5"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="InterPro:IPR041447"
FT                   /db_xref="InterPro:IPR041625"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRX5"
FT                   /inference="protein motif:PFAM:PF00703"
FT                   /protein_id="ACS98925.1"
FT                   /translation="MSELKWQISNWTFKNTEEQEWKPAFVPGCVHTDLLKNGLISEPFA
FT                   GTNEKDLQWIDKKAWEYESVFDAPGELLAHAKLELVFEMLDTYADVYLNDALILSADNM
FT                   FRTWTIDAKPHVREKGNRLYIRFRSPIEEGLAKLETYGPGLPAPNDDSVIGGLEGKKVS
FT                   VFSRKAPYHYGWDWGPRFVTSGLGRPVYLRGWSGARITDLYIQQDEVTAAEAKLTVQLA
FT                   VESESGGEFELKLHTDNGQEWTRKVVLESGAQTVDWPLTIEQPKLWWSRGLGEPHLYAF
FT                   TAALSQEQEELAQASAVTGLRCVKLIRKPDERGSSFYFEVNGIPVFAKGANHIPSDSFF
FT                   SEVTDERYRHEIASAVESNFNMLRVWGGGIYEQDIFYELCDQNGLLVWQDFMFACSMYP
FT                   GDEAFLGSVRAEAEDNVRRLRNHPSIALWCGNNEIDTAWSQYAENSGWGWKQLYTAEQR
FT                   EQIWADYEAVFHQVLPEVVAAMAPDIEYWPSSPMQRQTGNSEQHATNSSSHGDIHYWAV
FT                   WHAQEPFEQYNQNIGRFMSEYGFQSFPEYKTVRAYAEEKDMALDSEVMLHHQKNGRGNF
FT                   LIKDYADRYMKQPKDFPSFLYISQVLQAEAMKQAIEAHRRSMDYCMGSLYWQINDCWPV
FT                   ASWASMDYYGRWKAAQYLIKNSFADVLLSFDQKDDVTNFHVVSDLGQSIDAVLEWSLHE
FT                   LDGCLLKSGSETIAVGARSAKLVLSLSAEQLGEFNPNGTVLAGRLIQAGRELASSKHYF
FT                   VYTKELALTDPEIAVEEVAGSEGTAFVLTAKRLAKQVWVQAEEEGIFTDNFFDLIPGVP
FT                   VTVQFKKKAADQVLFVPSSPGKVTVQSMFNYAK"
FT   gene            295334..295429
FT                   /locus_tag="Pjdr2_0246"
FT   CDS_pept        295334..295429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0246"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98926"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRX6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98926.1"
FT                   /translation="MLEWQSRAPKQALAWNLRSLRDLKLAKGVAS"
FT   gene            296239..297339
FT                   /locus_tag="Pjdr2_0247"
FT   CDS_pept        296239..297339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0247"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   aba:Acid345_2211 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98927"
FT                   /db_xref="GOA:C6CRX7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRX7"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACS98927.1"
FT                   /translation="MGVLITALLVCASAMGFVLFRRNTVPVSSEGPFQERKLSVIIPAR
FT                   NEEGNLPFLLGSLKTQSYKPFEIIVVDDHSEDRTKAIAESYGVKVVSNPELPSGWTGKN
FT                   WAVWNGYLQAEGDLILFLDADVRLAPDAVRSLLAVREKEGGVISVVPFHVAEKFYERLA
FT                   LIPNLLGLFAFTSPMERTNPDKGLYGSFILATREDYEQAKGHESVKGEVLDDLNLGARF
FT                   IQAGVKVKNFIGRGVVSFRMYPGGIKSEIQGFSKGAVLSTSKLHIRTTLLVAVWLIGLI
FT                   AAEAAPFVIGTSALVPLAVGYVVYTLQIYYFVHYTGRFGIWLPAIHLLSTVFFLYIMLY
FT                   SLYQVVFLRKVAWKGRSIEVGGRGNP"
FT   gene            297336..297935
FT                   /locus_tag="Pjdr2_0248"
FT   CDS_pept        297336..297935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0248"
FT                   /product="protein of unknown function DUF205"
FT                   /note="PFAM: protein of unknown function DUF205; KEGG:
FT                   dde:Dde_0172 acyl-phosphate glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98928"
FT                   /db_xref="GOA:C6CRX8"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRX8"
FT                   /inference="protein motif:PFAM:PF02660"
FT                   /protein_id="ACS98928.1"
FT                   /translation="MIIGWTALAFLAGSLMFSYWIGRIKKLNLKTYGDGNPGAINLWKA
FT                   AGYGYGLAGIVLDFAKGYLPMALMQHGDSVTGFGIIFPAAAAILGHIFSPFTGWRGGKA
FT                   IAVTFGVWSGLTGFAASLAYAVILAMLLLVSRRLSKGRPISSETDAFHVVLGMLLLSIY
FT                   LVLDNYSWPYVLLGLINFLLLAYSHRKELIGVKDTN"
FT   gene            complement(298023..299309)
FT                   /locus_tag="Pjdr2_0249"
FT   CDS_pept        complement(298023..299309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0249"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: gur:Gura_3425 BNR repeat-containing glycosyl
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98929"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR028203"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98929.1"
FT                   /translation="MKKISTLVLLVTLSLTLLMAGCSKADNSANTPSSNNPTNQTSNSN
FT                   NTDTGSTNTSTNAPSTEPEDTSSQQPGNNGGSTSENPTPISTNEQTAQIGNVTALRLAD
FT                   SKAGWVAGNGQIARTDDGGAHWRLQYSGSKPINQIFALSSNKVWATIGDSNAKSLILIQ
FT                   STNGGKSWTKAGTVPNHGFLHFTNDKTAFSGNAMTKDGGKTWTELQTPGKEIGEVYFHD
FT                   VNNGWAVQVVNGRLLFMHTGNGGKTWNTVMTRKTEAAPNDVIIRSTAANDAWIELIGDS
FT                   GMSQTSYSLFHTADGGKTWLPAIVKNGAGSGPAPGFTMDDASVPKGMTSSAPGTLYVVN
FT                   PQTAIMGGQCSACDKPNTIMKTTDGGKHWTIGKSEFTGYGTQFIGASDASHIWFITTDA
FT                   TNAAVLNTSSDGGKTWHKAFTFKKPQAQK"
FT   sig_peptide     complement(299232..299309)
FT                   /locus_tag="Pjdr2_0249"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 26"
FT   gene            299594..303052
FT                   /locus_tag="Pjdr2_0250"
FT   CDS_pept        299594..303052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0250"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98930"
FT                   /db_xref="GOA:C6CRY0"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRY0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98930.1"
FT                   /translation="MNVRMNNSSLPKKAACALSAFLLTVPLVGGQAVHAEPVNTVLTPV
FT                   TGDNGWLNAGMAVNGDSFSFDVSGVFPQFTGPVTVTASSSKSNVATATTANGRIEVRVK
FT                   EPGVTRLAITGSDSTSLALTDYVDLNVTLLGDTTGDGLLTSADVLYIYKVINSKLPITD
FT                   QEKNRLDVNRDGVITTADATVLMNSYVGKTPATGGVKFIADLKDSNDAPSADRIAVTGT
FT                   VHTGSTLTGGYRYADPENDGEGTSLYQWYRGTLADGSDKTPIPGEVTTAYTVKDVDVDH
FT                   YLFFEVVPVDSRGAAGSAVQIGTTGTVPDTSPPVVTGTTPVVLSNAASRTEQLRIDFNE
FT                   PIKAAAGKSIHIYRASDNQMVTTYLASDPSKVTVTGNAAVLVNPGLGNATAYYVTIEAG
FT                   AFTDLVGNPFEGISGSSGWGFTTVDTEGPVTAALSPVNGAADANKASSFTLTLDENVQA
FT                   VSGKKITILNADQSELVSYDAADTTKVTISGKSVTIHNPGLAETTSYSIEVEAGALTDL
FT                   SGNDFAGINGTDWSFATPDTIAPVLQATTPADDASGVDRTASISMVFSESVQAVNGKTV
FT                   RIYRASGNSLIKTYNVTDTSAVQINGDTVTLLNPNLADGADFYVEIDAGAFRDAAGNVY
FT                   AGLQGILAWNFSTPDTIAPVVSSLNPTDNGTGVELSDELTVTFSEPVIPVNGKTVKIVN
FT                   AKDQTEFAVYTFGSDSEVSVNGDTLTIQHAPFDALKGYIIQIEAGTVKDAAGNGFAGIT
FT                   DWNFTSKDTREMLAVEDPGVPLLESELNSGAFVTLTLDGDTFLADADDDDFVLNHAPAG
FT                   LSIIGAGVFPDGSAYVMFDYDGTDFDADITDFSVTALSSAVASGQAITSQNLTIKAEVE
FT                   PDIISTVPAAGATKVKKADPLTMTFDKNITAAAGKKITIYKKSDNSIVQTIDAADGSKV
FT                   SVNGSTVTIQHNAFTANTEYYAVVEAGAFVDASLIGNKTVNAFAFKTTSVEIVPEMYIS
FT                   EFLKGTGAYDMAVELYYPERAPGSNPVTGETYSLWLYHYDTVSHTTVVSSEKLTAPAYK
FT                   NTVYIYIDRAFYSFFDVTHTTYYNEEVQFNQGANRILKGIVLKKGDQVIDVLGDPNETG
FT                   TGGLLDSPKTLVRKSGVNGASIEFDSDQWDTYPANSFQFMGKHTP"
FT   sig_peptide     299594..299701
FT                   /locus_tag="Pjdr2_0250"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.981 at
FT                   residue 36"
FT   gene            303073..304908
FT                   /locus_tag="Pjdr2_0251"
FT   CDS_pept        303073..304908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0251"
FT                   /product="cellulosome anchoring protein cohesin region"
FT                   /note="PFAM: cellulosome anchoring protein cohesin region;
FT                   S-layer domain protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98931"
FT                   /db_xref="GOA:C6CRY1"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002102"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRY1"
FT                   /inference="protein motif:PFAM:PF00963"
FT                   /protein_id="ACS98931.1"
FT                   /translation="MTLQQKMTKPYLMFVLALTLLLGGLSFGSTRAQASAGVPVQLKIG
FT                   DVSVNTGGTVDVPVSIKQPERGIGSYNVQLNYDPKALEIISVKPKYGDANTETCSESQE
FT                   GCFVSNFDQENGWLRVIWVDTTGGDRLINEAKQLFTIQVKAKPGSESAKQTLTVDAEDP
FT                   ASLTFTDGDMHTLPVAVTEGEITVYPNLPIDTGKVKVIVDGKEQGESATLSSVVVNGRV
FT                   VTTISVDNEKVAEQLQQNQIKTLTLPVEGSREVVVGELNGQLVKLMENRAASLVIQTNQ
FT                   ASYTLSASQLNIDQVAGQLGAGTALQDIKIQVTISVMKDKQSVEQAAANSEADLIATPV
FT                   QFEVTASYRGKSVTIDRFSNYVNRTIAIPDGVDPSHITTGVVMAGDGTITHVPTVITQS
FT                   EGHYYAQINSLTNSTYAVVWHSKTFADVTNHWAKADINDLASRMVIQGVSADRFAPDRS
FT                   VTRAEFTAILLRALGIHAPKDDTKVSFRDVGATAWYHDAVVNAVSYGLITGYSDGSFHP
FT                   NASISRQEAIVMINRSSAITGLVQASASETAGLISPFNDKKNIDSWALAAVASGAKQGI
FT                   VKGTNGKLLPKQPITRAESAVIMKRVLVAAGLINS"
FT   sig_peptide     303073..303177
FT                   /locus_tag="Pjdr2_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.790 at
FT                   residue 35"
FT   gene            complement(304970..305875)
FT                   /locus_tag="Pjdr2_0252"
FT   CDS_pept        complement(304970..305875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0252"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: transcription activator effector binding;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: baa:BA_1663 HTH_ARAC, helix_turn_helix,
FT                   arabinose operon control protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98932"
FT                   /db_xref="GOA:C6CRY2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRY2"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ACS98932.1"
FT                   /translation="MKQDYLAQIQQTIDYIEAHISEELSLSRLAQVAKLSDFHFHRVFQ
FT                   SMAGETVMEYVRKRRLAISAYQVANSDAKLIDIALDTGFQNHETFTRAFKRMFEMTPAE
FT                   YRKREIKPPAYSRLNVLQRKYNPYLGGIRMEYKIITKPAFKVIGYEIRTRANGDNHKEI
FT                   PAFWQEYIQKELYKNIPNRVHKESPVELGICYNFDMGSDSFSYLIGMEAESFDGVEGEG
FT                   LVCREFDGAEYAVFTTPKVPREQFSSSIQNTWMTVFGEWFPHSGYEHAGTPEFELYDER
FT                   SNHELSEIQMDIYIPIKKKA"
FT   gene            complement(306012..306932)
FT                   /locus_tag="Pjdr2_0253"
FT   CDS_pept        complement(306012..306932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0253"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bha:BH3927
FT                   aryl-alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98933"
FT                   /db_xref="GOA:C6CRY3"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRY3"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACS98933.1"
FT                   /translation="MRTIKLGSTALEVPVVAVGCMRINSLDKAGAERFVQTALEQGANF
FT                   FDHADIYGAGTCEEIFAEAIHMNDSVRENIILQSKCGIKPGVMFDFSKEHILASTDAIL
FT                   KRLKTDYLDILLLHRPDALVEPDEVAEAFDRLESSGKVRHFGVSNQNPMQIELLKKSVK
FT                   QPIVANQLQLSITNANMISNGINVNMENSSAINRDGSILDYCRLNDITVQPWSPFQYGF
FT                   FEGVFLDNDKFPELNKAIDAIAGKYDVSNTTIAIAWLLRHPAKMQPVIGSMNIERLKDC
FT                   IKAADITLTREEWYEIYRAAGNILP"
FT   gene            307214..308074
FT                   /locus_tag="Pjdr2_0254"
FT   CDS_pept        307214..308074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0254"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: baa:BA_1330 uncharacterized
FT                   protein family UPF0028"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98934"
FT                   /db_xref="GOA:C6CRY4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRY4"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACS98934.1"
FT                   /translation="MSAMHDIGLVLEGGGMRGVYTAGVLEYFSEHNVYFPYMIGVSAGA
FT                   CMGASYLSRQLGRNRTVNVEWVSDPRYISWKNLWKKGQLFGMDFIFDEIPNKHVPFDYA
FT                   AFERSPEEFVIGTTDCETGETVYYRKSEPDFDLLQLLRASSSLPFIAPIAEYGGRKLLD
FT                   GGISDPIPLRMAESDGYKRNLLILTRNGDYRKSTGKFSWIVQRAYRKYPKLVELMLGRH
FT                   KRYNGTLDYIAEQEKSGAVFVIRPQETLTVGRMERDPAKLDALYKQGYEDAKRMMPQLR
FT                   KWMEG"
FT   gene            308314..308967
FT                   /locus_tag="Pjdr2_0255"
FT   CDS_pept        308314..308967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0255"
FT                   /product="Fibronectin-binding family protein"
FT                   /note="PFAM: Fibronectin-binding family protein; KEGG:
FT                   baa:BA_2345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98935"
FT                   /db_xref="InterPro:IPR010841"
FT                   /db_xref="InterPro:IPR032330"
FT                   /db_xref="InterPro:IPR038344"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRY5"
FT                   /inference="protein motif:PFAM:PF07299"
FT                   /protein_id="ACS98935.1"
FT                   /translation="MSTPFIRNHQLNLIKKQVGELQKACSTVSDLKVIASVRSNTPFKV
FT                   MEAFPGATEAEQQLLESFATLNTPQEFQGYLRSLEEYVKPFDTVEEKQLKKLFPKAKKL
FT                   KVPDLAAIDLRYVTYLGWTDIATNKMYLAYHLNGRLVGVEGRFTPVQKKSVCFLCNRHE
FT                   EVALFSAVTKSRPANASPDYYKAIGNYMCVNSERCNNNITDVTVLERFISDIVL"
FT   gene            complement(309010..309474)
FT                   /locus_tag="Pjdr2_0256"
FT   CDS_pept        complement(309010..309474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0256"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH1782 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98936"
FT                   /db_xref="GOA:C6CRY6"
FT                   /db_xref="InterPro:IPR016942"
FT                   /db_xref="InterPro:IPR025508"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRY6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98936.1"
FT                   /translation="MSRPTVNLSYECVDEVPLHRVRGNQLGILLSVIATVLTQQWWILI
FT                   LPLAVQLVSRTYGVKYNLFVRLFSPLLPVSRRTEARELLRFNNLLVILFLVVTLAAHYL
FT                   GLTVLSYIALGMLTAAVVAALSGFCLGCFMYFQYKQFRLRRAAKARAASQ"
FT   gene            309666..310124
FT                   /locus_tag="Pjdr2_0257"
FT   CDS_pept        309666..310124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98937"
FT                   /db_xref="GOA:C6CRY7"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRY7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98937.1"
FT                   /translation="MNLKTIALCLYVMLIYWLSLHFSFLDTLFFPTLGAFSFLFISRSS
FT                   TIAEVGRVTFGAVISSAIGTVLYYIYPSPISLFINVVITIWLINKFKWNAPPIVAVALI
FT                   PFFSHSAHHWFIPVSVCAALLGLMLVLYVVQQIESRRSQVYESESTAA"
FT   gene            310241..311638
FT                   /locus_tag="Pjdr2_0258"
FT   CDS_pept        310241..311638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0258"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: spe:Spro_3106
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98938"
FT                   /db_xref="GOA:C6CRY8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRY8"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACS98938.1"
FT                   /translation="MGIGRPRLRGKHEAFLEKHFTGVSIDYRQIIALFIPILIDQAFLV
FT                   GLNLVNTAMVSSSGVDAVSAVNMVDSLNIFLISVFIAVSTGGTVVVAQYKGSGNHQMVS
FT                   KSAASSVSSVTLVAFAISLIVVVFHSQMLNLLFGAASPEVFQEGRTYLIGSGLSYVGIA
FT                   MMEAVCGALRGIGRSRASLMLSLVMNLTYVLLNIVFINLMNMGVLGLAISVNISRYAAA
FT                   ILAIVYLVKIDTSLRLRLRDMLSVNFSMLRKILFVGLPFAAEQMFFNGGKIVTQTFVVG
FT                   LGTFAIATNAISGSLANVLQIPSNALAITAITVIGQCMGQRNIEDARKFTRSFLWLSTA
FT                   CLFVMACLMLPLFYPLVGLFHPPAEIVDDILIITIINALMQVVFWSISFIMPSALRAAG
FT                   DSKFTSVVSLLSMWLFRIVLGYLLAIVFDFGIIGVWLAMNLEWGVRGAIFLWRFRGKKW
FT                   YRHRLID"
FT   gene            complement(311719..311958)
FT                   /locus_tag="Pjdr2_0259"
FT   CDS_pept        complement(311719..311958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abb:ABBFA_002698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98939"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRY9"
FT                   /inference="similar to AA sequence:KEGG:ABBFA_002698"
FT                   /protein_id="ACS98939.1"
FT                   /translation="METTTEQHIAEWMVNEIKFRGMLRQEEAIEHVKQQFGEQYIFVNE
FT                   NGNVSLEKEVKKAFRKLHKGRVAWDRDGFFWAWT"
FT   gene            complement(313727..314161)
FT                   /locus_tag="Pjdr2_0260"
FT   CDS_pept        complement(313727..314161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98940"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98940.1"
FT                   /translation="MTNIVKLSQWDALLVESLRKGHGWSDDEIIAKVKAGADLPTDDSI
FT                   FQFNYGDLAAFAEKEPETFEAAVRSGYQIKYNTVRGLRSWIWVAFGDEPQLELEAGQEA
FT                   VTAQLTPEQLERVKTALSFGWSIQPVDGVPGSYRIEPIQR"
FT   gene            complement(314201..315106)
FT                   /locus_tag="Pjdr2_0261"
FT   CDS_pept        complement(314201..315106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0261"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: baa:BA_1496 oligopeptide transport
FT                   system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98941"
FT                   /db_xref="GOA:C6CRZ2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRZ2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS98941.1"
FT                   /translation="MSEDKKVLVDVQQLKKHFVKSRDAWGRTSEVLKAVDGVSFRINKG
FT                   ETFGLVGESGSGKSTVGRSILRLYDYTDGTVKFDGQDISKLGEKALKPFRRRIQSIFQD
FT                   PYSSLNPGMSVLDLIGEPMNIHGLYKNVEERKEVIASLLERVGLKREHLYRYPHEFSGG
FT                   QRQRISIARALSVRPDFVVCDEPISALDVSVQAQVVNMLEDLQAEFGLTYLFIAHDLSM
FT                   VRHISDRIGVMYHGRLVEIADSDELYENPLHPYTKALLSAIPIPDPRAVVERVIYTPDA
FT                   ATEEAAVLREVRPGHWVALP"
FT   gene            complement(315093..316124)
FT                   /locus_tag="Pjdr2_0262"
FT   CDS_pept        complement(315093..316124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0262"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: baa:BA_1731 putative oligopeptide transport
FT                   system ATP-binding protein; TIGRFAM: oligopeptide/dipeptide
FT                   ABC transporter, ATPase subunit; PFAM: ABC transporter
FT                   related; Oligopeptide/dipeptide ABC transporter domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98942"
FT                   /db_xref="GOA:C6CRZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRZ3"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACS98942.1"
FT                   /translation="MADRLLTVNNLQVSFHTRSGENKAVRGVSLHIDQGETIGIVGESG
FT                   SGKSVTAKAIMAMIPPPGEIISGDITFAGEKLNDLPERKWRQIRGNRIAMVFQDPMTSL
FT                   NPVKKIGDQMTEVIRRHRGLSKEAALKEAIEMLRQVGINEPERRVQQYPHEFSGGMRQR
FT                   VMIAMALSCQPELLIADEPTTALDVTIQAQILDLLKELKAKTSASIALITHDLGVVAQV
FT                   CSRVIVMYGGMVMEEGTVEDIFYNSKHPYTQGLLRSVPQRQGGSRERLVPIEGSPPDLL
FT                   DPPPGCPFMERCPHAMPKCAELPPHFQIGEGHRALCWLNDAEIQAELARHPEIEGSAAR
FT                   VRG"
FT   gene            complement(316182..317027)
FT                   /locus_tag="Pjdr2_0263"
FT   CDS_pept        complement(316182..317027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0263"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bar:GBAA0910 oligopeptide
FT                   ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98943"
FT                   /db_xref="GOA:C6CRZ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRZ4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS98943.1"
FT                   /translation="MNRTKWRNAGLELVRSKMGIVAIAILVIFILGAIFAFLSPKDPNA
FT                   LDALQRLKSPSSAHWFGTDDYGRDYFARALYGGRVSLMVGFSAMVLATTIGTIVGVVSG
FT                   YFGGWIDNLLMRLLEVILSIPTFLLMLLLSVFLKPNLTSIVFIIGLLMWMNMSRIIRAE
FT                   TMTLLEREYVLYAKASGQNHLGIIIRHIFPSLVPVIIVAATNNVASAIMMESTLSFLGF
FT                   GVQAPNATWGSMLNNAQGYIAQAPYLALFPGLFILLTVLSFNILGDILRVGFEPKLGKR
FT                   "
FT   sig_peptide     complement(316917..317027)
FT                   /locus_tag="Pjdr2_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.550 at
FT                   residue 37"
FT   gene            complement(317032..317982)
FT                   /locus_tag="Pjdr2_0264"
FT   CDS_pept        complement(317032..317982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0264"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: baa:BA_1492 peptide
FT                   transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98944"
FT                   /db_xref="GOA:C6CRZ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRZ5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS98944.1"
FT                   /translation="MRQLIARRLLQTIPLLLFVSIACFALIKLAPGDPVLSFVTPNMHP
FT                   EDIERIRHNLGLDKPAYIQYLLWIKELFQGNLGYSLVNHQPVMDQILDRLPATAGLMAS
FT                   AIALSVLIAIPLGLTAGANRNRWQDKIINLISYVGISVPLFYLAILLIYLFAIELHWLP
FT                   IMGMRTIGVHSAWDVVKHGILPCAVLAFGFLSVYVRYIRSSTIGQLKEDYVQIQYAFGA
FT                   SRRQVLFRHVMKHVLLPVITLLGMSMADLVTGAIVTETVFSWPGIGSLGMTAVKGMDYP
FT                   VIMGITLFSALFLILGNLLADILYGFADPRIKSTR"
FT   gene            complement(318063..319679)
FT                   /locus_tag="Pjdr2_0265"
FT   CDS_pept        complement(318063..319679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0265"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bar:GBAA0908 oligopeptide ABC transporter,
FT                   oligopeptide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98945"
FT                   /db_xref="GOA:C6CRZ6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRZ6"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACS98945.1"
FT                   /translation="MRKSIPALLTLIILAVMISACSGNNNGGNTAGNNSEASPSNTAAA
FT                   DQAKDGGNLILGVQADPVVLNPIYAGDRVSLTIDQALYAPLFQVNNGKKTFYLADSLEP
FT                   SADNLTYTLKLKSGLTWHDGQPLTADDVVFTFDTILDEKQNSFFRENLILGGKPIKAVK
FT                   VDDTTVEFQLPQVNPAFEATLVQLTPIPKHIFEGEANIEKSTKNNTPVGSGAFKFKEYK
FT                   TGEYVTLERFDNYFGGKPHLDSITYRIAKDANAANLALQNGEINVKYLDPQDVSTIEST
FT                   GNFDIQAYSEGRLAYLLFNEDSDTGALKKKEVRQAISYALSRDELIQTVYGSSEYADPA
FT                   KSFVTPDGLFQTNDVTSYDNDVNKAKELLASAGESNLKLRFIVSSGNKAQEAAALYIQQ
FT                   KLKAVGITVELQSMDASAYGQKFVDLKSKDYELSYAGYIMGYDPDAYRILYTTGSNSNY
FT                   ARYSNPEVDKLFEQGAGEADATKRGEAYQQLQKTIADDAPIYPVGYTKTIVAIDKRFGG
FT                   LNEAVLKPVVIFEDPSKLYMK"
FT   sig_peptide     complement(319611..319679)
FT                   /locus_tag="Pjdr2_0265"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.352 at
FT                   residue 23"
FT   gene            320097..320972
FT                   /locus_tag="Pjdr2_0266"
FT   CDS_pept        320097..320972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0266"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bsu:BSU35640 membrane bound lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98946"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98946.1"
FT                   /translation="MKNKNITTKWTILLSSTVLAACLLSACNNNNSNSNVNSSPSPTVS
FT                   ASPTPSESPSAEAKQGKGVFVGLADSHTVEITVDGEAAAYQLGEGTDSAVAALKEGDNV
FT                   SFEYTEAAIEGDATAKLLTITKIEKAAGDTPAVNELPATKDFKFQLEGNEETRTGTLAK
FT                   GDGYALYIFEQFKFDAAANKLIMNVDNDYYIEISKLPEGFKLDDVKADAEKELKSVGDV
FT                   QSIDQKDSKSMIGDVDLMLKAASNKLTKEVIVKTVDGTSFLFKVNQPVGEPTEGFGPLA
FT                   FTSMGSIAAQ"
FT   sig_peptide     320097..320177
FT                   /locus_tag="Pjdr2_0266"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.536 at
FT                   residue 27"
FT   gene            321274..321366
FT                   /locus_tag="Pjdr2_0267"
FT   CDS_pept        321274..321366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98947"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRZ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98947.1"
FT                   /translation="MLHIVQLSRGMNPNICRFGLGEQAMLDSNQ"
FT   gene            complement(321704..323209)
FT                   /locus_tag="Pjdr2_0268"
FT   CDS_pept        complement(321704..323209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0268"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   response regulator receiver; KEGG: bha:BH2109 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98948"
FT                   /db_xref="GOA:C6CRZ9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRZ9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS98948.1"
FT                   /translation="MKGTVLIVEDQPNFREGLKFMISQSRNWTVIGEAETGEEGWQKAL
FT                   ELKPDLILMDIHMPVMNGIELAERIHSHGMDTLFIIITGFQDFQYAQSAIRYGAMDFLL
FT                   KPCSDEDISGILGSASKKLQAKRKDQQTTREHLLRSILLKYQMNQELTSHFLRMFEGCQ
FT                   LWLVTITDYFPEGKNYGADDLYVLQYGIYNIVQELALSEEADAKLLILKEDQFILSASS
FT                   DLKTDCWREHAELAVREYLGIAIESIPLGPCMDVDQLMSAYASYNEQRVLAPTVPQTAD
FT                   RSSKHQAVEAVKNEIMSLIISGDLQALHDYFEKVGGQAGSLQLTDGKFLVINHSLALDQ
FT                   ISEVLGLFSHQGKSAESLLQTIDQLPGSMELKSWFKAACQDFETRLDRWKQQANPYVNS
FT                   IQQAIDYIEEHYLDSDLSIKQVAENIHLNPSYLSTLFKKETGETFTGYVNKLKLQKAQV
FT                   LLRNTDMKISEICQTVGFEDSTYFSSVFKKHFQISPSEFRQNH"
FT   gene            complement(323206..324981)
FT                   /locus_tag="Pjdr2_0269"
FT   CDS_pept        complement(323206..324981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0269"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; SMART: histidine kinase HAMP region domain
FT                   protein; ATP-binding region ATPase domain protein; KEGG:
FT                   bha:BH3447 two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98949"
FT                   /db_xref="GOA:C6CS00"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS00"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACS98949.1"
FT                   /translation="MPFHTRSLVVKLILSLSLIVILTSSITGIIVYRSNQNMFREEIRS
FT                   QFLQNNKQALQRINQNIHEVERISQSIVFHPTVVKILTNSLNNEDKVEQLQLMYDMVSQ
FT                   AKLDAPHIRAMFIYNLRGDSYYNANYGAVSMLEKPTRSIINQELEGTNGALTWFRLKLA
FT                   SSADPSGYRYMIIAARQMKSTYQETYGTLVLVLDEGFFSEVIDDIGQDDGIVYLLDRKD
FT                   RLLFSQRSQEVNADEEQDSPEVIPLQHDQEERASIVQSTGQGNYLFVKNTSDSGIFKLI
FT                   SGLGLSALDKRNADILKTIALSGLFSILLAGLLLTLTSTRLLRPLGNLVSGMRRLRSGQ
FT                   MNARVEVRSKDELAFLGESFNDMADNIQKLVDEVLLKQLREKEAELRAIQAQLNPHFLY
FT                   NILNEIYWKLYLQNAKDTAGIIQSLSKILQYSLKPIEQPSTLREELEQLQSYINIQMSL
FT                   FHPDLELDIQTDEHLLCLEMQRLLLQPAVENVFVHAFADKTKADKKLLRIHVYQEQEHL
FT                   RVDVTDNGKGIKPEMLLKLAAGDRDVHGNHLGIHNVERRIQLVYGAPYGLHFDSRPGDG
FT                   TTVSFILPISKEDSV"
FT   gene            325115..326023
FT                   /locus_tag="Pjdr2_0270"
FT   CDS_pept        325115..326023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0270"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0484 transmembrane
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98950"
FT                   /db_xref="GOA:C6CS01"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS01"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS98950.1"
FT                   /translation="MKSASKKALFKKNVPLMLMFAPALAYYLIFRYLPIGGLVISFENY
FT                   NFFDGVFHSPWVGFKNFEMLFSNDKTLRIIWNTLWLSVLNLVVGFPVPIILALMINSVR
FT                   RSWYKRFVQTVVYLPHFFSWVIVGGMVITLFSMESSFLNHWIEDKYGEPYPFLYKTFSW
FT                   VTIFVGSGVWKEMGFSTIIYLAALTSISPALYEAAALDGASKWKQTWHVTLPGIRGTII
FT                   LVLILSMGRVLEVGFDQIYNLRNAMVSDISEVISTYIYTLGIQGGQFSLTTALGLFESV
FT                   VAFILILGANLIAKKFNSNLF"
FT   sig_peptide     325115..325192
FT                   /locus_tag="Pjdr2_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.961) with cleavage site probability 0.960 at
FT                   residue 26"
FT   gene            326036..326908
FT                   /locus_tag="Pjdr2_0271"
FT   CDS_pept        326036..326908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0271"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0481 ABC transporter
FT                   (permiase)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98951"
FT                   /db_xref="GOA:C6CS02"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS02"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS98951.1"
FT                   /translation="MRESYGDKITRIGISILLLLISISCLAPVINILSISFSGKQAVES
FT                   GQVLLWPIDVTLQSYSALFEGTRVLASLWNGVVMTVGGVLISMVFTICAAYPLSKGYFF
FT                   GRRTFTLMLLFTMVFTGGLIPTYLVVKSLGMIDSYWAIWMPGAVSTYNMLIMRSYFEGI
FT                   EPEIEEAARIDGCREMSLLFRIVLPLSMPVIATLILFYGVGYWNNFMNVLIYINSTEKY
FT                   TITVLIQQMIASQSLLTESLANDTSALELVPEGIKSAGIIVLILPMVIIYPFLQKYFVK
FT                   GVMLGSVKG"
FT   gene            326944..328629
FT                   /locus_tag="Pjdr2_0272"
FT   CDS_pept        326944..328629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0272"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bsu:BSU30160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98952"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS03"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS98952.1"
FT                   /translation="MLKMTKRNVLLAGASVTLLGVLAACGSNDNADNSGKSADSGSGKK
FT                   PTISATVYDRGLIAASEGTMEKNRWTQWINENSPTSVKFSAIPRTESKQKLNTLFASGS
FT                   APDLIFEFDPNIKNPLYDQKQLMPLDDMINQYSTTYKKLLEDNPILKSAATKSDGKMYE
FT                   FGKLNEAIPQNVIVIRQDWLDKLKLTAPKTTDELYQVAKAFAEQDPDGNGKKDTYGLNI
FT                   GPGITDMFGGTGLNNSYEDENGKLVRTWDNFKYYIDFAKHLYDEGIIDKDFITDNNGAK
FT                   ARQDFLNGKTGIYFVQANTNMWNRLWITDYATLKANVPGADLEIVPNPKSPLGQYTVWI
FT                   NNPVQMTAVVNRNAKDPKAIMEYVDFLSTPETGRTLAYGLEGVHWQAGPTGCPNPIDQE
FT                   KNKTELGYLGTDYNMIFSVVSGGKCSFLASSFNPDKPDEKLAKDKFNENMEILYKMIDE
FT                   GAKFPGLTHVEHLPTVPQDLLVDFQNASTEIGNLVTKAIVSGPSYSTDKAISDMQALWA
FT                   KFNGSKLDAFYQEWYTANKDTALMPDDIFQIVKDQKAIQEEILK"
FT   sig_peptide     326944..327039
FT                   /locus_tag="Pjdr2_0272"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.440 at
FT                   residue 32"
FT   gene            complement(328948..329367)
FT                   /locus_tag="Pjdr2_0273"
FT   CDS_pept        complement(328948..329367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0273"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: bha:BH2087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98953"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS04"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ACS98953.1"
FT                   /translation="MSLTLSMDFQYATTIEKLWSALTDSGKLGKWVANIHTGEAMENNF
FT                   KPEVGHQFQFHTQPNDYWDGIIDGEVLTVDAHNKLSYTWNSGGMKHTVTWTLLDLGEGK
FT                   VNLHLEQAGITNEQALHGAKYGWSKWCGELEKVVA"
FT   gene            complement(329422..329742)
FT                   /locus_tag="Pjdr2_0274"
FT   CDS_pept        complement(329422..329742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0274"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR; KEGG: bha:BH2086 ArsR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98954"
FT                   /db_xref="GOA:C6CS05"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS05"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACS98954.1"
FT                   /translation="MGDNDQLKDVFEAIADPTRRQLIRLLAEANAEVPLHELTKQFAMG
FT                   RTAVSKHLAILKSAGLVLDRKIGRETRYRLNVSPIQEIQDWAAFYSKSWSTNMQRLNHL
FT                   LE"
FT   gene            complement(329781..330203)
FT                   /locus_tag="Pjdr2_0275"
FT   CDS_pept        complement(329781..330203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bha:BH2085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98955"
FT                   /db_xref="GOA:C6CS06"
FT                   /db_xref="InterPro:IPR016944"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS06"
FT                   /inference="similar to AA sequence:KEGG:BH2085"
FT                   /protein_id="ACS98955.1"
FT                   /translation="MSKTVGAVTAANAGTKVQGKKVAYWSVTLLLAGALTLSGLGQLMK
FT                   LGGNVDLVANLGYPLYIMQILGVWKLLGVIAVLTPRFPRLKEWTHAGIFFLMTGAAFSH
FT                   LLDHDYGAGGFNVILPLFYAALNIASWTLRPEHRKL"
FT   gene            330385..330477
FT                   /locus_tag="Pjdr2_0276"
FT   CDS_pept        330385..330477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0276"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98956"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS07"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98956.1"
FT                   /translation="MQTNEKNRKGVRSLPVLMEIRMAMFPVNRA"
FT   gene            complement(330474..332105)
FT                   /locus_tag="Pjdr2_0277"
FT   CDS_pept        complement(330474..332105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0277"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98957"
FT                   /db_xref="GOA:C6CS08"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002102"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS08"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACS98957.1"
FT                   /translation="MARKRLSMLATICLAIAMLVPQYAMAAADPPSFSMTSDKSALNSG
FT                   DEVTVTVKGSKLQDVYAYELQVYYDSDLLTFKTGSEKTALVGFSTPAKVVADGGGESHL
FT                   VFAHTKSGSSPGDSGDLDLASFTFTAAANGKADVEVRKIRLVDSKLASSTIDSPYGTSI
FT                   QIGSSGGGSGGSGGSTGSPPAQPEGTLTVTTDQLKSGKSIEVPASATLIKLPANTDELL
FT                   GKDALNIITSGKAELSIPSGVFAELKKTLTAAQLQGGSIALTVKPVEGAAKPTLGTDTK
FT                   LSGPIYELKLQWIAADGTSYDLHQFKEPVTLRLPVDASTNPKLASIFYLPDSGAPEFVG
FT                   GTYGNGVYVAQLSHFSSYAILEINKNFSDVPSSYWASGVIKELFAKQIVTGTTASTFEP
FT                   NRSVTRAEFTALLVRALGLKAEGTPAFTDIPAGAWYAADVATAYKAGIVQGVSSTTFSP
FT                   GASITRQEMVTLAMRGYELMTGKPADATAEPFKDEASISAWALNNVKKAAALGIVQGRA
FT                   KGEFVPLGTSTRAEAAQMLYGIINKL"
FT   sig_peptide     complement(332025..332105)
FT                   /locus_tag="Pjdr2_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            complement(332163..334193)
FT                   /locus_tag="Pjdr2_0278"
FT   CDS_pept        complement(332163..334193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0278"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; cellulosome anchoring protein cohesin
FT                   region; KEGG: reu:Reut_B5142 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98958"
FT                   /db_xref="GOA:C6CS09"
FT                   /db_xref="InterPro:IPR002102"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS09"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACS98958.1"
FT                   /translation="MVQLSGPALTSVGNSFDVTVSLTGATGDATAGKFIFEYDPTQFEY
FT                   LSASSANSAVSIAGVNAVSGKVTIVTTDATGSLTTAGSLLTLTFKANAAADLSGISGTV
FT                   ELGIDDGSTVQTPEESLAVQITGAAEGDLNNNSVIDVGDLSVLIKYFGIASDDPNWTKV
FT                   ANGDFNKNNTIDVQDLASLGKKVLYDNGQPFQLMEADIMSIQNAMAAGKLTSEELVQMY
FT                   LDRINEYDDDIHSLITVNPDALATAKALDEERKEQGPRGLMHGIPIIVKDNYDTLGMPT
FT                   SAGCTCLKDNQTVSDAFMIKKLKDAGAIILAKANLSEFAINTDTNSSLGGQTLNPYDLT
FT                   KNPGGSSGGTGASLAANLGVAGLGTDTGGSIRIPSSWNSIVGIRPTIGLTSRDGIIPLA
FT                   LSQDVGGPMARTVSDAAILLDAVSGYDPNDIATAGSVGRKPASYTKFLDKNGLKGARIG
FT                   LVMDSSVIGSNQEVLALLNQAAQDMRDQGATVVGVNIPNIADILKYPSLSGYEFKFNLN
FT                   DYLSNTRFVDPNVVRYHSLQDIINSGTDFLSVLKSTLTTRNNVESLDTQEYKDIMLFRP
FT                   RTTQQSLLRLMADNNLDAILYPSTSGPAGSSSGNANRLSPFSGFPAISVPAGYVSSGLP
FT                   VGIELLGRPYEEGELIKLGYAYEQATHHREAPKSVPALTGK"
FT   gene            complement(334742..335389)
FT                   /locus_tag="Pjdr2_0279"
FT   CDS_pept        complement(334742..335389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0279"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   baa:BA_1541 NADHdh_2, NAD(P)H dehydrogenase (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98959"
FT                   /db_xref="GOA:C6CS10"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS10"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ACS98959.1"
FT                   /translation="MEKLLIINAHPNVDSPASVSLQVGHHFIENYRKMNPNESIEQIDL
FT                   YSEEIPELDRTVLGAWAKSASGEELTDEEKRVTGRMNEILQQFKNAKKYVIIMPLHNFN
FT                   IPSRLKDYMDNILIARETFKYTENGSVGLLTDGRSLLVIQGSGGIYTNNDWYTDIEFSH
FT                   KYLKSMFNFLGIEDYQIIRAQGTNVLDKAEVLEKAKKEAQEAAARLASKVTV"
FT   gene            335576..336076
FT                   /locus_tag="Pjdr2_0280"
FT   CDS_pept        335576..336076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0280"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   baa:BA_1542 uncharacterized protein family UPF0074"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98960"
FT                   /db_xref="GOA:C6CS11"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS11"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACS98960.1"
FT                   /translation="MQYSVGVEYALHCLVYLIPNESTIGIKELAFFQGIPETYLSKIFT
FT                   KLTKAGIVSSVPGVKGGFKLARVPDDISFWDVVEAVEGKKPIFQCQNIKDKGYLYRNRD
FT                   CSDCAASTGSCSINLVMLEAEETMQNYLRNKKLSWLEEELDRVLPAETRKQTREFFAKG
FT                   SSV"
FT   gene            complement(336144..336683)
FT                   /locus_tag="Pjdr2_0281"
FT   CDS_pept        complement(336144..336683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0281"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_4718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98961"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS12"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98961.1"
FT                   /translation="MRNTTEALQAFEKSVERYIDELGQFSLEQLLAKPSEEDWSVGQMV
FT                   VHLIRSAQYMHLRNVDQCIAGSEAVLVGTGVKTENGKAVFELGSFPPIRIRVPASPQYT
FT                   PQQPDNKEQLIAGLKDVAERMRSTEPTLNQAPPEHTVPHPNFGALNATEWFLLVEMHYR
FT                   HHFLQLERLKAFLEIQ"
FT   gene            complement(336750..337697)
FT                   /locus_tag="Pjdr2_0282"
FT   CDS_pept        complement(336750..337697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0282"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   gur:Gura_3521 helix-turn-helix, type 11 domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98962"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS13"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ACS98962.1"
FT                   /translation="MNKTDRQLAIMLELQRSKVIRAEDLASLYETSVRTIYRDIQALSE
FT                   MGVPIFGAPGHGYSLMEGYFLPPIGFSAEEAVALLMGADFIEQRLDGDYARVAKAAKSK
FT                   IEAILPETVREESTRVRETMRLLNAGEPRTGLREKDILGQVRRAILERRKISFSYKKKT
FT                   PEADGNRNSTREVAPYGLAFAQGNWMLIGHCGLRQDIRHFRLSRMTELAVLDTPFAMPH
FT                   GFNLNRYRPQDDRKEHIWIRANPEIADKIAETGNFYIESAEERTDGLWVHFRVRAPEEI
FT                   LPLILSWGGDVEVMEPESLRCRVREEAEKMLKRY"
FT   gene            complement(337717..338157)
FT                   /locus_tag="Pjdr2_0283"
FT   CDS_pept        complement(337717..338157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0283"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmy:Pmen_3081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98963"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS14"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98963.1"
FT                   /translation="MKINRIEMKSASRSDFVAIADGEKNTRFADLIIDGRSLFQMLKTY
FT                   DMVPSLGWMSQDCQREMIDYFLLRRPHETMWYRYPVMVCYWCGDEGCGFISVKVDRENN
FT                   IVTWKDFFLEPDMKKIDIGPFHFQWDHYKRVINSTFGVAGIQ"
FT   gene            338407..339630
FT                   /locus_tag="Pjdr2_0284"
FT   CDS_pept        338407..339630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0284"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sme:SM_b20158 ABC transporter periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98964"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS15"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS98964.1"
FT                   /translation="MFISKKKTALVLLTAASAMTIMSACGQDNKSSNTLSDAVPSDAPA
FT                   STNANATVPSADPSAAPAAESVDELYAKAKEEGKLIVYSTSGRANDAAETFMKQYPGIK
FT                   VEVSKVKSDEMMDKVTKEQDAGQFNPDVILTKEVSGAVEEEMVMTGRYIKYLPEDIAPM
FT                   VDEPYRTQAEAYANYVEFRTLFYNKSTYAEAPVTNWWDLTTPEFKGKVYTADPLSSPAF
FT                   MDLFTTMVINSDDMAAAYKEKFGKDIVLNGTDNAGYEFIQELFDNGLIVLKGSDDVLDA
FT                   IGKAKSEALGLAVSGDVSKNEEKGWTIAPIYDIKPKTSVPDSGYFFIANKAPHEAAAKL
FT                   FIRWMMGEKDGSGEGLAPFNEVGSWVPRSDVKTKNDISFEELNLWLFDGDALYKTAPKV
FT                   RDFWIKQK"
FT   sig_peptide     338407..338487
FT                   /locus_tag="Pjdr2_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 27"
FT   gene            339652..341478
FT                   /locus_tag="Pjdr2_0285"
FT   CDS_pept        339652..341478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0285"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: smd:Smed_3963
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98965"
FT                   /db_xref="GOA:C6CS16"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS16"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS98965.1"
FT                   /translation="MANKMALTVRSTRFYNGMLNGLRSPIHLIGLAALLFLAYTIAWPV
FT                   LKILYTTFLWRQQDVRLTGEANPGHFTLYHWTRVLASDISMNLFYKPILNSLGVGFAVS
FT                   ALSMLIGCGLAWLVVRTNVPWKKTIAFLAVIPYLLPSWIISQAWLTFFKNGKIGGTPGI
FT                   MEALLHVSPPDWLSYGFVPIVVSLSIHDSVFFFLIVGAALSSMNSQLEEAASVTGAARW
FT                   TILRRIVFPLVMPSILSGFILIFTKAISSYGVPALLGTPVNFYMISTMLYSSMRSRLTT
FT                   EANVLSLTLMLISMLTIYLNQRVVGRRKSFVTVTGKDSAKTLTSLGRWRYPAAGTAAAV
FT                   MILISVVPLLVLLFQSFMLKEGVYSLSNFTTHYWWGGSDPNINTGEKGVLQNDIFMLAL
FT                   KNSLYIAGVASVIAAVIGLILGYVVARGRQSWIGRMVDQVSFLPYLIPGISLAAIYISM
FT                   FAKPTLIIPALYGTITLLILITVVKELPFTVKAGSASMMQIGKELEEAAQISGASWLTR
FT                   FRRILLPLNRKSLMSAFLLVFIGAMKEMELIILLITPRTETLTTITFYYAEKGYEQLTN
FT                   VILMIIIAIVITVYFLAVKFGKADLTQGIGGQ"
FT   gene            341481..342725
FT                   /locus_tag="Pjdr2_0286"
FT   CDS_pept        341481..342725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0286"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: mlo:mlr8490 ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98966"
FT                   /db_xref="GOA:C6CS17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS17"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS98966.1"
FT                   /translation="MNAIELQGIHVVLDGKQVLNDIKLTIKQGDFMTFLGPSGCGKTTL
FT                   LRTIAGLQKADAGTITISGREVANGETRFHMEPSKRRLSLVFQSYALWPHMTVYENVAF
FT                   GLQVRKLAKAVVREKVEAALGKMRIAELAGRYPSELSGGQQQRVAIARAIVTEPDILLL
FT                   DEPLSNLDAKLRVEMRAELKRLHQELNTTVIYVTHDQHEAMTLSTQVAVFFGGQIVQLD
FT                   KPRELYKRPKTLQVAEFIGSAGMQMNRLEGVVRTDEEGLSWLETPVVLIPLATGENYSK
FT                   PPQLTSDVSLPHPSHLAGGVSMDEGQEVVLTVRPEDIRLYEERRPGSIAMSVSAVFPSG
FT                   AETLVQMDAAGMSLMARVIGESEYEPGTTLYAVLRQEQMNAYDKKTGIRMELQYANHNN
FT                   EPGESTHEDRLSYSR"
FT   gene            342697..343458
FT                   /locus_tag="Pjdr2_0287"
FT   CDS_pept        342697..343458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0287"
FT                   /product="PHP domain protein"
FT                   /note="PFAM: PHP domain protein; KEGG: dal:Dalk_4877 PHP
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98967"
FT                   /db_xref="GOA:C6CS18"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS18"
FT                   /inference="protein motif:PFAM:PF02811"
FT                   /protein_id="ACS98967.1"
FT                   /translation="MKIDFHIHVKLSKKTNFEIEHFNSMINEAKAQGLNAITLTEHFNT
FT                   HRFEDVYGTLDKMYPCNNHYYNVDGFKLFTGMEVDVAEGGHILVSGPKDKLLEVRAVLE
FT                   DHLTADRFIGLERLFELCHPRGLMVIGGHPFRESNHLYHIDKELLKRFDAFDLNGKDLH
FT                   EIGIQENIAKVLTLGAELGVPVIAGSDAHQMFQVGCVYNQFEGDFETVAELREAIRDGA
FT                   YKRVISPSLDLQVRAANYVKKLLKKKVEVVV"
FT   gene            343488..344321
FT                   /locus_tag="Pjdr2_0288"
FT   CDS_pept        343488..344321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0288"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: bpy:Bphyt_3133
FT                   transcriptional regulator, RpiR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98968"
FT                   /db_xref="GOA:C6CS19"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS19"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ACS98968.1"
FT                   /translation="MMQFEHAKLTRGHQRIADYISKNMDDVPFMIEEDIAAACGVSVST
FT                   VSRFWAEVGSKNLKEFKQRVKDEVLLSPARKLQSAFDKVGGDSGAAANVLSVADYLQQS
FT                   ADRIDQAAFDAAAAMLAGAGTVHIYGPGSAECLTALMDFRLSRFGADVRRLDRGGHELF
FT                   ESMVPIRPEDVIVIFGFVSESPEMAVLLDFARERGCRTLLITDLAVSPMLAKADISLFT
FT                   ARGQLWEFHSMVAPIAVIEALIVAVGKEWEQAALAGSEELHRLRRKYAKLLPKRV"
FT   gene            344543..346555
FT                   /locus_tag="Pjdr2_0289"
FT   CDS_pept        344543..346555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0289"
FT                   /product="Chromosome segregation ATPase-like protein"
FT                   /note="KEGG: sei:SPC_4629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98969"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS20"
FT                   /inference="protein motif:COG:COG1196"
FT                   /protein_id="ACS98969.1"
FT                   /translation="MNLVDMGMMEMNQIFLPELKRIEIKNFSLYKKDIHFEFIHGVNLI
FT                   VGGNGVGKTTFINLIKYGLIGLYKKELDVRTYKSEKRLVREQYSQFYFKNRMYDEELYK
FT                   NEDAEVILTFNINKTQFVVTRGLNEIILKKVIVIENNSSFELDGIPIRQDKYEKLDEDD
FT                   RKNFLQGRYEELVSSKSNINDFNDLIFFVNQILFFDEDRKTIIWEPLIQERLSSKYFND
FT                   PRLDEEFQEAKRQAKYHDSISRHKSEDIRAISKIVKRLEGETNDTQINGLNEINKLKKK
FT                   LDKANELLNDIQTERKGYEIKISICVNQRVNHNRKAKELEKQIKEEESSLYRKIWGTRN
FT                   PNYNIYYDNLKMLHLCPMCNQNVTEEHLTEENECFLCHQSITTEVEIPTNVKEMKLELE
FT                   KLLLLSQSCEKEIYNLENELRKMDSEYNKLKREVFELQSKVRELDHKMYSNNERSDESF
FT                   TYTAMMAELDELEREKQENVQLSDKYNHLADEIIQRIESNLSDITKELSGIFSDFAGDF
FT                   LGVDCRLTFDNLIKKEVKMYIPVIGDKVRLDPLELSESQRFFTDQAFRMSLLNYFYTTP
FT                   SFFVCETPDSSLDVSYEANAAQIFLKYLQQPNTLIVTSNLNNSEFLDLIIQRSTQISFL
FT                   NLLEYGKPSIIQKNSDILLGISKRIEEKINAKKTY"
FT   gene            346536..347171
FT                   /locus_tag="Pjdr2_0290"
FT   CDS_pept        346536..347171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98970"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS21"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98970.1"
FT                   /translation="MQKKPIELIFRVNGDVTSILSSGEEIGWDSISEYSIHRILYISSV
FT                   LYRFRFEELSFNPFEEDYDFSVSLRGPYSDIVPYSLKYLQANKYIFINEKGEYLLSTRE
FT                   LPDMSLMPNYQERSSWLEAVIYILGIYGEEKIYDFVFRDPQYQDNLQRNSIKEINIKEG
FT                   NKTELTLMKMKDAFEKTLGKAALELNNKRYLDMYFEYVFSKILRGETE"
FT   gene            347171..348247
FT                   /locus_tag="Pjdr2_0291"
FT   CDS_pept        347171..348247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: seg:SG2021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98971"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS22"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98971.1"
FT                   /translation="MQQFNFDSPDFLKEIGSRANDILLHARNQILNHPKFRILKAQYFD
FT                   KLWQNRINKGQLFTLILREEYLDTISFKKISKDYQTNMFQVSRDNNVIEVDDLLQVVNA
FT                   KTINFKTSTEAKKYFKDCSRDGYIVVFLGQVGLDIFIKGENTGENNFFYCTEDLTRFAE
FT                   KKDISQINEVIRSYQNSHLTNQSEYMVFFADNSTLRRIDESLVRRNILKNKPEKYMRDH
FT                   LRNYLNDRMKHTFLIETELSGSKRELDIYTEVNGEFYFFEIKWIGQSISDCGTKLTNPY
FT                   GDARAREGVTQTLEYIEEILDTMSINVRTGYLVIFDARDVSEDIDYQQLQFVSPGLKKY
FT                   MQLFEIIPQIKLNKRHPA"
FT   gene            348359..349669
FT                   /locus_tag="Pjdr2_0292"
FT   CDS_pept        348359..349669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0292"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sec:SC4351 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98972"
FT                   /db_xref="GOA:C6CS23"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS23"
FT                   /inference="similar to AA sequence:KEGG:SC4351"
FT                   /protein_id="ACS98972.1"
FT                   /translation="MKTYRSVKIKDWSTEYKGFVSANKNKKKSVNRWYPILEGFSNSFV
FT                   ESVINEQCKTNNLICLDPFAGGGTTPLVAQELGVKCYSFEVSPFMSQVCRAKLRNDYKS
FT                   AEFVGVVELLKSKLLEDGFTNDYRIELKTISKKKTLDKWLFHKTALTSLLNIRKAIEIS
FT                   TADFPVYYDILNVALGSILLQFSNVYRDGKAVKYKANWRTKYYKTKQIYNAYIEKCLGS
FT                   VLLDIQQIEASSSINKQINNQNYFINGDCRDLVGELNDNELDLVITSPPYLNSRDYTDS
FT                   HMIELWLLGHVHNYSDVRALRQKTMRSHVQVTWGEIPKPTSKILEECLFEIMKFQKKFW
FT                   NRNIPSMIVGYFKDIEELLSALRVKMKTKGKLYINVANSSYYGVIIETDRIIEEIATNL
FT                   GYSVLEIRLARKIKTSSQQYEEVKWLRESVIILENSK"
FT   gene            349800..352961
FT                   /locus_tag="Pjdr2_0293"
FT   CDS_pept        349800..352961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0293"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit;
FT                   helicase domain protein; SMART: DEAD-like helicase;
FT                   helicase domain protein; KEGG: dat:HRM2_39670 RecQ1"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98973"
FT                   /db_xref="GOA:C6CS24"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS24"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACS98973.1"
FT                   /translation="MKQGLYEQLINNVTLQQLTSLDTSAFDIGKEALDPEEARKLLSNY
FT                   IATVTRRALKAVRENSDTDEEAVLAQVRACNDIISTLKNALDQQDYEELQLAEQGEVLT
FT                   YVYAKLNSIRAVKEEKVLRPTTPLSQSSLFTGSHAEPNMLSELKHEILTSDRIEFLVSF
FT                   IKWSGLRCMIEQLEQFTARGGQLRVITTTYMEATDYKAIMELSKLPNTEIKISYDSTRT
FT                   RLHAKAYVFKRDTGFTTAYVGSSNLSNPALTSGLEWNLKVTEKDSYDVLKKIEATFESY
FT                   WNDREFSEFSGDNPAHEEQLKQALGKNYSKDQAQDAMFFKFSIQPYDYQKEILEKLEAE
FT                   RTLYGRHKNLLVAATGVGKTVISAFDYRRFAQRNPQRARLLFVAHREEILKQSLDTFRF
FT                   ILKDLNFGELHVGGNQAKSLEHLFISIQSLNSMKLTEITTPDYYDFIIVDEFHHAAAPS
FT                   YQKLLAHYEPQILLGLTATPERMDGKDVLRYFDDTIAAEIRLTDAIDRKLLCPFQYFGV
FT                   SDHVDLSQVKWTRRGYDQSELENLFTNNKIRATQILNSLRKYVTDLDEVKGLGFCVGVE
FT                   HALYMAKVFNEAGIPSISLHGGSSDEDRDQVKGRLARGEIKMVFVVDLYNEGVDIPEVN
FT                   TVLFLRPTESLTVFLQQLGRGLRLAEGKECLTVLDFIGQAHKDYNFHDKLRALLGKTKH
FT                   SVQHYVEHGFSSLPRGSFIQLEKVARDYILRNLKQATNNRRSLIHKMKYFEGDSGQKLT
FT                   ITNFLRYHGLSIQELYGGRTGNRTFRGLMVEAELLESFQFENGDYLTKRIPALLCLNSR
FT                   RLLRFLIGYLSGEKQVSTEEEQLMLNLFYYTFYRSEPKRNGFDSIGHGIRSIVACPQFR
FT                   EELLEILQYNESHISFVDESNAFPYACPLDVHCSYSTDQVLAAFGYWDETKSPAFREGV
FT                   KYFDDKETDIFFITLNKSDKDFSPSTLYEDYAINERLFHWQTQSRTSEESKTAQRYIHH
FT                   RQLGTRIALFVREYKEENNYTSPFIFLGEVEYVRHEGNKPMSFVWRLKTEMPPALVPAA
FT                   NKAIV"
FT   gene            352974..353372
FT                   /locus_tag="Pjdr2_0294"
FT   CDS_pept        352974..353372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0294"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bba:Bd2220 MutT/NUDIX
FT                   family hydrolase/pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98974"
FT                   /db_xref="GOA:C6CS25"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003561"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS25"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACS98974.1"
FT                   /translation="MIEVAAAIIENGQGQILIARRKQGKSQAGMWEFPGGKIEAGETAE
FT                   ACLKRELLEEMHIEINPYAYFGVNDHHYGATHIRLIAYKSTFVSGEIMLVDHDEYRWST
FT                   SAELGEFTFAPADILFVEMLEAGKQHGG"
FT   gene            353362..353565
FT                   /locus_tag="Pjdr2_0295"
FT   CDS_pept        353362..353565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmr:PMI3507 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98975"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS26"
FT                   /inference="similar to AA sequence:KEGG:PMI3507"
FT                   /protein_id="ACS98975.1"
FT                   /translation="MEVNELKQRIANLSIWKKNGQRAPHKPLLILLSLAEFQQQHTVLP
FT                   YEVVREKLKKLLVEFGPARNKV"
FT   gene            354092..354517
FT                   /locus_tag="Pjdr2_0296"
FT   CDS_pept        354092..354517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0296"
FT                   /product="Glycosyl hydrolase family 98 putative
FT                   carbohydrate binding module"
FT                   /note="SMART: Glycosyl hydrolase family 98 putative
FT                   carbohydrate binding module; KEGG: slo:Shew_2289 glycosy
FT                   hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98976"
FT                   /db_xref="GOA:C6CS27"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013222"
FT                   /db_xref="InterPro:IPR038637"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS27"
FT                   /inference="protein motif:SMART:SM00776"
FT                   /protein_id="ACS98976.1"
FT                   /translation="MDTSGFYQQFFINQWNDTWNNKKGPLKIAGKEYLHGFAADLGRVY
FT                   SEETAILYYNLDGKYTKLTGFAGIDDVSKNSASKGYLTIYGDDTELYRSNGLVGGDYAV
FT                   PVDINISGVAKLKIEFSIDETDGDSIAVDFVEAKITQ"
FT   gene            354782..357490
FT                   /locus_tag="Pjdr2_0297"
FT   CDS_pept        354782..357490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0297"
FT                   /product="alpha-L-rhamnosidase"
FT                   /note="PFAM: alpha-L-rhamnosidase; alpha-L-rhamnosidase
FT                   domain protein; KEGG: sus:Acid_5559 alpha-L-rhamnosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98977"
FT                   /db_xref="GOA:C6CS28"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS28"
FT                   /inference="protein motif:PFAM:PF05592"
FT                   /protein_id="ACS98977.1"
FT                   /translation="MQKIIRLRCEYNYNPIGIQTTQPRFSWELESSKRNCNQTAYQIIV
FT                   SNSEKDTFSGIGALWDSGKVESAETFHIEYTGSPLASGQRCYWTVKCWDQDGTLYEAEE
FT                   SAFFEMGILNSDEWTAQWIGADETIASPLFRTSFHIHKPIKQASIAVSGLGYFELYMNG
FT                   ERVGDHVLVPNWTDYDDRKIEGLLYSFDDQTSKRVHYLQYAVTDHVRQGENAIGVILGN
FT                   GFYNQTERTIEGKMRYGAPKLILQMALTYEDGTVDYIRSDEGWKCSSGPIVFNNVFYGE
FT                   IYDARLEQPGWDDYGFDDSTWEQARLVRSPKGQLTAQMSPPDKKISTLKPISRAEPKPH
FT                   IYIFDFGQNFSGWVRIRMQGEAGQQVTLRFAENLAPDGGLDTLSCGGNDQIQSDTYIMK
FT                   GEGIEQYEPRFVWHGFRYVEVTGYPGVPDLTDLEGIVVHVSVESTGEFTCSDPLLNQVQ
FT                   SAYRWSQLTNMHGGVPSDCPHRERLGYTGDGHLTAEAASYNFDMAAFYAKWIGDISDSQ
FT                   NKQTGFVPHTAPFNGGGGGVAWGSAYIIMPWTMYRLYGDRRLLAEHYDGMKSWISYLST
FT                   RNRGGYLVEFEEPDSWFLGDWCIPGANELPPTLVSTFYYAYTVRMMSEIAGVLGHNEDG
FT                   KQYAELFDLICAAFIEAFFDPETATYSIGRQGADLFPLVLGCVPEGYEDHVWERVLRHY
FT                   RDDLGGHLDTGIFGTFFLFELLSERGETDLALKMVAAKDYPGYGYMIENGATTLWESWD
FT                   GHDSHNHPMFGSVSSWFYKHVAGLAQHPDSVAFDQAVFKPFQAASLNHASASVHTIRGQ
FT                   YAIRWSREDSSSWACEIQIPPNCTAEVHFPLKNRNALISSIFEQGCNRNIWPSSDTDES
FT                   PDTIQWSTEPNDIVVTLGSGQYEFLVTINPE"
FT   gene            357625..358203
FT                   /locus_tag="Pjdr2_0298"
FT   CDS_pept        357625..358203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0298"
FT                   /product="phosphotransferase KptA/Tpt1"
FT                   /note="PFAM: phosphotransferase KptA/Tpt1; KEGG:
FT                   pst:PSPTO_4788 RNA 2'-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98978"
FT                   /db_xref="GOA:C6CS29"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS29"
FT                   /inference="protein motif:PFAM:PF01885"
FT                   /protein_id="ACS98978.1"
FT                   /translation="MKAMLNQAMEQSLSKLMTKILRHTPEQFGISLDPEDGSCGIHVLL
FT                   EAIQAQPKWAGITIEDIEQVVRNSEKQRFAIEDGRIRARYGHSHDRVQYTAGEPPAILY
FT                   HGTNRKALPSILGEGLHPMNRQYVHLSEGTHFATLAGSRRGELVILKIDTSRAKEAGVV
FT                   FFFAGNEVWLADRVPADCCSVFEREKGSR"
FT   gene            358206..358991
FT                   /locus_tag="Pjdr2_0299"
FT   CDS_pept        358206..358991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0299"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: xac:XAC0313 type V secretory
FT                   pathway protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98979"
FT                   /db_xref="GOA:C6CS30"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS30"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ACS98979.1"
FT                   /translation="MTNSIIDIGVNLMHRSFHEDRDQVVARAAENHVTPLIITGTSLRN
FT                   SVDAARYAGTYSGKLYSTAGVHPHDAKNCNEETIAKLRELSAMPQVVAIGECGLDYNRD
FT                   FSPRDVQRKWFGEQIRLALELDMPLFLHEREASADFIWMLKEHRVQNAVVHCFTGTLQE
FT                   LKAYLEMGYHIGITGWICDERRGKHLRELVRMIPLDRLMIETDAPFLTPRDLKEKPKDG
FT                   RNEPAILPHILQAVAECIGKPADEVARATTQTAKAFFRI"
FT   gene            complement(359036..359323)
FT                   /locus_tag="Pjdr2_0300"
FT   CDS_pept        complement(359036..359323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98980"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS31"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98980.1"
FT                   /translation="MSRSFKKSSAWTEQSTPNAIWAKRQAAKTVRRFTADISNGKWYRK
FT                   LYCPWNICDYRFYQTKQQAIQEWETSRWPSDLTKTRAEIINEWAKMYKRK"
FT   gene            359461..359943
FT                   /locus_tag="Pjdr2_0301"
FT   CDS_pept        359461..359943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aba:Acid345_3456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98981"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS32"
FT                   /inference="similar to AA sequence:KEGG:Acid345_3456"
FT                   /protein_id="ACS98981.1"
FT                   /translation="MKYFKSSLWSAINSGDPEVQERAKAEWKVNDQQYWTEYLRLEGRL
FT                   GKELYEFFHTFSFHDYDLKEYKLVQSEVHYEKVVDLYITVTGVQDEWTLVYNNISRVGI
FT                   TIDPPDWLNRRGFDDWGYDELLIVDDKTLSHEILFASGTALLVHFPDKKLSVKQFS"
FT   gene            360132..360332
FT                   /locus_tag="Pjdr2_0302"
FT   CDS_pept        360132..360332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0302"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein; KEGG: bar:GBAA2422 cold shock protein CspA"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98982"
FT                   /db_xref="GOA:C6CS33"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS33"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACS98982.1"
FT                   /translation="MEQGTVKWFNAEKGFGFIEVEGGNDVFVHFSAIQGDGFKSLDEGQ
FT                   RVEFNIVQGNRGPQAENVVKL"
FT   gene            360409..360618
FT                   /locus_tag="Pjdr2_0303"
FT   CDS_pept        360409..360618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bar:GBAA2421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98983"
FT                   /db_xref="InterPro:IPR025916"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS34"
FT                   /inference="similar to AA sequence:KEGG:GBAA2421"
FT                   /protein_id="ACS98983.1"
FT                   /translation="MMYSRKKTAEELPTELTVVWSCSSEQCKGWMRDNFSLSEAPVCFL
FT                   CQSPMIKEERMLAVVANTSFSHQK"
FT   gene            complement(360656..360952)
FT                   /locus_tag="Pjdr2_0304"
FT   CDS_pept        complement(360656..360952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98984"
FT                   /db_xref="GOA:C6CS35"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS35"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98984.1"
FT                   /translation="MIFIIGAGLAIAAAIVGWISYRSQIGKSVFGGLAAIAIFLASTVI
FT                   ATSATRTILDDTIYMTEIHSVLGSPTFIISTGYLMVYGIARMVAGIGRGAART"
FT   gene            361100..361921
FT                   /locus_tag="Pjdr2_0305"
FT   CDS_pept        361100..361921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0305"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH2961 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98985"
FT                   /db_xref="GOA:C6CS36"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS36"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98985.1"
FT                   /translation="MKRRSETLFDFSLVKMYYHISPEGAEHPIYDIPATGFFDPAILKE
FT                   ALQRSGETVQAISNALPASFIGTSLCKVSVVQLLFASMYNQLLDMYPDNINYQVEMHDD
FT                   HAHLGYKIKELRSIPVPTEPEERIAFLLQHWEEYFTNFITPAIEAIAEAGDLKPDAIWQ
FT                   QFSGQLKMTQDFIADHMQMPPLTEQFLADGKLLAEFLDPALFNRRRNPYYLANPRYVEN
FT                   PYKPEEKWLVPSSCCMYDRRENGTKCYTCPRMTSDEREARKCEILAEAAVH"
FT   gene            complement(362001..363440)
FT                   /locus_tag="Pjdr2_0306"
FT   CDS_pept        complement(362001..363440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0306"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   bsu:BSU03700 germination response to the combination of
FT                   glucose, fructose, L-asparagine, and KCl"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98986"
FT                   /db_xref="GOA:C6CS37"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS37"
FT                   /inference="protein motif:PFAM:PF03323"
FT                   /protein_id="ACS98986.1"
FT                   /translation="MTDTEPKTLQKQLDQNLAIIKQRFHHTTDLKIRDIQAAHLKASIV
FT                   YIEGLIDSKRLQESVIRPLLHMAPVERELVDYIRSNVIEAADATSSFHIQEISEGLVEG
FT                   KAVLLLEGYSKAILVDVAEWKERSLEKPISERAPRGPIIGLTEKASTNINLLRGAIKTP
FT                   DFCVDTHQIGILAKTNVSILYLNGVVDKQVLQFVQNRLHAIKVKYVTESRIVEEALEFR
FT                   KSIFPLSQTSERPDSIASSLYEGRVAVLVDGTPRAIIVPSLFTDNIQTPDEYHTRYGRL
FT                   TNRITRFIGFLLSIYIPAIFVALCNFHQSELPEAFAKVLIPKGVLINPLFEMILLIFIF
FT                   RTMIDIAFRLPQSLVILISLVGTITIGDSLVKVKLTHPFALVIVAATFMLTFLVLNKLV
FT                   AAISTLRFLFLFLGAFLDFTGIIVGTTLVIIYMAQLKSAGVPYLSPLIPFKPRELKDTI
FT                   IRGDLKKLLNSEHSYLREDNG"
FT   gene            complement(363533..364438)
FT                   /locus_tag="Pjdr2_0307"
FT   CDS_pept        complement(363533..364438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0307"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: vco:VC0395_A1224 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98987"
FT                   /db_xref="GOA:C6CS38"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS38"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS98987.1"
FT                   /translation="MNIDQLEYILEVAKVKSISAASNNLHVTLPAISQSITHLETELGV
FT                   KLFTRSRHGTFPTAEGIILIEKASEIIEKVRELREEAQSFTNTISGELRIATIPGPMSL
FT                   LVKTIAAFKRDFPNIRIEISETHSQEMITSIHQDKTDLGLLVLYKDLEPSVEGLKFTKV
FT                   MDVSMTCCVNKNSPLALRDRVKAEDLMRYPLALYNEDYIDWYVKHLNENYGATNLLFTT
FT                   NNLEAIRQALDDELAITLGLNYSFNYGNYQNYPIYKILDIDLPTAPPVPLGWMQSKSKA
FT                   NSKIIKTFIHRLQMQFPMPN"
FT   gene            364587..365342
FT                   /locus_tag="Pjdr2_0308"
FT   CDS_pept        364587..365342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0308"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: reu:Reut_B5463 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98988"
FT                   /db_xref="GOA:C6CS39"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS39"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS98988.1"
FT                   /translation="MRLKGKVAIITGAGTGIGKSTALRFAKEGAKVVVTDINEASVQQT
FT                   ADEVKKLGGEAIAIPHDVGSEDNWIQVVDEAVKTFGTIDVLFNNAGIYVIKPLFDTTVE
FT                   DWNRLMNINVTSVFLGMKHVIPVMLKQQRGSVINASSIAGIGGSPNHALYGASKGAVRT
FT                   MTKDVAMEFATQGVRVNSIHPGYINTAMVDYAAATTKRDKAELGQAVSPIGRVGSVDEV
FT                   SNLVLFLASEESSYMTGTEMVIDGGAMAR"
FT   gene            365380..366123
FT                   /locus_tag="Pjdr2_0309"
FT   CDS_pept        365380..366123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0309"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bov:BOV_1080 short chain dehydrogenase/reductase family
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98989"
FT                   /db_xref="GOA:C6CRT8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRT8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS98989.1"
FT                   /translation="MRFDNKVAIVTGGASGIGEATVRAFAAEGAKVVIADFSDRGTTVS
FT                   EELNSEGFDTLFVKTNVADEASVKAMVAATVKKYGKLDILFANAGIGAQGVTHELSMKD
FT                   WQRMIDINLTGVFLCDKYAIDQMLKQGTGGAVVNCGSIHSHVARNTIPAYSAAKGGVKL
FT                   LTQSTAIAYAQQNIRVNAVCPGYIDTPLIQGGSEEARQYLINLHPMGRLGTPEEIAKSV
FT                   LFLASEDASFITGTTLTVDGGYTAQ"
FT   sig_peptide     365380..365460
FT                   /locus_tag="Pjdr2_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.868) with cleavage site probability 0.862 at
FT                   residue 27"
FT   gene            366370..366648
FT                   /locus_tag="Pjdr2_0310"
FT   CDS_pept        366370..366648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98990"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRV5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS98990.1"
FT                   /translation="MSEPNQKELVNYLAEKTKVAAETISLVLKHEQAFIDKAQSTAKGQ
FT                   VIDIDSDELVDYVLKQRDVKLDEVTVEKILDTEMDYLVENGFAEYED"
FT   gene            complement(366716..367966)
FT                   /locus_tag="Pjdr2_0311"
FT   CDS_pept        complement(366716..367966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0311"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein; KEGG: sse:Ssed_2695
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98991"
FT                   /db_xref="GOA:C6CRZ1"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRZ1"
FT                   /inference="protein motif:PFAM:PF07907"
FT                   /protein_id="ACS98991.1"
FT                   /translation="MNVFWSKMAQPRFRTGVFIALLIIFAASVYQFNRMDEFTFNEQLG
FT                   SGYERYEKARVVEITKEQLEKDANIEGLYRGTQELKIKVLSGEHKGDILPVTNYLSTMF
FT                   NIHAKVGTKLVVNISTANASHFNVTIYNYYRAPYLYGMIAIFLAILWAIGGKKGLKSAV
FT                   ALLFTFSSIIFLFLPMLYRGYSPMLAAIIVVTTTIIATLLLLDGWSSKSLSAIIGTMIG
FT                   VILAGGVAALAGHLLHISGFNTNDSETLLIIADDTGMKVEGLLFAGVIIAALGAIMDLG
FT                   ISIASAVHEVYTTNRELGPRALFLAGMNVGRDMMGTMATTLILAFTGSSLMSLLVLYAY
FT                   KVPYDQLVNMNLVTIEVLQGMTGSIGVILTAPIVAFVSSRLMPYYDRMLARKAASAVEL
FT                   DQARPVPVDSEKTAVPQ"
FT   sig_peptide     complement(367871..367966)
FT                   /locus_tag="Pjdr2_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.805) with cleavage site probability 0.441 at
FT                   residue 32"
FT   gene            368127..369236
FT                   /locus_tag="Pjdr2_0312"
FT   CDS_pept        368127..369236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pat:Patl_2791 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98992"
FT                   /db_xref="GOA:C6CS40"
FT                   /db_xref="InterPro:IPR032809"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS40"
FT                   /inference="similar to AA sequence:KEGG:Patl_2791"
FT                   /protein_id="ACS98992.1"
FT                   /translation="MNRKRIRRLLAASMLGLFLLVAGLGGGTAALAHSGNSVAYSDIGL
FT                   QDGSIAYDLRIDMYDLRLAVAPNDPDVGDFSPEVLQKFVTEHKDDVENYLLDKIHLYAD
FT                   SLPLDGSLLTLEATVARDQPYAEAILRFDLSGKPEHFVLDYQPIYDDVDQWHMNYVTLD
FT                   LKQDGSDKQSYVLNFDKREVELGKISLLRAVKQFFILGIEHLITGYDHILFVLSLLIGA
FT                   RSIKQILGVVTAFTAAHTVTLLLAGFGVINLPGKLVESVIALSIIYVALNSILNKNASK
FT                   HNLFLAFGFGLIHGCGFAATLSEMRLDGGQMAASLLTFNVGIEFGQLMIVLLLYPVIHY
FT                   ARRIRWTMPAMSATISVFGLIWLIQRAFL"
FT   sig_peptide     368127..368225
FT                   /locus_tag="Pjdr2_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.898 at
FT                   residue 33"
FT   gene            369408..371600
FT                   /locus_tag="Pjdr2_0313"
FT   CDS_pept        369408..371600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0313"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; Ig domain protein;
FT                   KEGG: afw:Anae109_3838 metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98993"
FT                   /db_xref="GOA:C6CS41"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS41"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACS98993.1"
FT                   /translation="MFNVLKQQKGVRKGLYSVLVASVLATSLTATLVNAADEPGTGVST
FT                   QAVDPYAVSNVMLNPGADESQVNLTWYSAATQPVGTVVQIAKKADVVDGVFPVATAASF
FT                   NGTSSAAVTGFFSNKATITGLQESTDYVYRVGDGLDEHWSTAYNFSTKDSHDFSVMFVG
FT                   DPQIGAGGNAVTDGAGWANTLNKATQMFPDMSYIMSAGDQVNTASSETEYTNFLNPSQL
FT                   RNLPVATVVGNHDGAVNYKYHYNQPNESAQYGTTVAGGDYYYTYGETLFMVLNSNSSNS
FT                   ASHEAFMKDAIAANPNARWKIVTFHHSIYSAASHATDTEILNLRKVLFPVFDQLKIDLV
FT                   FMGHDHSYVKTYQMEGDQAIKGQSMDNGVFVNPKGIMYLTANSASGSKYYDLKTTLNDY
FT                   YSDVKSQLKVPTFSMINIDHNSISVDTYRTDTMAKVDTYTMVHTDMSGIEVTAPAKKNY
FT                   AVGELLDTTGLAVSKINLDGSKTALPLDQVTITGFDSATKGTKHVTVTYTIAGVPYTGT
FT                   FDVVVGTMVKIYAKKDTIIKEESPGAEFYLALGKSDKVNVLDVTFKFDSTKFTFDPATG
FT                   AELLDKTNGFLQANEVEPGTVRVIAGFQEHPITLTEFTDMIKLTFKPVNPDVDNVQADV
FT                   QLDNVVVNTSSENTDLDAIFDKLPSSILIRSYKDITDLFKDGKLTSADLSVAIDHYRAS
FT                   STDTDWANAKLADVNFDGKVDLTDFTIIILHIFQGK"
FT   sig_peptide     369408..369515
FT                   /locus_tag="Pjdr2_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 36"
FT   gene            371671..373368
FT                   /locus_tag="Pjdr2_0314"
FT   CDS_pept        371671..373368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0314"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98994"
FT                   /db_xref="GOA:C6CS42"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS42"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACS98994.1"
FT                   /translation="MMKKKLLAGLLFICFLVLPFNALAFAADSSTVQFSKQAIEVDKNA
FT                   SSFTVDLVLNSQTPFGSAEFGIKTDSHVQLKSVTYSQAIGSASQVSIKEKNGISYFGFF
FT                   DTSNHFSGSFTACTLTFTYTDSAAAVVTLAETTLTRLTGTGGATSESLTPNQTLQITRS
FT                   ASNTPGGGTTDPGNGGNTGTGNTGGSDNVYTQVIDNTKALEALEHAAPNSQNVKTISFE
FT                   VKSTDVGGAKEIAFQLPYSLFNADEKRQVEINTPFGTVTIPDHVIPAGQLGSAQSLTLR
FT                   IKQVDPASLPASAQQQVGSRPVLELHFELDGKAIEWKNEQAPVQVVLPYTLSATEKVNA
FT                   DLIVAAYIDSNGKLQIVPTGRFHAEDGEMSFSTTHFSLYTIVNSSKAFKDTTSSWARQD
FT                   IEALAIRGIINGTTADTFSPNANITRADFTKLLVGVLAKHAESTGAGFKDVTSKAYYYD
FT                   AVMTAQALGLASGSGDGKFNPGASISRQDMMVLLDRAFTAAGHPLKETASLPGYKDAAK
FT                   VAAYAKPSVEKLIASGIINGSNGYLTPQNNLTRAEAAKVLHLLYNELY"
FT   sig_peptide     371671..371751
FT                   /locus_tag="Pjdr2_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.699 at
FT                   residue 27"
FT   gene            complement(373594..374709)
FT                   /locus_tag="Pjdr2_0315"
FT   CDS_pept        complement(373594..374709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0315"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein; KEGG:
FT                   sfu:Sfum_1249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98995"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR025303"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS43"
FT                   /inference="protein motif:PFAM:PF07833"
FT                   /protein_id="ACS98995.1"
FT                   /translation="MRKPFKMLTIAVAGSCLLAFTPALAMAAESTAVPVAVTAEPITAV
FT                   PISAVLPDTQAVKVTTKVIEETSDLLTVKISVPVISGMLDTSYQDKLNASIEEKATKEI
FT                   DKLKALAADDKKSAQENDYPFRAYELNVAYELKADGSTAAKGIVSFTVSTYEFTGGAHG
FT                   GTAVEGYNIVNSQQAAELTLEQALGDGGFGAANSAVRYTISKNPDNFFWDAMTTFKIDA
FT                   GHTYFVDSKGNVNLVFQQYEIAPYAGGIINIPVDATTSVGPTLTLSTKDLTAGPNGAHY
FT                   IPLRKAAEALGYKIKWSNKTQSAEISRDAQWTSVTVGKNSYTINKMAPIQLFAAPKLIK
FT                   GSLYVPDEFFSKVLHLDVKNNTSNNSVTIKG"
FT   sig_peptide     complement(374626..374709)
FT                   /locus_tag="Pjdr2_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 28"
FT   gene            complement(374801..375199)
FT                   /locus_tag="Pjdr2_0316"
FT   CDS_pept        complement(374801..375199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0316"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98996"
FT                   /db_xref="GOA:C6CS44"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS44"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACS98996.1"
FT                   /translation="MSGSTAEAKITGSSTVLLVKDIQEASSFYLNLGFTYEEIGGHVHV
FT                   TRENITFILHPAVNKDDVRPNSAVQGGLYFDAFAYTDAVDLLAEECLAKDVEIVNGPNY
FT                   SEHWSEFTIKDADGYRIAFGGGVSARPE"
FT   gene            375865..378027
FT                   /locus_tag="Pjdr2_0317"
FT   CDS_pept        375865..378027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0317"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: sal:Sala_1014 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98997"
FT                   /db_xref="GOA:C6CS45"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS45"
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /protein_id="ACS98997.1"
FT                   /translation="MTKQSMTAILEQMTLEEKIFQLMQLTPNFLSEDDANLTGPLAWMG
FT                   VTENMVNNAGSVLSAVGAKETIALQKKYMENSRLGIPLLLMADIIHGYRTIFPVTLAIG
FT                   STWDLELAEKSAAIAAKESAVTGIHVTFAPMVDLVRDPRWGRVMESTGEDPYLNSEYAR
FT                   AFVRGFQGDDLAGDMDRVAACVKHFAAYGAAEGGRDYNTVNMSERQLRESYLPAYKAAL
FT                   DEGCEMVMTAFNTVDGIPATGNKWLMRNLLRDEWGFDGMLISDWGAVGEMIPHGVAADG
FT                   KEAALKAIEAGVDMEMMTSHYANHLKGLVEAGKVDIKLIDESVLRILKLKDKLGLFENP
FT                   YRAASEEREKEVLLSPGHRAAAREIAAKSFVLLKNEREALPLRSGQKLALIGPFAESGD
FT                   ILGPWSIWGKQEETVQLHAGLSAHKAADIVAVAKGSDIDAVTEEQLQEAVAAASQADVI
FT                   VLALGESSEMSGEAGSRGDIRLPEAQLELVRKLKPLGKPIVVVLFNGRPLDLHGVIEEA
FT                   DALLEVWFPGTEGGNAIADVLYGDVNPSGRLTMSFPYSVGQVPVYYNNYNTGRPLTLQN
FT                   ANERYVSKYLDMPNAPLLPFGYGLSYTSFSYSEASLSTDVMNAGDTLRVSVNVTNTGAS
FT                   AGEEVVQLYVRDLAGEVVRPLKELKGFRKLAIQPGETQAVTFEITEEQLRYYHADLQLK
FT                   SDAGEFHVFVGPNSRDAEAKSFRLTK"
FT   gene            378663..380489
FT                   /locus_tag="Pjdr2_0318"
FT   CDS_pept        378663..380489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bsu:BSU04320 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98998"
FT                   /db_xref="GOA:C6CS46"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS46"
FT                   /inference="similar to AA sequence:KEGG:BSU04320"
FT                   /protein_id="ACS98998.1"
FT                   /translation="MFTLIKRLLIGRPLKSTELGEQKLIKTKALAILSSDALSSVAYGP
FT                   EQILLVLMTVSAAAFWYSIPIGVGVLVLLTALILSYRQIIFAYPHGGGAYVVSKENLGV
FT                   FPGLISGGALLVDYILTVAVSVSAGTDAITSAFPSLHEHSVLISIVFVLFITILNLRGV
FT                   TESASILAYPVYLFVLAIFIMVGVGLYKIISGDVSPQLHTAVGTPVAGISLFLLLRAFA
FT                   SGSSALTGVEAISNAIPNFKDPAPNNAAKTLLAMGGLLSVLFAGIVFLAYYYGVAPKEE
FT                   VTVVSQIAESIFGRHTMYYFIQGTTALILILAANTGYSAFPLLAVNLAKDKFIPRMFTV
FT                   RGDRLGYSNGIISLGVLSIILIIAFQGKTEHLIPLYAVGVFVPFTLSQTGMLVKWFRQR
FT                   PKGWVGKFIINSIGALISFIVSMMFFLTKFEQVWSILIFLPLIIFVFHRIKKHYEAVGE
FT                   QLRLATCEPVMPIVGNVMILPVSGITHVVEHSILYAKSLKPEQIIAVYVPFEKEDETIF
FT                   EEKWEKFQPDVRLVTLHSPYRSISNPLFKFIDTVQRKASENNYQVTVIIPQFIPKKGWH
FT                   NILHNQTSLMLRAQLLYRKDVIITTVPYHLKK"
FT   gene            complement(380590..382794)
FT                   /locus_tag="Pjdr2_0319"
FT   CDS_pept        complement(380590..382794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0319"
FT                   /product="MMPL domain protein"
FT                   /note="PFAM: MMPL domain protein; KEGG: bar:GBAA2407 MmpL
FT                   family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACS98999"
FT                   /db_xref="GOA:C6CS47"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS47"
FT                   /inference="protein motif:PFAM:PF03176"
FT                   /protein_id="ACS98999.1"
FT                   /translation="MNGLKNIANAVSGKRGRWITLVLWILIVGLAGALLPSSSDHKDDA
FT                   AANLTSSAPSVQADAFNEHNGIPAIIAWHRTAGLTDEDIAQVQALSKKLADDPLPQQTE
FT                   LPPLHEMPLPALKAMLSEDGTTLLQTVVFDKNASSDELKVSLEQLQADADAIFTTKPFD
FT                   TALDDEGLVGRITGPAGIGVDATSLFKGADVSLLIATTLLVLIILLLIYRSPILALIPL
FT                   VAVGFAYGLTGPILGWMADEGWISYDSQGLSIMTVLLFGAGTDYCLFLIARFRSVLTEE
FT                   SDKKQALLKALGDSGGAITMSGLTVVMSLLALLLAQYGAIHRFAVPFSLSILIMMIASV
FT                   TLVPALLAILGRASFYPFVPRTPEMQAARAARKNKPLPAPKTKPAFGIRLGEAIVKRPK
FT                   TIAITTLIVLGITAAFSSQIKFTYDTLSSFPKDMPSREGFTLIGEHFAEGSLAKVQVLV
FT                   KTDGKDLPLDQKLGELANISSVSEPAANTKDSSIVSYNVELAMNPYSIEALDMIPTIRT
FT                   AAEQSLTDAGITDASDKVWIAGATAEQYDTRHVTNGDAYRVIPVIIGMIALLLLVYLRS
FT                   FVAMLYLMGTVLLSYFSALGIGWLVLHYLFGAEAIQGLIPLYAFVFLVALGEDYNIFMV
FT                   SSIWKKSKTMPLNRAIVEGVAQTGGVITSAGVILAGTFAVLATLPIQVLVQFGTVTAIG
FT                   VLLDTFIVRSFLVPALTVWIGKGVFWPSKQRSASVKEVEL"
FT   gene            complement(382791..383450)
FT                   /locus_tag="Pjdr2_0320"
FT   CDS_pept        complement(382791..383450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0320"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: afr:AFE_0255
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99000"
FT                   /db_xref="GOA:C6CS48"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS48"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS99000.1"
FT                   /translation="MGRRKKQPLDEATRAMIIKTAHDLFMEHGYRSVTTRQIAEACELT
FT                   QPAMYHYFADKEALYTEVLRTVTEETKTAMHDIVDSPGTVRERLIQVVAYILLNMPDDL
FT                   SQMERDIRHELRPENRQLITQWWRDCYLLPIAALFQEGQQTGQFRGIMEGGLDPYPSAF
FT                   TLLSMIQRKPGGPGGPVSTVPIEMLATRTIDVLLYGLASELGREESKIEQKGDEKE"
FT   gene            complement(383675..384523)
FT                   /locus_tag="Pjdr2_0321"
FT   CDS_pept        complement(383675..384523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0321"
FT                   /product="Aldehyde reductase"
FT                   /EC_number="1.1.1.21"
FT                   /note="PFAM: aldo/keto reductase; KEGG: baa:BA_0777
FT                   aldo_ket_red, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99001"
FT                   /db_xref="GOA:C6CS49"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS49"
FT                   /inference="protein motif:PRIAM:1.1.1.21"
FT                   /protein_id="ACS99001.1"
FT                   /translation="MTTAKHLNDKVILQNGVAMPWLGLGVFKVEDGSVVIQSVKDAIKN
FT                   GYRSIDTAAIYDNEAGVGQAVRESMAQHGIEREDLFITSKVWNADLGYESTLAAFETSL
FT                   NKLGLDYLDLYLIHWPVEGKYKDAWRALETLYKQGRVKAIGVSNFHVHHLQDLMKDAEV
FT                   MPMVDQVEYHPMLAQNELRAFTREHNIQLEAWSPLMQGHLLDHPVLGEIAAKHGKSVAQ
FT                   VILRWDLQNGVVTIPKSIKESRIIENAHVFDFELSSDDMAAIDALNEDRRVGPDPDNFD
FT                   F"
FT   gene            complement(384641..385849)
FT                   /locus_tag="Pjdr2_0322"
FT   CDS_pept        complement(384641..385849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0322"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; General
FT                   substrate transporter; KEGG: bsu:BSU29040 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99002"
FT                   /db_xref="GOA:C6CS50"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS50"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS99002.1"
FT                   /translation="MVTKQSRSALALLALAISSFAIGTTEFISVGLLPLISEDLDISVT
FT                   TAGLSVTLYAVGVTVGAPLLTALTSRVPRKTLLIAIMIIFILGNSLAASAGSIAMLLIA
FT                   RVISSFSHGVFMSIGSTIAADLVPEDRRASAIAMMFSGLTVATVTGVPLGTLLGQHMGW
FT                   RTAFIAIAVIGVIALISNLLLIPNTLRKGNRTKLSEPFKVLKNGRLLLAFAITMLGYGG
FT                   TFVVFTYLSPLLHDITGFKESTIAGILVLYGVAIAAGNLIGGKAANKKPLSALLVMFIL
FT                   QAVILLVLTFTAPYAVAALVTITLMGLLAFMNVPGLQMYVVLLAERYMPKSIDVVSALN
FT                   ISAFNAGIAIGAYVGGIITDELGLIHTPWIGAIMVLGAVALTAWSRSLENKDTKSKELK
FT                   ASA"
FT   sig_peptide     complement(385778..385849)
FT                   /locus_tag="Pjdr2_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.583 at
FT                   residue 24"
FT   gene            386008..386394
FT                   /locus_tag="Pjdr2_0323"
FT   CDS_pept        386008..386394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0323"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: bsu:BSU29030
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99003"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS51"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACS99003.1"
FT                   /translation="METTIIPPKKYNISVEATLEVIGGKWKCVILCHLTHGKKRTSDFK
FT                   RLMPSITQKMLTQQLRELEDDGIVNRIVYNQVPPKVEYELTPYGDSLRPILDSLCNWGE
FT                   QHIIKEYGSKAAVLEDNILNNLHD"
FT   gene            complement(386442..390197)
FT                   /locus_tag="Pjdr2_0324"
FT   CDS_pept        complement(386442..390197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0324"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; PFAM:
FT                   protein of unknown function DUF11; KEGG: bar:GBAA3601
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99004"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS52"
FT                   /inference="protein motif:TFAM:TIGR01451"
FT                   /protein_id="ACS99004.1"
FT                   /translation="MPFVNRFFLNRTGGATFTGNTLGLSRSETVGVPGTVDSIGGFTTT
FT                   NTALTFGTYPAGTTGNFALNSSSAVLVLPAGATVLYAELIWGGTYLNNGVDLSAFINNA
FT                   VSFTTPAGTFSISPDPATAQQVVLSSGTNAYVRSAAVTSLVTAGGAGTYTTGGVVGTIV
FT                   IPDPTSNHAGWTLAVFYEDVTQPLRNLSLRVGATVIQASQGPVDTVITGFATPFAGALN
FT                   GRALVGAQEGDANKTGDRMLFGQTAGSLTALSGPNNFATNFFASQINKNDGTLDTSGTF
FT                   GTRNQVNGTPGSNIIGGRQGWDITNVSVSSTLANAQTAAVFRLTTNGDGYLVDSVGLQI
FT                   DIQQPQLTIVKSADSSATVIGDTVEYTVVITNVGMVDTTSVVMFDSAIGNTTLVPGSVT
FT                   LNGVMVDEDPVLGVPIGTLTPGQIATVKFRVTVDSLPNPPFLKDQATAAYTFKATPDAP
FT                   PISTVVPSNIVEIPVFLPALVLEKEADLASAVVGDIITYTLTVTNIGNIAFAGVVNDPL
FT                   PAGTSFVAGSVYVNGLNQPGDNPNVGIDIGVLDFVQTTTIQYQLLVESVPPNNIIHNLF
FT                   NTAYVVTLPDGRIIRGTQPSNPVNIPVDSPMLTTVKSANLPSAVVGEIITYTVVATNNN
FT                   ATPLTNVILRDNIPVGSSFIPGSVTIDGVSFPTASPIDGIPVAVLPANTSITQTFQVRV
FT                   DFLPNPPELVNQAVETFTSGSFTGTSFSNEVTEPVVQPGIQLVKRAGVTEANVGDIVNY
FT                   SVTVTNTGNINIVPVLFDPLNAYSSFVAGTVRINGTLNAIASPITGIPVGTVAPGEAVV
FT                   VSYDVITTAVPPSQFYVNQANATYTYTPPGRTPLTGTGVSNEVLVRNPIYTLDVVKSAS
FT                   VATAVVGERILYTIEITNNGAIPATDVIVSDVVNAGTSVIPGSIQVNGVPAIGDLTAGL
FT                   NIGTLASGATSTVTFQSIVTSIPESFPRIDDFAVVRFNEDEVDRTPAVSNTVSIRVTQP
FT                   TITATKRALQSTAFVGEFINYVVEVENSGSYNALATWFDNLPEGSSFVANSLTVNGFPV
FT                   PGADHYKGLFLGTMIAGITNVVTFILQVVSYPPNGLLVNQGDILFQFILPNGQLVDQRV
FT                   RTNPVTVTVLRPPTVTKSVNVSEVFLGDSVIYTVVVNNPESTTLDNAVLQDIVPAGLSF
FT                   IPGSVSINGISSPSVNPAAGILLGVIGAFQTIRVTFAAQAVFEPENPLTENTASLAFNY
FT                   VTSGGQRIPGKVQSDPALVQILDNEE"
FT   gene            390475..390957
FT                   /locus_tag="Pjdr2_0325"
FT   CDS_pept        390475..390957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99005"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99005.1"
FT                   /translation="MKIPTTLKHKPVIVSENYEQVDGRYAEHTDAKGLSLGLAQWNDRG
FT                   KVEISAKVWRYTGEKWSRQSEELPLHRVLDLAILITRSMQHFREESYRYDNLYDPEKPV
FT                   IDRIGLQGDAMTVEVCTDNEKINQDIKLFNQALSDDDELNGERLSTLSRILKELGY"
FT   gene            391070..392854
FT                   /locus_tag="Pjdr2_0326"
FT   CDS_pept        391070..392854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0326"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; peptidase
FT                   M41; SMART: AAA ATPase; KEGG: gdj:Gdia_1207 ATP-dependent
FT                   metalloprotease FtsH"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99006"
FT                   /db_xref="GOA:C6CS54"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS54"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACS99006.1"
FT                   /translation="MRSYQWIKWRRFLLRLVVLVILVSLIWSGGPTAWNAALVVSSYLF
FT                   QLLFAVLFMIIQFAALFWFLSRGRTYWVLPGETGATWDDYRGNPEIVENAKRIVSLLRG
FT                   VKDFKKMGGEAIRGLLLCGPPGTGKSYLAQVIANEAQVPFAYASAPSFQNMFFGVGNLR
FT                   VMRIYKKARKLARMYGACIIFIDEVDAIGMSRQSGGGGGGMFGMGGGTGLLNELLLQMD
FT                   PPNLDSSRFKKFLRQLGLLRKKAERPPVLTIAATNLPDVLDQALLRPGRFDRQLWVDSP
FT                   DYDGRVDVFGYYLLKIKTDSTLTPEKAAMDTIGYSPAQIKHIVNEAVVIAHQRGAQEAG
FT                   YEDFRAAMETYEWGLKQPLRSMKDDEKRNVAYHEAGHAVAQFLLKPHERVWKVTIIRRG
FT                   GSLGLAATKPTHERYNRSDSEILAHIQVCLAARAVEEEFLGKKLNGVTSDLRQATESAG
FT                   AYLGMVGMGDELYSFLAAGSRMDALKSLRPQINELLKDQMQQVKKLVCDHADFVHKIAE
FT                   ELLLHGDLTGEEIEQIYQDLYGRPRPEPSEVKVTVTPTAPARAKEPAPPAAEPIEEAAE
FT                   REDNKEPESDPDQGEPES"
FT   sig_peptide     391070..391171
FT                   /locus_tag="Pjdr2_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.576 at
FT                   residue 34"
FT   gene            392946..393677
FT                   /locus_tag="Pjdr2_0327"
FT   CDS_pept        392946..393677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0327"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: pmy:Pmen_0263 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99007"
FT                   /db_xref="GOA:C6CS55"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS55"
FT                   /inference="protein motif:PFAM:PF00702"
FT                   /protein_id="ACS99007.1"
FT                   /translation="MVQEISLEKKGVFFDVDDTLYDHLSPFRQAVIAIVGDREGFPYEE
FT                   AYHRMRYYSDMLSLEMGGAGAMESGSSTELMRRRRFELALAEFGIALGEEQASAMQAAY
FT                   IGCQFNIAMFEGAKELIERLVKAGYVVGLLTNGAENHQLRKIRAMELDHLIPPARQFVS
FT                   GKIGWDKPDIRVFNHVNEATGTRPENSIYIGDSWRNDVVGALEAGWAVIWFNHREASPE
FT                   SREHTPNHTAVNYEQLAKLLL"
FT   gene            393741..394688
FT                   /locus_tag="Pjdr2_0328"
FT   CDS_pept        393741..394688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0328"
FT                   /product="ribokinase"
FT                   /note="TIGRFAM: ribokinase; PFAM: PfkB domain protein;
FT                   KEGG: pae:PA1950 ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99008"
FT                   /db_xref="GOA:C6CS56"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS56"
FT                   /inference="protein motif:TFAM:TIGR02152"
FT                   /protein_id="ACS99008.1"
FT                   /translation="MMNQRRPKLVVIGSLNMDIVVETSAYPQVGETITGQRVRFIPGGK
FT                   GANQAVAGARLGADTVMIGAVGDDAFGEELLGSLQKDGVDIAGVKRIEGTASGIASIYV
FT                   AEGDNSIVVVPGANGLVDPGDIDRSEDKLKEADLVLLQLEIPVETVLYAARKAKALGKL
FT                   VVLNPAPAQQLPEELFGLVDYFTPNRTELSGYADMSADGDSLEPAIRRMMELGAAHVVT
FT                   TLGASGSAYLDEEGKLVRINGYKMPVVDTTGAGDCYNAALAVALASGRDLRDAVDYASM
FT                   ASALAVTKFGAQTGMPAEEEVARFAKDQGKEFAG"
FT   gene            394755..395483
FT                   /locus_tag="Pjdr2_0329"
FT   CDS_pept        394755..395483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0329"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG: bar:GBAA3679
FT                   polysaccharide deacetylase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99009"
FT                   /db_xref="GOA:C6CS57"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS57"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ACS99009.1"
FT                   /translation="MKRFVLGVTVTALLCGFSAPVATKDRAYYEKRGEIIWEVPGENKR
FT                   IALTFDDGPYPDTTEPILDLLKEYHAKATFFVVGNRVENFPETIKREIAEGHEVANHTF
FT                   NHYFLQKKNYATVQNEIMKTEQALEKVTGKKPLLFRPPGGFYNDQMLAIAKKNGYTTVL
FT                   WSWHQDTNDWRSPGVQKIVNKVLNNARNGDIILLHDYVPRSVQTVEALKIILPELQRRG
FT                   YEMVTVSDLINNRDSVLNPY"
FT   sig_peptide     394755..394826
FT                   /locus_tag="Pjdr2_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.967 at
FT                   residue 24"
FT   gene            395704..396195
FT                   /locus_tag="Pjdr2_0330"
FT   CDS_pept        395704..396195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99010"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS58"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99010.1"
FT                   /translation="MGTRLWWEQAVRQRFPHIRYVTIRSCGHHKATIYAWDDQLELSEA
FT                   DAAKLHRYAMEWMSPDICVSVKPYNEAVADQVSCAKPDEELAKTALRGRLDQSAVFAVL
FT                   NNLFAGVVVSFNRYDVRTGTVHLAAYSHSPFTETAKSKIRHYAEELMPIGSTVNVTYYG
FT                   "
FT   gene            396422..396682
FT                   /locus_tag="Pjdr2_0331"
FT   CDS_pept        396422..396682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99011"
FT                   /db_xref="GOA:C6CS59"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99011.1"
FT                   /translation="MRLKRWRSTKYAATVAYLVLIVLGVTGMIPSRLSTSLVVILLGVV
FT                   LFIQSYEDARRGRTASMLFSAIGGIICISALTLILILTEFS"
FT   sig_peptide     396422..396505
FT                   /locus_tag="Pjdr2_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.363 at
FT                   residue 28"
FT   gene            396965..397666
FT                   /locus_tag="Pjdr2_0332"
FT   CDS_pept        396965..397666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0332"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   rsq:Rsph17025_3255 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99012"
FT                   /db_xref="GOA:C6CS60"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS60"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACS99012.1"
FT                   /translation="MNIISSLQPQQRKTLGDQIYDSIRESIVSFKLPPGTMIYENELAE
FT                   SMKVSRTPIREAIRLLVSEQLLEVLPQRGTRIALISARKVSEARFIREQLELGAFRLAS
FT                   VKWGERDRSAESAVFDSLLEQQRAAAEAKDIALFMQLDEAFHRAVLEIAGNETLMQMIY
FT                   YMRAHLNRARYLAIDQFGHTDRVIEEHRQLFEAIRSGDEQLVAARLEQHIRKLDQELPQ
FT                   LREANPDYFID"
FT   gene            397698..398771
FT                   /locus_tag="Pjdr2_0333"
FT   CDS_pept        397698..398771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0333"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="KEGG: bha:BH1063 mannonate dehydratase; TIGRFAM:
FT                   mannonate dehydratase; PFAM: Mannonate dehydratase; Xylose
FT                   isomerase domain protein TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99013"
FT                   /db_xref="GOA:C6CS61"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS61"
FT                   /inference="protein motif:TFAM:TIGR00695"
FT                   /protein_id="ACS99013.1"
FT                   /translation="MRMTFRWYGEGNDSVSLKQIKQIPGVEGLVWALHDVPAGEEWPMD
FT                   KIMEYKRLADEHGFHLEVVESVNVHDDIKLGLPSRDQYIENYKRTIEKLATVGVKVICY
FT                   NFMPIFDWMRTDLFKEMEDGSTALFFDKAKIQSMSAEELVSNIAGNSSYSMPGWEPERL
FT                   KRLAPLFEAYKDVTEEDLFNNLKYFLEQIIPVCEKHDIKMAIHPDDPPYSVFGLPRIVT
FT                   SRDNLARLLKLVDSPYNGLTLCSGSLGANPDNDIPALVREFADRIPFAHIRNVRVYENG
FT                   DFIETSHKSSDGTVDIAEVVRAYHESGFTGYARPDHGRHIWDEECRPGYGLYDRALGIM
FT                   YLWGVWDGLERIRKGNV"
FT   gene            398773..399621
FT                   /locus_tag="Pjdr2_0334"
FT   CDS_pept        398773..399621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0334"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   bha:BH1067 D-mannonate oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99014"
FT                   /db_xref="GOA:C6CS62"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS62"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS99014.1"
FT                   /translation="MVPNHENLAGKVAVITGGSGVLCAEMARELGRQGVKVAILNRTAE
FT                   KGEAVAREIREAGGVAIAVACNVVDAESVKEASAVVLEQLGSCDILINGAGGNHPDGIT
FT                   TKETFHPDDLENPDVTSFFDLKKEGFGFVFDLNLLGTLIPTQVFAKQMINKPGATVINM
FT                   SSMSAPSPMTKVPAYSAAKAAINNFTQWLAVHMADVGIRVNAIAPGFFLTEQNRKLLTN
FT                   EDGSLTERSNKIITHTPMRRFGKPEDLLGTLVWLADDSVSGFVTGITVPVDGGFMAYSG
FT                   V"
FT   gene            399731..400660
FT                   /locus_tag="Pjdr2_0335"
FT   CDS_pept        399731..400660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0335"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: scl:sce5048
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99015"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS63"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACS99015.1"
FT                   /translation="MKYRRLGSTDLNVSVIGIGTWQFGGEWGREYTQGEADAILDKGHE
FT                   LGINLIDTAECYGDHLSESLIGDYISRRNREDWIIATKFGHHFHERFTRTDSFDPAGVI
FT                   EQLDASLKALKVDYIDLYQFHSGPDQVFDNDDLWTALDKQVQAGKIRFLGTSIGSNANI
FT                   HQTEASTKVGSRAIQVVYNRLDRVPEEQVFPSCQRQDLGVLARVPLASGYLSGKYKPGA
FT                   VFSSTDVRHRHDAESTLEKLKEVERIQREEVPQGVDMASWALAWCLKHPAVTAVIPGCK
FT                   DPEQVASNALAAQLASEPHPQDVKLSKE"
FT   gene            400737..401156
FT                   /locus_tag="Pjdr2_0336"
FT   CDS_pept        400737..401156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99016"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS64"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99016.1"
FT                   /translation="MFRKWVAAGFVALVLVIAAGCSQKIVPDTAAIPDYAPFLTEQAGE
FT                   LLVVVLAKDKVQEETRAVNDMVAAMAGRFTPVIYDVNTEEGKKTVEQLGAGSGGYPAYY
FT                   LFDDQQLLAQGHDLPQIAQAAMDYKDRLSIGGTGG"
FT   sig_peptide     400737..400811
FT                   /locus_tag="Pjdr2_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.462 at
FT                   residue 25"
FT   gene            complement(401249..402241)
FT                   /locus_tag="Pjdr2_0337"
FT   CDS_pept        complement(401249..402241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0337"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bha:BH1706 polar chromosome segregation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99017"
FT                   /db_xref="GOA:C6CS65"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS65"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99017.1"
FT                   /translation="MTLLKTKEAAHQLAVSETTVRRWVSTFPASFRKDMFGHYIFDTPA
FT                   MDKLRKIKGQLDSGTALYDIRLLSLAEEETLAAVAAEVMGTAEAAPSVVAERPASKSDD
FT                   SGKLAVASRNIPVSNEVVGAGVGRAGGFVDNAGNLHTVGGNSSTGAAANPIGRSGVGAL
FT                   VVDSAGNVYAAGGEAEAQGAEASAEITTGLQHAAAAIDVTAGDRVSPAAQSPVESASQS
FT                   SKASQVIVPSAPVHPSSSLIDEPDPMLERLNAIEAALSQKADEVVTVQLLHHRKELEEL
FT                   RKSLTELSATIEALRTPQQELLAFGESAKAAAENEGKRKKRGLRSFFFF"
FT   gene            402757..404055
FT                   /locus_tag="Pjdr2_0338"
FT   CDS_pept        402757..404055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0338"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   bsu:BSU29990 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99018"
FT                   /db_xref="GOA:C6CS66"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS66"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ACS99018.1"
FT                   /translation="MDRLFKLKERGTTLTTELLAGITTFLTMVYIVIVNPGVLSEAGMD
FT                   FHGVFIATVLASIVATLIMGLFSNYPIALAPGMGLNAYFAFSVVGGEGVSWQTALGAVF
FT                   VAGVIFILLSLTSFRYMLLDAIPSSLKHAITAGIGLFITFIGLQNAKIVVASPATLITM
FT                   GDLSQPMTLLTIVGLIISLILMAYRVKGFLFIGMIITAIIAVITGQMHLPEKWAALPTG
FT                   LSATAFQLDIGGVFQNGLYAVIFTFLLITLFDTTGTMLGVAEQAGLLKDNKFPRSRGAL
FT                   LADAIGTTTGALLGTSPTSAYVESSSGVAVGGRTGLTAITVSVLLALTLFFSPTVSVLA
FT                   GIPAITAPALIIVGFLMINVLRKIDWSDIEEAFPAFLIVVLMPLTYSIATGIGIGFIVY
FT                   PILKLIRGKGKEVHPIFYVFAVLFFIQIGFFSH"
FT   gene            404157..404921
FT                   /locus_tag="Pjdr2_0339"
FT   CDS_pept        404157..404921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0339"
FT                   /product="Protein-glutamine gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.13"
FT                   /note="KEGG: bha:BH3970 transglutaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99019"
FT                   /db_xref="GOA:C6CS67"
FT                   /db_xref="InterPro:IPR020916"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS67"
FT                   /inference="protein motif:PRIAM:2.3.2.13"
FT                   /protein_id="ACS99019.1"
FT                   /translation="MLQISGTDAGDINPFALTPVERDVLQGKQNSPVVYQYDSMDSLRF
FT                   ELRLRDRTVNAARMLQDSRADFAVFRNSRCNPRYWTRTENGGFQMNPDVQPSDAINDIF
FT                   QNGENYGFECATAIVIVLYKAVLDTIGEQAFNKLFNPLYLRDWNHDSDLWFITTHNKNE
FT                   SYPGDVMYFRNPDFDRETPEWQGENVVKLSDNLFFGHGIGVETGEQIVSALNRMREPFS
FT                   TESAYLDDLVVHPNFQHLKQIAARGSRFAVRL"
FT   gene            complement(404987..405853)
FT                   /locus_tag="Pjdr2_0340"
FT   CDS_pept        complement(404987..405853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0340"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: ret:RHE_CH02597 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99020"
FT                   /db_xref="GOA:C6CS68"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS68"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS99020.1"
FT                   /translation="MAQIMDYMISSQPLRMIDLTVDPAKLSVRSLVIRNVGYLPGRTHF
FT                   RQGAVFQYWAIVYIAGGSGTYRVDHGEAQRVTAGSLFLFQPGFHYDYGPDPGGYWDEYY
FT                   FTIEGTRYREWLEHWPILPNTVMHPGEDASSQNRIDRIFALMDSGTPADADRAALTLES
FT                   LLYDWVQSCQSSPAAQGKTARLAQLLEALSGTLHEPFDAAAFAERHHWALSTLRRTVSE
FT                   YTGFALHEYVHRLKMAEAKNRLLNTEQTVKEIAAALGYGDVFYFSRLFKKITGEAPRLF
FT                   RRNMRSK"
FT   gene            405944..407050
FT                   /locus_tag="Pjdr2_0341"
FT   CDS_pept        405944..407050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0341"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: bha:BH2165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99021"
FT                   /db_xref="GOA:C6CS69"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS69"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACS99021.1"
FT                   /translation="MTKLKVGVIGAGSISGSHLHGYSVHPEVELAAIADLNGERAREKA
FT                   EAYGIPHVYDNYKDLLANPEIDAVSICTWNNSHAEIAVAALDAGKHVLCEKPLAKTVEQ
FT                   ALAVQEAVQRSGKQLLVGFVRRYADQAQLVKQYAESGQLGDIYYAKASAIRRLGNPGGW
FT                   FADSERSGGGPLIDVGVHMIDLCWYLMGKPKPVSVSGNTYRKLGNRSHIEGLSFYKAAD
FT                   YDASLNDVEDMANALIRFENGASLYVDISYTLHAAQNEMSSKIYGTKGGAEIDPKLVIV
FT                   TEQFNKIVNIEPQLDHLAFQFQDSFDLEVAHFVECCFGKAEPISPVEDGVELMRMLQAI
FT                   YESAALGAEVVLNTEAAASTAAAAKEGV"
FT   gene            407054..407950
FT                   /locus_tag="Pjdr2_0342"
FT   CDS_pept        407054..407950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0342"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sus:Acid_4909 xylose isomerase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99022"
FT                   /db_xref="GOA:C6CS70"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS70"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACS99022.1"
FT                   /translation="MTEPANTKINNPIGVIVESFGIGLNEGVKKAVEVGAEGVQIYAVS
FT                   GETDPANLSASARRELKDRIASLGLTISALCGDLGGHGFQDAEANPAKIEKSKRILELA
FT                   LDLGTNIVTTHIGIVPDDTNSPIYAAMQSSCEELSSYASSMGAYFAIETGPEPAARLKT
FT                   FLDSLTTNGVSVNFDPANMVMVTGDDPVQGVYLLKDYIVHTHAKDGIKLAAEIDPRVVY
FT                   GYLGFAGMSHDIIADMASDGALFREVPLGEGGVPFDRYLKALQEIGYKGYLTIEREVGQ
FT                   RPEEDIRKAVEFLRAFR"
FT   gene            408107..408226
FT                   /locus_tag="Pjdr2_0343"
FT   CDS_pept        408107..408226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99023"
FT                   /db_xref="GOA:C6CS71"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS71"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99023.1"
FT                   /translation="MNVPVGVWIFAAIIVVLLTWMTLWVTKKAYSKKWDDSDV"
FT   gene            complement(408288..409130)
FT                   /locus_tag="Pjdr2_0344"
FT   CDS_pept        complement(408288..409130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0344"
FT                   /product="protein of unknown function DUF191"
FT                   /note="PFAM: protein of unknown function DUF191; KEGG:
FT                   bha:BH2689 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99024"
FT                   /db_xref="GOA:C6CS72"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS72"
FT                   /inference="protein motif:PFAM:PF02642"
FT                   /protein_id="ACS99024.1"
FT                   /translation="MKIAFSPCPNDTFVFHALTHGLVPGAPEFDVMYADIDITNNLAAS
FT                   GDSDLDVLKISYAALPWVLKDYALLPCGGALGRGCGPLVLTKDKLEDASYLSGKRVAVP
FT                   SERSTAYLLFRLWAAQNVPGGVGEIIVMPFHEIMPAVRDGKIDAGLVIHEARFTYQNYG
FT                   LSMLVDLGSWWESDTGLPIPLGAIIARRSLDLGALSSWIEQSVEYAWKHPEASKDYVMQ
FT                   HAQEMDPSVAQQHISLYVNDFTGNLGSSGYAAISTLLNRAADEGLVPAIDPALLEFPG"
FT   gene            complement(409127..409789)
FT                   /locus_tag="Pjdr2_0345"
FT   CDS_pept        complement(409127..409789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0345"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   bha:BH2690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99025"
FT                   /db_xref="GOA:C6CS73"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR019963"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS73"
FT                   /inference="protein motif:PFAM:PF01048"
FT                   /protein_id="ACS99025.1"
FT                   /translation="MSENGKILVMTAVAVERDAVLRGLNGDDRFEVMEAGVGPVEAAVS
FT                   TATVLALASPDAYRLVISAGIAGGFKERAEVGTLVVSNAIIAADLGAETPEGFHSVDKL
FT                   GFGSAHIDVDGELAERLTSALQAAGLQTALGPVLTLSTVTGSAETAAGLAERIPGAAAE
FT                   AMEGFGVAAAARRAGLPVLELRAISNPVGPRDRSAWRIKDALQSLEAASSVLREVIV"
FT   gene            complement(409950..410165)
FT                   /locus_tag="Pjdr2_0346"
FT   CDS_pept        complement(409950..410165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99026"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS74"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99026.1"
FT                   /translation="MAINRRLTTDPDFEEAVKRKYPVRVFKDDFIVNNGGTVIRFDDNI
FT                   VVIQSSVSDLVYYTRAECEFFEVRKK"
FT   gene            410320..411390
FT                   /locus_tag="Pjdr2_0347"
FT   CDS_pept        410320..411390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0347"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /note="KEGG: bar:GBAA3427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99027"
FT                   /db_xref="GOA:C6CS75"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS75"
FT                   /inference="protein motif:PRIAM:3.1.1.31"
FT                   /protein_id="ACS99027.1"
FT                   /translation="MTLHNDKLTVFIGSYAEAENSGVYRYEFDTAEGTLTLKEQASGLK
FT                   NPTFLNVDAAKSRLYAIAEGADAEGAKVGDAVALSLEGSGLAQLNRKLAITAPSCHIQR
FT                   DADSEFVLLCSYHGGRISLVSLTDNGEIGEILDIQQHEGSGPHPNQKTPHPHSTNFSPD
FT                   GQYIFVPDLGIDRIVAYTLDKENRKLVRHGETVVQPGAGPRHMTFHPNGQFAFVINELD
FT                   STINSFRYDAEKGALEAVQTVSTLPEGFAEANGTAEIAISEDGRFLYGSNRGHDSLAVF
FT                   AVDAESGQLTLVGHVSTEGKHPRHFALVPGGHFAITANKDTNNVAVFRISESGMPVYTG
FT                   YSIEISQPVCVIPVQL"
FT   gene            411446..412381
FT                   /locus_tag="Pjdr2_0348"
FT   CDS_pept        411446..412381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0348"
FT                   /product="aminoglycoside/hydroxyurea antibiotic resistance
FT                   kinase"
FT                   /note="PFAM: aminoglycoside/hydroxyurea antibiotic
FT                   resistance kinase; aminoglycoside phosphotransferase; KEGG:
FT                   ott:OTT_0547 putative streptomycin-6-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99028"
FT                   /db_xref="GOA:C6CS76"
FT                   /db_xref="InterPro:IPR006748"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS76"
FT                   /inference="protein motif:PFAM:PF04655"
FT                   /protein_id="ACS99028.1"
FT                   /translation="MMQIPEHLCQTIRSVHGEKGEQWLAGFDKLLQDCEEKWGMTVELP
FT                   SPFVLSFNFVAPAVLRDGTPAVLKLGVPSREFRTELAALRLYDGRGAVRVLAADEERGA
FT                   LLIERVQPGVMLSSSGLGDDDAVLAAAEVMRRLAVPAPDGGEFPSVADWAAGLARLRER
FT                   HGGGTGPLPERVVGRAEEVFRRLLGEGGGGLLLLHGDLHHGNILSSGHGGPGWLAIDPK
FT                   GVVGEAEYGTIPLLLNQLPPKGQREVIRRRVELLCGALGLDHARLLAWGFAHAVLSTAW
FT                   CDEDGVGDIPAGLERAAWFEELLDELHQGQ"
FT   gene            413425..413970
FT                   /locus_tag="Pjdr2_0349"
FT   CDS_pept        413425..413970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0349"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cti:RALTA_A2979
FT                   putative transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99029"
FT                   /db_xref="GOA:C6CS77"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS77"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS99029.1"
FT                   /translation="MTPREKDFHAVTNRKEQILDAAASLFANNGYYKTTTAMVAAEVGV
FT                   TQPYVFHFFKSKEVLYLAVLERAQKRLLHAFSQVEAPAEMLHHHMGEAFNELMATHRDE
FT                   TLLCMQSYTTPEPNVRVIVKQRFAEVHQLITERFERAGISNPSQQASTFIACGMVITMS
FT                   EILELPILGDLGQLGHTE"
FT   gene            414182..415618
FT                   /locus_tag="Pjdr2_0350"
FT   CDS_pept        414182..415618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0350"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rso:RS03124 transmembrane efflux transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99030"
FT                   /db_xref="GOA:C6CS78"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS78"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACS99030.1"
FT                   /translation="MVSTASRVRLLVVTCIALFMAMLDNLVIGVALPSIQEEFHASMSD
FT                   LQWFLNAYTLAFAVLLIPFSAIGDRFGRKKIFLLGIVLFTLGSLASALSTSSIELSLSR
FT                   ALQGIGSAAIIPLSLTLVNAAFPPEKRAAAIGLWSGISGLGLSIGPLVGGIIINGAPWE
FT                   MVFWINVPVGIIAVILGALWLTESKGERKPLDLPGIVLLGVSLFGIVFGLMRGNSEGWD
FT                   AFNVWGAIAGGVVLLLGFYFWERSRKQPFIQFEYFKSRTYSAYLSAGFWMNAGIFGAIF
FT                   LLTLFLQQAQGYSALGAGVREMVWTVCTMICAPLAGLLVGKYGSKKILLFGLFLQTAAM
FT                   IYFALMIIGKGAIFPFGYIAPAMVAAGAGMGFSFTPLSHGILTSVPEHAAGEASGLSNA
FT                   SRELGGVFGVAISGLIFESGGAITSPKGFGDHIVPALFVLAAMLAIGFLSVTFLVRRGK
FT                   PATTAASEASGPTPRIETSN"
FT   gene            416543..417307
FT                   /locus_tag="Pjdr2_0351"
FT   CDS_pept        416543..417307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0351"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   bsu:BSU36260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99031"
FT                   /db_xref="GOA:C6CS79"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS79"
FT                   /inference="protein motif:PFAM:PF02706"
FT                   /protein_id="ACS99031.1"
FT                   /translation="MSSQLDLKEIVWLIRKKLWLVVLVTVLGASAAGAYSAWVMKPVYE
FT                   AYTKLIVNSTAGQAGSFKLDLNMINTNLSLINTYKEIIKTPAIMDLVVKKHPELGLTTQ
FT                   QLMHNIRFSSVNGTQVVTISYLDTDYKRAAQVVNTVSYVFQQQIPLIMKVDNVYILHTA
FT                   DSNDQPVKVKPETKLNIAIGFVAAFLLSITLVLALNYFDDTLRTESDVERYLGLPTLAA
FT                   IPNIKQGDLKPKALAIGKTTIGKEGEKNNVSQ"
FT   sig_peptide     416543..416653
FT                   /locus_tag="Pjdr2_0351"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.474 at
FT                   residue 37"
FT   gene            417294..417980
FT                   /locus_tag="Pjdr2_0352"
FT   CDS_pept        417294..417980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0352"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="TIGRFAM: capsular exopolysaccharide family; KEGG:
FT                   bha:BH3668 capsular polysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99032"
FT                   /db_xref="GOA:C6CS80"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS80"
FT                   /inference="protein motif:TFAM:TIGR01007"
FT                   /protein_id="ACS99032.1"
FT                   /translation="MSRSDLKLRPVVADANPTSPISEAYRTLRTNLQYAETDRPLQLLM
FT                   VTSAGPEEGKSTTILNLAVTYAQMERRTILVDADLRKPTSHYNFGLSNRTGLSHVLSGQ
FT                   ADLSEVIKETRIKGLDVLPSGPVPPNPSELLGSSRMEELLGKLREQYDMVLIDTPPVLA
FT                   VADAQVVANKCDGVLLVVNARTGKKQHAIKAKNALKFVQARIVGIALNQTAHREAGPYY
FT                   EYVDRT"
FT   gene            418115..419944
FT                   /locus_tag="Pjdr2_0353"
FT   CDS_pept        418115..419944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0353"
FT                   /product="polysaccharide biosynthesis protein CapD"
FT                   /note="PFAM: polysaccharide biosynthesis protein CapD;
FT                   3-beta hydroxysteroid dehydrogenase/isomerase; Male
FT                   sterility domain; short-chain dehydrogenase/reductase SDR;
FT                   dTDP-4-dehydrorhamnose reductase; NAD-dependent
FT                   epimerase/dehydratase; KEGG: bha:BH3718 capsular
FT                   polysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99033"
FT                   /db_xref="GOA:C6CS81"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS81"
FT                   /inference="protein motif:PFAM:PF02719"
FT                   /protein_id="ACS99033.1"
FT                   /translation="MRAHYRTKVIVAGDLAAVLASFAIAYALEPSVPQGGAVAWLSYAA
FT                   LAAVVGFWRLHRLRLHRRIWQYTGISDMLCLLQVALISAVVPFAAWWVMQGEAHPLLML
FT                   HHAAGTFLLLTAPRLAWRIFCDKYSVRKPAGGRRALIIGAGSCGTLIAKEMMQNDGVSV
FT                   TPVGFIDDDPYKHRMDILGLQVLGNRKEIACVVESHHIDEIIIAMPSVSKTQISELVNL
FT                   CKTTKAKLKIVPDLQDMIDNRGAAGRMRDVSVEDLLGRDPIRTDLEHIAGYVQEKVVLV
FT                   TGAGGSIGSELCRQIAPFKPSKLLLLGHGENSIYTIEMEMRSAFPQLAIETVIADVQDR
FT                   TRIDAVFAKFKPQVVFHAAAHKHVPLMERNPAEAIKNNVFGTKNVAECADAYGAERFVL
FT                   ISTDKAVNPTSVMGTTKRIAEMFIQSLDMHSNTKFVAVRFGNVLGSRGSVIPRFKDQIV
FT                   KGGPVTVTHPEMVRYFMTIPEAVQLVIQAGSFAKGGEVFILDMGKPVKIYDLAVDLIRL
FT                   SGYEPHVDIDITFSGMREGEKLYEELLTNEEGLSSTKHNRIFIGRPVQLNRKELDFEIR
FT                   KMEKVLGQHPDDIRAVLQHLVPTYRNGSATAAG"
FT   sig_peptide     418115..418198
FT                   /locus_tag="Pjdr2_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.761 at
FT                   residue 28"
FT   gene            419979..421385
FT                   /locus_tag="Pjdr2_0354"
FT   CDS_pept        419979..421385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0354"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; KEGG:
FT                   mlo:mlr6757 exopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99034"
FT                   /db_xref="GOA:C6CS82"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS82"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ACS99034.1"
FT                   /translation="MKLGGKEGSASSASTGAGSIRTLITSRLSRGGGASFLINSVGMGL
FT                   AMLLQIALARLLGVQDYGIYAFVTTVVTFMVFPAKLGFDTATVKLVSAYRVKGDWPLIK
FT                   GLLRRSNQIGFTLSVLAALIGIAVVALMDWGRGGQSGSEAHAKSIAYIAGFAAIPLLTL
FT                   ATLRQSALQAMKDALFAQMPEKIIRPVLTIGFVAALGAAGVKLGAAMALLCFAIATAVT
FT                   YVIGAIVLKKRIGTQTAAIKPNYETRGWLRLSSSLMINAGMYLILGQLNVLMMGFMRGE
FT                   TESGLFSAAVRLAVLVSFMLTAVNMTASPLVSEKYAKGDMAGLQRVCIRTGRIGFAFAA
FT                   VVFAYFVVRGHWTLGLFGPEFTKAYPSLLILAFGQLFSAYCGQNGTVATMTGRQNALTK
FT                   VLIAAAILNAALNALLIPTMGMLGGALASTLSIIVWNSAAVLLVRRKPGVQTLAWAPSL
FT                   SFARKRGNYS"
FT   gene            421382..422623
FT                   /locus_tag="Pjdr2_0355"
FT   CDS_pept        421382..422623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0355"
FT                   /product="polysaccharide pyruvyl transferase"
FT                   /note="PFAM: polysaccharide pyruvyl transferase; KEGG:
FT                   mes:Meso_2576 polysaccharide pyruvyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99035"
FT                   /db_xref="GOA:C6CS83"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS83"
FT                   /inference="protein motif:PFAM:PF04230"
FT                   /protein_id="ACS99035.1"
FT                   /translation="MKKVLLAGVPKSPNLGDGLIAYTLNRIISMRGKHQVIHFDLLDGR
FT                   CDQSMPIYSARGGLHYALAGPPASAAAQYASAPAVKLNSAGSSKKMTPDLLRRLKAYWI
FT                   HRSKNEKLNRELQQAVEESEAVFIGGGHLLIDTYWTFPLAVRRVADEAKRQGKPLHILL
FT                   VGARGPWSTQAKRWLLGACRYATSIAVRDEDSRRFLIDLDPKLAVKTVTLADPALFTPE
FT                   AFGLTEAAAGQEKPGRRKVGLGVMDPHEMNRHCELRWEREACADWWLQAAKVAIGAGHN
FT                   VSFFTNGAASDNAFVEEFVKPRLAGLKGVEFTPYPTTVEQLVGTIAACDTVIAQRLHAC
FT                   IPSLAMGKPTYGLIWDRKLENIFADLGMKSQLIDFRESRQQLAAAVDGRMADSGPAIDA
FT                   KKLQLYEHIGRILP"
FT   gene            422620..423759
FT                   /locus_tag="Pjdr2_0356"
FT   CDS_pept        422620..423759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0356"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   ank:AnaeK_4421 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99036"
FT                   /db_xref="GOA:C6CS84"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS84"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACS99036.1"
FT                   /translation="MSHTKIKVLHVVGRMHPGGIETLLMNVYRNIDRDKYEFHFAVQSP
FT                   EPSFYDDEIRALGGTIFVQPPPKDGIRSFRKQLTANMNKYGPYAAVHSHVFGFSGYVLK
FT                   LADKLGVPVRISHSHNTSDSKSTSLVRNLYRSYMRSLISRHSTNMLGCSRAACESLFGN
FT                   GCWKDGRVDVFPNAITLAPYESLVQENREELRRRFGAAEDELLIGHIGRFSKQKNHALL
FT                   LDSFASLVKQHPKSRLLLCGDGPLRPEMEEKARGLGIADKVNFLGLRKDVPELLGALDA
FT                   FVLPSLYEGLGIVLIEAQAAGVPCLISETVPREADLRIGLIERLALNDPPERWAEAMAS
FT                   IGERRARGGGEWQERAAALGERGYDIRVSAEKLERLYAG"
FT   gene            423749..425095
FT                   /locus_tag="Pjdr2_0357"
FT   CDS_pept        423749..425095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99037"
FT                   /db_xref="GOA:C6CS85"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS85"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99037.1"
FT                   /translation="MQADRLVDTRKIMLVGYSVLLILTAKWAFAADERLSLILYSGLLL
FT                   PFFVLMRWPNAPVLLMVSFTATLAGKAIYAATVNPLAGPDEIHYYEQVTTFEKLSQFMP
FT                   YAMEQIQTSWMNISAYPVFGLLYMPFFKWLELDDPLAIILFNTVLLILIVNSTYKLNAS
FT                   RFGYELPDPENARQPFIIVSVVGLMLSPSLMYMSSLFAKDITCVWLGLLGAQLLVRKRW
FT                   LLFILVILYATGLRDYAIIYTLSFYFLYTQKVRTSLCVMAGAAGLLFLQIGPLGIINAT
FT                   MLSIFLFISPNPINFSNWEPELLLRTLEAVFMGIILMISVYQAIVYKETRKFYLMAAAL
FT                   IFTYACTLVLVGYVTITGRELDYGVGTIGDNMVRKKLPVLPVLYTIAAYAIMWCRRIFI
FT                   LKHRKIQSLKAEQDRESKQLEAARVPAGGAAAPAWHERLAGGKGAQGHG"
FT   gene            425088..425768
FT                   /locus_tag="Pjdr2_0358"
FT   CDS_pept        425088..425768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0358"
FT                   /product="Acetyltransferase (isoleucine patch
FT                   superfamily)-like protein"
FT                   /note="KEGG: rlt:Rleg2_5291 transferase hexapeptide repeat
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99038"
FT                   /db_xref="GOA:C6CS86"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS86"
FT                   /inference="protein motif:COG:COG0110"
FT                   /protein_id="ACS99038.1"
FT                   /translation="MGEQEQRRRAGEWTGDRLERSAVHKTKKRGRDQFGRFRGLLRVAE
FT                   AALKPVPRPLLQWMWVLSDWLPDLPGVAMRYVLLRRMAKRCGDNVLIGRSVELRYPERL
FT                   VIGSNVSIHKQCYIDAYGGLIIEDEVSIAHQSSVVSFQHTWNDPSLPIRDNPVMGSAIR
FT                   IGRDVWVGCGVRILAGVEIGARSVIAAGAVVNKPVAAGTLAAGVPARAVKSIGTGTSPA
FT                   PEGA"
FT   gene            426154..427479
FT                   /locus_tag="Pjdr2_0359"
FT   CDS_pept        426154..427479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0359"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   maq:Maqu_2615 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99039"
FT                   /db_xref="GOA:C6CS87"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS87"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACS99039.1"
FT                   /translation="MNVLWAHDHTFYFNESGKFFSGGKLPYAVWERYLGVFDQITVAAR
FT                   GKKASSDEDMAGKTLSSGPNVDFLVLPSLSNPVNKMTKRGYIEQLLQEAIGKADAVIAR
FT                   VPSEIGAEAIRVARQMGKPYAVEVVACAWDGLWNYGNLQGKLYAPFSLNQTRTIVKDAP
FT                   YALYVTERFLQQRYPNIGGKTESCSNVEIPEPGDEVLTRRLERLQAMSPDAPMTIGLIG
FT                   SLNGRTKGIDIALRAIAKAKQQLPSAKFRVLGDGDPARWQAMAEKLGIGSMVSFEGVLP
FT                   SGGAVFEWLDGIDLYLQPSYQEGLPRATIEAMSRGCPVLGSMAGGIPELIHESCLHRPG
FT                   QVGQLAEQIKRATFDRKWLKEQAEQNFGKSKQFTKQRLDAKRQAFWQSFGDMVRQGALK
FT                   DSVAEAAAAGEQILSDKTGQDEAYTGSETTSTSESRERVGAI"
FT   gene            427476..428522
FT                   /locus_tag="Pjdr2_0360"
FT   CDS_pept        427476..428522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0360"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; polysaccharide biosynthesis protein CapD;
FT                   short-chain dehydrogenase/reductase SDR;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: sat:SYN_01112
FT                   UDP-N-acetylglucosamine 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99040"
FT                   /db_xref="GOA:C6CS88"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS88"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS99040.1"
FT                   /translation="MTILVTGAAGFIGFHLSARLLKEGKRVVGLDNFNDYYDVQLKRDR
FT                   WSQLVASPSFKGAEQDLADYEGLLALIREEGVTTIVHLAAQAGVRYSLTNPFAYLETNL
FT                   QGFGHVLEASRQAGIKHLVYASSSSVYGANVSMPFSVSDNVDHPVSLYAATKKSNELMA
FT                   HAYSHLYNLPTTGLRFFTVYGPWGRPDMAYFSFTQKIMAGEPIQVFNEGKMQRDFTYID
FT                   DIVEGIYRLLDQAPQPNAEWDRVDPDPGTSYAPYKVYNIGNNKPVELMAFINTIEDKLG
FT                   RKAVMEFKPMQPGDVTATYADIDGLMADVDFRPETTIEEGIGRFAEWYKSYYGAHSDLE
FT                   TAVKAAGQ"
FT   gene            428519..430318
FT                   /locus_tag="Pjdr2_0361"
FT   CDS_pept        428519..430318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0361"
FT                   /product="Undecaprenyl-phosphate galactose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="PFAM: sugar transferase; glycosyl transferase group
FT                   1; KEGG: dde:Dde_0362 sugar transferase involved in
FT                   lipopolysaccharide synthesis-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99041"
FT                   /db_xref="GOA:C6CS89"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS89"
FT                   /inference="protein motif:PRIAM:2.7.8.6"
FT                   /protein_id="ACS99041.1"
FT                   /translation="MNRKIAHICTSGISHKIMGDKLRLLQQQEGVQVTFISSPEGVDAE
FT                   LMKEKAYPFEWKLLPMARSIQPVADLRSILAMYKLFRRERYDIVHTHTAKAGLIGRIAA
FT                   KLARVPVVIHTSHGLPFYEGQSKKTYWLYKMLEKFGAVCCDALASQNEEDAGVLRKLAP
FT                   WRPVFVEGNGVDLKHLDELAGRVTPEQTAALRRKHGIDQEEKVLFMAARFEPVKDHSLL
FT                   LDALSELKRVGALNWVTVLAGQGPLEAEIKLQAEMSGLEDDVLFVGQQSSIIPWLVMAD
FT                   AVTLTSEKEGIPRSLMEAMALSKPVVATRVLGTRELVAHAETGLLVPYRDSMQLGEALA
FT                   AMMNTPEARKRMGDAGRRRIEATFTEARVVERLMRLYRSTKAQVNRSRGLGARLNAFGK
FT                   RLFDLVASVPAALLLSPVMLIVALLVKLKLGSPVLFKQQRPGRYGNPFYVLKFRTMRDA
FT                   YDRFGQPLPDEARLTSFGKLLRKLSLDELPQLFNVIRGDMSLVGPRPLLMEYLPLYTEE
FT                   QAHRHDVRPGITGWAQVNGRNAVSWEDKFKLDLLYVERRSIWFDFRILVRTVGKVLKRD
FT                   GISSAGQATVQKFTGSREMGNAS"
FT   gene            430348..431016
FT                   /locus_tag="Pjdr2_0362"
FT   CDS_pept        430348..431016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0362"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: bsu:BSU34240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99042"
FT                   /db_xref="GOA:C6CS90"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS90"
FT                   /inference="protein motif:PFAM:PF00132"
FT                   /protein_id="ACS99042.1"
FT                   /translation="MEEPARRPLIVVGMGGHGRVLMDIARVSKTYRLAAVLDDRFSGVE
FT                   LRGGLPYGPIATLKHFLADEPGMHVVIGIGDNRTRRAIVELLSLPESSYAVLVHPAAVV
FT                   AEDARIGLGAVVMPGAVIGPGAVVGAHAIINSGAVVEHDALVGPYAHVSPNATMAGAAS
FT                   AEEGAHIGSGAVLIPRIRVGSWSVLGAGGVAVRDIPGGKTAVGVPARVVPPRLSVEKAL
FT                   "
FT   gene            431327..432502
FT                   /locus_tag="Pjdr2_0363"
FT   CDS_pept        431327..432502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0363"
FT                   /product="Glutamine--scyllo-inositol transaminase"
FT                   /EC_number="2.6.1.50"
FT                   /note="PFAM: DegT/DnrJ/EryC1/StrS aminotransferase; KEGG:
FT                   lpc:LPC_2537 pyridoxal phosphate-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99043"
FT                   /db_xref="GOA:C6CS91"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS91"
FT                   /inference="protein motif:PRIAM:2.6.1.50"
FT                   /protein_id="ACS99043.1"
FT                   /translation="MNNSRIYLSPPHLGTREREYVELAFRTNWIAPLGPNVDQFERELA
FT                   EKVGAKGAVALSSGTAAIHMALRLLGVGRGDRVFVSSLTFIASVNPVLYEGGVPVFIDC
FT                   DAETWTMSPQALERAFEEAHRNRQLPRAVIVVHLYGQNADMDAINEICAKYRVPVIEDA
FT                   AESLGTMYKGQSSGTHGKFGIYSFNGNKIITTSGGGMLVSDDTAALSKARFWATQAREP
FT                   QPHYEHAELGYNYRLSNVLAGIGRGQLELLDDRVAARRAVFDRYKRAFADIEGINMMPE
FT                   AEYGYATRWLTTMTIDPIITGCTPADLLERLTEANIEARPVWKPMHRQPLLQYYPYFPH
FT                   EPGSSVSDTLFEQGICLPSGSSLTWEEQDRVITCIKQTIQMKSRRMSHESA"
FT   gene            432489..433385
FT                   /locus_tag="Pjdr2_0364"
FT   CDS_pept        432489..433385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0364"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   bha:BH3652 UTP-glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99044"
FT                   /db_xref="GOA:C6CS92"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS92"
FT                   /inference="protein motif:TFAM:TIGR01099"
FT                   /protein_id="ACS99044.1"
FT                   /translation="MKVRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAI
FT                   ASGIEDILIISGRGKRAIEDHFDKSYELEDMLAKKGKTKELEQIRGISEMANIHYTRQK
FT                   EPKGLGHAIWCARSFVGNEPFAVLLGDDIVQSEDPCLSQLIRVYDRYQSSVVGVQRVAD
FT                   EDVSKYGIIAPRGSSIEPSVFFLDGLVEKPSKKAAPSNYAIMGRYVLSPEIFDILEHQS
FT                   PGAGDEIQLTDAIKKLNDQRNVLAYNFEGVRYDVGDKFGFIKAQLDFALQRDDLQKDVL
FT                   GYLQQVYEKHFITKAAN"
FT   sig_peptide     432489..432560
FT                   /locus_tag="Pjdr2_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.683) with cleavage site probability 0.378 at
FT                   residue 24"
FT   gene            433387..434730
FT                   /locus_tag="Pjdr2_0365"
FT   CDS_pept        433387..434730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0365"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="KEGG: bsu:BSU35580 UDP-glucose 6-dehydrogenase;
FT                   TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99045"
FT                   /db_xref="GOA:C6CS93"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS93"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ACS99045.1"
FT                   /translation="MRKITVIGTGYVGLVSGTCFAEVGNRVICCDVDQRKIDLLNSGVI
FT                   PIYEPGLEEMALRNKSEGRLLFTTEVGEAIEASDIVYIAVGTPMSETGEADMRYVMSAA
FT                   KKIGEHLNGHKIIVNKSTVPVGTGELVREVVQANKKYPWTSFDVVSNPEFLREGTALSD
FT                   CMNMDRAIIGSDNAEAAEQIAQLHAPFKTRIFKTDLESAEMIKYAANTFLATKISFINA
FT                   IANICEKVGADVEDVAKGMGMDSRIGEKFLQAGIGYGGSCFPKDTYALAHIADKSGYDF
FT                   ELLKSVIKTNHRQRFVVMDKLRETLGGLAGKQIAVLGLAFKPNTDDMREAPSLSIIPEL
FT                   LKQGAVVRAFDPIAAEAAKKQLPAEVAYLESAELAAAGCDACVILTEWNEVLTMDLAKV
FT                   RDRMKQPIMIDGRNSFDPKVMEQHGFVYYSVGRRPVNRPEAERKSVNL"
FT   sig_peptide     433387..433452
FT                   /locus_tag="Pjdr2_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.991 at
FT                   residue 22"
FT   gene            434906..435859
FT                   /locus_tag="Pjdr2_0366"
FT   CDS_pept        434906..435859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0366"
FT                   /product="Collagen triple helix repeat protein"
FT                   /note="PFAM: Collagen triple helix repeat; KEGG: bba:Bd2932
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99046"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS94"
FT                   /inference="protein motif:PFAM:PF01391"
FT                   /protein_id="ACS99046.1"
FT                   /translation="MKKKFRALVTLAATALLVPALIVNASSTAAASKTATAAVTTGSSL
FT                   SSFFSQSSFQPLANTFIQKVIQNFAQEVQKAVESVQNGKGNNGKGNNGNGNGNNGNNGN
FT                   GHGNNGNNGNGNGNNGNNGNNGNGHGNNGNNGNGNGNNGNNGNGNGNNGNNGNNGNNGN
FT                   NGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNGNNEKQIQQVYND
FT                   TSAKLFQLRNQCQAGLTDIAVEFTTLTSTHEKTELYKTGTAAFSSCTAQYKTVMNDASA
FT                   QIVALGGEPSILEPMQDRYQQEIIAGRAQLNAIVGK"
FT   sig_peptide     434906..434983
FT                   /locus_tag="Pjdr2_0366"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.593 at
FT                   residue 26"
FT   gene            435966..436439
FT                   /locus_tag="Pjdr2_0367"
FT   CDS_pept        435966..436439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0367"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   saz:Sama_2775 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99047"
FT                   /db_xref="GOA:C6CS95"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS95"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS99047.1"
FT                   /translation="MIIRELQEKDNAAIERVIRECLIEFGGNREGLAWADESLSHLSDY
FT                   YNRAGRAYWVIEQDGEVVGGCGIAPFADSEEVCELQKMYLFPAVRGTGMAVKLLDTALA
FT                   FARLYYKQCYLETLQNMHAANRFYAKHGFESLAAPLAGSEHFACDAWYIKGLE"
FT   gene            436938..437417
FT                   /locus_tag="Pjdr2_0368"
FT   CDS_pept        436938..437417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99048"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99048.1"
FT                   /translation="MRNANHAAKLIKLFLFLCSLFLINACGSQAEEVQHVEAFGIEVLD
FT                   QNAEGLYEPTGYKKVNAITTTKADKNYTRVDLKTVEDFYDTGGKYIKTVITHSQGYKSN
FT                   VLDSKDGFDRTEELHEPSTILIPDEDAENFRGDQLSSDELEQLKKHVQSFMKLVD"
FT   sig_peptide     436938..437030
FT                   /locus_tag="Pjdr2_0368"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 31"
FT   gene            437520..438059
FT                   /locus_tag="Pjdr2_0369"
FT   CDS_pept        437520..438059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0369"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   bha:BH0620 RNA polymerase ECF-type sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99049"
FT                   /db_xref="GOA:C6CS97"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS97"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACS99049.1"
FT                   /translation="MGNELLVAAAKRGDDAAFYSLITQQKEKMYRIAYSYLKNETDALE
FT                   AVQEATCRAYMQIHKLKEPEFFGSWLIRILMNYCADEAKRKARRTDGQQAAAAALDLHA
FT                   TSGESALLERVMLESAVEQLDANYQKVIQLKYYHDLTITEIARTLQKPEGTIKTWLHKA
FT                   LGGLRQRLGKEGEPNG"
FT   gene            438052..439407
FT                   /locus_tag="Pjdr2_0370"
FT   CDS_pept        438052..439407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0370"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99050"
FT                   /db_xref="GOA:C6CS98"
FT                   /db_xref="InterPro:IPR025436"
FT                   /db_xref="InterPro:IPR040680"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS98"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99050.1"
FT                   /translation="MDEYRDEQARELPELEAMKEYMEDMPIPSEIDAKIWSGIRAGRRR
FT                   RRRKVFSRVAAYTACLLLLVSVVSVRFSPEVAAYVGEIPGLKPLVELIHYDKGLELAMD
FT                   NDFMQPVGLSEERDGMKMTIDGIIADESRIIAFYSLENMNGQKSVVNLQGVKLTEHLEA
FT                   SISHGSSDFREDWDTKQGTIDFNFVEGVQIPDTLNVDLELKKTGEAATSGTAWHFAIPI
FT                   DKAKFEGLKETYDINQTVLVEGQKIIFGKMTVYPTRIGIEVSYDPANTKKLFYFDDLRL
FT                   EDEKGEEFGSITNGVSGSTLSENSQVLYLESNYFRKPKHLYLRASSIRALDKDKREVEV
FT                   DLSHKKLLASPDDRLTLKDIGTSAEDGQSILIFEMKNEDTLDQNRMYSLFESTYKDASG
FT                   KSFESHMTGSSGNGSDAEYEYYIPKENYQSPLTLFIQDYPTRIHGDIDIKIK"
FT   gene            complement(439454..439693)
FT                   /locus_tag="Pjdr2_0371"
FT   CDS_pept        complement(439454..439693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99051"
FT                   /db_xref="UniProtKB/TrEMBL:C6CS99"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99051.1"
FT                   /translation="MNSVDKIRFTLLYGESPEEQCFGYMERNRNGTMIALYNGYGEEID
FT                   MYGGHEFVILRTLGKFDDEDRDHFYDLLESDGVG"
FT   gene            complement(439934..440767)
FT                   /locus_tag="Pjdr2_0372"
FT   CDS_pept        complement(439934..440767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0372"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: mlo:mll2481
FT                   beta-ketoadipate enol-lactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99052"
FT                   /db_xref="GOA:C6CSA0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSA0"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACS99052.1"
FT                   /translation="MTMTATFNETNRTSGVSFFTTGEGIRIAFRIDGAAGKPILMLANS
FT                   IATSMNMWDGQIARFTEHFRVLRYDYRGHGDSDTPAGPYSMDRMGRDVIELLDSLQIGR
FT                   VHFLGLSLGGAVGQWLGIHAPERISRLVLSNTSSYLGPSEQWNGLIDSVLQAENLNGFA
FT                   DMFINNWFPSPMIESESEIVAAFRQMVLATRAEGIGGSWAAIRDMDLRRTAALISSPTL
FT                   VIAGQHDTVTLPSHGELIAETVPHAKLLILPAVHLPNVEFPDAFEKAVIDFLLSE"
FT   gene            440912..441355
FT                   /locus_tag="Pjdr2_0373"
FT   CDS_pept        440912..441355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0373"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; regulatory
FT                   protein MarR; SMART: regulatory protein AsnC/Lrp family;
FT                   KEGG: bar:GBAA3205 AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99053"
FT                   /db_xref="GOA:C6CSA1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSA1"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACS99053.1"
FT                   /translation="MDQIDHKILSILHDNARITISEMSRIIAMSQPAVTERLRKLEEQG
FT                   VITGYRAELSLSKLGKYTTAFVLFKSNNCKEFEAFSEAAPEIVDFYRTSGEFNYLLKVV
FT                   TETSETLENFLEKCHTFGFSSTLVVLSTRFEDKLFPAFLPNQA"
FT   gene            441503..442411
FT                   /locus_tag="Pjdr2_0374"
FT   CDS_pept        441503..442411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0374"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: bar:GBAA2768 thioredoxin reductase,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99054"
FT                   /db_xref="GOA:C6CSA2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSA2"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACS99054.1"
FT                   /translation="MKLYDCAIIGGGPAGLNAALVLGRARRHVVLFDDNKPRNAVTRES
FT                   HGFITRDGVKPDEFRRAAHLDISKYPSVQVVRNKAVDMVKRGHALFLVKASTGEVYQAR
FT                   TIILALGLKEKLPDITGVADYYGSSLFSCPYCDGWELRDQPLAVISENESHRFSMASTV
FT                   YNWSKDLIVCTNGVGTFEPQQRAKLMSRGVRIFEQPIASLRGKSGRLQKIVFADGTEVA
FT                   RTGGFVTSDWYLPIRIAEKLGCRLNESGGLAIDDYGKTTVEHVYTAGDAATISPAQLIV
FT                   AAAGGSKAAMSVNTALTHLDF"
FT   gene            442517..442648
FT                   /locus_tag="Pjdr2_0375"
FT   CDS_pept        442517..442648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99055"
FT                   /db_xref="InterPro:IPR025097"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSA3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99055.1"
FT                   /translation="MESTSEFVAKVHATQAKQKKNKIHHGKGKASQKLQNVQHTNNP"
FT   gene            442810..443847
FT                   /locus_tag="Pjdr2_0376"
FT   CDS_pept        442810..443847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0376"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   bar:GBAA1756 cation efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99056"
FT                   /db_xref="GOA:C6CSA4"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSA4"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACS99056.1"
FT                   /translation="MSHEHNHPEEEHAHTHSGEEHEPSCSVGHHHGNGHGHSHGHHGHD
FT                   HGHHGHHHHFDMSGNKTGLFIALIITAGIMVLEFVGGLVTNSLALLSDSGHMLSDVSAL
FT                   ALSLVAVWFAARPASAVRTFGFHRFEILAALFNGITLVVISVFIIWEAIGRLFDPPSVA
FT                   SGSMMLIAAIGLLANLVSAWALLRKGDVHNNLNVRSAYLHVLSDALGSVGAVLAGLLIY
FT                   LFDWNIADPIISIVVAVLIVKSAWGVLKHTVHILMEGTPVNVDEKEVRAALGEIEGVVD
FT                   VHDLHIWTITSGLDSLSCHLQVADGTDCQGVLQAAIVLIEERFGIQHSTIQVESSRIRH
FT                   MELQV"
FT   gene            complement(444345..444959)
FT                   /locus_tag="Pjdr2_0377"
FT   CDS_pept        complement(444345..444959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0377"
FT                   /product="protein of unknown function DUF1696"
FT                   /note="PFAM: protein of unknown function DUF1696; KEGG:
FT                   bar:GBAA4710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99057"
FT                   /db_xref="InterPro:IPR012544"
FT                   /db_xref="InterPro:IPR021722"
FT                   /db_xref="InterPro:IPR037063"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSA5"
FT                   /inference="protein motif:PFAM:PF08000"
FT                   /protein_id="ACS99057.1"
FT                   /translation="MFGKVAADLLGLSDIGSVIRPENYDKVDSDDYVMHEDGEKIYFLI
FT                   KSKTDEYCFTNFALIHLDGTSAVSKKRMLHRYPYATNKISNVALETAGTVDLDVEIKFV
FT                   IGSVAFSIDVNKKHIEQVKDLYKSLFKISEIHHENEISLGFARQSLELASSTLSHAHKG
FT                   DYDVADTFDKLNKSAFNWLEGAQKQYKVKDFGAIFDRYINL"
FT   gene            complement(445049..446269)
FT                   /locus_tag="Pjdr2_0378"
FT   CDS_pept        complement(445049..446269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0378"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bha:BH2592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99058"
FT                   /db_xref="GOA:C6CSA6"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSA6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS99058.1"
FT                   /translation="MTQPYSWKRNLIVLWIGVFFCSTAYSVSIPFIPLFLHNDLGVNNH
FT                   LEMWSGFAFGITFLASALIAPYWGSLADKYGRKPMLIRSGFSLAALYFITFFVHDPYVF
FT                   LILRVFQGLLAGYVPAAIALVATNTPEEKSGYALGIMATSGATGGIMGPLIGGTVSHYI
FT                   GNRESFVFSGCIVLVAALIATFFATEHKFNRSGVRSSVLDDLKHASHNKAFLTLLGMSG
FT                   LAMFSVMILEPLLTVYVLQLGTNEHDASLQAGIVFSAVGIATLIAAPQWGKFGSRIGFS
FT                   KVLFIGLLGGGIGNCLQFFVGHIAEFGILRFVYGLFFAGVTPAINAMIVKSTETSFRGR
FT                   AFSLNQSATQFATMLGPVIGGVLGGIIPIKWVFIINGLMLMLAAILVKRQHMEEKMAAS
FT                   KAAAEQS"
FT   sig_peptide     complement(446189..446269)
FT                   /locus_tag="Pjdr2_0378"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.971 at
FT                   residue 27"
FT   gene            complement(446472..447278)
FT                   /locus_tag="Pjdr2_0379"
FT   CDS_pept        complement(446472..447278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0379"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bsu:BSU10900
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99059"
FT                   /db_xref="GOA:C6CSA7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSA7"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACS99059.1"
FT                   /translation="MNYYIDVEPGVSLYVEDTGVGQPILFVHGYPLDHRMYEYQINELP
FT                   KYGYRCIRMDLRGFGKSDSPWESYSMDRMADDVRCIIDTLGYKEITLAAFSMGGAVAVR
FT                   YMGRHAGHGVSKLLLFAAAAPYITKQPGFPQGMPPEGLDALISLAYRDRPLMLQEFGKL
FT                   FFHNEPTPAFRQWFDSVQLDQSPRAIIACGYTLRDENVKADLARIKVPTYIFHGVYDRI
FT                   CPFELAIIMKETIPNSILLRFDNSGHAIFYEELDLFNACLLEALRY"
FT   gene            complement(448105..449706)
FT                   /locus_tag="Pjdr2_0380"
FT   CDS_pept        complement(448105..449706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0380"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: smt:Smal_3677 diguanylate cyclase; TIGRFAM:
FT                   diguanylate cyclase; PFAM: GGDEF domain containing protein;
FT                   histidine kinase HAMP region domain protein; SMART: GGDEF
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99060"
FT                   /db_xref="GOA:C6CSA8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSA8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS99060.1"
FT                   /translation="MIYKIRPRKGFKLSSIISFVVILSVLITIFISTIIGYNTERRSLF
FT                   NNTIELNGIAALNLSKTTQSLVISMQKSLKVTANYFSDIELNDKNVLSQLDFFMGTSPY
FT                   FNSLTIVNKNGVIVSTSPNNLNLIGSKPTSEATTESLRLKKPYISKPFHAITNRMIVMV
FT                   SSPIFDHNGNYKGFVGGSIYLQQANIFRDILGVQASTTSGSYFYVVDSSGYLIYHPDKD
FT                   RISENVSGNPVVQKLMKGMSGAQRVINSQGQNFLAGFAPVPAAGWGIVSQTPQDHVTNI
FT                   SENVVQEMIKFSAPFVLLLVILSFWLSRKLAHPLNRLATYASRLSGGDEKLKPLQADVS
FT                   WNYEANQLVDTVAVAFNKLRAQKEELHAEANTDALTGLTNRRTMGAITALWKQQGTPFS
FT                   VIIMDLDHFKNVNDRHGHQMGDEVLKFVAGIMVSERGPDDYCCRFGGEEFTMLLPHATE
FT                   AEAVQVAERIRLRIEQSVTPIGESVTMSLGVATFPDAAEEVVELFKYADQALYQAKRDG
FT                   RNRTVAYSSLMNMARI"
FT   sig_peptide     complement(449596..449706)
FT                   /locus_tag="Pjdr2_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.639) with cleavage site probability 0.607 at
FT                   residue 37"
FT   gene            complement(449857..450837)
FT                   /locus_tag="Pjdr2_0381"
FT   CDS_pept        complement(449857..450837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0381"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bsu:BSU07500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99061"
FT                   /db_xref="GOA:C6CSA9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSA9"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACS99061.1"
FT                   /translation="MRKGIYAIIVAAVLLLLLAALSLRVGAVSVPLREVWNSLTMQHSP
FT                   DSFIVLQYRLPRVVIAVLAGIGLAVAGDILQGIVRNPLASPDVIGITKGAGFMAAAVIF
FT                   LFPGAPSYALPLAAFLGAIIALVILLLLSRRMTLSPSSFALVGVAVGAVFQAGIQYLLV
FT                   KHPSDVNMALLWMSGSLWGRDWQDVLSLLPWIAILTPVVWLSYPKLNVLQLGDEGSAAL
FT                   GLNVPRQRFILLLLAALLTGSSVAAVGSIGFIGLIAPHIARLFVGGRHQWLVPLSGLIG
FT                   ADLLLLGDVIGRVLIIPREVPVGITTAVIGAPYFIYLLRRERKNA"
FT   sig_peptide     complement(450754..450837)
FT                   /locus_tag="Pjdr2_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 28"
FT   gene            complement(450834..451853)
FT                   /locus_tag="Pjdr2_0382"
FT   CDS_pept        complement(450834..451853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0382"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bsu:BSU07510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99062"
FT                   /db_xref="GOA:C6CSB0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSB0"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACS99062.1"
FT                   /translation="MTTAASQGKQKRSAFLLFLFSFLLLIVGLVSSLKWGQSAVSWRTL
FT                   YEAVTYQGSDKAHLYIQTLRLPRAIMALVVGVHLALAGLLTQLITRNPLASPHIFGINA
FT                   GASLAVVIGLVAINGLSLLGSIAFAFAGAALGALLVWSLAGARQQHVRLALAGIAVHFL
FT                   LSSLTEGMIVLNQHSTDSIMFWLVGSLSSVVWGDVHTILPFTVVSLIVLIPMIPSFRLL
FT                   LMDDAVATGLGQRIAFVRTVGGILVITLAGSAVALCGPIGFLCLIVPHIARYLVGGRLA
FT                   LLVPLTGLLGGCMLVYADWISKFIAFPYESPVGIVTAVIGGPFFIYLARRSRSRGIAE"
FT   sig_peptide     complement(451749..451853)
FT                   /locus_tag="Pjdr2_0382"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.922) with cleavage site probability 0.357 at
FT                   residue 35"
FT   gene            complement(451857..452822)
FT                   /locus_tag="Pjdr2_0383"
FT   CDS_pept        complement(451857..452822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0383"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG:
FT                   bsu:BSU07520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99063"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSB1"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACS99063.1"
FT                   /translation="MPFIRTSKFYVLALIAVLAFTLAACGNTGNNAGSAASEQPAQETA
FT                   ASGKIVVNDELGTVELDKAPEKIVVLEFSYADALVTLGVQPAGLADDDDPSLLMDEVKD
FT                   KLGSYTSVGSRYEPNLEKISSLQPDLIIADSDHHKNVLDQLKAIAPTIVLNDHLADYDM
FT                   ALDNYLVIAKALGKEAEGQKRLEEHKATIEAEKQKIKETGYTILPAVVNPKGFFAQSDH
FT                   SFAGSFLTSIGYADPVKNEEAYPQLSLEQLSETNPQVIVLLPTEEKTIVNEWEANPLWS
FT                   KLDAVSGNKVLTAERRNWSLSRGLIGSEHIIKDIAAQLGE"
FT   sig_peptide     complement(452742..452822)
FT                   /locus_tag="Pjdr2_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.699 at
FT                   residue 27"
FT   gene            complement(452941..453753)
FT                   /locus_tag="Pjdr2_0384"
FT   CDS_pept        complement(452941..453753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0384"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: bsu:BSU01640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99064"
FT                   /db_xref="GOA:C6CSB2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSB2"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS99064.1"
FT                   /translation="MSFEEINSLIPCLDYIEAYTRSTPLPAVLGQYHLIVVRRGHVTVF
FT                   LESGESVICTQGYACHPGSGDYRIEVPRTKAAEYVIFTYRMLPLEQEWTLEGPLGTYSE
FT                   VKIHYMVDELLRKMQEELPEEGRPEAAAFRYRTRLMLERILYIFLRESLMKKNEGSVAR
FT                   SIEDTITYMNEHYMLPLTLSMLAGRAGMSEGHYTVLFKKQTGRTMTVYLRSLRIEKAKQ
FT                   LFRQTRLPAKEIAQQVGFSDYFYFSRMFKKEVGMSPSEYLTSVKPNQI"
FT   gene            complement(453870..454703)
FT                   /locus_tag="Pjdr2_0385"
FT   CDS_pept        complement(453870..454703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0385"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rlt:Rleg2_4664
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99065"
FT                   /db_xref="GOA:C6CSB3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSB3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS99065.1"
FT                   /translation="MNRQSKAGRIILEVVMVLFSLLFLYPLFLAINNSFKSFGEVMTDV
FT                   IALPSKLAFGNYSHVWSFINYPKLFLNNFVITGVGLIGIVFVSSIAAYKLARTKSRWSG
FT                   FLYLLCIMPMLIPFQSIMLTVLQLSKDLHITESTWGLGLLYWGFGAPLAVFIYHGFVKG
FT                   IPKEIDESATIDGASGFRLFFSVIFPLLKSVTTTIIIIDVMWMWNDFLLPLLMVNGSPD
FT                   TKTLTLAAYTFVGQYTSDWQYAMTAMVMAVLPSIVVFIFLQKYIVKGVVAGAVKG"
FT   gene            complement(454703..455593)
FT                   /locus_tag="Pjdr2_0386"
FT   CDS_pept        complement(454703..455593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0386"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: vei:Veis_4548
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99066"
FT                   /db_xref="GOA:C6CSB4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSB4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS99066.1"
FT                   /translation="MFKKMGRKVSEKIEFGLFTLPVLICIAIAFYIPFAMTIRYSLTKW
FT                   NGISKHPKFIGLDNFKQIFLHDTNFTQSAWFTIKYAVLYIVLVNVLAILLALVLDMKLK
FT                   STTWLRAAFFIPYILSLVIVGFIWKFIFMQGFESLGASTGWGIFKLSWLGEPGLAFISI
FT                   LLVSIWQSVGFYLVIYIAGLQSVPDDLKEAATVDGAGPIRRFFNITLPLLAPSITISVF
FT                   MALTNSIKVFDVILSLTGGGPGGTTYSIAYDIYRDTFQNNLYGYGTAKALILFVAVLIV
FT                   TIIQLTIFKRREVEA"
FT   gene            455787..457640
FT                   /locus_tag="Pjdr2_0387"
FT   CDS_pept        455787..457640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0387"
FT                   /product="putative sensor with HAMP domain"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; SMART: histidine kinase HAMP region domain
FT                   protein; KEGG: bsu:BSU06950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99067"
FT                   /db_xref="GOA:C6CSB5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSB5"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACS99067.1"
FT                   /translation="MAIANRIAKSWNALTERVSSRLVNKLILLFTTIIILVVGSLTFIS
FT                   YKMLQREALNNSIASTSNNLLLVNKNLEDYLAGMEQLSLPQINYDELAFAITHASTDYA
FT                   SKMYVEDYLRNMYFSRSNEDLEAIYLYFVRSGTYYTIAKENFDIKIRSGQADSIPTMSW
FT                   YKQAMDSGTNQAYQSFLLSNEERGYDMDPSRSFMAYHRVLRSISTRAPQAVVSFYYNKS
FT                   TINKIMKDIPEDTGQHLFFLSPDNVPFALDNRTSYESMVGSGLLKQIIKTDGTGANGLT
FT                   WKSPEDNKYLVVYNVGAQEGWKLVKPIPYKELYAAAKTTRNLNFMIGLLFLLLAVVLIT
FT                   YFSNAVTKPLKLLSQQMKRFSTGDFEASTEVVGRDELAYLSRQFNQMVSQTNELITERY
FT                   KMKLVEKNAILKALEAEINPHFLYNALQAISTKALKAERFDIADMVDALALTLRYCISG
FT                   KDIVRASEELLHIERYMSLQKARFGGRLQLVIDWDQDLKELELPKLSLQTLVENAIKHG
FT                   VEMVSSPVAIRISARAAGGHAFIIVNDNGPGFAPGRLKDVLESFEADWNERAEEEGSVG
FT                   LVNLNTRLKLLYGTSSQLVIRTSPSGTEMEMLIPRGGGQHV"
FT   gene            457633..459267
FT                   /locus_tag="Pjdr2_0388"
FT   CDS_pept        457633..459267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0388"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   response regulator receiver; KEGG: bha:BH1123 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99068"
FT                   /db_xref="GOA:C6CSB6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSB6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS99068.1"
FT                   /translation="MYKVLIIDDEEPLREAIRILGDWKGLGVAEVLEATDGKMGLEMIA
FT                   NHSVDLVMVDMKMPGMSGAELLQVLERDYPDMPAIVISGYNDFEYTRQAIRSKVVDYLL
FT                   KPINRPDLNAALRKAVDLLEARRVRESEFINRNITLNMSLPKLKEKMYLSIIDRSFRSQ
FT                   TNEAFLPLIGADDPDNRFAAVVLRMLNMEKVRKARFHSDVDLLHFAVGNMLNEIAGEYF
FT                   QAFSFASPKMDRELIVILTMKGAYQEDIAYRSLHQMNKALAALQDLLGIVAAAGIGTPC
FT                   ESIMEIASSYETAKAAINGIDLLKLKGYFVANAVAKSANEGYPVTGRMQMFRAALESGN
FT                   TAGAKSILSEELRKWGGADLFTLGDADQSLGRFIILMNDISLELGVPREKLPLMEEHPV
FT                   RFMGLSDDYASYEQFSKLLEDALHFYLEQLRLTQSANRPFEIGDIKAYIDNRYYEDIKI
FT                   SMFADKYFLSREYIMKLFKQQFGCGIHEYVQRIRMDKAKELLDDPSLKIQDISEMLGYK
FT                   DKNYFSKAFRNYFSISPTEYRTARKEG"
FT   gene            459444..460757
FT                   /locus_tag="Pjdr2_0389"
FT   CDS_pept        459444..460757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0389"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH3680 sugar ABC transporter (sugar-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99069"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSB7"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS99069.1"
FT                   /translation="MFKRMASVSLSLALVGGMLAACGGNNGNDTANNGGTANNGAASDK
FT                   PVTINMFTASPEYTDAFNAYIAEYKKVKPNVTINLEIMQADYNTVLKSKIASGSTPDVF
FT                   QTTAGGDIDTFAEYSADLTNEPLAAAMTDGVRTNMTSSDGKVLGLPVKGNLMTLIYNKK
FT                   LLTDAGIAEPPKTIAELNDDIAKLEAKKITPFANAYKEWWVWKHIFQHYVNAAAEDAGI
FT                   APKELVQQFIDGKTTFNDHPVLKDNFFNFIDLTVKHGTDKPLERDSNAEVSDFAQGKAA
FT                   FMTGKGAWDEEAIKKISPDIQIGIAGYPVSDKPEQTQIVTGADQALRINKDSKVAREAI
FT                   DFFNWLYTSDYGKQWFSNVAKVIPPIKDAPLPDLDMPKQMEEILKTQKSGDLSVNYSLD
FT                   TFHQKFGEIMQAYIGGSKSKDQAIKEIQTAWQQFGSAE"
FT   sig_peptide     459444..459515
FT                   /locus_tag="Pjdr2_0389"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.620 at
FT                   residue 24"
FT   gene            461212..463329
FT                   /locus_tag="Pjdr2_0390"
FT   CDS_pept        461212..463329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0390"
FT                   /product="glycoside hydrolase clan GH-D"
FT                   /note="PFAM: glycoside hydrolase clan GH-D; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99070"
FT                   /db_xref="GOA:C6CSB8"
FT                   /db_xref="InterPro:IPR002252"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR038417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSB8"
FT                   /inference="protein motif:PFAM:PF02065"
FT                   /protein_id="ACS99070.1"
FT                   /translation="MEKLATAAGITKIEENGLHLVYEVRENGDVLLLHFGTQPWVEESI
FT                   TAKQKDGFRLMELQLTGEDRAEYHGRTHRASQPGLRMVYDGLTDSRNEFGRKLVLGLKD
FT                   PVTGVSALWNVQFYDGVAVARCWTELVNEGEEEVGVEYVSSFALTGFDKDGEGDRDDKV
FT                   TLTLAHNAWQSELQWRTYTLPELGMSHLIDRGSKRLAFSNTGSWSAAELIPMAIMSNTA
FT                   SGESLFWQIEHNGSWHWELTDQVDRLTLLISGPTEHDNHWWLKLAPGETFVSVPVAIGA
FT                   VEGGVEEAAEQLTVYRRRIRRENDDNKLLRVIFNDYMNCLWGSPTTAKLLPLIDAAADV
FT                   GCEYFCIDAGWYAPGEWWDGVGQWLPSEERFPEGIKYVLDYIRGKGMIPGLWLELEVMG
FT                   INSPKLADTDDSWFFMRHGKRVKDRSRYQLDYRNPAVIAHADEVIRRLVEDYGVGYIKM
FT                   DYNINAGVGTETDADSVGDGLLQHNRAYLAWLDGVFARYPELVIENCSSGGMRMDYSML
FT                   SRYSIQSTSDQEDYVKYASIAAGAPAVLTPEQAAVWSYPLREGDDEEVIFNMVNALLLR
FT                   VHQSGHLAELSPRRRELVKEALDYYKTIRGDIREALPVWPLGLPAHGDDWLSLGLRRGN
FT                   KLYLAVWRIGGEASELALPLPEHSGKQLAARCAYPAAAGDTGCSWDAAAGELRVTLSSP
FT                   RTARLFELTLG"
FT   gene            complement(463764..463952)
FT                   /locus_tag="Pjdr2_0391"
FT   CDS_pept        complement(463764..463952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99071"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSB9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99071.1"
FT                   /translation="MQHITPFKAIWQVILHRMQDNLPDLSLSGLIFFDILQSMQDISGY
FT                   WAALRLLCSVCGRRIFN"
FT   gene            complement(464428..465111)
FT                   /locus_tag="Pjdr2_0392"
FT   CDS_pept        complement(464428..465111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99072"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSC0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99072.1"
FT                   /translation="MTVNDEYEEAHRRFIETHMEGRTGERRGRLARGHNFAEKLFLQNV
FT                   WWPLLGNFEHLHPEYEVYDWNRKSQFVDFAYLPPQGMFAIECDGFQSHVKDMDRERFSY
FT                   SLNRDTFLTGMGWKMIHFSFDDVQNHPEICMMLLKHVLGTHIIRGRQNVASLLVPSAER
FT                   DILRFAFHMGGRVGPKDLSDHFGISFRTARKRLQSLSAKGMLKPIERGVQIRYYELNDR
FT                   AIEHL"
FT   gene            complement(465888..466229)
FT                   /locus_tag="Pjdr2_0393"
FT   CDS_pept        complement(465888..466229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0393"
FT                   /product="general stress protein"
FT                   /note="KEGG: bha:BH3013 general stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99073"
FT                   /db_xref="InterPro:IPR022551"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSC1"
FT                   /inference="similar to AA sequence:KEGG:BH3013"
FT                   /protein_id="ACS99073.1"
FT                   /translation="MAQYREIDSMEGWNETFEASSDRPTVIFKHSTTCPVSANAYREFN
FT                   EYLNGSPREDADYVLVKVIESRPVSLQIAEDTSVKHESPQIIFLEKKAKVWSASHWSIT
FT                   KEHITAVLD"
FT   gene            466419..467525
FT                   /locus_tag="Pjdr2_0394"
FT   CDS_pept        466419..467525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0394"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: hsm:HSM_1574
FT                   spermidine/putrescine ABC transporter ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99074"
FT                   /db_xref="GOA:C6CSC2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSC2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS99074.1"
FT                   /translation="MSDQTIIRFEQVTKQYDDQTTVLSEVSFEIERGKFYTLLGPSGCG
FT                   KTTILRLIAGFIEPSKGQIYFNGKVINRIPPNERQVNTVFQDYALFPHLNVFENVAFGL
FT                   RIKKLKNAAITAKVKEALRFVNLEGYETRNISEMSGGQRQRVAIARAIVNEPEVILLDE
FT                   PLSALDLKLRTEMQYELRELQRRLGITFIFVTHDQEEALAMSDEIFVLNQGKIEQSGTP
FT                   NDIYDEPINRFVADFIGESNIVPGRMKQDFEVEFAGRAFECVDQGLNPNEPVEIMIRPE
FT                   DLEITTTEQGKLQVRVDSQLFRGVHYEISCYDEAGNEWLVHSTKKAAVGEQIGLYFDPE
FT                   AIHVMRFGETEEEFDKRLDAYSEGQDEN"
FT   gene            467515..468339
FT                   /locus_tag="Pjdr2_0395"
FT   CDS_pept        467515..468339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0395"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: lpf:lpl1147 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99075"
FT                   /db_xref="GOA:C6CSC3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSC3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS99075.1"
FT                   /translation="MRTNTRNFYLIPYLLWIALFVITPIVLVVYYSFFDVEGDFTFGNY
FT                   QKFFTPVYMKMTLSSFWYAFLITAFSLLVAYPAAYLLTRTKHKQLWLLLIILPSWINLL
FT                   LKAYAFLGLFGTYGAVNGMLKFIGIGTQQILFTDFSFIFVSVYIFIPFMILPIFNSLEE
FT                   MNPSLVFAARDLGASPWTAFRRVIFPLTLSGVKSGCQAVFIPALSLFMITRLIAGNRVI
FT                   TLGTAIEQHFLVTQDWGMGATIAVFLIIAMAVIMLLTGSRKRGLQNENRKAV"
FT   gene            468317..469120
FT                   /locus_tag="Pjdr2_0396"
FT   CDS_pept        468317..469120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0396"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dat:HRM2_13760 PotC2"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99076"
FT                   /db_xref="GOA:C6CSC4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSC4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS99076.1"
FT                   /translation="MKTAKLSNVYLIAVFIILYAPIFYLIFYSFNSGGAMRNFEGFTLE
FT                   WYQEVFADTRLLIIVLNTFVIALLSSAISVIFGIAGALAIHYVRRRQPKNALLSLNNVL
FT                   IVSPDVIIGASFLIMFTIIGIKLGFVSVLLSHIAFSVPIVVIMVLPKLQEMSPTLIDAA
FT                   RDLGASSWHVLTRVIVPFIKPGIFAGFFMALTYSLDDFAVTFFVTGNGFSTLSVEIYSR
FT                   ARQGIALSINALSTLIFLFTILLVIGYYFINQRNNRTSARSEGRR"
FT   gene            469117..470187
FT                   /locus_tag="Pjdr2_0397"
FT   CDS_pept        469117..470187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0397"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: pcr:Pcryo_2162 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99077"
FT                   /db_xref="GOA:C6CSC5"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSC5"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS99077.1"
FT                   /translation="MKSLVQTFIAVLVVSFGLMYLTSYLNSSAGYTGKDTLTIYNWGDY
FT                   IDPELLDEFQKETGIKVIYQTFDSNEAMMTKIEQGGTTFDVSIPSEYAIDKMKEENLLI
FT                   PLDKSKLPNLKYIDPSFLNLSFDPDNKYSIPYFWGTVGIVYNPDLTDLKFHSWNDLWDP
FT                   SLKNQILLLDGAREVIGMGLNSLHYSLNDTNEEHLQAAKAKLSTLTPNVKAIVGDEIKL
FT                   LLANEEAAVGLVWSGDASEIMSENEKLDYVVPEEGSNLWFDNMVIPKTAKNIEGAHKFI
FT                   NFMLDPEHAAQNAEYVGYSTPNAKALEYLPEEISGDKRFYPDKELTEKLEVYKNLGKKM
FT                   LVHYNELFLEFKMHRK"
FT   sig_peptide     469117..469200
FT                   /locus_tag="Pjdr2_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.355 at
FT                   residue 28"
FT   gene            470714..472843
FT                   /locus_tag="Pjdr2_0398"
FT   CDS_pept        470714..472843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0398"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99078"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSC6"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACS99078.1"
FT                   /translation="MTIKKKIIVSTIAASMAATAFAGIPLSSKGLAEKLGFSNTAYAAT
FT                   SSTDQLIAEANKWHDALGVSGLATLKTLRDVIKGLTPAEVKAIVLPVTSSIATKYSLST
FT                   DEKIAIEDLYINLLGFTYTADFSYFDGIQSSAGFDVLRTLADEADVSGLTFEDLAAYVL
FT                   KVKTNLFASLDALSVSQVQALATNPLGVVTLVQNAIQAVPDTNDTASKLKQVFNYYGIN
FT                   QSKLTEAAGNLVVKVTTVNSTAIPNAINAVITAYLNTRNTGTGPSVPSTGDEDTGTVKV
FT                   PTEVTELLGKLKDKLANATDAEKAAILAEAVQQATALVTKLSTFDLSGDVKVSNGQASV
FT                   QVSSSSVLSAIAGIGEILKNVKELAPGVTVPAPILNLNLGNVAQDDVKIGLNNALIQEA
FT                   IKAGLGGINLTVNGLSAVLPVGGQFNGAVDFNINKSKADSSTTGELKAASDVYSFGLTI
FT                   GGQSVTSFAQPVTVAIPLGNVDGVDKELLSLAKIVDGKLVFQGGTVEGNLIVEHRDTFS
FT                   QYVVVENKVSFTDIASVQSWAGRAIEVIAAKGAIEGKKAGVFAPKDNVTRAEFAKMLTR
FT                   ALDIDNSSAKEDFADVKDTDWSAPYIGAAAKLGIIQGRSATKFDPNAQITRAEMATMIA
FT                   RALKVTKGAQDVTDVTAALASFKDASSISASLKAGVAFASKNGIVIGNNGKFSPNASAT
FT                   RAEAAVMIYRAVNFK"
FT   sig_peptide     470714..470782
FT                   /locus_tag="Pjdr2_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 23"
FT   gene            473009..473773
FT                   /locus_tag="Pjdr2_0399"
FT   CDS_pept        473009..473773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0399"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   bha:BH3669 capsular polysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99079"
FT                   /db_xref="GOA:C6CSC7"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSC7"
FT                   /inference="protein motif:PFAM:PF02706"
FT                   /protein_id="ACS99079.1"
FT                   /translation="MSEELDLREYFLIVRKRLLLIVIFVLVCTVASGVYTKMFKDPIYE
FT                   ASTKIVVNQPSQQLAVGQLDLNQINSNIKMIDTYKEVIKTPAILGKVAEKYPQLGLSAK
FT                   ELTKKISVSSVNGTQVMTLAVQDVSYQQAAKIVNAISLVFQQEIPNIFQVENVSILNEA
FT                   LLDDQPAPVSPNVTLNIIIAFVVSLMIAVGIAFLLEYMDDTIKTETDVQRYLGQPTLAM
FT                   VARVEASEFQTGSSRTENRQKAGGLENVTIGE"
FT   gene            473754..474446
FT                   /locus_tag="Pjdr2_0400"
FT   CDS_pept        473754..474446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0400"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="TIGRFAM: capsular exopolysaccharide family; KEGG:
FT                   bha:BH3668 capsular polysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99080"
FT                   /db_xref="GOA:C6CSC8"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSC8"
FT                   /inference="protein motif:TFAM:TIGR01007"
FT                   /protein_id="ACS99080.1"
FT                   /translation="MSQSENKRRLISVANPRSPVSETYRTLRTNIEFAAIDSALQVIMV
FT                   SSAGPGEGKSTTIANLAVTFSQSDRKVVLIDADMRKPTAHKTFQISNRFGLSSVISQQS
FT                   TLQEVIQATDIPNMDVITAGPIPPNPAEMLASKRMTALLDELRTMYDIVLVDTPPLLAV
FT                   TDAQIAATKSDGVVLVVDQGRVKRQFAQKAIQNLQNVNARILGVVLNNVKRRSNEEAYY
FT                   YYYSADVK"
FT   gene            474731..475618
FT                   /locus_tag="Pjdr2_0401"
FT   CDS_pept        474731..475618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0401"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /note="TIGRFAM: UTP-glucose-1-phosphate
FT                   uridylyltransferase; PFAM: Nucleotidyl transferase; KEGG:
FT                   bha:BH3717 UTP-glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99081"
FT                   /db_xref="GOA:C6CSC9"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSC9"
FT                   /inference="protein motif:TFAM:TIGR01099"
FT                   /protein_id="ACS99081.1"
FT                   /translation="MTKVKKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEA
FT                   VAAGIEDIIIVTGKGKRAIEDHFDSAFELEHNLMEKGKLTLLDEVQKSSRVDIHYIRQK
FT                   EAKGLGHAVWCARNFIGDEPFAVLLGDDIVDSEVPCTKQLMDQFEQTGRSVIGVKPVPT
FT                   NETERYGIVEYSEKNGLLSLVDRFIEKPTPGTTESNLAIMGRYVLTPDIFKFLSKQEKG
FT                   AGGEIQLTDAIQKLNESQGVYAYEFEGRRFDVGEKLGFITTTLDYALRNESLKGPLLEA
FT                   MKEILERELIHKFK"
FT   gene            475637..476338
FT                   /locus_tag="Pjdr2_0402"
FT   CDS_pept        475637..476338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0402"
FT                   /product="Undecaprenyl-phosphate galactose
FT                   phosphotransferase"
FT                   /EC_number="2.7.8.6"
FT                   /note="PFAM: sugar transferase; KEGG: shn:Shewana3_2005
FT                   WecB/TagA/CpsF family glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99082"
FT                   /db_xref="GOA:C6CSD0"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSD0"
FT                   /inference="protein motif:PRIAM:2.7.8.6"
FT                   /protein_id="ACS99082.1"
FT                   /translation="MALSPLRKESEMTIDSHLSIAQRVHAKTRSTKRTYLMVKRMMDLV
FT                   GAACGILLLSPLLLVITLLIKLENRNAPVFFYQTRVGINEKTFRMYKFRSMVPNAENLL
FT                   KDLLHKNEIEGAMFKMKDDPRITRIGKFIRRTSIDELPQLWNVVRGEMSLVGPRPPLPR
FT                   EVAEYSSYDKLRLRVKPGCTGLWQVSGRNELSFKEMVELDLEYIEKRNVLFDLQIIAKT
FT                   AKAMVGSDNAY"
FT   gene            476358..477293
FT                   /locus_tag="Pjdr2_0403"
FT   CDS_pept        476358..477293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0403"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   gsu:GSU0627 GDP-fucose synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99083"
FT                   /db_xref="GOA:C6CSD1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSD1"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS99083.1"
FT                   /translation="MELNSKIFVAGHRGLVGSAILRALEEKGYTNLVYRTHAELDLLDR
FT                   DRVLSFFEEEGIEYVFLAAAKVGGIVANNEYPADFIRDNIMIQTNVIDAAYRNKVKKLL
FT                   FLGSTCIYPKFAPQPMKEEYLLTGVLEPTNEPYAIAKIAGITMCQSYNRQYGTKYISVM
FT                   PTNMYGPNDNFDLKTSHVLPALIRKFHEAKVNHSPEVEVWGTGTPRREFLHSDDLADAC
FT                   LFLMNTYEENEIVNIGVGEDISIKELAYLIKDVVGYEGEVVFNTSAPDGTPRKLVDVTK
FT                   INGLGWKATIPLEEGINAVYETFQNEYMVR"
FT   gene            477327..478421
FT                   /locus_tag="Pjdr2_0404"
FT   CDS_pept        477327..478421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0404"
FT                   /product="GDP-mannose 4,6-dehydratase"
FT                   /note="TIGRFAM: GDP-mannose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; KEGG: mno:Mnod_6329
FT                   GDP-mannose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99084"
FT                   /db_xref="GOA:C6CSD2"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSD2"
FT                   /inference="protein motif:TFAM:TIGR01472"
FT                   /protein_id="ACS99084.1"
FT                   /translation="MAKRALITGVTGQDGSYLAEFLLEKGYEVHGVIRRSSSYNQERLE
FT                   DLLTEEEARSILNNQNFHLHYGDVTDALNITRLIGEIQPDEIYNLAAQSHVRVSFDMPG
FT                   YTLDVDGKGTLNILEAVKFLGLTEKTRVYQASTSELYGKVQEVPQKETTPFYPRSPYGV
FT                   AKIYGFWITKNYRESYNMFAVNGILFNHESERRGETFVTRKITLAAARIAQGKQQKLML
FT                   GNLDSLRDWGYAKDYIECMWLILQHDKPEDFVIATGEMHSVREFVELAFKHVGISIEWQ
FT                   GNGVEEKGINKRTGEVVVEVDPTFFRPAEVEQLLGDPTKARTLLGWNPTKTSFEELVRV
FT                   MVKYDVAKVSSEEGSRKMFDGVLV"
FT   gene            478424..479683
FT                   /locus_tag="Pjdr2_0405"
FT   CDS_pept        478424..479683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0405"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   gme:Gmet_1502 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99085"
FT                   /db_xref="GOA:C6CSD3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSD3"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACS99085.1"
FT                   /translation="MTTEPSSKKKLLIYAHYYHPDVASTGQILKELAEGMLDSFDITVI
FT                   CVVPSYTGVIAPEYNNKMFYSEEINGVKVLRIRVPEFSKNNKVSRIKNILAYFVGAMLA
FT                   TFKVGKMDYVYSISQPPVLGGLIGVWGKWMKRAKYIYNIQDFNPEQTMAVGYSKNKLIL
FT                   NAMLWFDKFSCRCSDKVIVVGRDMVETVKQRFKGKKIPNHSFINNWIDEKEIYPLPSDH
FT                   KQVVAFKKKYGLEDKFVIMYSGNIGLYYDLENMMPVIKEFKDRDHVVFAFIGEGSVLKD
FT                   LVAYKEEHELNNVTFIPYQKKSDLIYSLNAGDVHWCINAKGIKGVSVPSKLYGIMAAGK
FT                   PILGVLEQGSEARLIIEETNCGYVTEPANYGEVEAIIEKFISEKETNIPAEMSKRGRAF
FT                   LVKNLTKDVSISKYIQEISI"
FT   gene            479703..480281
FT                   /locus_tag="Pjdr2_0406"
FT   CDS_pept        479703..480281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0406"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: rec:RHECIAT_CH0000844 putative fusion
FT                   protein: glycosyltransferase and acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99086"
FT                   /db_xref="GOA:C6CSD4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSD4"
FT                   /inference="protein motif:PFAM:PF00132"
FT                   /protein_id="ACS99086.1"
FT                   /translation="MNSNWFKILMKVTKVRYGKKLLLKGIPVIFNKSGAELIIGDNVTI
FT                   NSSFLSNLVGLYQRTIIVTRTADARIRIGSNVGISGATIYARKSIQIGNNTLIGGNTKI
FT                   IDNDFHPVDPNVRSITPNDHIGVRPIEIGQNVFIGCNCLILKGAKIGDNAVIGAGSVVS
FT                   GEIPANCVAAGNPVKVIRYLEINEVKVTI"
FT   gene            480278..481366
FT                   /locus_tag="Pjdr2_0407"
FT   CDS_pept        480278..481366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0407"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   afw:Anae109_4435 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99087"
FT                   /db_xref="GOA:C6CSD5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSD5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACS99087.1"
FT                   /translation="MKKKRVCFIAQFPPPIHGLSKAVDTLYRSDLNEVFDFDKIDITRN
FT                   RDFVKNLFLIWNSKADIFYFTISQTKAGNIRDLIILNLLKFRKKKCLVHLHGGYYRHLI
FT                   DKELSGWQRRININVIKNLSGVIVLGPSLKFNFQGIINEEKIHIVPNCIDDEYLISEAE
FT                   FEKKNVALEQKEVLNVLYLSNFIRSKGYPEVLKMAKLEKERVSEGGTKQFHFNFAGKFF
FT                   EVSEREFFEDYIKENELQDFISYHGVVTGQQKKELLNKCDIFILLTRYPNEGQPISILE
FT                   AMGNGMVIVTTDHAGIPDIVKDGINGIVVREEIDINKTFEALLMRRSQLHLIGRVNRTT
FT                   CLLNYKEKSYIKNLENIFKEES"
FT   gene            481368..482282
FT                   /locus_tag="Pjdr2_0408"
FT   CDS_pept        481368..482282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0408"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   bha:BH3713 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99088"
FT                   /db_xref="GOA:C6CSD6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSD6"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACS99088.1"
FT                   /translation="MEKISCIVTTYKRPIPVLQRAVASIVNQTYSNLELIVVNDAPQIL
FT                   KLVEDIRIMLNEFTNIPIKYIVQHQNMGACQARNTGIEEASGEYVAFLDDDDEWLPDKL
FT                   EKQYALITKERVALVYCSHYEIRQEGTRTLVIEDLAREGIHQDEFERLLLANFVGSTSY
FT                   PLLRLSAVKTVGGFDTNLKASQDHDLWLRIARKYPIVYCNEPLVNYYHSEESISSNMEN
FT                   KLQGFNFLLNKYKDEYLKKKDLHNYRLNYIAYCCFKSKYFNGFISFTLRAFKTKLISKY
FT                   NFMLLSKMSKKAVRILSTRKKLI"
FT   gene            482391..483680
FT                   /locus_tag="Pjdr2_0409"
FT   CDS_pept        482391..483680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0409"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pmr:PMI3192 O antigen polysaccharide unit
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99089"
FT                   /db_xref="GOA:C6CSD7"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSD7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99089.1"
FT                   /translation="MRSLNPSIYAFKISLIMLLSCYLIFSTSSTYTNQITAGLALAFSL
FT                   LLCYKARKSIPIFIASLFILYCNYSVVVGEYFTGGELGATFNQTKTTEIYGITIKILLL
FT                   FISILSVFYNAKKTELEAFVINHKNNALIYYSLLAVLLYIFLFGVKRGNYSSYEVSVTP
FT                   LYEYSTLLFLICYYTSGGIKLRKYIIVVFCLLFIIQDFYYGGRITSMQLIILLLMTIFL
FT                   KRLKLKLVIMGAIVGIVLNSFVDVYRQNYSLKSTYLLDIIASLFNNYFVFNTPVFAFYS
FT                   SSTHVATSQIIGFHDKAISLLQFIISIFIGSSKNMGNVTYYSKQHFFNIGGGFLPSHFY
FT                   FWLSWSGVIIAAIIMVLIFNAVGKGKSDFWRLATVCLIYSLPRWYLYTPLSLIRPILLL
FT                   CILYLIYFIVNQILQNVSDAPKVRYRSHKF"
FT   sig_peptide     482391..482489
FT                   /locus_tag="Pjdr2_0409"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.588 at
FT                   residue 33"
FT   gene            483756..485132
FT                   /locus_tag="Pjdr2_0410"
FT   CDS_pept        483756..485132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0410"
FT                   /product="Mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.13"
FT                   /note="PFAM: Nucleotidyl transferase; Cupin 2 conserved
FT                   barrel domain protein; mannose-6-phosphate isomerase type
FT                   II; KEGG: mch:Mchl_5260 mannose-1-phosphate
FT                   guanylyltransferase/mannose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99090"
FT                   /db_xref="GOA:C6CSD8"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSD8"
FT                   /inference="protein motif:PRIAM:2.7.7.13"
FT                   /protein_id="ACS99090.1"
FT                   /translation="MKMVLLSGGSGKRLWPLSNDSRSKQFLRVLDNEDQERISMLQRVW
FT                   SQINDSGLDESCFVTIAKSQIEMIHSQIGTSVPLIIEPERRDTFPAIALTASYLYSVAK
FT                   LDLNEVVAILPVDPYVEGQFFYAVKQLEEIIQQTDADLALIGVRPTYPSAKYGYIIPFS
FT                   NQVDNHDVLKVSHFQEKPTEEAAVNLIEQNGLWNCGVFSFKLGYLINILKDKGYPLSYE
FT                   QLVERYHELPKISFDYEIVEKSKNIVVLPYDGYWKDLGTWNTLTEEMGQSQLGKGTISE
FT                   DCVNTHLINELDIPVTILGLSNIVVVASPDGILVTDKSASPRIKEYIDYDQGPMFEERE
FT                   WGWIRILDEERYENGRSVIAKRVAIKEGKNLSYLMNMYREEVWTIVKGEGEFIQNGTPM
FT                   KVMAGNVLHIPAKTLHSLKAISDVEIIVVNTGEINQDQTIELYSSWSEVRKYFHDISIG
FT                   "
FT   gene            485219..486676
FT                   /locus_tag="Pjdr2_0411"
FT   CDS_pept        485219..486676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0411"
FT                   /product="polysaccharide biosynthesis protein"
FT                   /note="PFAM: polysaccharide biosynthesis protein; virulence
FT                   factor MVIN family protein; KEGG: apj:APJL_1491 flippase
FT                   Wzx"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99091"
FT                   /db_xref="GOA:C6CSD9"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSD9"
FT                   /inference="protein motif:PFAM:PF01943"
FT                   /protein_id="ACS99091.1"
FT                   /translation="MIVFMSSIKKNYIFQISYQILIIILPIFTAPYVSRVLGVEGVGTY
FT                   SYTFSVANYFVLFAMLGINNHGSRRIAMVRDNKEKLNQTFSSILTIHIISSIIMIILYL
FT                   GYSLFIVKENSLFALISTIYILAALFDVNWFFFGMEKFKITVTRNIIIKILTVLLIFLC
FT                   VKDKNDLVIYILIMAIGTFISQSMIWGLINKYVQIVKPSWSEITTHFKPMLIMFIPTLS
FT                   VSLYRIMDKVLLGALTDHSQVGLFDNAEKIINIPLALITGLGTVMLPRMSNLVTNSDFA
FT                   RAERYFSNSMKFAIIVSLGWFFGVSAIAPKFAPVFFGIEFEKTGAIMQGLAITIPFIAF
FT                   ANVIRTQYLIPNNLDSIFVKSVLIGAVISVITNIILIPHYQALGSTVATVLAEISVCAY
FT                   QCWAVRRELSIKKHIKSSVYFVFLGFLMFIIVSVISMNLPDSALYMILETMAGVLIYSL
FT                   GTLIYLYIFKDELLYTFAKRKVGSINR"
FT   gene            486706..487611
FT                   /locus_tag="Pjdr2_0412"
FT   CDS_pept        486706..487611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0412"
FT                   /product="glycosyltransferase"
FT                   /note="KEGG: dps:DPPB74 glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99092"
FT                   /db_xref="GOA:C6CSE0"
FT                   /db_xref="InterPro:IPR029465"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSE0"
FT                   /inference="similar to AA sequence:KEGG:DPPB74"
FT                   /protein_id="ACS99092.1"
FT                   /translation="MLKILKLIKGIVMFRLMKILNGSRLISNENKVRLNFYINHGYKLN
FT                   LNYPKTLSEKIHWIKINGKLTRFSDLVDKYEVRRYVGNIIGEEYLIPLIGVYENSRKID
FT                   FNKLPKEFIIKATHSSGWNLIVSDKSKLNWSITCRKIDKWINASFYRITGEENYKNIRG
FT                   RVVIEELIHDDSGDLKDYKFFCYHGEPKYVQLDGGRYNTHKRDMYDTDWNKINVRYGYN
FT                   NFDTPIEKPKMLDLMVELSRKLSKGFAFVRVDLYCVNESEILFGEMTFTPGNGARRFSP
FT                   IEYDQFFGEPLILEKYNQGI"
FT   gene            487631..488722
FT                   /locus_tag="Pjdr2_0413"
FT   CDS_pept        487631..488722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Os06g0702500; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99093"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSE1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99093.1"
FT                   /translation="MKIKIAYYISDYGYGHATRSIAVIRAMLLVAEQFYMLTICSSDKI
FT                   LAFMKASLSDYQEVIQYRRCISDVGYVLQPDSIEPDTVAFIAKYHEYLEKLPHEAAREA
FT                   DFLRTAEVNLVISDISPIAFAAARQADIPSVGISNFTWYTAYLEMINHSALQPLFEVYA
FT                   AMDYFVRLEGAVEPDWGKRGTLRADFFSREVDQQEVSRILQTINPGRQKRVVYFGIGMS
FT                   INVQDLVALKLWEDEACLFIVSSNMKVEHKNIIAIPAFYTESQNYVAASDLVISKPGWS
FT                   TVGEAVALRKPLYLLHRSKMKEDKNTIQALQDRHPYRMIEWGQLMEDNMHDFIDREHFF
FT                   EDIRQRNGAAHIAEYLKQIVGSE"
FT   gene            488725..490062
FT                   /locus_tag="Pjdr2_0414"
FT   CDS_pept        488725..490062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0414"
FT                   /product="nucleotide sugar dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /note="KEGG: bsu:BSU35580 UDP-glucose 6-dehydrogenase;
FT                   TIGRFAM: nucleotide sugar dehydrogenase; PFAM:
FT                   UDP-glucose/GDP-mannose dehydrogenase;
FT                   UDP-glucose/GDP-mannose dehydrogenase dimerisation;
FT                   UDP-glucose/GDP-mannose dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99094"
FT                   /db_xref="GOA:C6CSE2"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSE2"
FT                   /inference="protein motif:TFAM:TIGR03026"
FT                   /protein_id="ACS99094.1"
FT                   /translation="MKLAVIGTGYVGLVSGVCFSELGNEVVCVDNATSKIELLNNGEVP
FT                   IHEPGLKELIASNTAAGRLSFTTDLAAAVNDSEIIIIAVGTPSLPDGKANLAYIEQAAA
FT                   EIGRAINGYKVVVVKSTVPVGTNEKVAAIIRDYATESFDFASVPEFLREGTAVKDTLNP
FT                   DRIIIGTESGRAAEMLTALHRPLTDQITITDVRSSEMIKYASNAFLATKISFINEIANI
FT                   CEKVGADVEEVAKGMGMDRRIGSSFLKAGIGYGGSCFPKDTQALIQIAGQMDYDFKLLK
FT                   SVVEVNRDQRFNVIRKLDELLGDVTGRTIGIWGLAFKPETDDVRDAPAFEIMETLLERG
FT                   ALVKAYDPIASSNFEKAFDRSEVEYCTSAQEAAEGADALCILTEWKEFINIPLSDIQKW
FT                   LKTPNLIDGRNIYREEDLEETPFAYYSIGRPKMNNGVKETNPILSF"
FT   gene            490091..491110
FT                   /locus_tag="Pjdr2_0415"
FT   CDS_pept        490091..491110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0415"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: unc-89; UNCoordinated"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99095"
FT                   /db_xref="GOA:C6CSE3"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSE3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99095.1"
FT                   /translation="MDIPRKQKPKKKLKPWMKWVIGTASFFVVVALIFMGVTYYYIKSI
FT                   DIKDIASRHNTDVANGSGEEKSEPKKLPTIIEKPVEKASQLIGGKKIDSADALDVAAIL
FT                   LNSGLSLKQISYLQGNATTDLSVEEKQNIRDLLLTKLSDEEIKLLSSITKQYGVALNIL
FT                   NPDFPIEWVGERDPEKIKEHNEAWQKMKQQSNGSTKPVNNKPAESSKPTEPEKKPTPEL
FT                   STDLKKVKQSIDSKTESQLASLSGTCRAKSNTIVQQIVGSADGVTVEDLQNKYLGKVME
FT                   AEGSCDAQFQGIVSQSASSYADAGIDSSAMPDWNAKYEESKQSVRASAISAIATAIKS"
FT   gene            491131..492072
FT                   /locus_tag="Pjdr2_0416"
FT   CDS_pept        491131..492072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0416"
FT                   /product="copper amine oxidase domain protein"
FT                   /note="PFAM: copper amine oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99096"
FT                   /db_xref="InterPro:IPR012854"
FT                   /db_xref="InterPro:IPR036582"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSE4"
FT                   /inference="protein motif:PFAM:PF07833"
FT                   /protein_id="ACS99096.1"
FT                   /translation="MMKNLRHYTLMLLIVALCTVLPLTAGAASSSVTVKTQAVNLKFDG
FT                   QSLALPDGQYAFIYQDRTYIPVRFISYALQKSVKWDQKSSKVTVSEPTATEKEALAKLL
FT                   AGATAGGAQPAAGKSITIKPVQATLVFDGQAKALPTGQSLYSINNSIYVPLRFMSEAVG
FT                   TDIKWDQKTNSITGESAAYKAAQAGGGTTPGGNTGGGTGGTDPSTGTKPSYESIKSSTD
FT                   AKLTSLELQCAVSLGSLKDQYEAATDSAVKSSLAAQGNQVIAQCKAGFQKIIADVTADL
FT                   TKYGYSLDVLAEYQTRYENDLAVIDSVAAKLK"
FT   sig_peptide     491131..491214
FT                   /locus_tag="Pjdr2_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.857 at
FT                   residue 28"
FT   gene            complement(492151..492282)
FT                   /locus_tag="Pjdr2_0417"
FT   CDS_pept        complement(492151..492282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0417"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99097"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSE5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99097.1"
FT                   /translation="MAGYLMFSEIWTPFKMVGIRVFKDENGDYWYKYRNNKRSRLFR"
FT   gene            492582..493121
FT                   /locus_tag="Pjdr2_0418"
FT   CDS_pept        492582..493121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0418"
FT                   /product="VanZ family protein"
FT                   /note="PFAM: VanZ family protein; KEGG: baa:BA_0336
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99098"
FT                   /db_xref="GOA:C6CSE6"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSE6"
FT                   /inference="protein motif:PFAM:PF04892"
FT                   /protein_id="ACS99098.1"
FT                   /translation="MLKKDRKNSIIWFFVVFCWIFFIFTLSSESYNQQSIKPTLNKWVT
FT                   KEELAQKLPDTSVTYHGSTVVAKEDPYGFVEFFFRKGAHLFMYAVLCVSLYMFIRNLMF
FT                   RRQMVLPVIMALILTGGIAAMDETNQLSKVGRTGNPTDVIVDLTGGCIGLIICISINYW
FT                   LERRRRRPEYRFVRKF"
FT   sig_peptide     492582..492674
FT                   /locus_tag="Pjdr2_0418"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.962) with cleavage site probability 0.539 at
FT                   residue 31"
FT   gene            493233..494678
FT                   /locus_tag="Pjdr2_0419"
FT   CDS_pept        493233..494678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0419"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /note="KEGG: baa:BA_1178 nicotinate
FT                   phosphoribosyltransferase; TIGRFAM: nicotinate
FT                   phosphoribosyltransferase; PFAM: Nicotinate
FT                   phosphoribosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99099"
FT                   /db_xref="GOA:C6CSE7"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="InterPro:IPR041619"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSE7"
FT                   /inference="protein motif:TFAM:TIGR01513"
FT                   /protein_id="ACS99099.1"
FT                   /translation="MDGSNNLTLHTDKYQINMMYAHWINGTDGEGAVFEAFFRKLPFGN
FT                   GYAVFAGLERIVDFIRHLKFGEEELAYLAKQEENYDPGFLEVLRQFRFKGTVHAVEEGS
FT                   LVFPNEPIVRVEGTIFETQLVETALLNFMNYQTLIATKASRIKQVASGDILLEFGTRRA
FT                   QEADAAVWGARAAYIAGFHATSNMHAGMMFGIPTKGTHAHSWVQGHESEEEAFLAYAKA
FT                   LPDGVTLLVDTYDTLRSGVPNAIKTARYLESIGKRLGGIRLDSGDLAYLSKEARKMLDA
FT                   AGLQDAKIVASNDLDETLIFNLKAQGAKIDTWGVGTQLITAADQPSLGGVYKLTARKRD
FT                   GQYIPVIKISGNPEKVSAPGKKDVYRIMNKSTGLAEADYMTLHDETDILNGERIKLFDP
FT                   VHPYIHRFISDYEAVPLLKPIVVEGEIVYKLPLLEEIRSYHEHQLSIFRPEILRKLNPD
FT                   LYPVHLSEQAWQLKTDLIKAHQQ"
FT   gene            complement(494729..495610)
FT                   /locus_tag="Pjdr2_0420"
FT   CDS_pept        complement(494729..495610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0420"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: bsu:BSU10830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99100"
FT                   /db_xref="GOA:C6CSE8"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSE8"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS99100.1"
FT                   /translation="MTLFHFTVPPLPHYIASGYTKCSAGFKHPGRYRIGVFDLLVVTEG
FT                   CLFMGEGDSTFEVRAGEVLILGPDNHHYATKECEEPSAYYWLHFQTTGRWAASEEYAPR
FT                   IIQGREPHGLNPQIFTTQTFIKQVPQYTRLLQPAKTVEQIQQLMELGHGNHLGSVSWKQ
FT                   QVLFQEIIEQLSASIEMQGTTPTSQCAELAASYLRKHYREDIKAQQLGESINFHPVYIA
FT                   RCMQKEFGCSPFDFLLRFRIQQSKLLLLQTNYTIARVAEEVGFNSAAYFTSCFAKYEGI
FT                   SPRKYRQRFSHG"
FT   gene            495649..495753
FT                   /locus_tag="Pjdr2_0421"
FT   CDS_pept        495649..495753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99101"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99101.1"
FT                   /translation="MKVSVVKLIQYPKYSIYNMKLHDYYSGVLELPFT"
FT   gene            495794..497188
FT                   /locus_tag="Pjdr2_0422"
FT   CDS_pept        495794..497188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0422"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: bha:BH2936
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99102"
FT                   /db_xref="GOA:C6CSF0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSF0"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACS99102.1"
FT                   /translation="MQKREHHKFSLWMLAWPIFIELFLQFLLGAADTLQVSKISDNAVA
FT                   VVGFSTQLFSALMTLFMTVASGAGILIAQRIGMRKNEDARTIAIMAVKVSAIIGLGISV
FT                   LLYLFPGPIASALHLPDELLPLAKTYISIVGGGMVLVAVMAALSNAIRNTGNTKGPMYT
FT                   AIGMNIVHVGMNYAFIFGKFGFPQWGLKGVAISTDISRLLAVIVLLIMFLGAFERQISL
FT                   RDFKLFDSKLFKEILKIGWPLGINMSCWVFSQLLIYTYIAQLGSVELSARTYMNTLESF
FT                   CFMLGYSLALALQIQIAHLFGAGKVQEAYKNSYRALWIGLAIVTVNALVLYLIGGTILK
FT                   IFTDDPEIIAMGVSLLGMNLLLQPGKMLNMGIGNALNAVGDTRYVMWTSITSMTLIATI
FT                   LSYIFGITLGWGLVGIYACMIMDEYIRGIWVLRRWRQKKFMKTGQEKPAAVSHNGAGGK
FT                   GATLEA"
FT   gene            497217..497705
FT                   /locus_tag="Pjdr2_0423"
FT   CDS_pept        497217..497705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0423"
FT                   /product="translation initiation factor IF-3"
FT                   /note="TIGRFAM: translation initiation factor IF-3; PFAM:
FT                   initiation factor 3; KEGG: sil:SPO2638 translation
FT                   initiation factor IF-3"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99103"
FT                   /db_xref="GOA:C6CSF1"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSF1"
FT                   /inference="protein motif:TFAM:TIGR00168"
FT                   /protein_id="ACS99103.1"
FT                   /translation="MLIMNEKIKAAEVRLTGLDGESLGIVSREEALQMAKQLKVDLVCE
FT                   SLMSSPPPCKLIVRGGAKQQASQQKRAEKVKSEPAKVKELRLSVDIEQHDYDTKLRQAV
FT                   KLLESGNAVQLVIRIQGKEGARAKELLEQLLADLKPYGAKQTGIQLSGKQAAVQVNPN"
FT   gene            497866..499584
FT                   /locus_tag="Pjdr2_0424"
FT   CDS_pept        497866..499584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0424"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG: baa:BA_0268
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99104"
FT                   /db_xref="GOA:C6CSF2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSF2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS99104.1"
FT                   /translation="MLKKFFAYYRPYRKLFLLDFGCAVILAVLELLFPLAVSHVIDTLL
FT                   PEGNLKYIIGACAILLAVYVLNTFLSFVVTYWGHMLGINIETDMRRKLFDHVQKLSFRF
FT                   FDNTKTGHLISRMTNDLFEIGEVAHHGPEDMFIAVMTLMGAFGIMAYINLPLTIMTFIV
FT                   VPIILVLVLFFNGKMTKASHRLFGDMADFNARVEDTVGGIRVVQAFSNEKHESKLFAGN
FT                   NSRFRQAKLISYKIIGLNSSITYMLMRLVTLFVLLAGTWFVINDNLLYGEFVAFVLMTN
FT                   IFFKPIEKINAVIESYPRGIAGFRRYVELLETEPDVADAPNAKAVDRLHGDIEYKSVTF
FT                   GYEGEAKVLKDISLSIRAGETIAFVGPSGAGKTTLCSLLPRFYEVDGGGISVDGHDIRD
FT                   LKLESLRKQIGIVQQDVFLFAGTIRDNITYGKLGASDADIMEAARRARLEEFIQSQPDG
FT                   LDTVVGERGVKLSGGQKQRMAIARMFLKNPPILILDEATSALDTETEQAIQQSLAELSE
FT                   GRTTLVIAHRLATIKNADRIVVVTENGITEEGRHEELVATGGIYSRLHQAQFGAI"
FT   gene            499746..500657
FT                   /locus_tag="Pjdr2_0425"
FT   CDS_pept        499746..500657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0425"
FT                   /product="UbiA prenyltransferase"
FT                   /note="PFAM: UbiA prenyltransferase; KEGG: noc:Noc_1948
FT                   UbiA prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99105"
FT                   /db_xref="GOA:C6CSF3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSF3"
FT                   /inference="protein motif:PFAM:PF01040"
FT                   /protein_id="ACS99105.1"
FT                   /translation="MEPEIQMGKSLAQAHPGVPISLIKLLRPKQWTKNALVFAAPIFSL
FT                   SLLHWSLFWQVIIGFFLFCFVSGCVYILNDFFDREADRNHPEKRYRPIASGAVNPYVAL
FT                   VFGFLLLTTSLTTAFIFNPLFSGLLLVYFLMNVAYSMKLKHVVIMDVMIIAFGFVLRAI
FT                   GGGLMIDVPLTPWFLVCTMLLSLFLAISKRRHEIFLLQNEKEGHRKVLEKYSIQLLDQM
FT                   SNIVTTATIMAYSLFTFTSGRTVQLMWTIPFVIYGVFRYLYLVHMEGKGGKPDKVLLED
FT                   KPILVTVVLYGISVILILLFLE"
FT   gene            500661..501011
FT                   /locus_tag="Pjdr2_0426"
FT   CDS_pept        500661..501011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cvi:CV_0751 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99106"
FT                   /db_xref="GOA:C6CSF4"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSF4"
FT                   /inference="similar to AA sequence:KEGG:CV_0751"
FT                   /protein_id="ACS99106.1"
FT                   /translation="MILMWNMVWILVSVIMGAAGQVLLKFGAMHPNESMSGPLRMLNLY
FT                   NAGGIFLYGASALIWMFVLRKVELSYAYPFVSLAYIIVLVASYYFFGESINTYKIAGLV
FT                   LIVGGIAFISRA"
FT   gene            501018..501443
FT                   /locus_tag="Pjdr2_0427"
FT   CDS_pept        501018..501443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0427"
FT                   /product="acid phosphatase/vanadium-dependent
FT                   haloperoxidase related"
FT                   /note="PFAM: acid phosphatase/vanadium-dependent
FT                   haloperoxidase related; KEGG: pnu:Pnuc_0330 acid
FT                   phosphatase/vanadium-dependent haloperoxidase related"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99107"
FT                   /db_xref="GOA:C6CSF5"
FT                   /db_xref="InterPro:IPR003832"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSF5"
FT                   /inference="protein motif:PFAM:PF02681"
FT                   /protein_id="ACS99107.1"
FT                   /translation="MVVLPYFLAPLIGWFVSGILKFMINYIRFGKEAKQRVGNGGFPST
FT                   HTTVVTTPSMLIGLSEGFNSPMFALAVAVTFIVIIDATGLRRAVGRHAVAINIMTSDSS
FT                   AIQPTKLRESMGHTRLEIIGGLVLGILLGYLLHGIAG"
FT   gene            501513..503159
FT                   /locus_tag="Pjdr2_0428"
FT   CDS_pept        501513..503159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99108"
FT                   /db_xref="GOA:C6CSF6"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99108.1"
FT                   /translation="MTTVTAKAHLMKGAFILSGTAMTGLVSLKGTAFHVAIGVLCSFLI
FT                   LCWAAYTSGYLNKVIPVIRKKDILLPLIFAVAIDVSMIDYFYKQRTLKNVREMLQDSGY
FT                   MPYSDEIAAAISIIVGIVAFYFLFLCVYLLWPKLAAVVLEFARNLTKLEKRYLIISTLL
FT                   LAVVVIIAFNVSSVFYETRDQSGELVRFDVVYTTDTADLVDSNVYLNISSVQNDLKQPL
FT                   FGLFALPFALVGVVISKLLFFVPNSYPVMMQIIQVLLLQMAMILISRMLKLRSIDQLIF
FT                   LLFLNASYPVLMFSLNMEQYIFSLFWLILFLYSCQFGWGPKVYYFIGAAGSLLTSAVLF
FT                   PLLSKSKQLKGILKDTGRVALQALVIMVLFGRLPLLLEVVSSVKENMEFTGAAISSGDK
FT                   WLQYVNFVASCFVKPGAGVDKTTFEHVSYQLHAVHSLNILGLILMILAVAGFLLHYKQR
FT                   FMKICVLWVSFSFVMLCVVGWGTAENGLILYSLYFSWAFMALLFMLIDKLLARHHWVKY
FT                   SVHALLLVVMIGLNAQGLYDLIRFGAEYYPV"
FT   gene            503191..504822
FT                   /locus_tag="Pjdr2_0429"
FT   CDS_pept        503191..504822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99109"
FT                   /db_xref="GOA:C6CSF7"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSF7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99109.1"
FT                   /translation="MPVRSSILRLLFIASGACMTALLTLRGSAVNVLIGLLCSLLLLYW
FT                   LTYKRQVVEKVTQELSPGRIFFAALFTLVGVYYLTQYSYIKYSKLSGEVFDRIGLDIGG
FT                   HNDKVISIALGICSLLAVFLVLCWFLPKFYATAKELITGLDRLERRYWIIASIIMAVAI
FT                   LIIYNLTNVFYGAHDAAGKIIPYDVVYTADSIDQVESNAFLNIGTYENDIRQPLFGLYA
FT                   APFALIAMILSKVLFFIPNSYPIMMQIIHVFVMQFAMILLARMMKLQSMDKVFFLLFMS
FT                   FSYPFLLFMLNIEQYIFAVFWLILFIYSYLFQWGRRDFFFIGAVGSLVTTGILFPLLSQ
FT                   ARKLKEWIKDMAVNAFKFLAAATLFGQLPVILETHTEYKGLMAFSGAEVTTLDKWYQYV
FT                   NFFASCFVWPSAGEDRTTFEHASYQLRLVDSLNILGVIILVLAVIGFLLHYKDRFAQIC
FT                   MFWLAFSFVILFAVGWGTKENGLILYSFYYSWALFALIFKLANRLLARVQPLKFGVYGL
FT                   LLGVMAVINLIGIYDLIDFGIRNYPA"
FT   sig_peptide     503191..503280
FT                   /locus_tag="Pjdr2_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.517 at
FT                   residue 30"
FT   gene            504969..506711
FT                   /locus_tag="Pjdr2_0430"
FT   CDS_pept        504969..506711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0430"
FT                   /product="histidine kinase"
FT                   /note="PFAM: histidine kinase internal region; ATP-binding
FT                   region ATPase domain protein; histidine kinase HAMP region
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; KEGG: bha:BH3447 two-component sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99110"
FT                   /db_xref="GOA:C6CSF8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSF8"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACS99110.1"
FT                   /translation="MDEREVPYIKRLFGWDTLRGQLYWTLLVSSVIPLVLVGILTVYSI
FT                   YNILYNKIEKGIEQNLQRVSRSLEETLENLYDVSQQMSYQGFVGRDMEALQTSEDNYEK
FT                   SQLVVNIQRNMGILNASNPTIGLVFYYDTTTGEIQYNNYITRDLHPDFDSLPKLSVHSD
FT                   HVFNGPHLTLYKYNDIPVFSIVRSVGGITDPGNPLLVYAETNVSVIKNILNKEQYGMKV
FT                   SHLLMDKDGTVLFSDKPELTPIGSTYDPGKLKRYYFHEVTGSQGWRLGVFVEKGEYQKE
FT                   IRDWFVKYAFIVVLGLLISIWSAFRTWKVVISPLHRIRKGISAVISQEPNANFQMTGLR
FT                   EFDFLIQNFNDMQFRIQKLIMEVAKEASEKQEIEMEKLMAQINPHFLYNTLNTAQWLAR
FT                   LKGQHEIDRFLSLFTKVLKYNLAKDGAIVTLKDEIESLNDYVELQKIRYDFEFDVRYSI
FT                   PEPFLATPLPRFILQPIVENALYHGMMDEKGIIEVTAEEREGMLVLMVKDNGNGISPEK
FT                   IKELLESDTRKNNISGLGIGLNYVVRTLSSFTGGASQLRIDSQIGEGTTVSIHMPMHEE
FT                   EAKP"
FT   gene            506708..508078
FT                   /locus_tag="Pjdr2_0431"
FT   CDS_pept        506708..508078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0431"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix-
FT                   domain containing protein AraC type; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   response regulator receiver; KEGG: bha:BH2109 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99111"
FT                   /db_xref="GOA:C6CSF9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSF9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS99111.1"
FT                   /translation="MKVIIVDDEKLVRRGLISMMPWSKYDMEVVGEAGNGRKALELLET
FT                   LEVDLVFTDLMMPEMSGFELIEEMNGKYPAASAVVLSCHEEFSFAQKAIRLGAIDYIVK
FT                   NDLETDVMDEVLERVAHSYEEKVKARPVPEVRTFDRVMVVLELEEVEKAGQLIRKLSAG
FT                   HIIHYLERRCWFLSLDGVGKSEEQSLINDIKEANCLPVLVHGLGHESLSGAVDKLHGYL
FT                   AAGLLYDFTKMLRFWEWRADEEKEPLNPEKIQLGERWNKLEWIYSNETYEELLRDTTAI
FT                   RLPMSELKSLLFPALLESGRLLLMVEWSMQLIFRLEPLRMWEECRSVLDEERDKLRSIV
FT                   CRTKYSDDILRVIYKAIQYMHEQEEMDFSQNEIAGIASMSRTYFSQCFKNVTGKSFNDY
FT                   ATEIRMSRAKKLLAHTNTPIYQIAQLVGFKDEKYFSKLFMQEIGVLPSDFRKQWERE"
FT   gene            508258..509889
FT                   /locus_tag="Pjdr2_0432"
FT   CDS_pept        508258..509889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0432"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH1064 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99112"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSG0"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS99112.1"
FT                   /translation="MKKALSILIISALMVLAACSGNNGNANSGNNAGGNASNGGTAEPA
FT                   DPYAPMSETVTISIGKEAAVDPKLPSGSTIEDNELTRYFAEKLNVKYTNEWQATGDAYT
FT                   QKVGLTLSTGDIPDVMIVDKQQLVQLVNADLIEDLTSTYKSFVSPSLKAAYDSTNGYSL
FT                   ASATFDGKLMAFPNVSPGADAQNMVWVRQDWLDELQLEAPKTMDDVINVTKAFMDKKGS
FT                   VGLLGNQVIVNIGTSVFGFDSIFSAYNAYPQLWTKDASGNTVYGSIQPEVKEALAKIRG
FT                   WVQEGVIDKEFAVKKNEQVNELVVSGKAGIFFGPWWLPFGVLADSVAQDSKAEWVSYLA
FT                   PLDQEGKMNTHMASPTTRYLVVKKGFKHPEAVLKTLNMQFDTDQLQGEGIVQKDAYNWM
FT                   NMPFSLLLSNYDDKEKKAKLVQDVIDGKAGADTLQGEAKQIYNSYLKDKENPKKDLAAW
FT                   SQRHAFLTGALPLIQDDKINRNVGVYYDQTDTMRTKWANLRKLEDETFLKIIMGNEPVD
FT                   SFDSFVGKWKSQGGDEITKEVAEAAK"
FT   sig_peptide     508258..508338
FT                   /locus_tag="Pjdr2_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.541 at
FT                   residue 27"
FT   gene            509973..510863
FT                   /locus_tag="Pjdr2_0433"
FT   CDS_pept        509973..510863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0433"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH1065 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99113"
FT                   /db_xref="GOA:C6CSG1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSG1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS99113.1"
FT                   /translation="MRDSKSTLHYHLMLAPGMILLVIFGIVPLFGMAIAFQDFIPVKGI
FT                   WGSKWVGLENFKYMFELDDSKTIFFNTIFISVMKMLMNVLIPVSTALLLHEIVFNRLKR
FT                   WMQTIIYLPHFLSWVILAGILTDMLSQNGIVNQVIKSITGEPIFFLGSNNWFPVVVVLS
FT                   DVWKEFGFNTIIFIAALTAINPSLYEAASIDGAGRIRKIWSVTLPGILPTIILVSTLNI
FT                   GNILNAGFDQIYNLYNPLVYESGDIIDTYVYRIGLVQYQYGLATAVGTLKSVVGFILIF
FT                   VSYRLAARFAGYRIF"
FT   sig_peptide     509973..510074
FT                   /locus_tag="Pjdr2_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.834) with cleavage site probability 0.363 at
FT                   residue 34"
FT   gene            510913..511791
FT                   /locus_tag="Pjdr2_0434"
FT   CDS_pept        510913..511791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0434"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH1066 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99114"
FT                   /db_xref="GOA:C6CSG2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSG2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS99114.1"
FT                   /translation="MPLTGKRGIRTTDIVLTLVMLLITLLCLLPLVNVVSLSFSGKSAA
FT                   ASGAVTLFPKDFTFYSYEYMFKDSRFFDAFGVSVKRVLLGGAINFVLTIMMAYPLAKER
FT                   QEFRGRDIYMWVIVFTMMFTGGLIPWYMVVKSLHLTDTIWALVLPTAVPIFNVILLMNF
FT                   FRGMPKEINESAKMDGAGPWRTLITIAVPLAMPAIATVTLFSIVSHWNAFFDGLILMNK
FT                   QHNIPLQTYIQQLVVAPSITSSTRPEDLINFSQRTFNAAKIVVTMLPILIIYPFLQRYF
FT                   VHGITLGSVKE"
FT   sig_peptide     510913..511050
FT                   /locus_tag="Pjdr2_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.944 at
FT                   residue 46"
FT   gene            511815..512687
FT                   /locus_tag="Pjdr2_0435"
FT   CDS_pept        511815..512687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0435"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99115"
FT                   /db_xref="GOA:C6CSG3"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSG3"
FT                   /inference="protein motif:PFAM:PF04616"
FT                   /protein_id="ACS99115.1"
FT                   /translation="MQINNPILPGFWADPFILRDGEDYYLYPTKDSAGWMYEKFHVFHS
FT                   KDLVNWDGPYLALDLNDVSWADKQAWAPGIAKYKGKYYMYFSAEAQIGVAVSDSPLGPF
FT                   KDMLDRPLITRNQYHCQSIDADLFVDDDGQPYLLWGQGKCWIVPMEEDMTTFKSEPVQL
FT                   SVQIHNSKGSDAAAGDIAVYNEGPHMQKRDGRYWLTWSNYDTRDPRYQIAYAFSDHILG
FT                   PYEVPENNRMTLESVSAVGTGHASLTEFENEWYLIYHRLAEPETSVLRETCIGLVRFKD
FT                   GQPYVDVDE"
FT   gene            512880..513350
FT                   /locus_tag="Pjdr2_0436"
FT   CDS_pept        512880..513350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0436"
FT                   /product="protein of unknown function DUF985"
FT                   /note="PFAM: protein of unknown function DUF985; KEGG:
FT                   mno:Mnod_0449 protein of unknown function DUF985"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99116"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSG4"
FT                   /inference="protein motif:PFAM:PF06172"
FT                   /protein_id="ACS99116.1"
FT                   /translation="MSATAVKEISPLVAALELKPHVEGGWYKEIWKANFEIPQAVLGEP
FT                   YSGPRFAASSIYFLLHPGEFSDWHTVHSDELWLWHSGSPLMLTLGGTGENPEVRKEIIV
FT                   GGDVANGQHPQALVPATEWQMARPLGDEPVLVSCIVAPGFHYDDFKLIERKF"
FT   gene            513350..514561
FT                   /locus_tag="Pjdr2_0437"
FT   CDS_pept        513350..514561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0437"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bar:GBAA0787 major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99117"
FT                   /db_xref="GOA:C6CSG5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSG5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS99117.1"
FT                   /translation="MKPAEKLWTKNFILLACSNLFLFFGLEMLLPTLPLFADEKGGSGS
FT                   QIGMMLGIFTFSAVVSRLLIGIGLKHFGKRKLLLIGVTICLIGMACYYAADSISALLAL
FT                   RVVHGFGFGIATALYGTLVSDAIPAERRGEGMGYFAMGNAVSFSIGPMLGLWLLDQYDY
FT                   AGLFGAGVVFLAITLVLTLLVRQKSAQSVEIAAAEAAAAAELHAAGVKPSPWAEVIEPK
FT                   VLVPSMLGSLVGFAFGGMLSFVTLFTKDIGITQTGYFFLVVAISEVLIRFISGPLFDRK
FT                   GPFWVLFPTAILCMIGCVLLYYTDSMAMLLLAGVFYGAGFGAMFPALQAWVINLVQPER
FT                   RGVATATYYNFFDIGIGLGSILLGVVVTATSYTTMFLLSGILYVIYLAVYFIYLSRQRA
FT                   RAQG"
FT   sig_peptide     513350..513463
FT                   /locus_tag="Pjdr2_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.825) with cleavage site probability 0.804 at
FT                   residue 38"
FT   gene            complement(515785..517593)
FT                   /locus_tag="Pjdr2_0438"
FT   CDS_pept        complement(515785..517593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0438"
FT                   /product="5'-Nucleotidase domain protein"
FT                   /note="PFAM: 5'-Nucleotidase domain protein;
FT                   Peptidoglycan-binding LysM; metallophosphoesterase; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: bha:BH0026 nucleotidase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99118"
FT                   /db_xref="GOA:C6CSG6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSG6"
FT                   /inference="protein motif:PFAM:PF02872"
FT                   /protein_id="ACS99118.1"
FT                   /translation="MLIKLRKMKWAAGMLAASLFAASVGVVAAADETAVPASAKHITLL
FT                   HTNDMHARAVEGNSGEMGYAKLAGIIDSYRKANPESLLLDAGDATHGTTFATLVNGESV
FT                   VQVMNKMGYDAFVPGNHDFNYGYKRLLELEQMMKFPVLSANVKVAKDNTSLFKPYIIKE
FT                   VDGVKIGIFGLTTPETAYKTHPKNVEGLTFADPTKEAQAIVDELKDKTDVIVAVGHIGQ
FT                   DASSVDTSLKIVKAVDGIDVFIDGHSHTVLEHGLTAGHNTLIASAGEYTKYLGVVDLWV
FT                   DGGKVVKKEAKLENKDTAASIAPNAEIADMVASIQKSQETILAEEVGTASVKLNGEREQ
FT                   VRTSETNLGNLVADAIRDAAGADVAITNGGGIRASIDEGTITKGEIITVLPFGNQIVSL
FT                   KVKGADIKAALETGVSDYPNSKGGFPQVSGITFKIDVAKPKGQRVHSVTVKGKPLNEKA
FT                   DYLLATNDFMAAGGDEYTMFTPYPQAGMYGSLDEALIAYITKLGTANSKVEGRITAAAT
FT                   PVVAQPQPEPKPEPKPEPKPEPKPEPKPEPKPEPAKPAVYVVKQGDTLWAIAKKNNTTW
FT                   QKLRDLNHIKNPNLIYPGQKIKLPAA"
FT   sig_peptide     complement(517504..517593)
FT                   /locus_tag="Pjdr2_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.764 at
FT                   residue 30"
FT   gene            517933..518883
FT                   /locus_tag="Pjdr2_0439"
FT   CDS_pept        517933..518883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0439"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: putative sugar-binding domain protein; KEGG:
FT                   baa:BA_2393 helix_turn_helix, cAMP Regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99119"
FT                   /db_xref="GOA:C6CSG7"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSG7"
FT                   /inference="protein motif:PFAM:PF04198"
FT                   /protein_id="ACS99119.1"
FT                   /translation="MEELSDKRLKMIEAARMYYELDYNQQEIAKKLGVSRPTVSRFLQQ
FT                   AKEDGIVQIRIMDPASDNQERARMLKERFGLKEAIVASVPKYEDAMVKKVIGEAAANFL
FT                   NDTVQDGDTIAVTWGTTLYEVASRLPNKHTKKVKVVQLNGGVSHSETNTYAYEIAQLFA
FT                   KAYQTSPYLIPLPAIVDHAVVKHAIEADRHIRKILDMGKQANIAVVTVGAPTEDSVLIR
FT                   ANYFSDEDLGIILSRGVGDICSRIIDINGQLCSEELDHRTIGIDLNELKKKEWSVLVAG
FT                   GPSKVEAIYGALNGQYTNTLITDQITAQHLLEFKG"
FT   gene            518912..519601
FT                   /locus_tag="Pjdr2_0440"
FT   CDS_pept        518912..519601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0440"
FT                   /product="deoxyribose-phosphate aldolase"
FT                   /EC_number="4.1.2.4"
FT                   /note="KEGG: bar:GBAA1892 deoxyribose-phosphate aldolase;
FT                   TIGRFAM: deoxyribose-phosphate aldolase; PFAM:
FT                   deoxyribose-phosphate
FT                   aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99120"
FT                   /db_xref="GOA:C6CSG8"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR011343"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR028581"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSG8"
FT                   /inference="protein motif:TFAM:TIGR00126"
FT                   /protein_id="ACS99120.1"
FT                   /translation="MSNQKNLSAGEVAAYIDHTALKAETTKQEIIKLCEEAKQYHFATV
FT                   CVNPGYVALAAKELAGSGVGITTVVGFPLGATTTFAKAEEAKDAIANGATEVDMVINVG
FT                   LIKSGDFEGVKKDVEGVAQACKGKAVLKVILETGLLTDEEKVRACEICKEAGADFVKTS
FT                   TGFGKGGATAEDIALMRRTVGPDLGVKASGGVRDLETALKMIEAGASRIGASSSVAIVT
FT                   GGQGEGY"
FT   gene            519805..521205
FT                   /locus_tag="Pjdr2_0441"
FT   CDS_pept        519805..521205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0441"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: sulphate transporter; Xanthine/uracil/vitamin
FT                   C permease; KEGG: bha:BH0414 sulfate permease"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99121"
FT                   /db_xref="GOA:C6CSG9"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSG9"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ACS99121.1"
FT                   /translation="MSLKTSWREQWTGNVRMNVLAGITATLALVPDSLAFSFMAGVPPV
FT                   VGIYASICILLVITFLGGRPGMISAAAGSMAVLMLTLVKEHGIEYLFAATVLTGIIQFL
FT                   MGVFKLGKLMRFVPSGVLTGFINALAIMIFLSQLRYFKGESWVMYVLVAVTLGIIYLVP
FT                   RFFKAIPSPLIAVVVLTLAVWAFGMGDVTRIGDIARIDASLPSFLFPDIPFSLDTLWII
FT                   LPYSLSLAVVGYTETMLTHNLLDEMTGEKTDKNREMKGQGLANIVAGFFGGMAGCALVA
FT                   ESVLNVKMGGKNRLSTLVAALFLLLLVVLLGDLLSLVPMAALVGIMLMVCIAIFDWSSV
FT                   FRMNRLPLGETVVMLVTVGAVLLTHDLAIGVVAGVFVSFIGFAVKASKVHIHDEWNGST
FT                   RTYRVHGQLFFASASELEERIEHDCEAEEVRIDLSGTKVWDHTANLAVRKTVDRLQKNG
FT                   KQVTVVGV"
FT   gene            complement(521641..522348)
FT                   /locus_tag="Pjdr2_0442"
FT   CDS_pept        complement(521641..522348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99122"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSH0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99122.1"
FT                   /translation="MTDIEQTIALITKSSGRRSAYHFTRASNLQSIARFDSIWSSQHLL
FT                   PKSTGERRVAREVVSYEGASITVNSHLRIPEAMMETGCSVEEFRNFIDKHVFFWPTARD
FT                   CLKMLTTYMRREPDEAFAVLEFEASELLLEHKESVRLSKYDSGSSPRFPKSCNYRKSPA
FT                   MFVTLADFGRRTDYAVPVKPSEIKEILIEKQAHFVTRLLKSVYAPTQEYVPPAWLPNYQ
FT                   PLDRLLPVDETEA"
FT   gene            complement(522575..523444)
FT                   /locus_tag="Pjdr2_0443"
FT   CDS_pept        complement(522575..523444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0443"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: scl:sce1454 putative
FT                   galactose mutarotase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99123"
FT                   /db_xref="GOA:C6CSH1"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSH1"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ACS99123.1"
FT                   /translation="MSQFQVTSYTDTFKIYELIEESTSSRIRVCPERGGIVIGCQLNGL
FT                   EVFYLDKATFDHPTANIRGGNPILFPICGQLENKTYTWNGQSYEMANHGVARTSVWEVA
FT                   GTSTDGEASITIVLRSNEETKQSFPFDFEVSFTYALVNGELHIRQQYRNLTEGETMPFY
FT                   AGFHPYFNADSKKLPYETDATTYLDYNDMVEKPYTGELDLDGMVESVTLLGAEKREIAF
FT                   PVSGGARVRMTYDDIFKYVQVWSVQDKPFVCVEPWMAMTGELNRQEELVMLQSGEALNC
FT                   NLTISCER"
FT   gene            complement(523627..524805)
FT                   /locus_tag="Pjdr2_0444"
FT   CDS_pept        complement(523627..524805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0444"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: glo:Glov_0699 PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99124"
FT                   /db_xref="GOA:C6CSH2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023059"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSH2"
FT                   /inference="protein motif:PFAM:PF00639"
FT                   /protein_id="ACS99124.1"
FT                   /translation="MENKDSQHKRENEELDTAAEQENQQYVYEDDNKDDQHVDALQDEK
FT                   DEEVEEEERKQAPTSETPAQAAGGRSGGKAWIAVSAILAIVLIIVLIKPPFGAGDKAVA
FT                   TVNGAKITKDKLYDSLVEQGGKSTLDNMITTELIDQAAADAKVTVTEADVDKEIENLKK
FT                   SFGSEDEFNQTLAQYGMTVDSLREDAEVQVKIRKILEPQVKVTDDDIKAYYDANKASMS
FT                   TPEQIRASHILVATKEEAEDILKQLKAGADFATLAKEKSTDTGTKDNGGDLNFFGKGSM
FT                   EPAFEDAAFALKKGELSGVVQTSYGYHIIKKTDEKAAVTPTLEEKKEDIKYQLVTQKVS
FT                   ELSSTWMADLKAKAKITNTLDPAAAEESPAASADASPEASAAAGNASTNTAK"
FT   gene            525010..527061
FT                   /locus_tag="Pjdr2_0445"
FT   CDS_pept        525010..527061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0445"
FT                   /product="diguanylate cyclase/phosphodiesterase with MHYT
FT                   sensor"
FT                   /note="KEGG: pag:PLES_36021 putative integral membrane
FT                   sensor domain; TIGRFAM: diguanylate cyclase; PFAM: EAL
FT                   domain protein; GGDEF domain containing protein; MHYT
FT                   domain protein; SMART: EAL domain protein; GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99125"
FT                   /db_xref="GOA:C6CSH3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSH3"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACS99125.1"
FT                   /translation="MVILHGEYNGWVILLSFIIALFVSYSALNLVYKISQSKGKVQLGW
FT                   MLAGAFVMGSGVWTMHFIGMMAFHIGIPISYNVPITLLSITASICASYVAFYLTLAKEI
FT                   NRLKLLGGGFIMGAGIVAMHYTGMASMHSPTMSIQYNPIIVVLSAVIAILASCAALYFF
FT                   INFRDGSKAVWSKWAAASLMGLAVCGMHYTGMGAASFWCGEPIASSLTENIPINLFLLI
FT                   SVTLVTLLIMLVTWIAIYLDRTVLERMAYSDPLTGLANRHAMNRYFDQKLDKARSYGLL
FT                   FLDLDQFKIINDTLGHDIGDLLVQAVAKRLRSHVSEGAQTFRLGGDEFLLVTRGMEPSE
FT                   VEKLANRILEDIRKPYLLEGNELYITGSIGISLSPQHGIERSSLLIAADTAMYQAKRRG
FT                   KNQYCLYDEQMERELLRRMELEKDLRLALPREQFVVHYQPKWDAAANRAIGVEALLRWN
FT                   HPLLGRIPPEEFIPIAEETGLIVPITRWVLGQACRDCFEWNEGRAEPLSVSVNMSVSVF
FT                   DSKNLEDMVISALLHSGLDAHLLELEITETIVMHNVEDVIEQLNPIREMGVQISMDDFG
FT                   AGYSALGSIDLIPFQTLKIDKLYMQQSDSPSKRAIIQTIIILAKQLNLEVIAEGVETEQ
FT                   QIAFLQSAGCSMMQGYYFSKPMSRADLDLWLQQSMVIDRSQTSQSLIG"
FT   gene            527087..528496
FT                   /locus_tag="Pjdr2_0446"
FT   CDS_pept        527087..528496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0446"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: sfu:Sfum_3292 response regulator receiver
FT                   modulated metal dependent phosphohydrolase; TIGRFAM: metal
FT                   dependent phophohydrolase; PFAM: metal-dependent
FT                   phosphohydrolase HD sub domain; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99126"
FT                   /db_xref="GOA:C6CSH4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSH4"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACS99126.1"
FT                   /translation="MNSQARIYLYLLLSLTVPLIVFMVLHMNPAWDYHLHSPNGHFYVV
FT                   SIVSGLAFALAIAVGVAAIRLRNLKISFLSLSFVSLAALFLVHGLSTPREAYHTTALPS
FT                   NAAQMSILLAVMWLWLSSMSSDRRIISWLSTHQRWLLPIWTASIAVICALLWLFSDQMS
FT                   WLQMKQGPIKWTATLLIIGLNGWTMYRYLETYLSTRFPLQLAIVYSSGWMIAAQFINVM
FT                   GKMWMLSWWIYHLLLLASISAMIIGIYYQYRSSGSYTMSLKQLFQNDPKEWIHTYMSPA
FT                   VRELIRTTETRDAYTAGHNYRVALYAIQLGEELGLNSDQLRAIAQGGIVHDIGKLIVPD
FT                   NILNKPGKLTPEERDIIEKHPVTGFNLCRRLGFMQEELAVIRSHHERWDGSGYPDALSG
FT                   DNIPLLARVTAVADVYDALTSSRSYRAALSHEEAMTIILKERGKHFDPLCVDALVRIAG
FT                   EKGWAFKASAS"
FT   gene            528610..529599
FT                   /locus_tag="Pjdr2_0447"
FT   CDS_pept        528610..529599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0447"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: yen:YE1221 putative
FT                   ion channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99127"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSH5"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACS99127.1"
FT                   /translation="MTYAADKSRFEDMKYFRVGKSGLKLPAVSLGLWHNFGGNDRLENG
FT                   RAMIHRAFDLGITHFDLANNYGPPPGSAEETFGKVLKQDMAAYRDQMIISTKAGYYMWE
FT                   GPYGDWGSRKYLVSSLDQSLKRMDLEYVDIFYHHRPDPETPLEETMAALDHIVRSGKAL
FT                   YVGLSNYSAEQTAQASAILKQLGTPCLIHQPSYSMFNRWIEDGLQDVLDQEGIGSIVFS
FT                   PLAGGLLTNRYLDGIPTDSRAGGPSVFLNSNSITEEKLAKVRALNEIAQSRGQSLAQMA
FT                   LAWVLRGGRVTSALIGASRVEQIDDNVAVLSRLDFSDDELQAIENILA"
FT   gene            530080..530595
FT                   /locus_tag="Pjdr2_0448"
FT   CDS_pept        530080..530595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0448"
FT                   /product="protein of unknown function UPF0157"
FT                   /note="PFAM: protein of unknown function UPF0157; KEGG:
FT                   cbd:CBUD_1699 glutamate-rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99128"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSH6"
FT                   /inference="protein motif:PFAM:PF04229"
FT                   /protein_id="ACS99128.1"
FT                   /translation="MEVRLSDYKEEWAQMFREEAEYLRSIFDGVEIRFEHFGSTAVPGM
FT                   KAKPVIDMMGIVDDINKIDLFNDVTASLGYDVAGDWGIPGRRLFRKGGEQRTHHIHFYQ
FT                   SDSPQIGRHLIFRDYLRSHPEEAARYSSFKEQLARRYERTNEYSPAKKAFVSEMEQLAL
FT                   TWYSQTNE"
FT   gene            531634..535437
FT                   /locus_tag="Pjdr2_0449"
FT   CDS_pept        531634..535437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0449"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: dat:HRM2_43550 putative two-component system
FT                   sensor protein; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; PAS fold domain
FT                   protein; Hpt domain protein; response regulator receiver;
FT                   PAS fold-4 domain protein; histidine kinase HAMP region
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAC repeat-containing protein; response
FT                   regulator receiver; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99129"
FT                   /db_xref="GOA:C6CSH7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSH7"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACS99129.1"
FT                   /translation="MLIIVLITFIPLGIAGVINYLSVKQEMINTASDRAASQLSVSANY
FT                   LASWLQIRRAEVVVMSRTDIVRYGTDAEKLKYFRDELYRSDYTYHAIGYIDLNGRAIRT
FT                   NGDPVNMSGQAFFREAVKGKSAITDLFLPSFDNLKQSLIVIPVFDQTNSINGVIYASMP
FT                   MSTMSPYFLVDKDPSLEYWLYNDRGVVLFHSYSTSAGIKPIQGLLNGQPGLSLEKLLKP
FT                   SGKIHIQRGNMKHVLLYMDVDSAAPWHAALEIPQASLNKGLSKVLWWTFATIALSEVVI
FT                   VILFSIYFNMIINRLKGILSVTKQAADGQFEVEHLSQEPGDEVGKLAESVNGMMEHLKD
FT                   MFGRLEAIINQNEYSFILLDENYRVSYMNQAAEKLIGYTTDELKGHATPLLFMDPDEIE
FT                   REAERLSQKLGEHVEPGLEVFRMLRQVDFSYERQWTYVHKDGTKIPVRHFSNGLRDQQG
FT                   RLTGVLGMAYDISEHVKVEKSRNLLLDIIGSAKDLIASIDHNGKVAYINKAGKRMLGLP
FT                   LDYKPKDYKSYVEPSMYLYLIKGSRIAMKMGYWEGEAELLTQAGDKVNVSLVIVAHPYR
FT                   NTGELYFSCIARDITEQKHIQEELIQATQEAEQANAAKSRFLAMVSHEIRTPLNGIIGL
FT                   SQLMRRTGLSPSQKDYMDKLGNSSESLLRIINDLLDFSKIEAGKVEVERVAFQPQEMLS
FT                   RLTDQLSVFMGGKEQFEFILEVPEQLPTTLLGDQMRVEQILLNLCMNAVKFTERGHVKL
FT                   ALEVMEQCSDGLKLQFTVEDTGIGMTKKQIDKLFTPFTQADGSTTRKYGGTGLGLVIAN
FT                   GLVKMMGGKIQVDSEPGLGSRFSFVLSFPVLSSVMEEKLIVSEELEDQCIWVVEDSDEM
FT                   RQHWCRLAESFRLTPVAFSSWGSAREKLRRMGAGAMPKLIMLDMEMPDMYGAETWLEFH
FT                   KQATSAGVKTIALTTSFGRDELMQMPDSGRPYAILTKPVTRLALFHALTGTLDQRPVQV
FT                   KEWTMAAQEAAVSAEPQEKIRVLLAEDNHINQLVAIELLKERGFEVGLAENGREVLDKL
FT                   EQGDWHLVLMDIHMPEMDGMEATTIIRNDPRYEQLPIIAVTANSLRADHEHYLQLGMNG
FT                   VVTKPLDPDQLCMVIMNLLNNKKFPVLQQQSWGASGQSVPELDGIQVETALARVSGKIA
FT                   ILRQMLVHFLKDYEGFADKLIEELTNGQSATARRMIHTLMGAASHLSANDVVQAAARLN
FT                   EILKKEDGEEDWKAPAELLKKELDRVITGLEHASISTFDSFS"
FT   gene            535541..536263
FT                   /locus_tag="Pjdr2_0450"
FT   CDS_pept        535541..536263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0450"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: sml:Smlt0594 putative two-component
FT                   response regulator transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99130"
FT                   /db_xref="GOA:C6CSH8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSH8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS99130.1"
FT                   /translation="MYKVLVIEDDVMMRDMLSMYLSEEGYSVRQAGTGEEGLRIVQEFA
FT                   PDVVLLDLMLPDMDGMGVCASIRERSHVPIMILSMKSEVSERVQALKAGADDYMCKPFS
FT                   MHEMTARVEALIRRSQFSATEAEAASASEAEEADLAPIQLDSERRMLLVRGKLIETTFS
FT                   EFEMMKLFLSHPGKVFSREELINTIRGFDSFVTDRAIDVHIVNLRKKIEQNPKEPRLIR
FT                   TVWGFGYKYTTDHSQEHD"
FT   gene            536492..537718
FT                   /locus_tag="Pjdr2_0451"
FT   CDS_pept        536492..537718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0451"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; GGDEF domain containing
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; KEGG: gsu:GSU0537 sensory box/GGDEF family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99131"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSH9"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ACS99131.1"
FT                   /translation="MSRARASGQRLVVALIQIDRFYGVNEAKGLEAGNQVLESIGGRLS
FT                   QGADTAFVTLISGDTFLMAREIGYSQAECANAVEEMKYAAQYPVSYEGAELNLTSSIGT
FT                   CLFPQNGRTSERLLGHAETALFKSREQGGNRITFYSEEETAQMNRWLEVGALLRPALYL
FT                   RQFHLSYQPIFRTEGGRLRGFEALLRWNQPELGAIWPAEFIPIAEQNGLIVPIGEWALR
FT                   EACKMLAGMQEYGLKELVIAVNVSHVQLMDNSFCSMVAHVLEEAGIEPSCLELEVKEDV
FT                   ILHFTEKTLAALSQLRALGVRITLDNFGEGYASLANLKQLPVNSVKISKSFIRQIDVQS
FT                   VERHIVEAMIGLLHKLEIEVIAGGVEYEEQYKLLKEWNCDFVQGFLLGSPMQPDLLDMS
FT                   IIRKSPQTA"
FT   gene            complement(537827..538045)
FT                   /locus_tag="Pjdr2_0452"
FT   CDS_pept        complement(537827..538045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99132"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSI0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99132.1"
FT                   /translation="MMKIITFKDRSVPVYYVNEQAASVEQLHHKLVEMEYNFDFRKKWK
FT                   RISKVEVVRDVAIFQYNDGTKLYLEVS"
FT   gene            complement(538158..538361)
FT                   /locus_tag="Pjdr2_0453"
FT   CDS_pept        complement(538158..538361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein LOC724814"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99133"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSI1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99133.1"
FT                   /translation="MIRHLLQRLLGSVTGKHYNKHGHHGHNGHNGHYSHSSSDYKKGNY
FT                   YPPKQPPYGHSHYKKKYGSYSS"
FT   gene            538632..539375
FT                   /locus_tag="Pjdr2_0454"
FT   CDS_pept        538632..539375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0454"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: protein of unknown function RIO1; SMART:
FT                   serine/threonine protein kinase; KEGG: bar:GBAA2307 protein
FT                   kinase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99134"
FT                   /db_xref="GOA:C6CSI2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSI2"
FT                   /inference="protein motif:PFAM:PF01163"
FT                   /protein_id="ACS99134.1"
FT                   /translation="MGSYGQAYRCTDLRSGETVLLKRAKPSKRDTGRRLLRREADILQQ
FT                   LNHPQMPKRLDWVVHRREEALVMTYVEGVTAEQAALLEERTFTQLEALRIVEALLSPLK
FT                   HMHEAGYVHRDVRIPNVVMNSKGIYLIDLGLACRIGEKNPDGREESVMPSGFADSWGAV
FT                   KFRMRQPDRNSDLYGLGHLFLFLMYAGYTPQEGEKERSWEEELTLAPEIRGFVRGLLDS
FT                   RWQTAAECERVLGKILEHYSSGNNE"
FT   gene            539446..539520
FT                   /locus_tag="Pjdr2_R0041"
FT                   /note="tRNA-Thr2"
FT   tRNA            539446..539520
FT                   /locus_tag="Pjdr2_R0041"
FT                   /product="tRNA-Thr"
FT   gene            complement(539695..540081)
FT                   /locus_tag="Pjdr2_0455"
FT   CDS_pept        complement(539695..540081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99135"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSI3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99135.1"
FT                   /translation="MSKEDDFADFRDQMKKLKNEKKSKNHREQDDVNDVIKRVKSEMLP
FT                   VIKAFVDTDRSLEMQSNRSRAIYISYANSRIYGLWVSATSLDSINIDAVHDSFSTRIYS
FT                   GSFIEKEIKTTVKNALLDWYRIII"
FT   gene            541378..541938
FT                   /locus_tag="Pjdr2_0456"
FT   CDS_pept        541378..541938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0456"
FT                   /product="superoxide dismutase copper/zinc binding"
FT                   /note="PFAM: superoxide dismutase copper/zinc binding;
FT                   KEGG: rpa:RPA0225 putative superoxide dismutase (Cu/Zn)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99136"
FT                   /db_xref="GOA:C6CSI4"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSI4"
FT                   /inference="protein motif:PFAM:PF00080"
FT                   /protein_id="ACS99136.1"
FT                   /translation="MNKSMMLCSLGFLVASCGFSSAAMASQGHGHHTRSHVMEAKAAFI
FT                   DTKGNQIGTVVLTEEKDGVHLKLEAKGLTPGVHGIHFHNVGKCEAPSFESAGSHLNPKN
FT                   KQHGFDNPQGFHDGDLPNITVDKDGTVKADIISKNVTLDTEAPNSLLPAAGTALVIHEK
FT                   ADDYKTDPSGNSGSRIACGVIQH"
FT   sig_peptide     541378..541455
FT                   /locus_tag="Pjdr2_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 26"
FT   gene            complement(542007..542273)
FT                   /locus_tag="Pjdr2_0457"
FT   CDS_pept        complement(542007..542273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99137"
FT                   /db_xref="GOA:C6CSI6"
FT                   /db_xref="InterPro:IPR032111"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSI6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99137.1"
FT                   /translation="MSWESITSLIDPRLVIVVAACWVIGYMLKQTPIVPDWTIVYAVTA
FT                   VAILCACLILGFHVESVLQGILCGAFSVYGSQLVKQTFIKRGK"
FT   gene            complement(543041..543673)
FT                   /locus_tag="Pjdr2_0458"
FT   CDS_pept        complement(543041..543673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0458"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bha:BH0986 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99138"
FT                   /db_xref="GOA:C6CSI7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSI7"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACS99138.1"
FT                   /translation="MAEERFDIYDEQLNPLGTASRSETHALGYWHRSFHCWLTRREENR
FT                   RFVRFQLRQAGKDTYPGYYDITAAGHLSAGETMQDAVREIEEELGVAARFEELIPLGEA
FT                   RKEMSGEVKGVPFIDREVSDVFALVCSLPLGDLKLQAEEVAAVFEADVELMIRLFEEEL
FT                   PELICEGVASTADGGLSKATRAVRAAEFVPREPSYYASIMRALRDCT"
FT   gene            complement(543700..544206)
FT                   /locus_tag="Pjdr2_0459"
FT   CDS_pept        complement(543700..544206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0459"
FT                   /product="large conductance mechanosensitive channel
FT                   protein"
FT                   /note="TIGRFAM: large conductance mechanosensitive channel
FT                   protein; PFAM: large-conductance mechanosensitive channel;
FT                   KEGG: gme:Gmet_2522 large-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99139"
FT                   /db_xref="GOA:C6CSI8"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSI8"
FT                   /inference="protein motif:TFAM:TIGR00220"
FT                   /protein_id="ACS99139.1"
FT                   /translation="MRKIIQEFKEFAIKGNVIDLAVGVIIGGAFGKIVTSLVNDIIMPP
FT                   IGRMLGGADFKDLFINLGSDKPLPAGVTTHDIHTLTDATKYGVAVIAYGQFINVLLDFF
FT                   IVAVCIFLLVKGINILRRMKPEEVAAPAEPTEKECPYCLSQIPIKATRCKHCTSVLEEG
FT                   TATSS"
FT   gene            544440..545216
FT                   /locus_tag="Pjdr2_0460"
FT   CDS_pept        544440..545216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0460"
FT                   /product="SpoOM family protein"
FT                   /note="PFAM: SpoOM family protein; KEGG: bar:GBAA2308
FT                   sporulation-control protein Spo0M, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99140"
FT                   /db_xref="InterPro:IPR009776"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSI9"
FT                   /inference="protein motif:PFAM:PF07070"
FT                   /protein_id="ACS99140.1"
FT                   /translation="MDDMFNRLLASIGIGSAKIDTLLEKSQYVPGEEVRGVVNIRGGNA
FT                   PQNIDTIQMSVMTEYIRESNDNRFRQHGEIGRYDVSTPFTLEAGETKEVPFSFRLPYQT
FT                   PLTIGRAPVWVKTELEVRGGVDPGDNDRIDVLPTSAINTVFHALDLLGFRLRQAECEYS
FT                   PRHGGEMPFVQEFEFVPTGQFRGQLDELEVMFYSSDRELELLLQVDRRARGLGGLFAEA
FT                   LDLDETFVRCRFTEEQLQAGPAVIARQLSELIARTI"
FT   gene            545470..546543
FT                   /locus_tag="Pjdr2_0461"
FT   CDS_pept        545470..546543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0461"
FT                   /product="protein of unknown function DUF939"
FT                   /note="PFAM: protein of unknown function DUF939; KEGG:
FT                   bar:GBAA0529 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99141"
FT                   /db_xref="GOA:C6CSJ0"
FT                   /db_xref="InterPro:IPR010343"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSJ0"
FT                   /inference="protein motif:PFAM:PF06081"
FT                   /protein_id="ACS99141.1"
FT                   /translation="MTIGARVLKTGMAVALAIYLSGMFGFASPLITTVAAILTIQPSIY
FT                   RSWQQVLDQFQTNLLGAAMALAAMKLFGQTPIAVGLVCILVILVSIRLKMETTIGVTLV
FT                   TVVAIMEAHGQVTTVALERFLMVLAGMGAAFTVNVLVFPPRPRKQFTEQVHHAFSEMSL
FT                   LLRTAISNEMKEQVYRKEKEKLHKRLRKLEDSYNLFEEERKILARTKISHARQLLVSKQ
FT                   MIKALQKGSDLLEVVEEHYFSVPKAGDWAARFDRQIEDLTKYHESIVLKIENKMKPNMS
FT                   LEPGEEREARLVAELTDYVREDPDEHKRLIFVASALFEYAYHLRRLEKLVDHIQRPHGE
FT                   AEERRSAEKADAAAVRE"
FT   sig_peptide     545470..545553
FT                   /locus_tag="Pjdr2_0461"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.959) with cleavage site probability 0.484 at
FT                   residue 28"
FT   gene            complement(547497..547793)
FT                   /locus_tag="Pjdr2_0462"
FT   CDS_pept        complement(547497..547793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99142"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSJ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99142.1"
FT                   /translation="MSEQEQQHNQMEPMTGEHVEVSGVYKNDIGRVEKLERGEVFPADP
FT                   QNGNTEWELVELDFDNHHEGRTDPRLIAKDDDDDPEAHMQHPRRHKGSNKTDS"
FT   gene            complement(547816..547959)
FT                   /locus_tag="Pjdr2_0463"
FT   CDS_pept        complement(547816..547959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99143"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSJ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99143.1"
FT                   /translation="MSGEWPSHKQVEASKAQSLADRTGKGKEQASQKQSEADAAAVPKH
FT                   GL"
FT   gene            complement(548055..548669)
FT                   /locus_tag="Pjdr2_0464"
FT   CDS_pept        complement(548055..548669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0464"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   bsu:BSU10480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99144"
FT                   /db_xref="GOA:C6CSJ4"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSJ4"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ACS99144.1"
FT                   /translation="MHVMESMNNLYVQMKSLDLEHLQRTLESYSQFGILPGILLPLLES
FT                   FLPFLPLIVIVAANANIFGLWLGFLLSWIGVSIGAICVFLISRKLGKNVKSRIERRFPK
FT                   TERFFRWVDQKGFTPLFLLACFPFSPSSIINIVSGFSKISLRTFVLATVLGKGVMILSI
FT                   SLISFNIGSFREEPWRIFVTCAVIIVMWFGGKKIESRYHVN"
FT   gene            complement(548721..549899)
FT                   /locus_tag="Pjdr2_0465"
FT   CDS_pept        complement(548721..549899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0465"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pmr:PMI1687 multidrug resistance protein (MFS-family
FT                   transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99145"
FT                   /db_xref="GOA:C6CSJ5"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSJ5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACS99145.1"
FT                   /translation="MKNVGMRFGAEMRLISVILFLVEFVRGAVLISLLPIYGTKVLGLS
FT                   LDVIGIAITAHYLTDTLLKMVIGYLLDRFSIRFVVRTGLLISLAGVFLIQFANVAWLFI
FT                   LAAALYGIGMSPIWIVCLTKVSDDNRASQMGFLYTVWLTGLGAGPIVCNILLDYYVNGT
FT                   YFLLLILSIFAAFLAFFMNSAKAGGQQIQAIPLKRQLVALMERIKAMRMLLPGMILQTA
FT                   GASMLVPVLPSFAESELGFAGAQYSLLLSAGGVCAAAGLIPMGRLSDKLGGKKWFLIFG
FT                   FAIFAAGLYMLAWRLPFWYCLVIVVILGLSYAAILPAWNALLAAYVPPKQEGLGWGLLS
FT                   TVEGLGGMVGPLAGGILAASFGSRTVIWVSAALFGLIALLYVLIPATKMNGK"
FT   gene            complement(549930..551126)
FT                   /locus_tag="Pjdr2_0466"
FT   CDS_pept        complement(549930..551126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0466"
FT                   /product="Monogalactosyldiacylglycerol synthase"
FT                   /note="PFAM: Monogalactosyldiacylglycerol synthase;
FT                   glycosyl transferase group 1; KEGG: bar:GBAA0511
FT                   diacylglycerol glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99146"
FT                   /db_xref="GOA:C6CSJ6"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSJ6"
FT                   /inference="protein motif:PFAM:PF06925"
FT                   /protein_id="ACS99146.1"
FT                   /translation="MVRANNGYQPKVLILYASYGEGHLQAAKAIRDALEEAGNNRTVMV
FT                   DLMAESHPWLNEMTRRVYLKSYTHIPHLYGWVYDVTRPMKHNSLFGGFLHSFGRDKIKK
FT                   LLQKEQPDAVIHTFPFFALPALHRRRLSKTIHPGASIPTYTVITDFDLHRRWVHPGIGR
FT                   YFVATDDLKQELGSLGIHPGRVSVTGIPLGRGFQSSLTPSFELFEKYGLHPEQPVILLM
FT                   PGAQGVMPDCDELCRLLLEQHPHAQIALVCGRNNLLRSSIADQFRYHPSADRLHLFGFV
FT                   DQVHELMSLATCLVSKPGGVTLAEAIWAGLPLFLYRPVPGQEKKNARYLQSKGAATISY
FT                   DPEELAAAIMKLIRNPEQLQRCRLAVQRLRTEDAAADSIAHHILQECGWNAKFGQRYS"
FT   gene            551304..552284
FT                   /locus_tag="Pjdr2_0467"
FT   CDS_pept        551304..552284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0467"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: bsu:BSU26850
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99147"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSJ7"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACS99147.1"
FT                   /translation="MKYTYLGQSGLRVSRLCLGTMNFGVDTDEKEAFRIMDAALDAGIN
FT                   FFDTANIYGWGENSGRTEEIMGRWFAKGGGRREKTVLATKVYGDMHDPYDGPNREAGLS
FT                   AYKIRRHLEGSLRRLQTDHIELYQMHHVDRNVNWNELWGAFETAVHQGKIGYVGSSNFA
FT                   GWDIAVAQGEAKARGALGLVSEQHKYNLLCRLPELEVLPASKALGLGVIPWSPLDGGML
FT                   SGSHRHGGAGRRSGERNERFAQVKPQLDAYGALCDELGAPEDLVSLAWLLANPAVTAPI
FT                   IGVRTLEQFERSLRAVELTLDESTLKRIDEIFPGPGGDAPKAYAW"
FT   gene            complement(552332..553600)
FT                   /locus_tag="Pjdr2_0468"
FT   CDS_pept        complement(552332..553600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0468"
FT                   /product="threonine dehydratase"
FT                   /note="TIGRFAM: threonine dehydratase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   Threonine dehydratase domain protein; KEGG: bha:BH1711
FT                   threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99148"
FT                   /db_xref="GOA:C6CSJ8"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011820"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSJ8"
FT                   /inference="protein motif:TFAM:TIGR02079"
FT                   /protein_id="ACS99148.1"
FT                   /translation="MEFQSSYSSKIGLEDIVHAQMHLKDVITRTPLQYNRVLSERYGCN
FT                   VYLKREDLQIVRSFKIRGAYHLMRSLPPERLAAGVVCASAGNHAQGVAYSCQALGVQGK
FT                   IYMPSTTPRQKVNQVSFFGGDFVEVILTGDTFDDAYAEAIAESKRSGMAFIHPFDDPKI
FT                   IAGNGTVGQELMEAAETVPDYVLASVGGGGLVAGIASYVKTVSPQTKVIGVEPEGAPSL
FT                   RVSLDAGEVTPLEHIDKFVDGAAVKRIGDLTFSICRELLDDVRTIPEGKICTTLLDLYN
FT                   ENAIVAEPAGALPIAALDALRDEIAGKTVVCVISGGNNDVDRMQEIKERSLIYEGLKHY
FT                   FMLSFPQRAGALREFLDDVLGPNDDITRFEYTKKHNKDNGPALVGIELKQREDYAALIG
FT                   RMQKKGFQFVELNKDPVLFNLLI"
FT   gene            553701..554246
FT                   /locus_tag="Pjdr2_0469"
FT   CDS_pept        553701..554246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99149"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99149.1"
FT                   /translation="MFRWLKWLAIIVVLLAAIAAGGGLWLKSYVAPEEKLDLSYDPVSI
FT                   KDKAVEMVANLKPEIVLSEADVNNLIKSQLQSSPASLPPDMTLDGARFEVNGDRLIAHL
FT                   NMTYHDILPVGMLATYKMTWQAPNLTFEPLSLTVKNYDLGKDRLDRIVVPIELPSLISI
FT                   GNMEFQQDQIVIKLRLQL"
FT   sig_peptide     553701..553766
FT                   /locus_tag="Pjdr2_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.400 at
FT                   residue 22"
FT   gene            554376..555383
FT                   /locus_tag="Pjdr2_0470"
FT   CDS_pept        554376..555383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0470"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: bha:BH2313 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99150"
FT                   /db_xref="GOA:C6CSK0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSK0"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS99150.1"
FT                   /translation="MDKKIVDVAKRAGVSAATVSRVLNESSLVSEKTKIKVLKAIEEMD
FT                   YHPNAAAKHLRSQRTMTLGIIVPDINVSYFSEIIKGIENKAYAHKYKVLICDSDNQIEK
FT                   EMEYLGLLPDKTVDGMILVTPRVSDDIINEYVQKGYVIGVVGRAVVHDNILSCKTDNVK
FT                   FSNEAVRHLVEQGHQQIAYIGGYSDSLENYERMEGYMKALKEGKIPFLPTLIDNGDFEE
FT                   TGGYQAFNRLLERNQSFTAVYCANDEMALGVYRACRERGIRIPEDMAIVGVDNNRITEY
FT                   LLPSLSTVEQPKYEMGAHLTEKLIAQMNGNEQSAQKKYVIESKLIKRESSGFKR"
FT   gene            556808..557848
FT                   /locus_tag="Pjdr2_0471"
FT   CDS_pept        556808..557848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0471"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: bha:BH2313 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99151"
FT                   /db_xref="GOA:C6CSK1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSK1"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACS99151.1"
FT                   /translation="MNDSKIIDVANRAKVSVATVSRVLNRSELVSEKTKKRVLEAIQEM
FT                   NYTPNAMAKNLRSKKTMKIGVVVADIEVSYFAEIIKGIENMANSLDYNVIICDAQNKKQ
FT                   KELEYVSLLQNRTVDAMIFVTPEMMSKELIALVEDGYSVGVIGRNIDHEQIPCAFTDNV
FT                   KIARDVVNHLIGQGHEKIAFLSGYADAIDSYERLEGYMKALRDAGMPFVPDLIDNGDFN
FT                   EDGGYLSFMRLREKNDDFTAIFTANDEMALGVYKACKQLSIQVPHQLAIVGVDNIRLTK
FT                   YIVPRLSTVDQPKYTMGALLTEKLIDQMNNNEFKDKRTFKVESKLLIRESSMFDRNPVK
FT                   SSEASQ"
FT   gene            557931..558842
FT                   /locus_tag="Pjdr2_0472"
FT   CDS_pept        557931..558842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0472"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0794 sugar transport
FT                   system (permease) (binding protein dependent transporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99152"
FT                   /db_xref="GOA:C6CSK2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSK2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS99152.1"
FT                   /translation="MKGFFQELVRNRILFLMIAPALLFFIVFAYVPMVGVYYAFTRFSF
FT                   DGGLFGGEFIGFKNFEFLFNSGVLWNLTKNTVLYNIAFIIISNVLQLACAIFLSELPGK
FT                   WFKKSTQSIMFLPFFVSFVLVGAFVFNLFSNAGVVNTMLTSLGLQPYDFYLHTAPWKYI
FT                   IVFFHVWKGLGYGTVIYLAAIMSVSDEYHEAAKIDGANIFKRVRHITLPLLVPTFILLI
FT                   LLSLGGILKGQFDLFYQIIGNNGMLYNSTDIIDTYVYRSLAVNFDIGMGTAAGLYQSLF
FT                   GFVLIILVNYIIRKVQKDYALF"
FT   sig_peptide     557931..558020
FT                   /locus_tag="Pjdr2_0472"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.979 at
FT                   residue 30"
FT   gene            558856..559743
FT                   /locus_tag="Pjdr2_0473"
FT   CDS_pept        558856..559743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0473"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0481 ABC transporter
FT                   (permiase)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99153"
FT                   /db_xref="GOA:C6CSK3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSK3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS99153.1"
FT                   /translation="MKIKMERATIVFNIIGYVLITILTVLCLLPFLLIVSGSFTPEIQI
FT                   ISKGFSLIPETFSLDAYKAAFSNPKQILEGYKVTIFITVAGTAIGLFLTSMAGFVLSRK
FT                   DFKYRDQLSFFIYFTTLFSGGLIPWYILITKHLDLKDTYMALIVPSLLSAWNIILMKNF
FT                   MKSIPDSIVESAKIDGAGEFTIYLRLILPLSGPGLATIGLFMALGYWNDWFMANLFITS
FT                   ESHYPLQFLLYKILASAAVLKTNVAGNLSPTFQPPAETLKMAAAVIATGPIVFLYPFVQ
FT                   RFFVKGLTIGAVKG"
FT   gene            559804..561402
FT                   /locus_tag="Pjdr2_0474"
FT   CDS_pept        559804..561402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0474"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH0796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99154"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR022627"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSK4"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS99154.1"
FT                   /translation="MKRKIKTMGTVLVSTAIMASMLAACGSDNNNNSNKSSNASANPGT
FT                   EASSNTGTDAKTPDTSKKVQLTWYLLGDPAPDQEKVVAEWNKMLEQDLNTTVKLNFTTW
FT                   TDWQTKYNLLLASGEKVDMIFASSWADFYKFANQGAFMPLNDLLPTYAPTTWSSVSEQD
FT                   WKEATVNDKIYAIPATYPEYTPDGLVYRDDWRQELGLPEIKDVDSIEAYLDGVKKSKGI
FT                   TPINGKAYNEVFTMFKAFEGYQQIGGDSGVIAAKSYDTPRDIVAYPFTPEFEQWVKKMK
FT                   TWSEKGFWKSDTLSDQKEAGDAIKTGQGAVYWRNAPGAGGFITGMEKSNPDIKLGYFPF
FT                   SRFHNLTVPTLSVNNAMAIPKSAPNAERSLMVLDKLRSDPKYYDLMSYGLEGTDYSMDA
FT                   DGKHIVTPPAGVEAKDFKGYGIASWGYRVESMERVKQAGGWEGFDALLEEFKSQSKPNI
FT                   FAQVIMDYAPVKSQQAAVNSVIQQYGMPLMMGLVPDVDKALATYRKQLEAAGVNDVLKY
FT                   VQEQANKSFDAQGIK"
FT   sig_peptide     559804..559884
FT                   /locus_tag="Pjdr2_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.615 at
FT                   residue 27"
FT   gene            561519..563501
FT                   /locus_tag="Pjdr2_0475"
FT   CDS_pept        561519..563501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0475"
FT                   /product="glycoside hydrolase family 2 sugar binding"
FT                   /note="PFAM: glycoside hydrolase family 2 sugar binding;
FT                   glycoside hydrolase family 2 TIM barrel; KEGG: sde:Sde_2632
FT                   HflK"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99155"
FT                   /db_xref="GOA:C6CSK5"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSK5"
FT                   /inference="protein motif:PFAM:PF02837"
FT                   /protein_id="ACS99155.1"
FT                   /translation="MLKTTLTLEKVNGVNVPFQNGIPVPSFEPQTRGKITLNGEWQKRR
FT                   LSMDHDFSMADRSESWLKELESREGDYVRGTASELWQPHAVPSPENKLTGLPEANAAET
FT                   YEDGVWYRRAFTIASKNEGYAYTLKSLGISYVADIWINGEWVGCHEGGFTPFAFDLTAY
FT                   LRTGDNEIRIRVDNPPWGSRNDTIPAVAGTDFFNYTGIIHDLYIEITPQAAIVRADIVP
FT                   LDVSGRLDVKVVLHNRGNDAVQVGLEGSLLEADPEAPNFLLSPLASSLIGVPAVTDKPM
FT                   HTELTLQPDEAKVVQFEITVRDPKLWSVWQPYLYVATFRLTAAGSTTLAQDSFSTQFGI
FT                   RTVRTDKTRILLNEQSVFMAGIARHEEWPDTGRTAAWERIRTDLEQIRELNVNMVRTGH
FT                   YPNHVYTYLLLDRMGFMAMSEIPLWQFETEHYEAQNEKRLADQMWREMVFSQYNRPSVL
FT                   MWSTQNESKDVWLRLAYNERLVRDLRENYNDGRLLTQSSAADQPGPHDPSMAPLDVAAW
FT                   TMYFGIFHGGTYYEGTRQFLEEANRFFPDKPILNTEFGHWSSGGNEGEQVLTYEETLRA
FT                   LMEKGTLSAEGEDNPDGYVAGIDFWIMYDWYVNHNNWIDTFGIIHMDRSTEKPVAPLIR
FT                   RDYGAITRHKGGLGQKLEGAANEKV"
FT   gene            563488..564948
FT                   /locus_tag="Pjdr2_0476"
FT   CDS_pept        563488..564948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0476"
FT                   /product="Glucan endo-1,6-beta-glucosidase"
FT                   /EC_number="3.2.1.75"
FT                   /note="PFAM: glycoside hydrolase family 30; KEGG:
FT                   rfr:Rfer_1106 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99156"
FT                   /db_xref="GOA:C6CSK7"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="InterPro:IPR033453"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSK7"
FT                   /inference="protein motif:PRIAM:3.2.1.75"
FT                   /protein_id="ACS99156.1"
FT                   /translation="MRRFSTVILPVLLVALLATACSNGNSGRSGSADGQVQVWLTTPDK
FT                   SKLLQQEESLKLTKAKDSEENVITIDDRKVYQQMDGFGASMTDSSAWLIANKLNDSQRE
FT                   ELMNKLFDHDKGIGISYMRVPLGASDFAVKNYTFDDMPAGQSDPELKNFSIDHDKEYII
FT                   PTLQQALKINPELKLMGSPWSAPGWMKTTDSVIGGSLKPDAYEPFANYFVKMIQGYEAE
FT                   GVPFDAITLQNEPHYTPDDYPGMRMEPVEQAELIKNFVGPAFEKNSIKSKIVVWDHNWD
FT                   EPYYPLTILNDPDASKYVDGTAFHGYAGEVGNQAQVHDAHPDKNLYFTESSGGAWSTDF
FT                   GGNLKWDMENLIIGATRNWSKVVLKWNLALDENYGPTIGGCKDCMGVVTINQGSGDVAF
FT                   NSEYYSFGHASKFVKSGAYRIESGESVSGEIEQVAFKNPDGTIVLVALNAASEDKELKV
FT                   KLGGKSFAYTMPAGAVATFVWPGTANSK"
FT   sig_peptide     563488..563550
FT                   /locus_tag="Pjdr2_0476"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.604 at
FT                   residue 21"
FT   gene            564981..566372
FT                   /locus_tag="Pjdr2_0477"
FT   CDS_pept        564981..566372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0477"
FT                   /product="Glucan endo-1,6-beta-glucosidase"
FT                   /EC_number="3.2.1.75"
FT                   /note="PFAM: glycoside hydrolase family 30; KEGG:
FT                   sde:Sde_2992 helix-turn-helix, AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99157"
FT                   /db_xref="GOA:C6CSK8"
FT                   /db_xref="InterPro:IPR001139"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033452"
FT                   /db_xref="InterPro:IPR033453"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSK8"
FT                   /inference="protein motif:PRIAM:3.2.1.75"
FT                   /protein_id="ACS99157.1"
FT                   /translation="MSAILKTAVTTKEVEVWLSSEMTPGNTRWFEGPTDPAYALSGQPK
FT                   LALTAPSVSDQTTILVTPAHSYQQMLGIGTSVEETTINNLLKMDAASQASFIQQLADKE
FT                   KGLGFNLFRITIGTSDFTAQPFYTYNDLPEGETDFELKHFSVQKDIDLSIFRVVQLLLK
FT                   AVPDAKIFASPWSPPAWMKTNGDLKRGSLKEGAEYTEALAKYYRLAIQAYEEHGIPVCA
FT                   MTLQNEPLLETDYPSCYMSPERQRELAIALKREFEEHGLATELWIFDHNFADAMGYVTP
FT                   ILNDSEGYAAVDGIALHDYDGSPEVMSEIHAAYPEKPIYLTERSLWGTAGADRMAQYFR
FT                   NYASSYNAWVTMLDSKIGTHQWLGQPGPTMLVQDADEPSRFWRTPEFNLLAQYSRFVER
FT                   GAYRIGSTYGSPETVTNVAFRNPDGSLVMVVINQTAEEQLFRVLCDGKQFVATLPAGTV
FT                   GTYRW"
FT   gene            complement(566431..567414)
FT                   /locus_tag="Pjdr2_0478"
FT   CDS_pept        complement(566431..567414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0478"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   rle:RL1385 putative short-chain
FT                   dehydrogenase/oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99158"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSK9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACS99158.1"
FT                   /translation="MMLTPQAPIGSGFGASSTAAEVIKGIDLTGKIVMVTGGYAGIGLE
FT                   TVRAFRSAGAKVIVPARDMEKAKAALADMPDVLLDTMDLLNPASIDAFAERFLSQFDKL
FT                   HILVNNAGIMAVPLTRDERGYESQFAANHLGHFQLTCRLWPALVRAEGARVVALSSFAH
FT                   RRAGIDFNDLNFERREYDTWAAYGQSKTANALFAVALDSIGKSQGVRAFSVHPGGIATD
FT                   LQRHLSQAQLNSLDMFDKSGKPIISPENNRKTPEQGAATSVWCATNPKLEGMGGVYCAD
FT                   CEIAIALPSDDSTEMHGIRPRATDQVAAGRLWQLSEQLTGVKLDLK"
FT   sig_peptide     complement(567355..567414)
FT                   /locus_tag="Pjdr2_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.665) with cleavage site probability 0.563 at
FT                   residue 20"
FT   gene            567610..568515
FT                   /locus_tag="Pjdr2_0479"
FT   CDS_pept        567610..568515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0479"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AraC-type transcriptional regulator domain
FT                   protein; helix-turn-helix- domain containing protein AraC
FT                   type; SMART: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: pap:PSPA7_3240 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99159"
FT                   /db_xref="GOA:C6CSL0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSL0"
FT                   /inference="protein motif:PFAM:PF06719"
FT                   /protein_id="ACS99159.1"
FT                   /translation="MAESTLEHYEATAELIDRFAGQQNGVHETPISSLFLFRQNQPTEP
FT                   SHGVHSRSICFVFQGKKEVSLAEERFPYSPDEYLVASVELPVISRILEASSERPYLALK
FT                   LEFSPEQILGVMKESGIQPRPQEHARRGLFIGQMERSLTDAIHRLVQLLEQPDDIPLLA
FT                   PLLIKEILYRILQSKHGVSLEQLALEGGGAFRIKEVIDHIKKNYEKSIRSDELAAIANM
FT                   SVPTLYRHFKEVTAMSPIQFQKHLRLQAARSLLLSEPVNAADVAFRVGYESPSQFSREY
FT                   ARMFGLSPIQDIKRLRTFDA"
FT   gene            569135..569428
FT                   /locus_tag="Pjdr2_0480"
FT   CDS_pept        569135..569428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99160"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99160.1"
FT                   /translation="MGTVDSAIENGYHVCNETDNHYQSWDGQQLYTHHRARGPGFAQRE
FT                   VLTLGLLYEMVLKKKKQIHPVRQTESEERESKPWQVESIIIHKADDRKEHNK"
FT   gene            569471..570322
FT                   /locus_tag="Pjdr2_0481"
FT   CDS_pept        569471..570322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99161"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99161.1"
FT                   /translation="MKESRFNQNGQPGNTADQINHEGKPWNWMLFPFSSVRVSQDSIIA
FT                   ASVGYGVYEIDEFGEWTKLAAGLPPHASVNRLQLHSGILHACTSEGLFLYEDEEWVDTG
FT                   LAVPCSQYRILGGTGYAATEYGLWSEVRGEWQKFACPGKKVFDFMNLPQYLVVGHESGI
FT                   SLYDRFMDEWAEFELNRAVTSLSVFRGHLIVASDKGELLVGDKRGRFERIRFSGKFVFS
FT                   VVSIGIDTYVCTDHGLFRLSMIQNQFALLSVKLGYPVTDVELRDGRLYMATLFQGIQYL
FT                   DI"
FT   gene            570391..570840
FT                   /locus_tag="Pjdr2_0482"
FT   CDS_pept        570391..570840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0482"
FT                   /product="flavodoxin"
FT                   /note="TIGRFAM: flavodoxin; PFAM: flavodoxin/nitric oxide
FT                   synthase; KEGG: baa:BA_1918 flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99162"
FT                   /db_xref="GOA:C6CSL3"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010087"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSL3"
FT                   /inference="protein motif:TFAM:TIGR01753"
FT                   /protein_id="ACS99162.1"
FT                   /translation="MKVIVAYASLTGNTEEMAEAIAAGAREAGAEVVVRDAYDADASEL
FT                   DQYEGIAIGAYTWGDGELPDEFIDFYEALSNLDLSGRKAVVFGSGDTSYPIFCGAVDTI
FT                   EAKLKEIGAELVLPGLKVEFDPSKDQIIECKAAGWLIAGSVPAVK"
FT   gene            570872..571651
FT                   /locus_tag="Pjdr2_0483"
FT   CDS_pept        570872..571651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: baa:BA_1919 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99163"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSL4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99163.1"
FT                   /translation="MDAAAKVTVIEDYKLEELLRCPYRYAKRQGAASSAKAEVNWMQLA
FT                   QVAVSHVVNAFFMTPEGERANFSIPDRLERWWTNKVAKFESPEHYWSIRQQLIDGLHSL
FT                   LISEKSYTPIILFEQHQVFVPELQVELMQIFQAVLKSENGDPSDYIVRKYIIDEDEESI
FT                   ALFQHLTAVFCSSAFGRLPLRIEVLPVLSGNRRIVHPDKESLEQSLDYMKLAASFMPEA
FT                   SSAAGLRKSKGSAECRRCPFLGECLSPVEESAEAIIM"
FT   gene            571826..572674
FT                   /locus_tag="Pjdr2_0484"
FT   CDS_pept        571826..572674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0484"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: bsu:BSU10830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99164"
FT                   /db_xref="GOA:C6CSL5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSL5"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS99164.1"
FT                   /translation="MSEELLLTFRSPPLPFFIESNRRTYQAGEEHPNRTNLGVFDLLFV
FT                   QQGSLYIAEEGNRWTLQAGDVLILRPDRWHHSFKPCQEETVFDWVHFQTVGAWEETEAS
FT                   QGSLRGDYYTYAIRLPKKMHLSFPDEAKLLFSQLHEAAQSSSHGAFWERQQRFLHLLQM
FT                   LDEGWRSDAAKAGVSVAERAAAYLKMNYRSVITNTMLSEALQLHTNYITRCMTEVFGCT
FT                   PQQYLLYYRLDQAKLLLIKTDWPIARVAEETGFRQTPHFSRLFAAQTGMPPLKFRKRFT
FT                   N"
FT   gene            572745..573416
FT                   /locus_tag="Pjdr2_0485"
FT   CDS_pept        572745..573416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0485"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   bsu:BSU20490 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99165"
FT                   /db_xref="GOA:C6CSL6"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSL6"
FT                   /inference="protein motif:PFAM:PF02586"
FT                   /protein_id="ACS99165.1"
FT                   /translation="MIERYSITADVGDMIEAFKVEQLINCYTNRFNVAPTQTVSIVMND
FT                   RWGLRTMHDARWGLFPFWAKDSVNADSSMLSNKPFFERMLRKQRCVVPCSGFFGWQKGQ
FT                   KEKDSRAMHIVVPNHRVFGIAGFFDVWRNYSGQEVRAFTMITAPATGTMSQWQPNVPVI
FT                   MDEEGMEDWLNPSISDFRSLRKHLEPMDSYRMRAYPVTNAVNDEAYESPDCIREIRPDF
FT                   A"
FT   gene            complement(574031..575014)
FT                   /locus_tag="Pjdr2_0486"
FT   CDS_pept        complement(574031..575014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0486"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: bha:BH3099 electron transfer flavoprotein
FT                   (alpha subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99166"
FT                   /db_xref="GOA:C6CSL7"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSL7"
FT                   /inference="protein motif:PFAM:PF01012"
FT                   /protein_id="ACS99166.1"
FT                   /translation="MGRTILVFAECRDGKLRRVALEALGAARRLAGADGSVHAVLAAPG
FT                   GAADEAAALAARGADVVHVADDPALRAFAPEAYIAALRAAIEAVRPDALLLGHTAVGRE
FT                   LAPRVAAAIGAGHVADVTAIDETDGVFTRPLYAGKAFERRSFTPGRPWVVTVRPNNFEP
FT                   AETLPAGEPQGTVQALPFTVPPILTAVRSLVRRAGGQIDLAEADVVVSGGRGVRSSAGF
FT                   EPLQELAGVLGGAVGASRGACDAGYCGYALQIGQTGKVVTPQLYIACGISGAIQHLAGM
FT                   SQSRVIIAINKDPDAPIFSVADYGIVGDLFEVVPLLTEEFRRTQSG"
FT   gene            complement(575878..576699)
FT                   /locus_tag="Pjdr2_0487"
FT   CDS_pept        complement(575878..576699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0487"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: bar:GBAA4760 electron transfer
FT                   flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99167"
FT                   /db_xref="GOA:C6CSL8"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSL8"
FT                   /inference="protein motif:PFAM:PF01012"
FT                   /protein_id="ACS99167.1"
FT                   /translation="MLNIVVLLKQTFDTEEKIIVKDGSVAEADAKLVINPYDEYALEEA
FT                   LRQREVHGGEVRVVSCGGDRSEEALRTALAMGADEAIRLDAATLESGDSFALAAALAKV
FT                   IEPLKPDLLLAGLFAVDSGSGSVALQVAERLGLPHASAAVKVGIAQPDEAKASGELPPG
FT                   AASAARFAVVERDVEGDTETVVIPLPALITAQQGLNEPRYPSLPGIMKAKRKPLARVSA
FT                   AAGGEEEGARTSRLALFPPAPRAAGRRLAGTPGEQAAELVRLLQAEGQLPQ"
FT   gene            577116..579350
FT                   /locus_tag="Pjdr2_0488"
FT   CDS_pept        577116..579350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0488"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: bha:BH3802
FT                   iron-sulphur-binding reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99168"
FT                   /db_xref="GOA:C6CSL9"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSL9"
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /protein_id="ACS99168.1"
FT                   /translation="MLEWWSAEVATAALRWILFAAVLGVAAVAFITVVLRRVGYIKLGR
FT                   AAAHEAMPSDERRELAGRPSVAGQVLGHSKLLRDIRSGVMHFIYFYGFIVLQFGAADII
FT                   WKKLSGRPIPFPFYGQFAWSQELTVSLVLLAVLYGGFRRYIEQLPRLKRGWKPSLVLWF
FT                   IGGLMLTVLLTLSFERLSGDPHAVAGRFAPVSSVLADWIGKLGVPAGSIASEAGYELFW
FT                   WMHLLVLLSFLVYVPQSKHFHLLTAPVNLWLGRNAPVGRLAPLNLEDEDAEYFGAGKIE
FT                   HFTQKQLLDLYACVECGRCTNVCPASNTGKLLSPMHLMTKLRDHLTEKGAAITSKSPWV
FT                   PTFMGGQAAGAHVMGALIPSWEDSPEGSVTSIIPTMTAQKQAWNAREGTKPDELELIGD
FT                   VMSEEELWACTTCRNCEEMCPVGNEHVDKIIDMRRYLVLMEGRLPSDGQRALQNIERQS
FT                   NPWGLPRAERAAWIDECESRTGVRVKTMQEIKRAGAPKPHFLLWAGSMGSYDTRSRKVL
FT                   YDLVRLLDQAGVSFATLGAEERNSGDTPRRIGNELLFQELCRENIETIVRYGITRIVTA
FT                   CPHTLNTFRKEYPDFGLPSDVRIEHHTELLARLLKDGRLTPEHLVKERVTYHDSCYLGR
FT                   YNGIYDAPREVLKAIPGIEIEEMARNRENGMCCGAGGGLMWMEEQSGVRVNRARVSQAL
FT                   EVRPTVIGSACPYCLTMMEDGLKLLEADEQTAARDVAELLAASVFGKETA"
FT   gene            579453..581870
FT                   /locus_tag="Pjdr2_0489"
FT   CDS_pept        579453..581870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0489"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase NAD-binding;
FT                   Enoyl-CoA hydratase/isomerase; 3-hydroxyacyl-CoA
FT                   dehydrogenase domain protein; KEGG: bsu:BSU32840
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99169"
FT                   /db_xref="GOA:C6CSM0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSM0"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACS99169.1"
FT                   /translation="MSMNRTGTVRRAAVIGSGVMGAGIAAHLANAGMRVLLLDVVPQAL
FT                   LPEEEKRGLTLASPQVRSRLAQAAVARMAKAQPAPLYEPSFAGRITAGNLEDHLAGLSE
FT                   VDWIVEAVVERLDVKRSLFERVESVWKPGTIVSSNTSGLSVAEMVEGRSDAFRQHFAVT
FT                   HFFNPPRYMKLVEVVPTSDTAPEVTALLTALCEERLGKGVVVAKDTPNFIANRIGTYGM
FT                   LVTLEEGLRFGLTVEEADALTGPAMGRPKTATFRMLDLVGLDTLLHVVDNVREKSTDAA
FT                   ERETFARPPLLGQLVASGRLGEKSGGGFYRKIRGQKGGSEIESLDLESLAYRPRSSVKG
FT                   PIIDAAKAAKGTGAKVRALIGTDPKHKYAQFAWQTVKRTLLYSAALAGVIADSITDIDK
FT                   AMKWGFSWELGPFELWDALGLEKSVARMKAEGDAVPEWVLAWIAEGNGSFYKVQEGRRS
FT                   VYAGGGGGYAAEEPSPDEISLAALKEAGRAVLRTSDASLIDLGDDVVCLEFHSQNNAIG
FT                   GEILTAIRRTAEEVSKNWRGLVIANDGRNFCVGANLLLLLMEAQNGEWDEVEDIIRMFQ
FT                   SSMLSIKKLDRPVVAAPHRMTLGGGVEACLPADQIIFSPETYFGLVETGVGLIPAGGGS
FT                   KEAAVMAAARAGGGEIQPHLNALFETVAMAKTSTSGFDVGRIGLKRPQDRVIMRQDARI
FT                   AEAKRAVLELDRAGYTPQPEARVRVAGREGKAVLRMGVHSLLLGGQISKHDALIGNKLA
FT                   HVMAGGDAAPGAEVSEQYLLDLECEAFLSLCGERKTQDRMSHMLSTGKPLRN"
FT   sig_peptide     579453..579548
FT                   /locus_tag="Pjdr2_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.859 at
FT                   residue 32"
FT   gene            582607..583818
FT                   /locus_tag="Pjdr2_0490"
FT   CDS_pept        582607..583818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0490"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: bha:BH3487 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99170"
FT                   /db_xref="GOA:C6CSM1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSM1"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACS99170.1"
FT                   /translation="MGAAGKFADHDRDAVIVSAVRTAVGKAKKGSLAETRAEDLGRAVL
FT                   TAAVGRVPGLDAVDVEDVIIGCAMPEGEQGLNMARIISLYSGFPVTTPAVTINRFCASG
FT                   LQAIAYAAERIRLGDADILVAGGVESMSHVPMTGFKLAPHPGIVDAMPEVYMGMGHTAE
FT                   EVARRYNVTRAAQDAFAASSHRKAAAAIQEGRFKDEIVPVTATRSDVNEYGRPVERTFT
FT                   FDTDEGVRADTTPETLAPLKPSFAREGTVTAGNSSQMSDGAAAVVVMSRAKAKELGLTP
FT                   LAAFRTYRVAGVAPKVMGIGPIEAIPKALKAANLTVGDIDVLELNEAFAAQCVPIIEQL
FT                   GIDPERVNVNGGAIALGHPLGCTGTKLSVSLIHELKRRGGGIGVVTMCVGGGMGAAGVF
FT                   EVYA"
FT   gene            583873..585648
FT                   /locus_tag="Pjdr2_0491"
FT   CDS_pept        583873..585648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0491"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: bha:BH3486
FT                   butyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99171"
FT                   /db_xref="GOA:C6CSM2"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSM2"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACS99171.1"
FT                   /translation="MGENIRFGGRFVIEDALPSATVTPEDFNEEQRMMADAARQFVEGE
FT                   IFPLDEQIEGLDYELTVKLMRQAGELGLLGADVPEAYGGLGLDKVSTTLLSETLARASS
FT                   FALSVGAHTGIGTLPIVFFGTAAQKRKYLPKLATGELIAAYCLTEPASGSDALGAKTTA
FT                   KLSQDGSHYILNGSKLYITNAGFADVFIVYAKVEGEAFSAFIVEKGMPGFSLGPEEHKM
FT                   GIKGSSTRPLFFEDVAVPVENVLGEIGQGHKIAFNILNIGRFKLGAGCLGGSKETIELA
FT                   SKYANTRKQFGRAISSYPLIGAKLADMNIRTFVLESMVYRTAGWIDAMLSAEGAGADAP
FT                   DAGMRAAKAISEYALECSINKVFASETLDFVADEGVQIHGGYGYIKEYKVERIYRDSRI
FT                   NRIFEGTNEINRMLIPGTLLKKAMKGELPLLEKAQSLQAELLQPMPVPPFDEPLSREVY
FT                   RVSQGKKAFLAVGGLAVQKLGMKLDQEQEVLCSLSDIMIQLFAAESALLRTQKLVQSGA
FT                   DAGNAIQMTEVFVQEALEKIESIAKVALAALAKGDALQMQLSVLKKLMRGPLVDTIAAK
FT                   RDIAARVISGEQYIV"
FT   gene            585664..587628
FT                   /locus_tag="Pjdr2_0492"
FT   CDS_pept        585664..587628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0492"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   bha:BH3104 long-chain fatty-acid-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99172"
FT                   /db_xref="GOA:C6CSM3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSM3"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACS99172.1"
FT                   /translation="MDKADPENPLVPEDRQKPPNSAPNETPLSPRQEEAAAPQLVEAEP
FT                   PAAESAAPSAEAEPSVAAAATDSAPDEEPAPEEAVASATSEGPEAPVEIPKPWLRHYPL
FT                   EIPASLDYPNHGIPQFLINAVEKFPANEAVHFLGKSLTYRELYDHTCRLANGLISLGVN
FT                   RGDRVAIMLPNCPQAVISYYAALMIGAVVVQTNPLYVERELEHQLKDSGAATIITVDLF
FT                   YQRLANVRGEFPEAGAVPQLKNAVITSLKDGLPFPKNLLYPLKQRKEGFKADIPYGRHG
FT                   VVSYKKLISSSSNLPVLTDIHGSDLAQLQYTGGTTGTPKGVMLTHRNLVANTMQTSAWC
FT                   YRVKDGYERFLAALPLFHVFGLTVLMNFSIMRAGSLVLLPRFETETVLDTISRQQPTLF
FT                   PGAPTMYVALINHKNSASTDLSSIEACISGSAALPLEVQEQFEKMTGGKLIEGYGLTEA
FT                   SPVTHANLIWGKRKIGTIGMPFPDTIAAIFSPEGKPLPVREVGELVIRGPQVMKGYWNN
FT                   PEESEIVLRGGWLHTGDLGYMDEDGFFTIVDRIKDVIIAGGFNIYPREVEEVLYEHPGV
FT                   MEASVLGVKDPYRGETVKAFVVLKKGSYVSAAQLDVWCRQRLAAFKVPHLYEFRESLPK
FT                   TMIGKVLRRKLMEELEKEQ"
FT   gene            587645..588082
FT                   /locus_tag="Pjdr2_0493"
FT   CDS_pept        587645..588082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0493"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   ppd:Ppro_1137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99173"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSM4"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACS99173.1"
FT                   /translation="MRVAEDFAAEQADIERHLAKLEELASGTFWSELGCEVVFAHAEKA
FT                   AIQLRAEQRHLNLIGIVHGGVLMSMLDNAMGLVVMIACREKTVTAGLNTHFLESAKSGN
FT                   LVCEAEIMHRIGRTITLQATVKDEEGRLIAWGSGTYRIVSR"
FT   gene            588230..588442
FT                   /locus_tag="Pjdr2_0494"
FT   CDS_pept        588230..588442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0494"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99174"
FT                   /db_xref="GOA:C6CSM5"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99174.1"
FT                   /translation="MVDGWITAVVLIFGIAVALIGVFAYLRMFNRNETHHSSMDVPPPT
FT                   IPPKAAPPKDEEPPVKPPRENEGTG"
FT   gene            588624..588812
FT                   /locus_tag="Pjdr2_0495"
FT   CDS_pept        588624..588812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0495"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99175"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99175.1"
FT                   /translation="MAKHSQNEVKESLKELTRIFQPKDPRKFVKDYIRKYRITGGYEDE
FT                   LTILVEDEMGKINSSVS"
FT   gene            589020..589235
FT                   /locus_tag="Pjdr2_0496"
FT   CDS_pept        589020..589235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: queuine tRNA-ribosyltransferase; K00773
FT                   queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99176"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99176.1"
FT                   /translation="MKKPVWAIVVLGIVLLLSACNADNNKDKMNNKPATEMGDDKSMND
FT                   DKMMNDDKSMSDDKMMNDDKSMGDGK"
FT   sig_peptide     589020..589088
FT                   /locus_tag="Pjdr2_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.927 at
FT                   residue 23"
FT   gene            589367..590107
FT                   /locus_tag="Pjdr2_0497"
FT   CDS_pept        589367..590107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0497"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: bsu:BSU40410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99177"
FT                   /db_xref="GOA:C6CSM8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSM8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACS99177.1"
FT                   /translation="MGANIIVADDERNITDVCRRYLEREGHEVWVAENGEEAIRLWKEH
FT                   RPDLLVLDLMMPKVDGLEVCDLIRQTDDTPIIMLTARGEEPDRLLGLTMGADDYMTKPF
FT                   SPRELVLRVHNILRRAGWRSEASPGERDAEKLSEEASGQAIYLEGLSIYPQERRVSVLE
FT                   SDVELTVKEFDLLHLLAMYPGKVFSRSQLLNQVWDIAFDGDTTTVTVHVRRLREKIEPN
FT                   PSDPTWIKTVWGIGYKLDNKGNTT"
FT   gene            590104..591153
FT                   /locus_tag="Pjdr2_0498"
FT   CDS_pept        590104..591153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0498"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   gme:Gmet_2694 PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99178"
FT                   /db_xref="GOA:C6CSM9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSM9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS99178.1"
FT                   /translation="MKLRSYLLLANTISIAFIIVLLLVFFQYMLVTREQLIWLGLATVV
FT                   AGIVSAVLFFLLIRPLEASVRRVGEGAGRIAAGELEARVDRTGLTEFRLLADQFNQMGT
FT                   SLEQSFRQVKAAESAQRELVANMAHDLRTPLASMQSYAEALEDGVIEDDATYRRYLATI
FT                   RSETVRLSELIQDLFELSTLDRRTDDQVEKVPAVLEDVLLELHPRFSMGLDAKGLQLRV
FT                   RLPERSLRVNMLARHLQRILQNLIENAIRYSPHNGIIVIAAEEREDGVIRVSVTDEGVG
FT                   IAEAERERIFERFYRTDRSRSREGGGAGIGLSIAKLLVEQYGGRIGVEQAEGQGSRFWF
FT                   TVNEAQGNL"
FT   gene            591171..592421
FT                   /locus_tag="Pjdr2_0499"
FT   CDS_pept        591171..592421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0499"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   rce:RC1_3170 oxidoreductase molybdopterin binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99179"
FT                   /db_xref="GOA:C6CSN0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSN0"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACS99179.1"
FT                   /translation="MGELLKRLRKGFGRKLAILHTWNGWIVVVLALSGVMLVMNYWRGV
FT                   LGEGRVWLKELHIIVGLLSLVPVVFYLLLAAKHWKQLRGKAWQKFNVFVVLGLLVGWFI
FT                   SGVLLWQFRAVGPRVSNQALTVHDLLTWIGLPYIIYHSITRAKWLKEPNRRTVHTEREE
FT                   KTGAAPIHPAASPQSYMSRRSFVKWAVGGGIAVAVGPSFLKWTVNTLGVSIGSPSYEEI
FT                   VTRDGNQLVPLPQPMPASAPPLGGGAKGEFRIYSVTPIPTFSNETWSFTIDGLVDKPMT
FT                   WNWEQFVKLTRKVQVSDFHCVTGWSVYKNTWEGIPLKQFLQEAGIKTNAKMVKFYSGDG
FT                   VYTDALTLEQAQMDDIMVAMLHDGNLIPSDLGGPVRLIVPKMYAYKSVKWLNRIELIDK
FT                   DHIGYWEERGYDIDAWV"
FT   gene            592533..593543
FT                   /locus_tag="Pjdr2_0500"
FT   CDS_pept        592533..593543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0500"
FT                   /product="Collagen triple helix repeat protein"
FT                   /note="PFAM: Collagen triple helix repeat; KEGG:
FT                   collagen_XVIII; collagen XVIII homologue"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99180"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSN1"
FT                   /inference="protein motif:PFAM:PF01391"
FT                   /protein_id="ACS99180.1"
FT                   /translation="MPRAKRLTIEERVNRLERPITASRIAPRAITAAKLARNAVTSGKI
FT                   SSDVIPALIANPNFNRSIVAALPEVLATPAFDRVVRTVLPQVIEHPVFDNAIRSVLPGL
FT                   VSSPAFVQAIQAANIVGAEVTPSPDVTGLQREAIQRDVQGTQGVQGAQGAQGAQGAQGA
FT                   QGLQGVQGPVGAQGVAGAEGPQGAPGVSGPLSMTAIRFSGSREQIDLVNNQATVELMLT
FT                   PIVLLADQVVMLEAFANANFTGVQSYSVNGVLSRNPADVIATDNEAITQQGNQADFSQV
FT                   SATSALTWVDSPGPGTYTYSFTVTASATSQQQVVGGLINTRGLTATVINTTNGTL"
FT   gene            complement(593604..594284)
FT                   /locus_tag="Pjdr2_0501"
FT   CDS_pept        complement(593604..594284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tcx:Tcr_1353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99181"
FT                   /db_xref="GOA:C6CSN2"
FT                   /db_xref="InterPro:IPR025495"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99181.1"
FT                   /translation="MISITKTPKVTGTLFILAAVSSVLGLLFYGPILNHANYLTNGSEH
FT                   ADQIILGALMELILVASAVGTAVTMYPFLKKYNESIALGHVCFRLLEAVVITVGLVGML
FT                   SLVTLSRQYVSAGAPDPASYEAAGTLFLAVHDWTFMLGPNFLLGINTMLYSYIFYKSGL
FT                   VPRFIPILGMTGAVLVFSASLFEMFGVFSQLSVWGGLLSLPVAANEMILAVWLIVKGFN
FT                   KAAL"
FT   sig_peptide     complement(594207..594284)
FT                   /locus_tag="Pjdr2_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.582 at
FT                   residue 26"
FT   gene            complement(594302..594526)
FT                   /locus_tag="Pjdr2_0502"
FT   CDS_pept        complement(594302..594526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0502"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: scl:sce8899
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99182"
FT                   /db_xref="GOA:C6CSN3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSN3"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACS99182.1"
FT                   /translation="MVKNLVGNHIRKLRFNLNEMTQQQLADKVGVTRQTIVALEKGNYS
FT                   PSLELAFRISHTFGLPIEEIFFYGDDTSQ"
FT   gene            complement(594528..594974)
FT                   /locus_tag="Pjdr2_0503"
FT   CDS_pept        complement(594528..594974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0503"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmr:Mmar10_0510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99183"
FT                   /db_xref="GOA:C6CSN4"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99183.1"
FT                   /translation="MTYQEKKSITTLISAVLIFAVYCLYKYTQYPEEGMALEESIRYWG
FT                   SFVLVLTLVSIIAHIVISIIFNIIFRITTGEKEPAFADELDKLIELKAHRNSFFLFILG
FT                   FLLAMISLAADQPLNQMFIILIASGFLSDVTGSISKLYHYRKGV"
FT   gene            complement(595156..596019)
FT                   /locus_tag="Pjdr2_0504"
FT   CDS_pept        complement(595156..596019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99184"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSN5"
FT                   /inference="similar to AA sequence:KEGG:An04g04590"
FT                   /protein_id="ACS99184.1"
FT                   /translation="MFKRFIGTAAVIIALGSALVTEAGVAPSEAHAASNMVPDYEVKLL
FT                   MNPSTTLGPDFKLTSSVLSAFSMPTTVTKMNVAFLDTNAKDIYNNGWSTRIRKTEGEDN
FT                   FELSYKKRYTINNNDINAALTQANNDGFNSGDTNYEAQVEWGYQKKTLSITRSKSGSKS
FT                   GYSGMDLPSISDARSLMINNAPDKFNDWLSNNWGTTKLQTSRYFGPVLAKRSIGTWSGM
FT                   QLYIEVWPIKNAAGTGTEYVVEASFKTTSATTASTKHDELVTYLQNKGWFLAQDSLKTQ
FT                   LIMDRY"
FT   sig_peptide     complement(595948..596019)
FT                   /locus_tag="Pjdr2_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.649 at
FT                   residue 24"
FT   gene            596205..597041
FT                   /locus_tag="Pjdr2_0505"
FT   CDS_pept        596205..597041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0505"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: baa:BA_2117 rhodanese homology
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99185"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSN6"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACS99185.1"
FT                   /translation="MNNIVSLKWLLARLYETDLVIVDCRFQLGKPDFGREAYEASHIAG
FT                   AVFLDLEKDLSAPIDEHGGRHPLPDITDLTIALSKVGISNETRVVAYDDQGGAFASRLW
FT                   WLLKYLGHEQVFVLDEGFTAWQNAGFPVNAEQKTLVPARYLATVQHNMLIEMDEVKEKL
FT                   GAEHITLIDSRDGARYRGEVEPLDRIAGHIPGAINRLWSEGKGEDGKWKSADEQAARFE
FT                   DLPKDQETIVYCGSGVTACPNVLALQEAGFTKVRLYAGSWSDWISYEGNPIEVGEE"
FT   gene            complement(597601..599400)
FT                   /locus_tag="Pjdr2_0506"
FT   CDS_pept        complement(597601..599400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99186"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSN7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99186.1"
FT                   /translation="MFILKKRNWHSTHTDLSKYFIMKFTQLVDKSEFLTNNHTSTNGLI
FT                   LLEELCEVSSICLKRSKNHRRLQSLLNECSDESINSSVVSDVIINKYFRPAANNIREWQ
FT                   RDFSIELIQQIYSGTLLHKSSIKPVYLTYVQKELNDIDFSSRHFDTYSKKIDELLSLLI
FT                   PQLVYDGYSLAFLQIAPKKLIQRPLNSMIKHLFTFFDYSIDRKYRCFIPKTDNISRNPL
FT                   IDILNPINITLRNSDYFPNEKPVPLDGYSFEISGKDPFSALRNRVTLAYRKYSLEYTDA
FT                   TPHLLDPFWEEAYYFNGKINKFTRYNFSKTNDPLIPSFRKNTLSHSLSKHEEFLEAVNL
FT                   DNLSIFEEPIYFYNLARTVPSVENSYILLWTALEALMGLRSNKTDIEIIKDNVAQSIAL
FT                   GAVGRRLLSFHERYTKASEINKLKLLCPKIYKLEDKSLSSVMSWAIDKTFENKPNDPFN
FT                   AIKTDPLLAKQYRIINEKWGTLQDLLDIINTSSNTISYQLDRLYFTRNMIVHAAQLGKT
FT                   GDHLWVHLEWYIGKLLAQAVVIMDQFKGSALSRDSDPRDIVFGSLQGQYKASIDYLERH
FT                   KDAKITRDHLINSGIFRFPMLCF"
FT   gene            complement(599840..600730)
FT                   /locus_tag="Pjdr2_0507"
FT   CDS_pept        complement(599840..600730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0507"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /note="KEGG: ajs:Ajs_2947 ATPase involved in chromosome
FT                   partitioning-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99187"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSN8"
FT                   /inference="similar to AA sequence:KEGG:Ajs_2947"
FT                   /protein_id="ACS99187.1"
FT                   /translation="MSAKIISFISEKGGVGKTTCCYHIAIGLERFHKKKVLVVDTDYQR
FT                   GGITCRLIPSMLEHFKKGKVPNKTLYTVFRGLYSDMDLEEIPQPEVIIGNYNTPLIPSD
FT                   PRLTEVTIDKLPGRTNVLERSMLDYNHLSAISNALAPYKDKYDYILIDTHPEISHLLRS
FT                   VIFASHFSVSPVKLDLQSSVGVPSAIEAIRGVNKDREILERTLDLPTTPETIFAGAIGM
FT                   MTKEYNGDLIFTMKKQYVRLKKTDSIFNNYVTEGDGLRVAAEQYLAVYDCDGTTADKQS
FT                   WQFRSIVNEFIARCN"
FT   gene            complement(601283..601381)
FT                   /locus_tag="Pjdr2_0508"
FT   CDS_pept        complement(601283..601381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0508"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99188"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99188.1"
FT                   /translation="MVFGHEITKEAMRTKSLGKMMYDLHKELKIYK"
FT   gene            601711..602274
FT                   /locus_tag="Pjdr2_0509"
FT   CDS_pept        601711..602274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99189"
FT                   /db_xref="GOA:C6CSP0"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99189.1"
FT                   /translation="MTKLKQETKTKLFKWHENLTVGIVIALLFYFMIGSMFILFFPAGQ
FT                   IIVPSLLRPESWINVQTYQMMSGYIFWGGFLGGCVFSVTSILNKMKESASMSERSAAEE
FT                   YIVFVLTLFFRPFLGGTIALVIVLMLNSGFINFKSMDQIKESGSINFQISLSFIVGFSI
FT                   DAILFKLNSMVSIIGNKAKDNSSN"
FT   gene            complement(602538..603371)
FT                   /locus_tag="Pjdr2_0510"
FT   CDS_pept        complement(602538..603371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0510"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: similar to
FT                   Y105C5B.9"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99190"
FT                   /db_xref="GOA:C6CSP1"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSP1"
FT                   /inference="protein motif:PFAM:PF05721"
FT                   /protein_id="ACS99190.1"
FT                   /translation="MLSQAQIAEFENNGFLKGGVVLSDDQVEELREELDKVMNGETVNK
FT                   PVLNRNMLDSDSPYDNMKMITSESVVQIVNIWLASDRFLQHAAHSVICEEVAQLCHSNS
FT                   LRIWHDQVQYKPPITGGSTNWHQDHPLWPIIQPADLVSAWVALDDAVIENGCMWMVPGS
FT                   HKWGNQQRYLANTPDFMPYHQQPEMLPNNAAVNALPFEIKKGQVGYHHCLTWHGSPHNR
FT                   SEMKRRAIAVHYMPGHTRYEPVGEHVMLSYVNVKPGELLVGDHFPEVYRKQGVQV"
FT   gene            603552..604445
FT                   /locus_tag="Pjdr2_0511"
FT   CDS_pept        603552..604445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0511"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; Cupin 2 conserved barrel domain protein; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: pfo:Pfl01_3555 AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99191"
FT                   /db_xref="GOA:C6CSP2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSP2"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS99191.1"
FT                   /translation="MIQDPPHSYPDIVLGAIDDLQPTVNFASRAEVPASEQWGPRIIPD
FT                   YQLFCLLSGEAEISIGQEQYTLAAGDSALYGPHCPHRIIARTGAVFIGIHFAYRQSSLE
FT                   LVHPAFSIEACSEEKLKTSIRPSYKLELANKQLLELPPFFTKPDLKPILMRIVKEYMNE
FT                   QPGYRIVLRSLMTDLITTIVRSQLTKRQKSPEQDKIDPALQAINEQPEKNWTVNELAAL
FT                   CGYHVIYFSSLFRKCTGDSPKQYLINERIRKAKYYLLSGEKMDVIAERLGYASVHYFSR
FT                   NFKEETGLTPTEFKNG"
FT   gene            604593..605633
FT                   /locus_tag="Pjdr2_0512"
FT   CDS_pept        604593..605633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0512"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   psa:PST_1131 probable oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99192"
FT                   /db_xref="GOA:C6CSP3"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSP3"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ACS99192.1"
FT                   /translation="MSTSTAVQSLFRPFTLGQLTLANRIVMAPMTRAMSPNGVPGTNVA
FT                   AYYRRRAENHVGLIITEGTVVNHPDSSNSKDVPHFYGEEALKGWANVAAEVHAAGGKIM
FT                   PQIWHMGTKKQVNDYTEAEITAIVQAFADAASEAKRIGFDGIELHGAHGYLIDQFFWEK
FT                   SNQRTDRYGGSLLARTRFAEEVVRACREAVGPDFPIVLRISQWKEREYTVKLAYNPEEL
FT                   EQFLQPLVDAGVDIFHCSTRRYWEPEFAGSDLNLAGWVKRITGKPTITVGSVGLDSDFM
FT                   TFFTEGKSSANTGIDGLVQKLEKDECDLVAIGRALLVDPAWASKIREGKLTELVPFTPE
FT                   ALKTLF"
FT   gene            complement(605699..606769)
FT                   /locus_tag="Pjdr2_0513"
FT   CDS_pept        complement(605699..606769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0513"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bar:GBAA0860 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99193"
FT                   /db_xref="GOA:C6CSP4"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSP4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99193.1"
FT                   /translation="MATLGIMWDRMNTAVFKWQAKAIRAAGFDRLLLFKPDHVDRKYRT
FT                   IAGWVYENNHWRYEPSSPYPSIIYDRGIYSGRMLREARQMKENSGIPFAGDWLGNDKWS
FT                   IHKHLLVNSRLRPYLIPTLLLSHNQAVHTMLHKYNKVIIKPLGTHKGTGILKLSYRNGK
FT                   YVIEENKKQRLPLSKEGLQRKLAQLRSKRNYLVQKWVDITDAANRVYDIRVLIQKNELG
FT                   QWHLTGMGVRLGKAGNITSNLATEGSAKEIISFLTKQFGHARALRLEQKLRELAFEMAA
FT                   QLERSFQKRLVELGLDFGIDRQSHIWIIEANAIPGKEVFKRAASPKVFKQSLQLPIYYA
FT                   GFLHRRLSGGRVRRRQ"
FT   gene            606923..608263
FT                   /locus_tag="Pjdr2_0514"
FT   CDS_pept        606923..608263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0514"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99194"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSP5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99194.1"
FT                   /translation="MIKIRSRSSLPSDTVLVAPAFLKNWSLSQNQSLLLQFGITTHPIK
FT                   LMASEKVPLGQMLVSHACMTTLKIPAEGQFQVRKTGNTLSVGPYIGILVDKIKGSLPFK
FT                   NLLHYAKTHRHVNGALLAFSPDAVNLRTKTIHGFMYSPVKKTWIYGQYRYPSSIMNKSL
FT                   TSTPLMPHFQNSLGRAVFNNFRLDKWSMHKLLSRNGSVRTHLPRTILYQSPQDIARMLE
FT                   QSNEVYMKPVQGSFGSHILKLSKQNHKIAVTHKGSLKKVFRHVQELGQFLRKQNHHSGY
FT                   LIQDRIKLVSSKERLIDFRLILVKDGQGNWQRMGIIARQGPRRSIVSNISKGGTAMEGK
FT                   RALRRILHKGEAEAGAVCLRMEKIARNIAKQLVSSGYHAANLGFDFALDTRNKLWIIEV
FT                   NHNDPNHTIALDAGETQMFHRTIRANMLYAQKLAGFGTSHPSKGRRP"
FT   gene            608266..609624
FT                   /locus_tag="Pjdr2_0515"
FT   CDS_pept        608266..609624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0515"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99195"
FT                   /db_xref="InterPro:IPR026838"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSP6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99195.1"
FT                   /translation="MAMHVKKLNHAEKDSLLVNQAFLRKFASRPSTVKVHFGAWNRQLK
FT                   VRVSQSLPSDTIGISSQSLGGYSLPPLKYKVLVKGNNVHIGPVLGIVAFKPGAAITMEK
FT                   IKNYNDYLRPYSQIQGLIYICRADDISLQAKKIRGYYYSPGDAKPKWTLGTFPYPSALY
FT                   RRAALNPPTYKALKRVLGPRLFNGYFLGDHFNKWKLWRWLSPHPAIRKHLPHTKKLQSR
FT                   KDLDQMLSRYTAVYLKPTMESMARGIIKAVRSGAGYQFIYPENNKKASPYRVVSVGTNE
FT                   VAGYLANLLREHQYIVQQGIEMKRSDSRGIDFRVIMQKNEQLQWSCTGVIARFGKKNGI
FT                   VTNFTSAGFASKGLNALQGTYGYSRSQSLLTQQRMIEICTKACKVFDAKGGNYADIGVD
FT                   VMVDKNGHIYVLEVNILPDHHLALYAKQRSLYLKQVAKPLLYANALSGFKNSN"
FT   gene            609879..612194
FT                   /locus_tag="Pjdr2_0516"
FT   CDS_pept        609879..612194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0516"
FT                   /product="Glycosyltransferase-like protein probably
FT                   involved in cell wall biogenesis"
FT                   /note="KEGG: reu:Reut_C6029 cellulose synthase
FT                   (UDP-forming)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99196"
FT                   /db_xref="GOA:C6CSP7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSP7"
FT                   /inference="protein motif:COG:COG1215"
FT                   /protein_id="ACS99196.1"
FT                   /translation="MPRLRRTRKLARKRQWGTEHDSTPLSIVHDKPSTRKMVYSRLAII
FT                   LTIGFWGTYVITTIIKQYFKGPNTFPFVMESLAYLVIVTLLTFSALMYLLARQGALQRF
FT                   SKHVRVPRAEIDRYFEKNQPSITVLVPSYDEEPGVVRKTLLSAALQEYPHIRIVLLLDD
FT                   APYPTDPETLARLNATRQLAKEITDLFAEPRRLFEAKLVEFTGEQALSSHVSPAVTKEL
FT                   AEHYAWAADWLDQLGSKEAKDDHVGEFFVNDVVGSLSGELRLVHKALIASCDDEVRLPF
FT                   ARISQLYQRLTWIFNSELDVFERKKFASLSHEPNKAMNLNSYIGLMGRTCNQVDTPDGP
FT                   ILVPASGIRKGKSVAFPDSDFVLTLDADSILRSGYCLRLVYFLQQPDNARVAVVQTPYS
FT                   SFRGAATRIERIAGATTDIQHILHQGMSRYNATFWVGANAIIRKSALEEIGETEWVGGF
FT                   EIRRFIQDRTVIEDTESSVDLARHNWTLFNYPERLSYSATPPDFGSLIVQRRRWANGGL
FT                   IILPKLWSLVRDRKRQGNAMSNAEILLRLNYLASIAWASFGLIFLLAYPIDGRLLSPFV
FT                   LLAALPYFIAMSSDLKYSGYKRSDVFRIYGFNLILLPVNLAGVLKSMQQALSAKKIPFA
FT                   RTPKVKERTVSPMLYVISPLIVIGFSLFIFWHNKVQHNWGNAAFAAFNAITASWAVVEF
FT                   IGIKNTIVDVWLSILNWLYVPVKKKQKDQEKEHTERANWQTILYHGDTEMRLPESALNH
FT                   LASTSRTSYLEEKEVMTS"
FT   gene            612191..613789
FT                   /locus_tag="Pjdr2_0517"
FT   CDS_pept        612191..613789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0517"
FT                   /product="Chitinase"
FT                   /EC_number="3.2.1.14"
FT                   /note="KEGG: bte:BTH_I2402 glycosy hydrolase family
FT                   protein; PFAM: Carbohydrate-binding family V/XII; SMART:
FT                   Carbohydrate-binding family V/XII"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99197"
FT                   /db_xref="GOA:C6CSP8"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSP8"
FT                   /inference="protein motif:PRIAM:3.2.1.14"
FT                   /protein_id="ACS99197.1"
FT                   /translation="MTSATKSLIGGRRLSPWRLIFLCLVLIGLITSGILGATGRIGNIW
FT                   AARADVQNQWFAPYVDVTATPQFTFQNLGSTENKDVVLAFIVSDPANPCTPSWGGAYTL
FT                   NQARDSLDLDRRIARLQQQGGSIAASFGGQKNRELAVGCADAGELASAYRSVVDRYNLN
FT                   TIDLDLENAGLTDTAAGNRRAAAIAKLQSERRDAGKQLAVWVTLPVSPQGLSQDGTNAV
FT                   AQLLQHDVDLAGVNVMTMDYGSSLSSDQTMLTASESALIQTARQLKILYQQAGTHLDDT
FT                   TVWSKIGATPMIGQNDYKNEVFTLKDAEALNKFALSHGVGRMSMWSANRDIMCGSNYAD
FT                   VSLVSDACSGVKQTQYGYSDLLGMGFKGNISMSAGLVTTPDQVSSDQQQPDNPATSPYQ
FT                   IWSPTTTYLAGDKVVWHHNVYEVKWWTKGDVPDNPVLQSWETPWNLIGPVLPGEKPIPQ
FT                   PTVPKGTYPSWSDSAIYEAGKRVMFEGIPYQAKWWNQGEGPASASDPDSSPWARLTEDQ
FT                   INAVLSKLQKAVKGK"
FT   sig_peptide     612191..612301
FT                   /locus_tag="Pjdr2_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.600 at
FT                   residue 37"
FT   gene            complement(613879..616050)
FT                   /locus_tag="Pjdr2_0518"
FT   CDS_pept        complement(613879..616050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0518"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aca:ACP_1144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99198"
FT                   /db_xref="GOA:C6CSP9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSP9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99198.1"
FT                   /translation="MEATEWKQRVKQYKGIFTEPPKTVPSDKVVDSPVIGNGDLGVTIS
FT                   GRPEQQRVWISKTDFWKAQLMYPNGSPCLLGGIDIHIPDLVNASYYCEQQLDEAKIVST
FT                   FRGSAATVYMTSWISAMENALIVELSCEGQAVSVTTDLWVQPGNESETDYGQDGDTVWA
FT                   ARKFSGDDIEWPTEGVIAMRSSAGSHSFKLQPGTKQYLIAYVMTNHDEEHYLQESIRKV
FT                   GLIDEDLIASLRCDHEDWWSTFWSKSAIDIGDELLEKFWYGSHYIMACCSRNKKFAPGL
FT                   FGNWITTDTPEWSGDYHLNYNYQAPWWGVYSSNHIELSEPYDTPLLEYMSNGRRYAKEY
FT                   LGCRGLYYDVGIGPKGLPTALCNTPYENGHMFLGQKSNSALSTVNMLMRFYHTYDLDYA
FT                   GFVYPFLTEVANFWEDYLTFENGRYVIYRDAIHEVGTYTESHDDDHWDRGLEDMNPILS
FT                   LALIRLLFKGLLDISRQLQLDADRHVKWTHIVEHISEYPTYQREGKTIFRLTEQGYDWW
FT                   PDNTLAIQHIWPAGGIGLDSDPRLLEIAKDTITVLNRWTDYNGFPTIFTAAARVGYDPE
FT                   TILRELRRQCSEHSFANLFIFFGGGGIECCSGVPSAINEMLLQSHEHVIRLFPVWPRDK
FT                   AARFHNLRAVGAFVISSELSGGTVTRIELTSEKGQACRIFNPWPNKAFSLMEVDGNQQK
FT                   EVAWQLSADIISFHTETGKSYTLRLHESN"
FT   gene            complement(616130..617791)
FT                   /locus_tag="Pjdr2_0519"
FT   CDS_pept        complement(616130..617791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0519"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bsu:BSU07100 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99199"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSQ0"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS99199.1"
FT                   /translation="MRQRIKLTSLLLAGVLSTGTVLAGCSSDSTTATSGNTKAAEQAGG
FT                   TLSFSVTLPSFGAKIEDSMVQKEWVKQMEALMGKKLDIKFNYIPIGEYDEKSKLLLASG
FT                   DTTDLFMVMSKDLYKQYETEGTFLDLSKYTDLLPNYLGLVDQATDGKIKAIRSDGQFYG
FT                   LWNIDLPRQAKDKGMGVYTPATYRYDIFQKEGLPIPTTLDELYAAAKTLKEKYPNSYPV
FT                   NTQGGSFDSLFYANHNGGSSIYWNGKNYVYGPFEDSYKEALQFANKLYAEKLLDPESFS
FT                   DKSDAVKKKAMNGTNFILLSNWFTFAGDWNRASTGGEKFVISLFPDNPKYGKAWQSVND
FT                   FSSVSVSSGAVMVVSPKAKNVKDLVKLMDLQYKPDIVTLITWGIEGTTYTKDASGKPTF
FT                   VDSIKHADNPWMEGDKYGMRSSSSYRPGLQMAIDTRAFVDFAPKDSGIINGKPVDQPWE
FT                   TAFQDIPFPNDYVPPMIFEPSLEFTDTEREQITSVMSPVNTFVAEMQNKFVNGKESFDN
FT                   WAAFQAKIKKTGDLDKVLNIYEDALKRYEERRAANK"
FT   sig_peptide     complement(617720..617791)
FT                   /locus_tag="Pjdr2_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.669 at
FT                   residue 24"
FT   gene            complement(617890..618780)
FT                   /locus_tag="Pjdr2_0520"
FT   CDS_pept        complement(617890..618780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0520"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0481 ABC transporter
FT                   (permiase)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99200"
FT                   /db_xref="GOA:C6CSQ1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSQ1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS99200.1"
FT                   /translation="MVGKESIGSRIFDLLNMVLMLLLCVAMLYPFLNVIATSLSNSEHI
FT                   LRGDITIFPKGFNLGGYRYILKDPFLYSGYAHSIIYAVGSTLFMLTFTSLMAYPLTIPE
FT                   FVAKKFLSIFLVITMFFSGGLIPSYLLARSLHLLDTYWIIIIPGCVSAFNVFLFRSFYQ
FT                   TIPADLRESAVIDGANDIQILIKIILPLSKPLLATFALFGIVGSWNSWFEALVYLQDES
FT                   KYPLQLILRKYLFSISFDSGTGTEVMQAMLSQMNISPKNIQMAIVVIAMFPIMVIYPFL
FT                   QKYFVKGVMIGAVKG"
FT   gene            complement(618794..619705)
FT                   /locus_tag="Pjdr2_0521"
FT   CDS_pept        complement(618794..619705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0521"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: atc:AGR_L_3564 AlgM1,
FT                   putative multiple sugar transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99201"
FT                   /db_xref="GOA:C6CSQ2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSQ2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS99201.1"
FT                   /translation="MVSAHKLFKACWKQRYLFLMVLPGFLVVLVFSYFPMYGIQIAFKK
FT                   YSAVRGMWGSDWVGFKYFVLFFQDPMAMRVLKNTLLLGFYSLLWGFPAPIILALLFNEL
FT                   KRPIFKKAVQTISYLPHFISTVIIIGILRTFTERDGLFNQIAAWFGSDPIVFLSEPEWF
FT                   RTIFISSSIWQGIGFGTILYLAALSSVDPTLYDVANIDGANRWKKVLNINWPHIKPTTI
FT                   ILLILSLSGILGTDFQKILLLYNPDTYEVADVIGTYLYREGIMGSRFEYTTAIGLFQSF
FT                   VAFILLIGANMLSRKVSNTSIW"
FT   gene            complement(619958..621052)
FT                   /locus_tag="Pjdr2_0522"
FT   CDS_pept        complement(619958..621052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0522"
FT                   /product="transcriptional regulator, GntR family with LacI
FT                   sensor"
FT                   /note="PFAM: regulatory protein GntR HTH; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein GntR HTH; KEGG: bsu:BSU33970 LacI family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99202"
FT                   /db_xref="GOA:C6CSQ3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSQ3"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACS99202.1"
FT                   /translation="MAKYTVIKEDIKRRLNSGEWTEGYRLPSSREFAQYYESSVNTIEK
FT                   AIKELAEEGWLIRDTRRGTFMDKGKEPLPGGSRLVAAFVFGIDNPIWATALRGVEDVLF
FT                   LRGYQLLSSSDDRNMAKLESLVRGAVERKVEGVILSPIMNQGHEEINNRIFSMLESNGI
FT                   KHVNLDRAVHNTSIPYVTSDNLTGAYNLTKLLIAQGHRRILFIKNSNISTINERLCGFK
FT                   QAFIDSDLEYSDEFEVFISTKNEDFIDEFDAYCEVLEKKMKEMQFTAVFTANDQIAEAA
FT                   IRSFENLNYRIPEDVSLVTYDAENLNRRSKLNVTGVTQPFYEMGQCAAKLLLNMIDDHE
FT                   NQSFYGQVCNSKMYIGKSVKSIVT"
FT   gene            621265..623379
FT                   /locus_tag="Pjdr2_0523"
FT   CDS_pept        621265..623379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0523"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: sus:Acid_6613
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99203"
FT                   /db_xref="GOA:C6CSQ4"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSQ4"
FT                   /inference="protein motif:PFAM:PF00732"
FT                   /protein_id="ACS99203.1"
FT                   /translation="MSQDQLHVDALLKAVTDRLIPGDDWQSASDAGVLTYLERYAAQDA
FT                   AVWAKIIEPGIRSLQEEAIRLHGKPFSELPADEQDQLLQEAESDAYRDWPVSSKLFFDT
FT                   LLNLTVEGYYGTPEAGGNREGKSWEMIGFRPGPVAEAIAPAPEADFPHKTLEQLRDRYD
FT                   AVVIGAGAGGSVAAAVLAESGMQVLVVERGSWLKYDQIGRDHLRNHRISKYGHNTGPDA
FT                   EGNPRTFAMADGSERITLPIDGDYHNNAMTVGGGTRVYGAQAWRFHTEDFRMASRYGIP
FT                   EGSSLADWPISYEDLEPYYQRAEWEVGVSGDGGAHPGRGKRYGPYPMPAMPMTLEAGRL
FT                   ARAAQKLGWHSGAVPLLINSVERDGRQACGRCGQCVGFACPTNSKNGGHNTMLVRAIAT
FT                   GNCDLICDTFAEYIDSDGGKHATGVRLVQEVKGSVQRRPIQAGHVVVAAGAIESARLLL
FT                   NSASDSEPDGIGNRNGQVGRNLQGHVYSGAYGIFDEVVQDGLGPGVSIATFNTEHSNLG
FT                   IIGGGLLANEFTRLPLIHWYRALSPNAARWGMKGKETMRDTFLRTSQIQGPIQEIPNAE
FT                   SRVRLSKSVRDRFGIPVASLSGSVHPESLRAAAVLGGQAEKWLWAAGALEVWQTKPGGG
FT                   LSAGQHQAGTLRMGNDPETSVTDPSGRVHGYDNLWVSDGSVHVTNGGVNPVLTIMALAF
FT                   RTADNLVKLG"
FT   gene            623482..623826
FT                   /locus_tag="Pjdr2_0524"
FT   CDS_pept        623482..623826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0524"
FT                   /product="YCII-related"
FT                   /note="PFAM: YCII-related; KEGG: ara:Arad_3753 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99204"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSQ5"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ACS99204.1"
FT                   /translation="MHFTLMFFESTEDFAARKDLEKQQEYLAGWSHYVHALRDSGVVVT
FT                   GFGLHAPETAATLKRNDGTIFVQDGPFTETKEQLGGLFVIDVPDLDAALEWAARAPVNA
FT                   VEVRQNLPAM"
FT   gene            623837..625057
FT                   /locus_tag="Pjdr2_0525"
FT   CDS_pept        623837..625057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0525"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; KEGG:
FT                   ara:Arad_3754 RNA polymerase sigma factor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99205"
FT                   /db_xref="GOA:C6CSQ6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSQ6"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACS99205.1"
FT                   /translation="MDIYRTIENTVRDSYGRILSYLAANWRDLEAVEDALADALVTALE
FT                   SWPKKGIPDKPEAWLLMVAKRRLMDRLRRKRVSEKAYSALIAMSEEAEHMDSAAFPDDR
FT                   LKMLFLCSHPEIDPLIHTPLMLQLVLGIDASRIASAFVVKPSTMGQRLTRAKAKIRSDR
FT                   LTFTMPDIEELPKRLDAVLDSIYAAYGSGWDDLAGVDSRRRGLVDEAIYLGRLLAAYMP
FT                   DEPEAQGLLALMLHCEARQSARRDDTGSYIPLSGQDTSRWSVPLITEAEKCLHKAARFG
FT                   RIGRFQLMAAIQSVHAQRARTGRTEWKEIALLYEGLSQLSPTLGILAGRAAAVAEAYGP
FT                   REGLVLLEAIPQANRDSYQPYWALLAHLHRTMENLEEARTAYSRAIGLCEDRSVKQFLH
FT                   QRAMEIC"
FT   gene            complement(625054..625911)
FT                   /locus_tag="Pjdr2_0526"
FT   CDS_pept        complement(625054..625911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0526"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: ect:ECIAI39_4283 putative
FT                   DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99206"
FT                   /db_xref="GOA:C6CSQ7"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSQ7"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS99206.1"
FT                   /translation="MYNRTKTPKGRLAMSFMNIPYVLEELPPQPPCRFQLIWKVQADIA
FT                   YQVANPTGFSSPGLFATWEGKGVITLGSEQHELVAGTYIIVPPDTPTAYRCLNGNWKFY
FT                   FLEFDSLDMALGLNLPVGIPVSTAKMAEAARMNERLINNLIMKPAGYAYDSHLAMQELL
FT                   LLFARERHANRSGRHPELDDILYRMHQTIGQAFPIEKWVQQSGLSRNAFFTRFRERTGM
FT                   SPNQYMQELKLAAAKTSLETTQASVKEIAAALQFYDEFHFSKLFKKRYGMSPRAYRRDA
FT                   PLAD"
FT   gene            625994..626821
FT                   /locus_tag="Pjdr2_0527"
FT   CDS_pept        625994..626821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0527"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99207"
FT                   /db_xref="GOA:C6CSQ8"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSQ8"
FT                   /inference="protein motif:PFAM:PF05721"
FT                   /protein_id="ACS99207.1"
FT                   /translation="MLLKVGSRELELGGPYLTELRDSNELMHDADALRERLAEDGYLLL
FT                   RDFHNREQVLKARHSILKKMDKMGKLDRDTLLEEGVMADGSKTIFMGGTNEDLPELLSV
FT                   LNGDHIMGFFDELLGERSLTYHYKWLRAVGQGDFTGAHYDIVYMGRGTHNLYTVWSPLG
FT                   DINYDMGGLAICLDSHHFEELKKSYGSKDSDRDPGIGHYTDDPLVITEKFGGKWATAEY
FT                   RAGDVLIFGMFLMHCSLANTTNQYRLSVDTRYQSSLEKVDERWSGKKPRGHYK"
FT   gene            complement(626933..629011)
FT                   /locus_tag="Pjdr2_0528"
FT   CDS_pept        complement(626933..629011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0528"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; S-layer domain protein; KEGG:
FT                   smt:Smal_0786 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99208"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSI5"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACS99208.1"
FT                   /translation="MVTTSNYDVFNKSIAQLQNDMEKGVTTSEAITKAYLDRIAAYDLG
FT                   QLGFHSFLHVSETALQQARGADQARREGKTGQLLGIPIAIKDIYDTKDMPTTGGSKALE
FT                   GFQPKADAYQVEKLREAGAVIIGKTNTSEFANSGSFSESGWMQTWNALYPSKTSFGSSG
FT                   GSAVSVAASFAAAAMGTQTGVSLYAPTTGASLTAFRGTDGMASTRGVIPLTWGQDYAGP
FT                   IARSVTDLAYLLNATTGTDPQDMLTQEADARRPEDWTAALSADALKGKRIGYIPSSFNS
FT                   SYADDGTGEAVKQHFDDLVKAGATMVEMSEPPSGGTRPAGNAGSEGWARYIELHDNFPF
FT                   ANGDELLASPKVLLYNQRSLQVRPRMTESQVQDYINYRTNYKRIIADWMDQYDVDSVVY
FT                   AGFISDVYNNDSAASQLSSDRGTGVLTSNVGLPTVIVPVGTNPNGYSISMQLMGKAWDD
FT                   ANVLAMGYALEQQASARTVTAFAPALSYSPPTTPPTTPPTTPPGNNNGAPSGGNETPDD
FT                   PTPEEISFTDTEGHWAKSSIDYLVQKGLLSGYPDGTFRPDLGITRAEALKVLALQLGLA
FT                   SQASSFADVPSTHWAAGFIGAAQKSGLMNGYADGKFRPDAQLNRAEMAALVARAFQLSG
FT                   SSNVSFPDVGTDSWSRDYIDALIANKIVTGYADGKFRPDNAITRAEFATMIARVLQR"
FT   gene            complement(628969..629485)
FT                   /pseudo
FT                   /locus_tag="Pjdr2_0529"
FT   gene            complement(629545..630045)
FT                   /locus_tag="Pjdr2_0530"
FT   CDS_pept        complement(629545..630045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99209"
FT                   /db_xref="GOA:C6CSJ2"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSJ2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99209.1"
FT                   /translation="MFKTRNLLSLNKSRPASDSAVPRVGKRTWSQKGVFAAALALSMVF
FT                   AGVIPANNAFALTRLTSEGGIAWEIHDSFAPNLDTGSIRSASSTPIQGFGNIFVQVSTS
FT                   PAPRMNGQLMRDFGLSFDGKDTFDTTKSVNLEMYLLLAIFTLTAQATPFVSSTRLRIRQ
FT                   TLP"
FT   sig_peptide     complement(629875..630045)
FT                   /locus_tag="Pjdr2_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.765 at
FT                   residue 57"
FT   gene            630422..630997
FT                   /locus_tag="Pjdr2_0531"
FT   CDS_pept        630422..630997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0531"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: sfu:Sfum_1327 RNA polymerase,
FT                   sigma-24 subunit, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99210"
FT                   /db_xref="GOA:C6CSK6"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSK6"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACS99210.1"
FT                   /translation="MDVNESMEPLSADRIENLVKAVQAGQVEPYRAIVLHFQRRLHLYC
FT                   YYMIGDRAESEDIVQEVFLRAYREIGKYQPTVSFSAWLYKIGYRLCLNALKKHKGQHRL
FT                   LSLIQQQWLTAPATSSDESADCLLKGLSPEERQLVIFRSLEERSFAEIAELTGSNAAAL
FT                   RKKYERIRKKLRKQMREEKLDERLFPGL"
FT   gene            630972..631949
FT                   /locus_tag="Pjdr2_0532"
FT   CDS_pept        630972..631949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99211"
FT                   /db_xref="GOA:C6CSQ9"
FT                   /db_xref="UniProtKB/TrEMBL:C6CSQ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS99211.1"
FT                   /translation="MSDYSPGFEPLEQFKRDAKRGAPAPVDFSERIMQRIELDSAGSSN
FT                   YTAHKPKRMAIGIAIIALTVTLLCGFTYAITAGVLTIKDDAGREIMQVQSPDPIPAEQA
FT                   ELQERIEKVVEDQLQQGEAAQIVIGQEDIDAVKRYEEPKDYYPLFRGFSYSSTQDIPRL
FT                   VGHLNELKKLGDQVMNAKLTKAELFPYLGHPNAVQSDKWVDATDAASGTPYAYYKLKPD
FT                   EQAYMEDAVLSLTYQEGDLTFKLIGNYGEFTSVTIFDNNPSAKRMHEVEGISVYHSEGQ
FT                   ETPYLTWLEPVGDGELMYWLNSNAEIKQQLKFAEAVIKATKRKV"
FT   gene            631967..632875
FT                   /locus_tag="Pjdr2_0533"
FT   CDS_pept        631967..632875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0533"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99212"
FT                   /db_xref="GOA:C6CRD0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR011230"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRD0"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACS99212.1"
FT                   /translation="MGKQLAFRQDGTFKIIQFTDIHVYDGLGEADVRSLALIKNLIESE
FT                   KPDLIVFTGDLIFADNETGDLRGGFRKTVQIADQSGIPFAVIYGNHDAERNVKKPELQE
FT                   ILSEFGNCISDAGPEDIGGIGNYTATVKSSSSDSDAAVLYFMDSGEYAHESIGGYAWIQ
FT                   PGQVQWYREQSRQLADKNNAVLPGLAFLHIPIPEYNDVWQSGGAEGTKGEQVCCSKVNS
FT                   GLFAALLERGDVMGVFAGHDHNNDYIGKHHGITLAYGRATGYNTYGDLKRGARIITLVE
FT                   GERRFDTYIKEDEQSESGSLQ"
FT   gene            632996..633907
FT                   /locus_tag="Pjdr2_0534"
FT   CDS_pept        632996..633907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0534"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: transcription activator effector binding;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: bsu:BSU05170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99213"
FT                   /db_xref="GOA:C6CRD1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRD1"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ACS99213.1"
FT                   /translation="MDWLQRMNLAVEYIEDNLEHDIDYEQIARIALCSVYQFQRMFSFV
FT                   LEIPLSEYIRRRRLTLAAFDLQDRKNKVTDIALKYGYETPESFSRAFQNLHGLTPTAAR
FT                   LAGSPLKAYPRLSFQIILKGVAEMNYRIVEREAFQVFGLEDIYGMDNIANQDGITIPEI
FT                   WQNISKNGEFDRLFHSLAGDWRAEGRFGKELGEVFAFDSYRFTSNTTFPYLIGCYKSAG
FT                   STIEGYTVIDVPASTWAVFSTLNDGNGSGNYDLRSLKNRIFSEWLQTSKYHIIDGGNFE
FT                   MYCTHPSGDEYCELWYRIEEKR"
FT   gene            complement(633971..636007)
FT                   /locus_tag="Pjdr2_0535"
FT   CDS_pept        complement(633971..636007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0535"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: bar:GBAA0575 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99214"
FT                   /db_xref="GOA:C6CRD2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRD2"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS99214.1"
FT                   /translation="MNPNPPSKLKKKLGSVRSRLILSCLLILLLPSLAIGTFAYGTAKN
FT                   KVSEQLASMATTDITLVSHMIDQFMQATINDVNGLSGQISPPSASQLLEAYKQNHSEIE
FT                   AASYMQGDGTVLYSTGSVTADAESDAYKQAVENKGKAVIMEPYTSENSGDTVAMVAEAS
FT                   SDGKSVVAVVVNLQALQEAVGEVKIGEQGFVVIFSANGGMVVSPPWNMNASSAEGAADA
FT                   VPTGEPPADSAGEPPAGEAGGGEPGVMFTGDSGQIEQVSPEGETRNLIYITNELTGWKI
FT                   GGDRSPSEVTRAAKPILYNTILVIALSTILGVFLMWFIVRSIMRPLKALTETTQTIRQG
FT                   DLSKRVSLTSKDEFGELGTTFNTMVDSLRSIVSEVSHSSHQMIASSEQLSVSADQTAAA
FT                   TEHIASTIEDMADGAEQQVDIIEDNARTIRDVTGAITHIAARAQTAADTTSQVSAKSSE
FT                   GGQAVQNAVRQMGHINHSVKSLADVIARLVDTSREVGQIIEAISDISQRTNLLALNAAI
FT                   EAARAGEQGLGFAVVAGEVRKLAEQSSKSTEKVAALIAAIRGEIGNADASMQAAAGEVS
FT                   EGVTVIRTAGRLFAEIEHAVGEVNSQVHEVSTAAEQIASGTKQVVKAIEDISAVSQSTA
FT                   DGAQTVSAATQQQLASMEDISSSAAHLTRMAEELQANVDKFKL"
FT   sig_peptide     complement(635888..636007)
FT                   /locus_tag="Pjdr2_0535"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.589 at
FT                   residue 40"
FT   gene            complement(636132..636494)
FT                   /locus_tag="Pjdr2_0536"
FT   CDS_pept        complement(636132..636494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0536"
FT                   /product="protein of unknown function DUF1304"
FT                   /note="PFAM: protein of unknown function DUF1304; KEGG:
FT                   scl:sce9310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99215"
FT                   /db_xref="GOA:C6CRD3"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRD3"
FT                   /inference="protein motif:PFAM:PF06993"
FT                   /protein_id="ACS99215.1"
FT                   /translation="MLIVSVILTAIVAIEHVYILILEMFLWTGPRARKAFGTDKAFAEA
FT                   TKSLAANQGLYNGFLAAGLFWGLVHPNASTGHQIQLFFLICVLVAAVYGGFTAKRSILL
FT                   VQGLPALIALIAVLLT"
FT   gene            636761..639439
FT                   /locus_tag="Pjdr2_0537"
FT   CDS_pept        636761..639439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0537"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; Fibronectin type III
FT                   domain protein; SMART: Fibronectin type III domain protein;
FT                   KEGG: gur:Gura_2022 fibronectin, type III domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99216"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRD4"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACS99216.1"
FT                   /translation="MLFGMVPPSLAAAANNSNGGSQPEKSDRPVFSDIQSHWAYNEITE
FT                   LAEANIVAGFTDGTFRPSGQVTREQFLKMLVVLNKYSSDNVSVPFKDIEPTRWSEPYIA
FT                   AGLKHGILLLTDYPDGKFKPSQPITRFEMAIWIVRALQLPPGKDERMLSKLKDQANIKQ
FT                   SRSLIEAALETGIIRGMPDGSFQGGIHSTRAEAAVMLSRALNYLLGKSGAPHKIVQYRP
FT                   EVKLSASKNYSMRDSSTWVITDPQLKLSAGDVFVMPPNDKYYGGIAKKVVSVSKENGTL
FT                   IVKTSVPRLKEVFSKLDISTSELIDPKLLKPINSSVTIQTSGQSAQPMNMSLLNQVPQS
FT                   YASLALPCFNIGLNNAKLDGIAFDASLNACNLGVNADIGLDVDFDWFDTDLEFYSKLVL
FT                   TGDITTKVHASANTGNSALNEPKFIPLTTPFYVPVFTGVFVKGQLFLRIDPDFRASVVV
FT                   DFNDQFHLEQGFSLSSSNGLRAINNTTNTATLNVDTKANASIAAGPDVQLTLTLLDVAY
FT                   AGFDLYPGIEAGYSRNYEQGRCDAINVDAFLRLDVIAGYDIWIASDDFRANLINAKYQL
FT                   YQTELNCPPPQPPGNLKAELFGFRATLGPYSSTIINRTDVQLSWSAVKDAATYNVKRSE
FT                   SSSGPFTSRRTSSTQFKDTTATIGKTYYYQITAVNEHGESKPSSTFKVAVTMQPPPAPQ
FT                   SLTADKRGGASVVLHWADVGGLVHYTVQRADGNGTNFATIASNVSGTSYTDSSASLIKA
FT                   YSYRVMAEDNGGTSAPSNVVSVPIPDISVTPIDPVIPIGPIIIKLPAPANFNAGTDINS
FT                   GKVILTWNAVSGAAGYDVMRSTAANGTFTVIGSKITEPKFTDTTASIGVTYYYKVAAVS
FT                   SNGAEGNATAVKSAAPSSGIH"
FT   sig_peptide     636761..636820
FT                   /locus_tag="Pjdr2_0537"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.685) with cleavage site probability 0.678 at
FT                   residue 20"
FT   gene            complement(639500..641548)
FT                   /locus_tag="Pjdr2_0538"
FT   CDS_pept        complement(639500..641548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0538"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Sigma-70 region 4
FT                   type 2; SMART: regulatory protein LuxR; KEGG: sus:Acid_3765
FT                   response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99217"
FT                   /db_xref="GOA:C6CRD5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRD5"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACS99217.1"
FT                   /translation="MAKEQGYLRPADKFEAPHSRELYGRDREVQLFIELLETPSTVRRM
FT                   ISVYGTGGVGKTVLLREFDQLARQRDIPFVMVDTRLFAHTPAEFCIFLLRTLHTPIPGM
FT                   MRPNDTAALTELCREVILGAGKPFVLALDTFEEIGEMEHWLRDSFINRMPEGIIIILSG
FT                   RFALHPSWRAFPAWQRTIYPLPIRDLDYEAARSYLLRCGIASDETIRSIWLRTRGHPLS
FT                   LALLASTSLVNVDNEGRPSNEDAWFSHIVQTWLREVPDSDMRELVESAAVARHFNQEML
FT                   SRMLGRPVTTEQFRRLISYSFIQRMDRGWLLHELLREAISKDLRMRMPERYNRIWQRCL
FT                   QYYSNKLKQSARNKSVSWENAEFLYYIGNQFVHFLMYRQWVSYSVEPLGPGNWKEAEQY
FT                   IERRRRTAKDSYIPFSAQDGTHIQFCLSRQESLLVLDQIRLQELYELEPGSVKLIRNGE
FT                   DEVCGLIEIIPIHAGTIDYLRTARMSRAYFTALPEELLLELAVQPPSHSGYFVKILDVY
FT                   DFADDVMMHASLSTLISHILSTGYIVAAPIGNPISHAICTSLGLEQAAGTGNLDYDNVT
FT                   PAPYYILDTRGNKVNHYVDKMIAALGMQEEGKEAEAEGFAEEALLSLLSRREREVLDRV
FT                   ILGRSNLELARDLCLSEVTVKKHLANIFRKLEVKSRTQLIHKVSGRT"
FT   gene            641744..642718
FT                   /locus_tag="Pjdr2_0539"
FT   CDS_pept        641744..642718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0539"
FT                   /product="glycosyl transferase family 4"
FT                   /note="PFAM: glycosyl transferase family 4; KEGG:
FT                   bsu:BSU35530 teichoic acid linkage unit synthesis
FT                   (synthesis of
FT                   undecaprenylpyrophosphate-N-aetylglucosamine)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99218"
FT                   /db_xref="GOA:C6CRD6"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRD6"
FT                   /inference="protein motif:PFAM:PF00953"
FT                   /protein_id="ACS99218.1"
FT                   /translation="MVVIAILYVAAFLLSFVTVLVLIPPFSKLAFKIDFVDRPRKDVER
FT                   KLHRKPIPLTAGYAIFIGFFIAYLAVVRDFSMQTGAIFLGGLLLLAIGTVDDWYKTKGK
FT                   DFPALPKLIVQLSAAVLVYASGVVFTGFVNPFSGHYVELPVLLQFVLTTLWIFGVTTVI
FT                   NFSDGLDGLAGGLSAISAMTLFIVALAMGQSNSANMAIILVGITLAYLRFNKPPAKIFM
FT                   GDAGATFLGFMLAVISLDGAFKQATALSIFIPILALGVPIFDNLYVMLKRFLQGKAIYQ
FT                   ADASQAHYRLLRAGLNHKQALMVLCLMGTCLGLSSIILMLVEI"
FT   gene            642832..643599
FT                   /locus_tag="Pjdr2_0540"
FT   CDS_pept        642832..643599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0540"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; SMART: regulatory
FT                   protein DeoR; KEGG: smt:Smal_3818 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99219"
FT                   /db_xref="GOA:C6CRD7"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRD7"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACS99219.1"
FT                   /translation="MLIHDRHQQIIQLLHESQSVKTADLIARFGVSFETIRRDMEYLEQ
FT                   EGFLKRVHGGATLPQADYRKELPFTVRETKRHPEKRELAHTALRFVEEGQSLFLDVSTT
FT                   NTEFAKALAARFERLTILTNSFPIASILMSKPQFTIIFVGGVVRNSEQCAVGDYAESFV
FT                   SQFHADLFFMSMSGISLTEGLTDYGISEIQLKKRMLERTRRVIVLADSSKFDVVSLTPV
FT                   CGLDKIERIITDSGLSPDILERYKKAGITVESK"
FT   gene            643830..644648
FT                   /locus_tag="Pjdr2_0541"
FT   CDS_pept        643830..644648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0541"
FT                   /product="small multidrug resistance protein"
FT                   /note="PFAM: small multidrug resistance protein; protein of
FT                   unknown function DUF6 transmembrane; KEGG: gur:Gura_1643
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99220"
FT                   /db_xref="GOA:C6CRD8"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRD8"
FT                   /inference="protein motif:PFAM:PF00893"
FT                   /protein_id="ACS99220.1"
FT                   /translation="MAHAIWNLLTKKSGNKQLFLFMIYIPATLLLLPEFIAEIVSVQVP
FT                   LSGYVLLVLSLLIQAGYAYFLSRTLTLGDLSQVYPMMRGIATFLLPLCGVIFLNERLST
FT                   WGWLGLGLIALGFFLLSGFHRRKQRFQASGKVLSSIVAVGFCTMAYVMVDKVNLQHFSP
FT                   VVLLEISNIGFMLGLVPFIRFREIGWVKEIKENGKLLVAGSILSPGSYLLFLFAMSMSQ
FT                   LTYVAPLREIGTVFGTFMGVWLLKEGKGALRLASASIIFAGILLVGILGI"
FT   gene            644662..645513
FT                   /locus_tag="Pjdr2_0542"
FT   CDS_pept        644662..645513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0542"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: baa:BA_1401
FT                   PA_phosphatase, purple acid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99221"
FT                   /db_xref="GOA:C6CRD9"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRD9"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACS99221.1"
FT                   /translation="MRSEEGKEKAKLQFQVITDTHVRTDPGHTHNGNLARALEDMKREA
FT                   PDSDGIMHVGDITDHGHAEEYEEFRKIWREHGEGLPAAYFASGNHDVGGGEWPSRLGAY
FT                   LNATEMGGPYHDHWVKGYSFIFLGTEQGLDLFSFLSEAQLSWLDGKLEESKSLNRPAFV
FT                   FLHQPLKDTVAGSYESQNWYGVTQDEQLKEVLSRHRHAILFTGHTHWELEAPHTLYDDE
FT                   QLPRMFNAASVAYLWTDEDEHKDGSQGLFVEVYEDRIIVRGRDFAAGQWLEKVRYEWEI
FT                   PE"
FT   gene            complement(645591..646013)
FT                   /locus_tag="Pjdr2_0543"
FT   CDS_pept        complement(645591..646013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0543"
FT                   /product="protein of unknown function LppY and LpqO"
FT                   /note="PFAM: protein of unknown function LppY and LpqO;
FT                   KEGG: bid:Bind_2102 protein of unknown function LppY and
FT                   LpqO"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99222"
FT                   /db_xref="InterPro:IPR011094"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRE0"
FT                   /inference="protein motif:PFAM:PF07485"
FT                   /protein_id="ACS99222.1"
FT                   /translation="MAQPVKASPQFIKICNRFSSILGGTEHEITKGPVCFVTRNRVIKA
FT                   SILGKRTASPLVRYQLFSFESLDSSGRALCLGETALFQNQVNRLLSNLRRNGIKVTAVH
FT                   NHWLFENPRLMYVHWESIDNPIEFAKKVKRSIAFLG"
FT   gene            complement(646060..646479)
FT                   /locus_tag="Pjdr2_0544"
FT   CDS_pept        complement(646060..646479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0544"
FT                   /product="protein of unknown function LppY and LpqO"
FT                   /note="PFAM: protein of unknown function LppY and LpqO;
FT                   KEGG: mno:Mnod_7991 protein of unknown function LppY and
FT                   LpqO"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99223"
FT                   /db_xref="InterPro:IPR011094"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRE1"
FT                   /inference="protein motif:PFAM:PF07485"
FT                   /protein_id="ACS99223.1"
FT                   /translation="MAQKVKVSPQFTRLCNQFSKILGGESEIEAGPVCFVTRMTNLKET
FT                   ILGRRTRSPLVQMQMFSFESLSASGRALCLGETAVHQNQVNRLMSNLRKRGIKVTSLHN
FT                   HWLNENPRLMYMHWEANMDPVEFAKKTKASIAFLG"
FT   gene            complement(646901..647863)
FT                   /locus_tag="Pjdr2_0545"
FT   CDS_pept        complement(646901..647863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0545"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bsu:BSU03550 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99224"
FT                   /db_xref="GOA:C6CRE2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRE2"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS99224.1"
FT                   /translation="MGHKEMRLPYFLAVLNAVIIGLSFLFAKTALDYASPLDTLAFRFT
FT                   SSFLVMSIPVLFGWIKLSYRGKPLRKVLLLASMYPLGFFTLQGYGLQHANSAEGGILYA
FT                   FTPVVTMIIASMFLKETTTVLQKLSIFLSVFGVVFIFVMKGSSIDLSNLLGISLLLLTC
FT                   FAFAGYTVLARSLSRQFSPAEITYLMMGIGFVFFTVTSLTSHASAGTLSHIFAPLASGT
FT                   FIASLIFLGIVSSLLTALTSNYILSKMEASKMSVFANLSTIVSMTAGAVFLGEEITIYH
FT                   LIGSVLIIAGVIGTNRLGRKKTAGHENSQKLNAVNHSRS"
FT   sig_peptide     complement(647780..647863)
FT                   /locus_tag="Pjdr2_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.631) with cleavage site probability 0.617 at
FT                   residue 28"
FT   gene            648011..649348
FT                   /locus_tag="Pjdr2_0546"
FT   CDS_pept        648011..649348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0546"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99225"
FT                   /db_xref="GOA:C6CRE3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRE3"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACS99225.1"
FT                   /translation="MKKYNLILSDMEEKIRQGKYRPGQKLPSVRIAAEAYGCSISTITR
FT                   AYAELEKRHVIYSVPQSGYYVVVKPGDWRDERDSSMIYFATVLPDLDAFPYLDFQHCLN
FT                   KAIDIYKYDLFTYGDPLGLESFRHTLVSHLASDQVFTKVERIFVTSGAQQALEILAKMP
FT                   FPNGGEAVLLEQPSYDRYLRFLETENIPVHGIARTASGIDLQELEHWFKSGSIKFFYTM
FT                   SRYHNPLGTSYNAEERRTMAKLAGKYGVYILEDDYMADLGADRQLGPIYASDGGEYVIY
FT                   VKSFSKIIFPGLRLGAIVLPERLLKTFYAYKIYPDTSLLSQAALEVYIKNGMYERHKHK
FT                   IAGLYAARMLALNESVKRHNEPGLMEVPDIRSGIYTHFKLKQTVNVEQLLKRLAERNVS
FT                   VVSGKGFYLSNYLDKEKFLRISISQTGPEQIEEGVRIITEEARKGS"
FT   gene            complement(649369..650172)
FT                   /locus_tag="Pjdr2_0547"
FT   CDS_pept        complement(649369..650172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0547"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: bha:BH1906 AraC/XylS family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99226"
FT                   /db_xref="GOA:C6CRE4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRE4"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACS99226.1"
FT                   /translation="MLQLLSVNFDDRIPNWRTQSEVLSYHVLVLVTDGKVKYTINGQEI
FT                   IAERGDFLYIPQSTLRSGDTIPAIPHQKYTVLITTEPGSKLGIPFFDQGEFIRFRLSNL
FT                   HYMQRRFMKLFEEMRGGRSFRSYICLGLTQELVGLLARELEKPEVTPAKMLYAQLVKQY
FT                   LLDHYREHVEIEQLGELIHRSPNYTTALFKEVFGQSPIRYMHQLRLLEACRLLLHSDMT
FT                   VADIAQYLGYYDPSYFFRMFKKHVGLSPSEFITRGRMEDLSQLFP"
FT   gene            650374..651855
FT                   /locus_tag="Pjdr2_0548"
FT   CDS_pept        650374..651855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0548"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: bcs:BCAN_B1216 arylsulfatase
FT                   D precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99227"
FT                   /db_xref="GOA:C6CRE5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRE5"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACS99227.1"
FT                   /translation="MIMRILLLDLDSTRPDHLGCYGYPRQTSPNIDRIAAQGVRFDNYY
FT                   TSDAPCFPSRTALMTGRFGIHNGVVGHGGSAADVRHEGASRDFRDRLASESFPALFRQA
FT                   GMRTALVSPFGERHSAWTFYAGFNEIYNTGKGGMESAEEVTPVVLDWIDRNAEQDNWML
FT                   YVNYWDPHTPYRAPESFGNPFKDDPLPEWITGEVLDKHMRKVGPHSASEINMYDNATSP
FT                   NYPRHPGDIRSRDDLRRMVDGYDCGVRFMDENIGQLFALLEKKGVMEELIIIITADHGE
FT                   NMGELGIYGEHGTADQGTCRIPMIIRWPGMQKGIVDKGLHYHLDLPPTIAELLGRQPMP
FT                   SWDGSSYAKVLQSGEEAGREYLVVSQCAHVCQRSVRFGDWLYIRTYHDGYHLFDKEMLF
FT                   HIAEDPHEQINLAAERQDLCREAVYWLNDWHDRMMTSMPYDTDPLWTVMKEGGPYHAKG
FT                   SLPRYLKRLEQTGRGDAVPELIRRHPREIEGKDKL"
FT   gene            complement(652171..653412)
FT                   /locus_tag="Pjdr2_0549"
FT   CDS_pept        complement(652171..653412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0549"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   pin:Ping_2763 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99228"
FT                   /db_xref="GOA:C6CRE6"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRE6"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACS99228.1"
FT                   /translation="MNYIKDLLVDLGVNTNLAVYLASIAIVIIAGIVSIAANFVTKKVV
FT                   LRIVSHYIRNNRYRWDNYLLDRKVFHKLSHIVPAIILYYFSFSFSAYHSLILKGITIYL
FT                   IIVVLLVLDAFLNAVNDIYRTYDISRSRPIKGYVQVVKIFLFIIGGILAISNLIGESPV
FT                   ILISGIGALSAVMLLIFKDSLLGLVAGIQLSTNDMVQVGDWIEMPKYGADGDIIDISLH
FT                   TVKVQNFDKTITTIPSYALISDSFKNWRGMQDAGGRRIKRAVYIDMNSIAFCTPEMIEK
FT                   FKKIHLLSEYILDKEREIIHYNLENEIDPTVSVNGRAMTNIGVFRAYVERYVEQHPKIH
FT                   KGMTRIVRQLAPAENGLPLEIYAFTNDISWAVYEGVQSDIFDHVLAVAPEFGLHVFQNP
FT                   SGQDFKSLPKVGAY"
FT   gene            653589..654185
FT                   /locus_tag="Pjdr2_0550"
FT   CDS_pept        653589..654185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0550"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   slo:Shew_1744 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99229"
FT                   /db_xref="GOA:C6CRE7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRE7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACS99229.1"
FT                   /translation="MKFRTNLTLENRKVILLPLQAEHVKELAGLLSDPRVWEMTWRRNN
FT                   TEQAIELALESALVSRDAGTQLPFAIIDKASGSMVGTTRLGDLDANNRNVEIGWTWMAP
FT                   DFWGQGINPACKLLLLQYSFEELGVIRVQFSASGSNLRSQRALEKIGAVREGVLRRHRV
FT                   DATDGGTVHDNVFYSILEEEWPLVREKLLHEMNLF"
FT   gene            654281..655432
FT                   /locus_tag="Pjdr2_0551"
FT   CDS_pept        654281..655432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0551"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99230"
FT                   /db_xref="GOA:C6CRE8"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRE8"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACS99230.1"
FT                   /translation="MNLSLIQPEWKVEKIEVATLTGERARNAGSNGRLGNHGKHCSVRI
FT                   ARLTIDGDTGFGHTGSMTEELAEAVLGMRLIDLFDLNGRILEPYRIPLEYPILDWLGRR
FT                   LNTPVYELVSAVNRAPGSPLVVPCYDTSLYFDDLHLANERDAVALLKEEAAQGFSKGHR
FT                   NFKIKVGRGGRHMPVLEGTKRDIAIIHGVAEIAGPEGKIMIDANNAYNLNLTKEVLAAV
FT                   QDVNLHWIEEAFHEDDALYADLKAWLRERGQNVLIADGEGLASPHLVSWAKKGLVDVLQ
FT                   YDVIYPGFTHWLELGAELDQAGLRSAPHCYGNAYGIYALGHIAAAINNFEFVEYDDIAI
FT                   EGMDTSAYRVEDGKFYVPEKAGFGLEFEGELFARQVLENGWSR"
FT   gene            655587..656516
FT                   /locus_tag="Pjdr2_0552"
FT   CDS_pept        655587..656516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0552"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: reu:Reut_B5462 esterase/lipase/thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99231"
FT                   /db_xref="GOA:C6CRE9"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRE9"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACS99231.1"
FT                   /translation="MKMPEATKRFLEDIAGFPPLHLLSPEEIRKVVVANAISDRVELAG
FT                   TEDITLEGPHGPLPVRIYRPSNRPALPAIVFFHGGGFVFNRMGHYDPMCGKLAAATDHA
FT                   VISVDYRLAPEHKFPVPVEEAVYAAEWVYRQASSLGLDPERIAVAGESVGGNLAAIVAQ
FT                   QAVSRGTFSVAAQILLCPLTDWAGDYASKRIYGEGYFLDSALLEYCAGHYLNSDVDRAN
FT                   PLASPLYGDTAGVAPAIVVTAEYDPLRDEGELYSQRLIASGAEVTHKRYAGMIHLFYAL
FT                   TDVFEDGHDVYALINQVLGRLYKGTIAS"
FT   gene            complement(656531..656893)
FT                   /locus_tag="Pjdr2_0553"
FT   CDS_pept        complement(656531..656893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0553"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   geo:Geob_0974 transcriptional regulator, HxlR family"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99232"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRF0"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACS99232.1"
FT                   /translation="MNEFEEMESPCHYRRALEIVSSKWTVLVFYELESGKRRYSDLKRR
FT                   VEGVTQKMLTQTLRQLERDGLVVRYVHPTVPPTVEYELTPLGQTLIGPMRILHQWTDAH
FT                   YDSVLRARKAFDAITS"
FT   gene            657038..657946
FT                   /locus_tag="Pjdr2_0554"
FT   CDS_pept        657038..657946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0554"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix type 11 domain protein; KEGG:
FT                   bsu:BSU19100 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99233"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR028349"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRF1"
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /protein_id="ACS99233.1"
FT                   /translation="MKLERLISIIYKLLNNDVLPANALAEEFQVSQRTIYRDIDVICAA
FT                   GFPVVSYQGNKGGFGMLEGFKMDKSLLGSYDVNALVTVLKGLSTVFEDERAQGTIERLQ
FT                   TVGTEQRTPSLAVDFETRRSDPETLPLLRAAITERKVIRFDYINAKNERTTRELEPVRL
FT                   HFKYGSWYIYGYCLTRCDYREFRLSRMVEALQTERCFEPHKEVPEEAGPSVGDSSLVED
FT                   VVVRVGPEALADAMDHFGYVPKTFHSDGGMTMRIPVYKPAEAAWLWSILLGFGSGAEVL
FT                   EPLELRAVMKKQLQMTLNLYE"
FT   gene            658017..658541
FT                   /locus_tag="Pjdr2_0555"
FT   CDS_pept        658017..658541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0555"
FT                   /product="DinB family protein"
FT                   /note="PFAM: DinB family protein; KEGG: bha:BH3115 nuclease
FT                   inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99234"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRF2"
FT                   /inference="protein motif:PFAM:PF05163"
FT                   /protein_id="ACS99234.1"
FT                   /translation="MKNYPAEILNYHFWANQTILGRIKELPPAVLHQEVNSSYPTLAHA
FT                   LNHIYAVDKMWYLVLSGTDMGTALQECMPLSGRILGTVDDYIQLFAELAGQFKEWLGSG
FT                   SDAEQVITLNNPYAGVRETSLAEIMLHTANHGTYHRGNVSTMLRQLGYASTMTDYILYL
FT                   YRQPETVTAVS"
FT   gene            complement(658612..659580)
FT                   /locus_tag="Pjdr2_0556"
FT   CDS_pept        complement(658612..659580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0556"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   bar:GBAA0176 alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99235"
FT                   /db_xref="GOA:C6CRF3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRF3"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACS99235.1"
FT                   /translation="MKAIVCEKYGTPEVLRFKDVEIPDPKEQEIRVKVYAAVVTPSDCS
FT                   FRRADPFFIRFLYGLRNPKHPILGVEFAGEVDSVGKDVTLFKKGDQVFGISPHRFGTYA
FT                   EYVCLPENQPVFLKPNNAAYDEAAGLCDGALTALIFLRDHAKIQTGQKVLINGASGAVG
FT                   AYALQLAKYYGAEVTGVCSSRNFELAKSLGADTVIDYTKEDFTRGDQTYDVIFDAVGKR
FT                   TYPECKGSLTPQGIYLSTVPTGGAMLSMLWTSRSRGKKAIFTAAGLKQKKENLAFLKEL
FT                   FEAEKIKSVIDRRYPLEQTIEAHRYVETGRKKGNVILHVSS"
FT   gene            660003..661256
FT                   /locus_tag="Pjdr2_0557"
FT   CDS_pept        660003..661256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0557"
FT                   /product="urea ABC transporter, urea binding protein"
FT                   /note="TIGRFAM: urea ABC transporter, urea binding protein;
FT                   PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bha:BH0251 ABC transporter (substrate-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99236"
FT                   /db_xref="GOA:C6CRF4"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR017777"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRF4"
FT                   /inference="protein motif:TFAM:TIGR03407"
FT                   /protein_id="ACS99236.1"
FT                   /translation="MKKKWFYQTGLVAVVLSMLLAACGNNNEKPASTTTESSGAEASGD
FT                   TIKVGVLHSLSGTMAISEVSVRDAEMMAIEEINAAGGVLGKKIEAIQEDGASDWPTFAE
FT                   KARKLLSEDKVATVFGGWTSSSRKAMKPVFEELNGLLWYPVQYEGLEASPNIFYTGATT
FT                   NQQIVPAVDWLLENRGKKFYLLGSDYVFPRTANLIIKEQLKAKGGEMVGEEYTPLGHTD
FT                   YSTIISKIKEAKPDVVFNTLNGDSNVAFFKQLKDAGISAKDITTLSVSVAEEEIRGIGV
FT                   DVLQGHLAAWNYYQTTDTPANKTFVENYKKKYGEDRVTADPIEAGYTAVYLWKAAVEKA
FT                   GSTDVDKVKAAAKDLEWDAPEGKVKIDGENQHIYKTVRIGEVQADGQFKELWNSGDAVM
FT                   PDPFLKGYDWAASIKPTD"
FT   sig_peptide     660003..660077
FT                   /locus_tag="Pjdr2_0557"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.379 at
FT                   residue 25"
FT   gene            661359..662264
FT                   /locus_tag="Pjdr2_0558"
FT   CDS_pept        661359..662264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0558"
FT                   /product="urea ABC transporter, permease protein UrtB"
FT                   /note="TIGRFAM: urea ABC transporter, permease protein
FT                   UrtB; PFAM: inner-membrane translocator; KEGG: bha:BH0250
FT                   ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99237"
FT                   /db_xref="GOA:C6CRF5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017779"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRF5"
FT                   /inference="protein motif:TFAM:TIGR03409"
FT                   /protein_id="ACS99237.1"
FT                   /translation="MEVITLQLFNGLSVSSILLLIALGLAITFGLMKVINMAHGELIMI
FT                   GAYSTYLTQNMFKDYLPKSMFDWYFALAIPVSFLIAFLFGLILEMSLIRFLYGRPLDSL
FT                   LATWGVGLVLQQLARSIFGAPNVAVTSPTWLDGGVSFLGAVLPYKRLFIIGLVIVTLLA
FT                   MYFYIYRSLEGRRMRAVMQNRDMAACLGVSTRRVDAMTFAIGSGIAGIAGCALTLIGPI
FT                   GPSLGTYYIVDAFMVVVLGGVGKLVGTVLGALGIGVFNTMFEYWTNASLGKVLVFICIV
FT                   AFLQWRPMGFVAMRSRSLDS"
FT   gene            662283..663377
FT                   /locus_tag="Pjdr2_0559"
FT   CDS_pept        662283..663377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pjdr2_0559"
FT                   /product="urea ABC transporter, permease protein UrtC"
FT                   /note="TIGRFAM: urea ABC transporter, permease protein
FT                   UrtC; PFAM: inner-membrane translocator; KEGG: bha:BH0249
FT                   ABC transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Pjdr2_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACS99238"
FT                   /db_xref="GOA:C6CRF6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR017778"
FT                   /db_xref="UniProtKB/TrEMBL:C6CRF6"
FT                   /inference="protein motif:TFAM:TIGR03408"
FT                   /prote