(data stored in SCRATCH3701 zone)

EMBL: CP001657

ID   CP001657; SV 1; circular; genomic DNA; STD; PRO; 4862913 BP.
XX
AC   CP001657;
XX
PR   Project:PRJNA31289;
XX
DT   08-JUL-2009 (Rel. 101, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Pectobacterium carotovorum subsp. carotovorum PC1, complete genome.
XX
KW   .
XX
OS   Pectobacterium carotovorum subsp. carotovorum PC1
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Pectobacteriaceae; Pectobacterium.
XX
RN   [1]
RP   1-4862913
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Munk A.C., Brettin T., Detter J.C., Han C.,
RA   Tapia R., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Balakrishnan V., Glasner J., Perna N.T.;
RT   "Complete sequence of Pectobacterium carotovorum subsp. carotovorum PC1";
RL   Unpublished.
XX
RN   [2]
RP   1-4862913
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Munk A.C., Brettin T., Detter J.C., Han C.,
RA   Tapia R., Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N.,
RA   Balakrishnan V., Glasner J., Perna N.T.;
RT   ;
RL   Submitted (01-JUL-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B310, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 098681dde1ca476db1ca96f487559cbc.
DR   BioSample; SAMN02598478.
DR   EnsemblGenomes-Gn; EBG00001150439.
DR   EnsemblGenomes-Gn; EBG00001150440.
DR   EnsemblGenomes-Gn; EBG00001150441.
DR   EnsemblGenomes-Gn; EBG00001150442.
DR   EnsemblGenomes-Gn; EBG00001150443.
DR   EnsemblGenomes-Gn; EBG00001150444.
DR   EnsemblGenomes-Gn; EBG00001150445.
DR   EnsemblGenomes-Gn; EBG00001150446.
DR   EnsemblGenomes-Gn; EBG00001150447.
DR   EnsemblGenomes-Gn; EBG00001150448.
DR   EnsemblGenomes-Gn; EBG00001150449.
DR   EnsemblGenomes-Gn; EBG00001150450.
DR   EnsemblGenomes-Gn; EBG00001150451.
DR   EnsemblGenomes-Gn; EBG00001150452.
DR   EnsemblGenomes-Gn; EBG00001150453.
DR   EnsemblGenomes-Gn; EBG00001150454.
DR   EnsemblGenomes-Gn; EBG00001150455.
DR   EnsemblGenomes-Gn; EBG00001150456.
DR   EnsemblGenomes-Gn; EBG00001150457.
DR   EnsemblGenomes-Gn; EBG00001150458.
DR   EnsemblGenomes-Gn; EBG00001150459.
DR   EnsemblGenomes-Gn; EBG00001150460.
DR   EnsemblGenomes-Gn; EBG00001150461.
DR   EnsemblGenomes-Gn; EBG00001150462.
DR   EnsemblGenomes-Gn; EBG00001150463.
DR   EnsemblGenomes-Gn; EBG00001150464.
DR   EnsemblGenomes-Gn; EBG00001150465.
DR   EnsemblGenomes-Gn; EBG00001150466.
DR   EnsemblGenomes-Gn; EBG00001150467.
DR   EnsemblGenomes-Gn; EBG00001150468.
DR   EnsemblGenomes-Gn; EBG00001150469.
DR   EnsemblGenomes-Gn; EBG00001150470.
DR   EnsemblGenomes-Gn; EBG00001150471.
DR   EnsemblGenomes-Gn; EBG00001150472.
DR   EnsemblGenomes-Gn; EBG00001150473.
DR   EnsemblGenomes-Gn; EBG00001150474.
DR   EnsemblGenomes-Gn; EBG00001150475.
DR   EnsemblGenomes-Gn; EBG00001150476.
DR   EnsemblGenomes-Gn; EBG00001150477.
DR   EnsemblGenomes-Gn; EBG00001150478.
DR   EnsemblGenomes-Gn; EBG00001150479.
DR   EnsemblGenomes-Gn; EBG00001150480.
DR   EnsemblGenomes-Gn; EBG00001150481.
DR   EnsemblGenomes-Gn; EBG00001150482.
DR   EnsemblGenomes-Gn; EBG00001150483.
DR   EnsemblGenomes-Gn; EBG00001150484.
DR   EnsemblGenomes-Gn; EBG00001150485.
DR   EnsemblGenomes-Gn; EBG00001150486.
DR   EnsemblGenomes-Gn; EBG00001150487.
DR   EnsemblGenomes-Gn; EBG00001150488.
DR   EnsemblGenomes-Gn; EBG00001150489.
DR   EnsemblGenomes-Gn; EBG00001150490.
DR   EnsemblGenomes-Gn; EBG00001150491.
DR   EnsemblGenomes-Gn; EBG00001150492.
DR   EnsemblGenomes-Gn; EBG00001150493.
DR   EnsemblGenomes-Gn; EBG00001150494.
DR   EnsemblGenomes-Gn; EBG00001150495.
DR   EnsemblGenomes-Gn; EBG00001150496.
DR   EnsemblGenomes-Gn; EBG00001150497.
DR   EnsemblGenomes-Gn; EBG00001150498.
DR   EnsemblGenomes-Gn; EBG00001150499.
DR   EnsemblGenomes-Gn; EBG00001150500.
DR   EnsemblGenomes-Gn; EBG00001150501.
DR   EnsemblGenomes-Gn; EBG00001150502.
DR   EnsemblGenomes-Gn; EBG00001150503.
DR   EnsemblGenomes-Gn; EBG00001150504.
DR   EnsemblGenomes-Gn; EBG00001150505.
DR   EnsemblGenomes-Gn; EBG00001150506.
DR   EnsemblGenomes-Gn; EBG00001150507.
DR   EnsemblGenomes-Gn; EBG00001150508.
DR   EnsemblGenomes-Gn; EBG00001150509.
DR   EnsemblGenomes-Gn; EBG00001150510.
DR   EnsemblGenomes-Gn; EBG00001150511.
DR   EnsemblGenomes-Gn; EBG00001150512.
DR   EnsemblGenomes-Gn; EBG00001150513.
DR   EnsemblGenomes-Gn; EBG00001150514.
DR   EnsemblGenomes-Gn; EBG00001150515.
DR   EnsemblGenomes-Gn; EBG00001150516.
DR   EnsemblGenomes-Gn; EBG00001150517.
DR   EnsemblGenomes-Gn; EBG00001150518.
DR   EnsemblGenomes-Gn; EBG00001150519.
DR   EnsemblGenomes-Gn; EBG00001150520.
DR   EnsemblGenomes-Gn; EBG00001150521.
DR   EnsemblGenomes-Gn; EBG00001150522.
DR   EnsemblGenomes-Gn; EBG00001150523.
DR   EnsemblGenomes-Gn; EBG00001150524.
DR   EnsemblGenomes-Gn; EBG00001150525.
DR   EnsemblGenomes-Gn; EBG00001150526.
DR   EnsemblGenomes-Gn; EBG00001150527.
DR   EnsemblGenomes-Gn; EBG00001150528.
DR   EnsemblGenomes-Gn; EBG00001150529.
DR   EnsemblGenomes-Gn; EBG00001150530.
DR   EnsemblGenomes-Gn; EBG00001150531.
DR   EnsemblGenomes-Gn; EBG00001150532.
DR   EnsemblGenomes-Gn; EBG00001150533.
DR   EnsemblGenomes-Gn; EBG00001150534.
DR   EnsemblGenomes-Gn; EBG00001150535.
DR   EnsemblGenomes-Gn; EBG00001150536.
DR   EnsemblGenomes-Gn; EBG00001150537.
DR   EnsemblGenomes-Gn; EBG00001150538.
DR   EnsemblGenomes-Gn; EBG00001150539.
DR   EnsemblGenomes-Gn; EBG00001150540.
DR   EnsemblGenomes-Gn; EBG00001150541.
DR   EnsemblGenomes-Gn; EBG00001150542.
DR   EnsemblGenomes-Gn; EBG00001150543.
DR   EnsemblGenomes-Gn; EBG00001150544.
DR   EnsemblGenomes-Gn; EBG00001150545.
DR   EnsemblGenomes-Gn; EBG00001150546.
DR   EnsemblGenomes-Gn; EBG00001150547.
DR   EnsemblGenomes-Gn; EBG00001150548.
DR   EnsemblGenomes-Gn; EBG00001150549.
DR   EnsemblGenomes-Gn; EBG00001150550.
DR   EnsemblGenomes-Gn; EBG00001150551.
DR   EnsemblGenomes-Gn; EBG00001150552.
DR   EnsemblGenomes-Gn; EBG00001150553.
DR   EnsemblGenomes-Gn; EBG00001150554.
DR   EnsemblGenomes-Gn; EBG00001150555.
DR   EnsemblGenomes-Gn; EBG00001150556.
DR   EnsemblGenomes-Gn; EBG00001150557.
DR   EnsemblGenomes-Gn; EBG00001150558.
DR   EnsemblGenomes-Gn; EBG00001150559.
DR   EnsemblGenomes-Gn; EBG00001150560.
DR   EnsemblGenomes-Gn; EBG00001150561.
DR   EnsemblGenomes-Gn; EBG00001150562.
DR   EnsemblGenomes-Gn; EBG00001150563.
DR   EnsemblGenomes-Gn; EBG00001150564.
DR   EnsemblGenomes-Gn; EBG00001150565.
DR   EnsemblGenomes-Gn; EBG00001150566.
DR   EnsemblGenomes-Gn; EBG00001150567.
DR   EnsemblGenomes-Gn; EBG00001150568.
DR   EnsemblGenomes-Gn; EBG00001150569.
DR   EnsemblGenomes-Gn; EBG00001150570.
DR   EnsemblGenomes-Gn; EBG00001150571.
DR   EnsemblGenomes-Gn; EBG00001150572.
DR   EnsemblGenomes-Gn; EBG00001150573.
DR   EnsemblGenomes-Gn; EBG00001150574.
DR   EnsemblGenomes-Gn; EBG00001150575.
DR   EnsemblGenomes-Gn; EBG00001150576.
DR   EnsemblGenomes-Gn; EBG00001150577.
DR   EnsemblGenomes-Gn; EBG00001150578.
DR   EnsemblGenomes-Gn; EBG00001150579.
DR   EnsemblGenomes-Gn; EBG00001150580.
DR   EnsemblGenomes-Gn; EBG00001150581.
DR   EnsemblGenomes-Gn; EBG00001150582.
DR   EnsemblGenomes-Gn; EBG00001150583.
DR   EnsemblGenomes-Gn; EBG00001150584.
DR   EnsemblGenomes-Gn; EBG00001150585.
DR   EnsemblGenomes-Gn; EBG00001150586.
DR   EnsemblGenomes-Gn; EBG00001150587.
DR   EnsemblGenomes-Gn; EBG00001150588.
DR   EnsemblGenomes-Gn; EBG00001150589.
DR   EnsemblGenomes-Gn; EBG00001150590.
DR   EnsemblGenomes-Gn; EBG00001150591.
DR   EnsemblGenomes-Gn; EBG00001150592.
DR   EnsemblGenomes-Gn; EBG00001150593.
DR   EnsemblGenomes-Gn; PC1_R0001.
DR   EnsemblGenomes-Gn; PC1_R0002.
DR   EnsemblGenomes-Gn; PC1_R0003.
DR   EnsemblGenomes-Gn; PC1_R0004.
DR   EnsemblGenomes-Gn; PC1_R0005.
DR   EnsemblGenomes-Gn; PC1_R0006.
DR   EnsemblGenomes-Gn; PC1_R0007.
DR   EnsemblGenomes-Gn; PC1_R0008.
DR   EnsemblGenomes-Gn; PC1_R0009.
DR   EnsemblGenomes-Gn; PC1_R0010.
DR   EnsemblGenomes-Gn; PC1_R0011.
DR   EnsemblGenomes-Gn; PC1_R0012.
DR   EnsemblGenomes-Gn; PC1_R0013.
DR   EnsemblGenomes-Gn; PC1_R0014.
DR   EnsemblGenomes-Gn; PC1_R0015.
DR   EnsemblGenomes-Gn; PC1_R0016.
DR   EnsemblGenomes-Gn; PC1_R0017.
DR   EnsemblGenomes-Gn; PC1_R0018.
DR   EnsemblGenomes-Gn; PC1_R0019.
DR   EnsemblGenomes-Gn; PC1_R0020.
DR   EnsemblGenomes-Gn; PC1_R0021.
DR   EnsemblGenomes-Gn; PC1_R0022.
DR   EnsemblGenomes-Gn; PC1_R0023.
DR   EnsemblGenomes-Gn; PC1_R0024.
DR   EnsemblGenomes-Gn; PC1_R0025.
DR   EnsemblGenomes-Gn; PC1_R0026.
DR   EnsemblGenomes-Gn; PC1_R0027.
DR   EnsemblGenomes-Gn; PC1_R0028.
DR   EnsemblGenomes-Gn; PC1_R0029.
DR   EnsemblGenomes-Gn; PC1_R0030.
DR   EnsemblGenomes-Gn; PC1_R0031.
DR   EnsemblGenomes-Gn; PC1_R0032.
DR   EnsemblGenomes-Gn; PC1_R0033.
DR   EnsemblGenomes-Gn; PC1_R0034.
DR   EnsemblGenomes-Gn; PC1_R0035.
DR   EnsemblGenomes-Gn; PC1_R0036.
DR   EnsemblGenomes-Gn; PC1_R0037.
DR   EnsemblGenomes-Gn; PC1_R0038.
DR   EnsemblGenomes-Gn; PC1_R0039.
DR   EnsemblGenomes-Gn; PC1_R0040.
DR   EnsemblGenomes-Gn; PC1_R0041.
DR   EnsemblGenomes-Gn; PC1_R0042.
DR   EnsemblGenomes-Gn; PC1_R0043.
DR   EnsemblGenomes-Gn; PC1_R0044.
DR   EnsemblGenomes-Gn; PC1_R0045.
DR   EnsemblGenomes-Gn; PC1_R0046.
DR   EnsemblGenomes-Gn; PC1_R0047.
DR   EnsemblGenomes-Gn; PC1_R0048.
DR   EnsemblGenomes-Gn; PC1_R0049.
DR   EnsemblGenomes-Gn; PC1_R0050.
DR   EnsemblGenomes-Gn; PC1_R0051.
DR   EnsemblGenomes-Gn; PC1_R0052.
DR   EnsemblGenomes-Gn; PC1_R0053.
DR   EnsemblGenomes-Gn; PC1_R0054.
DR   EnsemblGenomes-Gn; PC1_R0055.
DR   EnsemblGenomes-Gn; PC1_R0056.
DR   EnsemblGenomes-Gn; PC1_R0057.
DR   EnsemblGenomes-Gn; PC1_R0058.
DR   EnsemblGenomes-Gn; PC1_R0059.
DR   EnsemblGenomes-Gn; PC1_R0060.
DR   EnsemblGenomes-Gn; PC1_R0061.
DR   EnsemblGenomes-Gn; PC1_R0062.
DR   EnsemblGenomes-Gn; PC1_R0063.
DR   EnsemblGenomes-Gn; PC1_R0064.
DR   EnsemblGenomes-Gn; PC1_R0065.
DR   EnsemblGenomes-Gn; PC1_R0066.
DR   EnsemblGenomes-Gn; PC1_R0067.
DR   EnsemblGenomes-Gn; PC1_R0068.
DR   EnsemblGenomes-Gn; PC1_R0069.
DR   EnsemblGenomes-Gn; PC1_R0070.
DR   EnsemblGenomes-Gn; PC1_R0071.
DR   EnsemblGenomes-Gn; PC1_R0072.
DR   EnsemblGenomes-Gn; PC1_R0073.
DR   EnsemblGenomes-Gn; PC1_R0074.
DR   EnsemblGenomes-Gn; PC1_R0075.
DR   EnsemblGenomes-Gn; PC1_R0076.
DR   EnsemblGenomes-Gn; PC1_R0077.
DR   EnsemblGenomes-Gn; PC1_R0078.
DR   EnsemblGenomes-Gn; PC1_R0079.
DR   EnsemblGenomes-Gn; PC1_R0080.
DR   EnsemblGenomes-Gn; PC1_R0081.
DR   EnsemblGenomes-Gn; PC1_R0082.
DR   EnsemblGenomes-Gn; PC1_R0083.
DR   EnsemblGenomes-Gn; PC1_R0084.
DR   EnsemblGenomes-Gn; PC1_R0085.
DR   EnsemblGenomes-Gn; PC1_R0086.
DR   EnsemblGenomes-Gn; PC1_R0087.
DR   EnsemblGenomes-Gn; PC1_R0088.
DR   EnsemblGenomes-Gn; PC1_R0089.
DR   EnsemblGenomes-Gn; PC1_R0090.
DR   EnsemblGenomes-Gn; PC1_R0091.
DR   EnsemblGenomes-Gn; PC1_R0092.
DR   EnsemblGenomes-Gn; PC1_R0093.
DR   EnsemblGenomes-Gn; PC1_R0094.
DR   EnsemblGenomes-Gn; PC1_R0095.
DR   EnsemblGenomes-Gn; PC1_R0096.
DR   EnsemblGenomes-Gn; PC1_R0097.
DR   EnsemblGenomes-Gn; PC1_R0098.
DR   EnsemblGenomes-Gn; PC1_R0099.
DR   EnsemblGenomes-Gn; PC1_R0100.
DR   EnsemblGenomes-Gn; PC1_R0101.
DR   EnsemblGenomes-Gn; PC1_R0102.
DR   EnsemblGenomes-Gn; PC1_R0103.
DR   EnsemblGenomes-Tr; EBT00001566676.
DR   EnsemblGenomes-Tr; EBT00001566677.
DR   EnsemblGenomes-Tr; EBT00001566678.
DR   EnsemblGenomes-Tr; EBT00001566679.
DR   EnsemblGenomes-Tr; EBT00001566680.
DR   EnsemblGenomes-Tr; EBT00001566681.
DR   EnsemblGenomes-Tr; EBT00001566682.
DR   EnsemblGenomes-Tr; EBT00001566683.
DR   EnsemblGenomes-Tr; EBT00001566685.
DR   EnsemblGenomes-Tr; EBT00001566687.
DR   EnsemblGenomes-Tr; EBT00001566689.
DR   EnsemblGenomes-Tr; EBT00001566693.
DR   EnsemblGenomes-Tr; EBT00001566694.
DR   EnsemblGenomes-Tr; EBT00001566697.
DR   EnsemblGenomes-Tr; EBT00001566699.
DR   EnsemblGenomes-Tr; EBT00001566701.
DR   EnsemblGenomes-Tr; EBT00001566702.
DR   EnsemblGenomes-Tr; EBT00001566703.
DR   EnsemblGenomes-Tr; EBT00001566704.
DR   EnsemblGenomes-Tr; EBT00001566705.
DR   EnsemblGenomes-Tr; EBT00001566706.
DR   EnsemblGenomes-Tr; EBT00001566708.
DR   EnsemblGenomes-Tr; EBT00001566709.
DR   EnsemblGenomes-Tr; EBT00001566710.
DR   EnsemblGenomes-Tr; EBT00001566711.
DR   EnsemblGenomes-Tr; EBT00001566712.
DR   EnsemblGenomes-Tr; EBT00001566713.
DR   EnsemblGenomes-Tr; EBT00001566715.
DR   EnsemblGenomes-Tr; EBT00001566717.
DR   EnsemblGenomes-Tr; EBT00001566718.
DR   EnsemblGenomes-Tr; EBT00001566719.
DR   EnsemblGenomes-Tr; EBT00001566720.
DR   EnsemblGenomes-Tr; EBT00001566721.
DR   EnsemblGenomes-Tr; EBT00001566723.
DR   EnsemblGenomes-Tr; EBT00001566725.
DR   EnsemblGenomes-Tr; EBT00001566726.
DR   EnsemblGenomes-Tr; EBT00001566727.
DR   EnsemblGenomes-Tr; EBT00001566728.
DR   EnsemblGenomes-Tr; EBT00001566729.
DR   EnsemblGenomes-Tr; EBT00001566730.
DR   EnsemblGenomes-Tr; EBT00001566732.
DR   EnsemblGenomes-Tr; EBT00001566734.
DR   EnsemblGenomes-Tr; EBT00001566736.
DR   EnsemblGenomes-Tr; EBT00001566738.
DR   EnsemblGenomes-Tr; EBT00001566740.
DR   EnsemblGenomes-Tr; EBT00001566741.
DR   EnsemblGenomes-Tr; EBT00001566742.
DR   EnsemblGenomes-Tr; EBT00001566744.
DR   EnsemblGenomes-Tr; EBT00001566747.
DR   EnsemblGenomes-Tr; EBT00001566750.
DR   EnsemblGenomes-Tr; EBT00001566752.
DR   EnsemblGenomes-Tr; EBT00001566754.
DR   EnsemblGenomes-Tr; EBT00001566755.
DR   EnsemblGenomes-Tr; EBT00001566756.
DR   EnsemblGenomes-Tr; EBT00001566757.
DR   EnsemblGenomes-Tr; EBT00001566759.
DR   EnsemblGenomes-Tr; EBT00001566762.
DR   EnsemblGenomes-Tr; EBT00001566764.
DR   EnsemblGenomes-Tr; EBT00001566765.
DR   EnsemblGenomes-Tr; EBT00001566766.
DR   EnsemblGenomes-Tr; EBT00001566768.
DR   EnsemblGenomes-Tr; EBT00001566770.
DR   EnsemblGenomes-Tr; EBT00001566772.
DR   EnsemblGenomes-Tr; EBT00001566773.
DR   EnsemblGenomes-Tr; EBT00001566774.
DR   EnsemblGenomes-Tr; EBT00001566775.
DR   EnsemblGenomes-Tr; EBT00001566776.
DR   EnsemblGenomes-Tr; EBT00001566777.
DR   EnsemblGenomes-Tr; EBT00001566778.
DR   EnsemblGenomes-Tr; EBT00001566779.
DR   EnsemblGenomes-Tr; EBT00001566780.
DR   EnsemblGenomes-Tr; EBT00001566782.
DR   EnsemblGenomes-Tr; EBT00001566784.
DR   EnsemblGenomes-Tr; EBT00001566786.
DR   EnsemblGenomes-Tr; EBT00001566788.
DR   EnsemblGenomes-Tr; EBT00001566789.
DR   EnsemblGenomes-Tr; EBT00001566790.
DR   EnsemblGenomes-Tr; EBT00001566791.
DR   EnsemblGenomes-Tr; EBT00001566792.
DR   EnsemblGenomes-Tr; EBT00001566793.
DR   EnsemblGenomes-Tr; EBT00001566794.
DR   EnsemblGenomes-Tr; EBT00001566795.
DR   EnsemblGenomes-Tr; EBT00001566796.
DR   EnsemblGenomes-Tr; EBT00001566797.
DR   EnsemblGenomes-Tr; EBT00001566799.
DR   EnsemblGenomes-Tr; EBT00001566800.
DR   EnsemblGenomes-Tr; EBT00001566802.
DR   EnsemblGenomes-Tr; EBT00001566804.
DR   EnsemblGenomes-Tr; EBT00001566806.
DR   EnsemblGenomes-Tr; EBT00001566808.
DR   EnsemblGenomes-Tr; EBT00001566810.
DR   EnsemblGenomes-Tr; EBT00001566811.
DR   EnsemblGenomes-Tr; EBT00001566812.
DR   EnsemblGenomes-Tr; EBT00001566814.
DR   EnsemblGenomes-Tr; EBT00001566816.
DR   EnsemblGenomes-Tr; EBT00001566817.
DR   EnsemblGenomes-Tr; EBT00001566818.
DR   EnsemblGenomes-Tr; EBT00001566820.
DR   EnsemblGenomes-Tr; EBT00001566821.
DR   EnsemblGenomes-Tr; EBT00001566822.
DR   EnsemblGenomes-Tr; EBT00001566824.
DR   EnsemblGenomes-Tr; EBT00001566825.
DR   EnsemblGenomes-Tr; EBT00001566826.
DR   EnsemblGenomes-Tr; EBT00001566827.
DR   EnsemblGenomes-Tr; EBT00001566829.
DR   EnsemblGenomes-Tr; EBT00001566831.
DR   EnsemblGenomes-Tr; EBT00001566832.
DR   EnsemblGenomes-Tr; EBT00001566834.
DR   EnsemblGenomes-Tr; EBT00001566837.
DR   EnsemblGenomes-Tr; EBT00001566838.
DR   EnsemblGenomes-Tr; EBT00001566841.
DR   EnsemblGenomes-Tr; EBT00001566844.
DR   EnsemblGenomes-Tr; EBT00001566845.
DR   EnsemblGenomes-Tr; EBT00001566847.
DR   EnsemblGenomes-Tr; EBT00001566849.
DR   EnsemblGenomes-Tr; EBT00001566850.
DR   EnsemblGenomes-Tr; EBT00001566851.
DR   EnsemblGenomes-Tr; EBT00001566854.
DR   EnsemblGenomes-Tr; EBT00001566855.
DR   EnsemblGenomes-Tr; EBT00001566856.
DR   EnsemblGenomes-Tr; EBT00001566857.
DR   EnsemblGenomes-Tr; EBT00001566858.
DR   EnsemblGenomes-Tr; EBT00001566860.
DR   EnsemblGenomes-Tr; EBT00001566862.
DR   EnsemblGenomes-Tr; EBT00001566864.
DR   EnsemblGenomes-Tr; EBT00001566865.
DR   EnsemblGenomes-Tr; EBT00001566866.
DR   EnsemblGenomes-Tr; EBT00001566867.
DR   EnsemblGenomes-Tr; EBT00001566868.
DR   EnsemblGenomes-Tr; EBT00001566869.
DR   EnsemblGenomes-Tr; EBT00001566870.
DR   EnsemblGenomes-Tr; EBT00001566871.
DR   EnsemblGenomes-Tr; EBT00001566872.
DR   EnsemblGenomes-Tr; EBT00001566873.
DR   EnsemblGenomes-Tr; EBT00001566874.
DR   EnsemblGenomes-Tr; EBT00001566877.
DR   EnsemblGenomes-Tr; EBT00001566878.
DR   EnsemblGenomes-Tr; EBT00001566879.
DR   EnsemblGenomes-Tr; EBT00001566880.
DR   EnsemblGenomes-Tr; EBT00001566881.
DR   EnsemblGenomes-Tr; EBT00001566882.
DR   EnsemblGenomes-Tr; EBT00001566883.
DR   EnsemblGenomes-Tr; EBT00001566884.
DR   EnsemblGenomes-Tr; EBT00001566885.
DR   EnsemblGenomes-Tr; EBT00001566886.
DR   EnsemblGenomes-Tr; EBT00001566887.
DR   EnsemblGenomes-Tr; EBT00001566891.
DR   EnsemblGenomes-Tr; EBT00001566892.
DR   EnsemblGenomes-Tr; EBT00001566893.
DR   EnsemblGenomes-Tr; EBT00001566894.
DR   EnsemblGenomes-Tr; EBT00001566895.
DR   EnsemblGenomes-Tr; EBT00001566896.
DR   EnsemblGenomes-Tr; EBT00001566897.
DR   EnsemblGenomes-Tr; EBT00001566898.
DR   EnsemblGenomes-Tr; EBT00001566900.
DR   EnsemblGenomes-Tr; PC1_R0001-1.
DR   EnsemblGenomes-Tr; PC1_R0002-1.
DR   EnsemblGenomes-Tr; PC1_R0003-1.
DR   EnsemblGenomes-Tr; PC1_R0004-1.
DR   EnsemblGenomes-Tr; PC1_R0005-1.
DR   EnsemblGenomes-Tr; PC1_R0006-1.
DR   EnsemblGenomes-Tr; PC1_R0007-1.
DR   EnsemblGenomes-Tr; PC1_R0008-1.
DR   EnsemblGenomes-Tr; PC1_R0009-1.
DR   EnsemblGenomes-Tr; PC1_R0010-1.
DR   EnsemblGenomes-Tr; PC1_R0011-1.
DR   EnsemblGenomes-Tr; PC1_R0012-1.
DR   EnsemblGenomes-Tr; PC1_R0013-1.
DR   EnsemblGenomes-Tr; PC1_R0014-1.
DR   EnsemblGenomes-Tr; PC1_R0015-1.
DR   EnsemblGenomes-Tr; PC1_R0016-1.
DR   EnsemblGenomes-Tr; PC1_R0017-1.
DR   EnsemblGenomes-Tr; PC1_R0018-1.
DR   EnsemblGenomes-Tr; PC1_R0019-1.
DR   EnsemblGenomes-Tr; PC1_R0020-1.
DR   EnsemblGenomes-Tr; PC1_R0021-1.
DR   EnsemblGenomes-Tr; PC1_R0022-1.
DR   EnsemblGenomes-Tr; PC1_R0023-1.
DR   EnsemblGenomes-Tr; PC1_R0024-1.
DR   EnsemblGenomes-Tr; PC1_R0025-1.
DR   EnsemblGenomes-Tr; PC1_R0026-1.
DR   EnsemblGenomes-Tr; PC1_R0027-1.
DR   EnsemblGenomes-Tr; PC1_R0028-1.
DR   EnsemblGenomes-Tr; PC1_R0029-1.
DR   EnsemblGenomes-Tr; PC1_R0030-1.
DR   EnsemblGenomes-Tr; PC1_R0031-1.
DR   EnsemblGenomes-Tr; PC1_R0032-1.
DR   EnsemblGenomes-Tr; PC1_R0033-1.
DR   EnsemblGenomes-Tr; PC1_R0034-1.
DR   EnsemblGenomes-Tr; PC1_R0035-1.
DR   EnsemblGenomes-Tr; PC1_R0036-1.
DR   EnsemblGenomes-Tr; PC1_R0037-1.
DR   EnsemblGenomes-Tr; PC1_R0038-1.
DR   EnsemblGenomes-Tr; PC1_R0039-1.
DR   EnsemblGenomes-Tr; PC1_R0040-1.
DR   EnsemblGenomes-Tr; PC1_R0041-1.
DR   EnsemblGenomes-Tr; PC1_R0042-1.
DR   EnsemblGenomes-Tr; PC1_R0043-1.
DR   EnsemblGenomes-Tr; PC1_R0044-1.
DR   EnsemblGenomes-Tr; PC1_R0045-1.
DR   EnsemblGenomes-Tr; PC1_R0046-1.
DR   EnsemblGenomes-Tr; PC1_R0047-1.
DR   EnsemblGenomes-Tr; PC1_R0048-1.
DR   EnsemblGenomes-Tr; PC1_R0049-1.
DR   EnsemblGenomes-Tr; PC1_R0050-1.
DR   EnsemblGenomes-Tr; PC1_R0051-1.
DR   EnsemblGenomes-Tr; PC1_R0052-1.
DR   EnsemblGenomes-Tr; PC1_R0053-1.
DR   EnsemblGenomes-Tr; PC1_R0054-1.
DR   EnsemblGenomes-Tr; PC1_R0055-1.
DR   EnsemblGenomes-Tr; PC1_R0056-1.
DR   EnsemblGenomes-Tr; PC1_R0057-1.
DR   EnsemblGenomes-Tr; PC1_R0058-1.
DR   EnsemblGenomes-Tr; PC1_R0059-1.
DR   EnsemblGenomes-Tr; PC1_R0060-1.
DR   EnsemblGenomes-Tr; PC1_R0061-1.
DR   EnsemblGenomes-Tr; PC1_R0062-1.
DR   EnsemblGenomes-Tr; PC1_R0063-1.
DR   EnsemblGenomes-Tr; PC1_R0064-1.
DR   EnsemblGenomes-Tr; PC1_R0065-1.
DR   EnsemblGenomes-Tr; PC1_R0066-1.
DR   EnsemblGenomes-Tr; PC1_R0067-1.
DR   EnsemblGenomes-Tr; PC1_R0068-1.
DR   EnsemblGenomes-Tr; PC1_R0069-1.
DR   EnsemblGenomes-Tr; PC1_R0070-1.
DR   EnsemblGenomes-Tr; PC1_R0071-1.
DR   EnsemblGenomes-Tr; PC1_R0072-1.
DR   EnsemblGenomes-Tr; PC1_R0073-1.
DR   EnsemblGenomes-Tr; PC1_R0074-1.
DR   EnsemblGenomes-Tr; PC1_R0075-1.
DR   EnsemblGenomes-Tr; PC1_R0076-1.
DR   EnsemblGenomes-Tr; PC1_R0077-1.
DR   EnsemblGenomes-Tr; PC1_R0078-1.
DR   EnsemblGenomes-Tr; PC1_R0079-1.
DR   EnsemblGenomes-Tr; PC1_R0080-1.
DR   EnsemblGenomes-Tr; PC1_R0081-1.
DR   EnsemblGenomes-Tr; PC1_R0082-1.
DR   EnsemblGenomes-Tr; PC1_R0083-1.
DR   EnsemblGenomes-Tr; PC1_R0084-1.
DR   EnsemblGenomes-Tr; PC1_R0085-1.
DR   EnsemblGenomes-Tr; PC1_R0086-1.
DR   EnsemblGenomes-Tr; PC1_R0087-1.
DR   EnsemblGenomes-Tr; PC1_R0088-1.
DR   EnsemblGenomes-Tr; PC1_R0089-1.
DR   EnsemblGenomes-Tr; PC1_R0090-1.
DR   EnsemblGenomes-Tr; PC1_R0091-1.
DR   EnsemblGenomes-Tr; PC1_R0092-1.
DR   EnsemblGenomes-Tr; PC1_R0093-1.
DR   EnsemblGenomes-Tr; PC1_R0094-1.
DR   EnsemblGenomes-Tr; PC1_R0095-1.
DR   EnsemblGenomes-Tr; PC1_R0096-1.
DR   EnsemblGenomes-Tr; PC1_R0097-1.
DR   EnsemblGenomes-Tr; PC1_R0098-1.
DR   EnsemblGenomes-Tr; PC1_R0099-1.
DR   EnsemblGenomes-Tr; PC1_R0100-1.
DR   EnsemblGenomes-Tr; PC1_R0101-1.
DR   EnsemblGenomes-Tr; PC1_R0102-1.
DR   EnsemblGenomes-Tr; PC1_R0103-1.
DR   EuropePMC; PMC3126425; 21378044.
DR   EuropePMC; PMC3318820; 22307293.
DR   EuropePMC; PMC3678301; 23781227.
DR   EuropePMC; PMC6286560; 30526490.
DR   EuropePMC; PMC6514923; 31010197.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00034; RprA.
DR   RFAM; RF00040; rne5.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00057; RyhB.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00077; SraB.
DR   RFAM; RF00078; MicA.
DR   RFAM; RF00079; OmrA-B.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00081; ArcZ.
DR   RFAM; RF00082; SraG.
DR   RFAM; RF00083; GlmZ_SraJ.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00110; RybB.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00112; CyaR_RyeE.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00128; GlmY_tke1.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00391; RtT.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00512; Leu_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00534; SgrS.
DR   RFAM; RF00552; rncO.
DR   RFAM; RF00630; P26.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01394; isrK.
DR   RFAM; RF01396; isrN.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01748; nuoG.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01769; greA.
DR   RFAM; RF01770; rimP.
DR   RFAM; RF01796; frnS.
DR   RFAM; RF01830; StyR-44.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02029; sraA.
DR   RFAM; RF02030; tp2.
DR   RFAM; RF02031; tpke11.
DR   RFAM; RF02074; STnc240.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; CP001657.
DR   SILVA-SSU; CP001657.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085667
CC   Source DNA and bacteria available from Nicole T. Perna
CC   (ntperna@wisc.edu)
CC   Contacts: Nicole T. Perna (ntperna@wisc.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Pectobacterium carotovorum carotovorum PC1
CC   GOLD Stamp ID         :: Gi04239
CC   Oxygen Requirement    :: Facultative
CC   Cell Shape            :: Rod-shaped
CC   Motility              :: Motile
CC   Sporulation           :: Nonsporulating
CC   Temperature Range     :: Mesophile
CC   Gram Staining         :: gram-
CC   Biotic Relationship   :: Free living
CC   Diseases              :: Soft rot
CC   Habitat               :: Host
CC   Phenotypes            :: Pathogen
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4862913
FT                   /organism="Pectobacterium carotovorum subsp. carotovorum
FT                   PC1"
FT                   /sub_species="carotovorum"
FT                   /strain="PC1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:561230"
FT   gene            72..1469
FT                   /locus_tag="PC1_0001"
FT   CDS_pept        72..1469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: eca:ECA4441 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11064"
FT                   /db_xref="GOA:C6DGH7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DGH7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACT11064.1"
FT                   /translation="MSLSLWQQCLARLHDELPATEFSMWIRPLQAELSDNTLALYAPNR
FT                   FVLDWVRDKYLNNINVLLNDFCGMDAPLLRFEVGSKPLVQAISQPAQPHHKQVSAAPQQ
FT                   QVRSAPVRPSWDNSPAQAEHTYRSNVNPKHTFDNFVEGKSNQLARAAARQVADNPGGAY
FT                   NPLFLYGGTGLGKTHLLHAVGNGIIARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKR
FT                   YYRSVDALLIDDIQFFANKERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLK
FT                   SRFGWGLTVAIEPPELETRVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNR
FT                   VIANANFTGRSITIDFVREALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSR
FT                   SVARPRQMAMALAKELTNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSN
FT                   LIRTLSS"
FT   gene            1474..2574
FT                   /locus_tag="PC1_0002"
FT   CDS_pept        1474..2574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: eca:ECA4440 DNA polymerase III subunit beta;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11065"
FT                   /db_xref="GOA:C6DGH8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGH8"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACT11065.1"
FT                   /translation="MKFIVERERLLKPLQQVSSPLGGRPTLPILGNLLIQVTEDALSLT
FT                   GTDLEMEMVAKVALTQPHEPGATTVPARKLFDICRGLPEGAEITIMLDGDRMLVRSGRS
FT                   RFSLSTLPAADFPNLDDWQSDVEFSLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETE
FT                   GEELRTVATDGHRLAVCSMPVGQSLPSHSVIVPRKGVMELVRLLDGGDTPLQLQIGSNN
FT                   IRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKTLEASCDLLKQAFSRAAILSNEKFRGV
FT                   RLHLIQNQLKITANNPEQEEAEEILDVQYDGTEMEIGFNVSYVLDVLNALKCEGVRLLL
FT                   TDSVSSVQIEDSASRAAAYVVMPMRL"
FT   gene            2624..3709
FT                   /locus_tag="PC1_0003"
FT   CDS_pept        2624..3709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: eca:ECA4439 recombination
FT                   protein F"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11066"
FT                   /db_xref="GOA:C6DGH9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DGH9"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACT11066.1"
FT                   /translation="MALTRLLIKDFRNIEAADLALVPGFNFLVGANGSGKTSVLEAIYT
FT                   LGHGRAFRSIQAGRVIRHDQPEFVLHGRIDGTETERSVGLSKNRQGDSKVRIDGSDGHK
FT                   VAELAQLLPIQLITPEGFTLLNGGPKFRRAFLDWGCFHNEPGFFAAWSNMKRLLRQRNA
FT                   ALRQVSHYGQLRAWDQELVPLAERISEWRAQYSAAIANDIATTCTQFLPEFSLSFSFQR
FT                   GWDKESEYAELLERQFERDRMLGYTALGPHKADFRIRASGVAVEDMLSRGQLKLLMCAL
FT                   RLAQGEFLTRQNGLRCLYLIDDFASELDSTRRRLLAERLKATHAQVFVSAVSAEQIEDM
FT                   VGEKGKMFRVEQGKITVQSQD"
FT   gene            3728..6145
FT                   /locus_tag="PC1_0004"
FT   CDS_pept        3728..6145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: eca:ECA4438 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11067"
FT                   /db_xref="GOA:C6DGI0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGI0"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACT11067.1"
FT                   /translation="MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVVD
FT                   NAIDEALAGYCKDIIITIHADNSVSVQDDGRGIPTGIHEEEGISAAEVIMTVLHAGGKF
FT                   DDNSYKVSGGLHGVGVSVVNALSEKLKLVIHRDGKLHEQTYKHGVPQAPLAVTGETNRT
FT                   GTTVRFWPSHETFTNVVEFEYEILAKRLRELSFLNSGVSIRLIDEREKDKADHYHYDGG
FT                   IKAFVDYLNRNKTPIHPNVFYFSTVKDDIGVEVALQWNDGFQENIYCFTNNIPQRDGGT
FT                   HLAGFRAAMTRTLNTYMDKEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFSSQTKDK
FT                   LVSSEVKTAVESLMNEKLVDYLMENPSDAKIVVGKIIDAARAREAARKARDMTRRKGAL
FT                   DLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKAR
FT                   FDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFYR
FT                   QLPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDEAMDQYQIMLALDGATLHTNAQAPAL
FT                   AGEPLEKLVSEHYAVQKLIGRMERRFPRALLNRLIYQPTLSEADLNERENVQAWAESLV
FT                   NSLNESELHGSTYSFVIHHDEERGVFEPALRVRTHGVDTDYPLGAGFVAGSEYRKLNQL
FT                   GEKLRGLIEEDAYIERGERRQPVASFEQALEWLVKESRRGLTVQRYKGLGEMNPDQLWE
FT                   TTMDPNSRRMLRVTVKDAIAADELFTTLMGDAVEPRRAFIEENALKAMNIDI"
FT   gene            complement(6488..7678)
FT                   /locus_tag="PC1_0005"
FT   CDS_pept        complement(6488..7678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0005"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA4437 MFS efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11068"
FT                   /db_xref="GOA:C6DGI1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGI1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACT11068.1"
FT                   /translation="MKFIKLPLLAQISSAHLVSHFHMMVLPALIPLLSAQRDISFVELG
FT                   FALSVFNIVSACVQTPIGFMVDRIGARRTLTAGLALGSLCFLSLGFSDSYVWLVAAMGL
FT                   AGVANAVYHPADYALLSRGIDEKRMGRAFSVHTFSGFLGTAIAPGILLSIAAFSGINSA
FT                   FIVSGVIGLLTIPLLLTDRDEPSRVKPAAATGTQPGKSRAPVFTLPILALLILFLLLNL
FT                   STGSIQNFSVTALVTGYDLSLSQANVALTAFLFASAFGVLAGGSLADKTKRHGLVATAA
FT                   LAVTAVLVSIVAMYSLPTIVLVPLLAAAGFLSGMIAPSRDMLVRAASPPGAEGRVFGIV
FT                   STGFNIGGAAGPVLFGWLLDHGHPHAIFWSAVIFMLITAFITLLQEMRSAKRRALA"
FT   gene            7843..8211
FT                   /locus_tag="PC1_0006"
FT   CDS_pept        7843..8211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0006"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: pfl:PFL_2470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11069"
FT                   /db_xref="GOA:C6DGI2"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGI2"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ACT11069.1"
FT                   /translation="MTIKSYLGGCLCGQIRFRASGEPGNPHACSCTFCQQHSGAPTLLW
FT                   VEFPRSAVEWIGEGGEPARYRSSDYSSRAFCPHCGSTLGAIDDEPTIALTIGNFDEKNS
FT                   PELKPTSHSFEDCCPRWE"
FT   gene            complement(8261..10171)
FT                   /locus_tag="PC1_0007"
FT   CDS_pept        complement(8261..10171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0007"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: chemotaxis sensory transducer; Cache domain
FT                   protein; histidine kinase HAMP region domain protein;
FT                   SMART: chemotaxis sensory transducer; KEGG: esa:ESA_02212
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11070"
FT                   /db_xref="GOA:C6DGI3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGI3"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACT11070.1"
FT                   /translation="MLLAGVSTIALGFILTIGLLIWQSGQQQKTIAQHYLEQTAYTNSY
FT                   LIQQKLDVALHAARNLVQSVVSLQEAGNADRKTAETLLKNALKSHPDFLSMSLAWEPDA
FT                   FDGKDREYAGQPDQDPQGRFVRYVDRDTAGNVALHNLVDYETPGSGDYYLLPKKLQKEV
FT                   ILEPYSYPYNGVDVLLTSIAVPIIINNKFYGSVTADFSLDTLQQLTNNIKPYEGTGYAQ
FT                   LLSHSGAYISHPEKARVTKKIENDPTLLEHVTTGQPYQIERDNAVLNTPAFNVYVPVTI
FT                   GNTGTPWMLGLSAPVNVVMAETVRQRNIGLLLMVLSIVVVSGVLGIIFNRKVARPIGGE
FT                   PAQAAQIALSVAQGDLTQTIPVQPKDDSSIFYAMNAMQSQLRDIAEQLISTSESVSHGA
FT                   TEIAAGNTDLASRTEQQAAALEETAASMEQITATVKQNADNAHNATTLAQNAAHIAQKG
FT                   DKIVGQVVHIMSEIDDSSKKIADITSIINGIAFQTNILALNAAVEAARAGEQGRGFAVV
FT                   ANEVRNLAQRSASAVKDITALITESANRVDSGVTLVQSAGETMQDMLRAVTSVKDIMDE
FT                   IVSASDEQSRGISQVTQAVHEMDGVTQQNAALVQEATAAAASLEEQARQLAQTVLVFKL
FT                   S"
FT   gene            complement(10548..11561)
FT                   /locus_tag="PC1_0008"
FT   CDS_pept        complement(10548..11561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0008"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI; KEGG: eca:ECA4436 LacI family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11071"
FT                   /db_xref="GOA:C6DGI4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGI4"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACT11071.1"
FT                   /translation="MVTMLDVAKKAGVSKATVSRVLTGNNYVSKTTRDRVFRAIEDIGY
FT                   RPNLLARQLATSKSQIIGLVVTNTLYSGPYFSELLFQTATMTEKYGRQLIMADGKHSAE
FT                   EEREAIQFLLDLRCDAVIIYPRFLSIDALESIIEQHEQPIMVVNRTLHRHGDNGICADH
FT                   QQHCHDAVNYLITQGHRDIAFICGSPNSPTGTSRLAGYRQALEENGIPYSDSLVAPGDW
FT                   THDSGYSAAKTLLQRSTTFSALVASNDDMAIGAAKALREHGLAIPQDVSLLGFDDLPMA
FT                   SWFYPPLTTVHVPVAEMINYTLEKLLCRLEGETVEPAPDFKGELIIRDSVSKGPAT"
FT   gene            11776..12081
FT                   /locus_tag="PC1_0009"
FT   CDS_pept        11776..12081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0009"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG: eca:ECA4435
FT                   pts system, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11072"
FT                   /db_xref="GOA:C6DGI5"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGI5"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACT11072.1"
FT                   /translation="MNKILLCCAAGMSTSMLVQRMEKVAEQKAIAVEIKAVGFEEFSEL
FT                   IDEYDCCLLGPQIKYKLPEFKVIADEKEKPIAVINMVDYGMMNGEKVLNDALAMIA"
FT   sig_peptide     11776..11844
FT                   /locus_tag="PC1_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.334 at
FT                   residue 23"
FT   gene            12098..13411
FT                   /locus_tag="PC1_0010"
FT   CDS_pept        12098..13411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0010"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="KEGG: eca:ECA4434 PTS system, IIBC component;
FT                   TIGRFAM: PTS system, lactose/cellobiose family IIC subunit;
FT                   PFAM: phosphotransferase system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11073"
FT                   /db_xref="GOA:C6DGI6"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGI6"
FT                   /inference="protein motif:TFAM:TIGR00410"
FT                   /protein_id="ACT11073.1"
FT                   /translation="MSKLTESLFSVIENRISPIAAKLSSQRHVVAIKDGFIASMPFLIV
FT                   GSFMMLFAHPPFSPNSEWAFAQWWLGMVERHGEQIMMPYNMTMGIMAVYITSAIAYNLA
FT                   QSYKMNGFMAASLALMSFMVVAAPQIDKSLPVGSLGGEGIFTAIIVAIYSTELMHFLQK
FT                   HNIGIRLPEQVPPKIRQSFDLLIPILAIFLTLFPLSLFMQSQFGMLLPQAIMAVFAPII
FT                   SASDSLPAILIAVLLCHLLWFAGIHGAVIVGGILQAFWLTNLGINQEAFNAGAPITKIF
FT                   IEPFWQFFITVGGSGATMGLVFLYLRSRSAHLRSIGKLAVVPSMFNINEPVIFGSPVVM
FT                   NPLLFIPFITAPLVNAILAYIALKTDLVHRVISLAPWTTPGPIGAAWSTGWDWRAVVLV
FT                   GVLIVVSSLIYYPFFKMYERQLIEQEVGTAEEAVSDAR"
FT   gene            13401..13727
FT                   /locus_tag="PC1_0011"
FT   CDS_pept        13401..13727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0011"
FT                   /product="phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /note="PFAM: phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit; KEGG: eca:ECA4433
FT                   pts system, cellobiose-specific IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11074"
FT                   /db_xref="GOA:C6DGI7"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="InterPro:IPR036542"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGI7"
FT                   /inference="protein motif:PFAM:PF02255"
FT                   /protein_id="ACT11074.1"
FT                   /translation="MLDETTIMELIIYAGEARSSSMEALSAARKYDWDKAEELLNAASV
FT                   AARKAHQIQTALIGADEGSGKIPVNLILVHAQDHLMNAMLCRELVEELIQLHREISSLK
FT                   QLIN"
FT   gene            13760..15202
FT                   /locus_tag="PC1_0012"
FT   CDS_pept        13760..15202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0012"
FT                   /product="glycoside hydrolase family 1"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   eca:ECA4432 6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11075"
FT                   /db_xref="GOA:C6DGI8"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGI8"
FT                   /inference="protein motif:PFAM:PF00232"
FT                   /protein_id="ACT11075.1"
FT                   /translation="MSVQQLPKDFLWGGAVAAHQVEGGWDQGGKGVSICDVLSGGAHGV
FT                   DRVITDGVQPGVSYPNHQAVEFYSHYKQDVALFAEMGFKCFRTSIAWTRIFPNGDELEP
FT                   NEAGLQFYDDLFDELLKYNIEPVITLSHFEMPHHLVKQYGGWLNRKVVDFFVRYSEVVM
FT                   KRYQSKVKYWMTFNEINNQRNWQYPLFGYCCSGVIFTDHDKPEQAMYQTLHHQFVASAK
FT                   VVKLGHEINPNFKIGCMLALVPIYPWSCHPDDVMFAQEAMRERHLFGDVQLRGYYPSYI
FT                   LKEWARKGYQIDMQPEDEQTLRDGCTDYLGFSYYMSSAVQLAAKGQKKEDSITGFDGGV
FT                   KNPHVKASEWGWQIDPVGLRYTLNSFYERYQKPMFIVENGFGAVDKVEADGSINDDYRI
FT                   EYLKAHIDQMKKAVVEDGVELMGYTPWGCIDCVSFTTGQYSKRYGFIYVDKHDDGTGTF
FT                   KRSKKKSFDWYKKVISSNGAEL"
FT   gene            15358..16173
FT                   /locus_tag="PC1_0013"
FT   CDS_pept        15358..16173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0013"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; KEGG: eca:ECA4428 sugar phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11076"
FT                   /db_xref="GOA:C6DGI9"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGI9"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACT11076.1"
FT                   /translation="MSVKLIAIDMDGTLLTPQNQISPAVKAAIAAAREKGVQVVLATGR
FT                   PYIGVERYLMELDLQQEGCYCITNNGALVQRTVNGDCVAQTALSFDDYLYFEALACKLG
FT                   VHFHALDFNFVYTANKDISPYTIHESHLTGMPLKYRAVEEMDRSLTFPKVMMIDEPEIL
FT                   DRAISQIPPEAFERYTIMKSAEYYLEILDKRVNKGEGVKMLAEHLGIPRESVMTLGDQQ
FT                   NDLAMIRYAGIGVAMGNAIDEVKEASQFVTKSNTEDGVAYAIEKFVLNA"
FT   gene            complement(16319..17215)
FT                   /locus_tag="PC1_0014"
FT   CDS_pept        complement(16319..17215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0014"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: eca:ECA4427 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11077"
FT                   /db_xref="GOA:C6DGJ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGJ0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACT11077.1"
FT                   /translation="MRINPRQVEAFHKVILTGGITAAANMMYITQPAVSRLIKDFEDAL
FT                   NLKLFDRDGRGLIPRAEAMKLYREVERLYLGLDQIGLIADEIRHAKGSVLRIAAVQALS
FT                   FLCSDQVLPTLLKKYPDLSLFLDIESSSRITDAIAENHYDVGFIFGQPGIKGLEAEPLA
FT                   DASAVAVLAMGHPLATADEITLADLAGTRAILPGRTTPLRAQIDISARKEQIYLHNPIE
FT                   TSMANCCVLASRNVGIGVVDFITALNSPSPVIVKPFNPDIKMAYCAVYPPQIPRSQVVN
FT                   HITQVMKEKIADSLELK"
FT   gene            17358..18908
FT                   /locus_tag="PC1_0015"
FT   CDS_pept        17358..18908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0015"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: eca:ECA4426 putative extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11078"
FT                   /db_xref="GOA:C6DGJ1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGJ1"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACT11078.1"
FT                   /translation="MKKSTLALLFTVLFSSSPLVYSADLNIGLASSTTSMDPQFYVSGA
FT                   NSAMARNIFDGLVVQDEKQQIAPALATSWKVIDDKTWEFVLRPGVKFHDGSDFTAKDVI
FT                   ASIKRVALASKNSPSSYAPYVSDIAEVIEVNPLTVRIKTKEASPLLLNNLSRISILPAR
FT                   LENVPTETLNSGKDVIGTGPFKFVSWVPDDRVVLSRNDDYWGGKAEWDNVTVRVFKNSS
FT                   ARVAAVLSGDVDMIENVPTADSSNIEKNQQLKTISTPGNRVIYLHMDQQREESPFAKGP
FT                   DGKNPLLKKEVRQAMSLAINRQAIVDRVMEGQAVVASQLVPKGYPGYSASIPAPVYNPE
FT                   KAKQELAAAGYPDGFTLTFHASNDRYPNDSKIAQAIGQMFTRAGIKTEVVTMPGSVYFS
FT                   RASRLEFSLIMGGAAIETGEASGVLGPLLETFGPNAGQGNRGRYSNPAFDKALSEARVT
FT                   LDETKRDALLAEAMNIGMNDLGVIPVMFLSNTWAMKKQYTYVGRSDAYTLPYFVRSAK"
FT   sig_peptide     17358..17426
FT                   /locus_tag="PC1_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 23"
FT   gene            18978..19862
FT                   /locus_tag="PC1_0016"
FT   CDS_pept        18978..19862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0016"
FT                   /product="dihydrodipicolinate synthetase"
FT                   /note="PFAM: dihydrodipicolinate synthetase; KEGG:
FT                   eca:ECA4425 putative dihydrodipicolinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11079"
FT                   /db_xref="GOA:C6DGJ2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGJ2"
FT                   /inference="protein motif:PFAM:PF00701"
FT                   /protein_id="ACT11079.1"
FT                   /translation="MNTFSGVFPYLVSPVRPDGQVDKPVLAQLTEHLIQCGVHGVVPLG
FT                   STGEFAYLSAAQRLDVVKTVIETTAGRVPVIAGVASTTIQDAVEQTKRYVELGADGILA
FT                   VLEAYFPLKDEGVEQYFRAIAEAAQGKPVVLYTNPQFQRSDLSLPVIERLSHVSNIRYI
FT                   KDASTNTGRLLSIIERTRGRMDVFSASAHIPACVMLIGGVGWMAGPACIVPKQSIALYE
FT                   AARAGDWNKAMELQRPLWRINEIFARYSIAGCIKAALQLQGFAVGDPLPPQLPLDEKAR
FT                   KEIADVLASVDSL"
FT   gene            19965..20918
FT                   /locus_tag="PC1_0017"
FT   CDS_pept        19965..20918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0017"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: eca:ECA4424 putative nucleoside hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11080"
FT                   /db_xref="GOA:C6DGJ3"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGJ3"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ACT11080.1"
FT                   /translation="MSALPIIIDCDPGIDDAIALLSAFVAPELDIRGICTVCGNQPLDK
FT                   TLRNALQIVELGQRTDIPVFAGCHRPLLRDPIHGQFHGESGLGQTVLPAPQKQAEAQHA
FT                   VSFIIAQCKQAIADGTPITLCTLGPLTNVAMALRMAPEIADGIARIVMMGGAYREAGNR
FT                   SLTSEFNMIADPQAAKVVFDSSIALVALPLDVTHQVILTPELVARFIALSGRISAPLGE
FT                   MMAFWDRNDIRRYGSRGGPLHDPLVIAWVLAPHCFTTEKASVYIEQESELCMGQTVADW
FT                   YGKTDRQPNVDVVTGVDAKQVVELFADLLSRYGEGV"
FT   gene            20920..21927
FT                   /locus_tag="PC1_0018"
FT   CDS_pept        20920..21927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0018"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: eca:ECA4423 putative nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11081"
FT                   /db_xref="GOA:C6DGJ4"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGJ4"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ACT11081.1"
FT                   /translation="MVQERIIIDTDPGVDDAIAIWLALASPELDVLGITVVAGNVPLAA
FT                   TLSNACNVVGVTGRTDVPIFAGASRPLIRDQVFGKYAHIGKFSADWVPESTLSPEQEHA
FT                   VDFLVRMTRQAAADNNPITICALGPLTNLALALCFHPDVARGIKQIVSMSCAFTAMGNR
FT                   VPWADFNVYADPHAAEIVFSSGVPIVIMPLDMTFQALIQTEQVDDIERSGGAPGKAMAA
FT                   LLRMFDRSEVDRFGREGGPIHDATVIAWLLKPELFKSKRARIGVEVAGRTAGYAFADFY
FT                   HKLGEPENALVMREIDEQGFLGLIAERLRRYGSEEIEGSEKKDSSEALNGSGGR"
FT   gene            21927..22904
FT                   /locus_tag="PC1_0019"
FT   CDS_pept        21927..22904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0019"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4422 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11082"
FT                   /db_xref="GOA:C6DGJ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGJ5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT11082.1"
FT                   /translation="MIAYLLSRIGQTLLTLAVMSVLVFVGVYLVGNPVDMLLGATATPA
FT                   ERLAVIQSFGLDKPVWEQYGLFVWNAFQGDMGNSFIFNQPALTLIFQRMPATLELAMVA
FT                   FVMALIVGIPLGIYAGLKPDSAVSKSIMTFSILGFSLPTFWIGLVMIMLFSVKLGWLPS
FT                   SGRGDVHELFGIPFSFLTRDGLEHLLLPAFNLALFKISLVIRLMRAGVMECLQQDYVQF
FT                   ARAKGLSETRIVLVHVLRNTLIPLITVLGLELGSLIAFAVVTETIYAWPGMGKLIIDSI
FT                   AVLDRPVILAYLMITVVMFSVINLLVDLLYVLVDPRVRLGGDKG"
FT   gene            22901..23809
FT                   /locus_tag="PC1_0020"
FT   CDS_pept        22901..23809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0020"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4421 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11083"
FT                   /db_xref="GOA:C6DGJ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGJ6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT11083.1"
FT                   /translation="MTGNTIHQPAAVQKAVHPVMRVVMALINDRLALFGLIMLAIFVLL
FT                   ALLAPLLSPQNPYDLMQLDIMDGRLVPGSSSMSGMTYWLGTDDQGRDLFSAILYGTRIS
FT                   LMVGFTSAVFALLIGASLGLISAYVGGKTDATIMRIVDIQLSFPPILIALILLAVLGQG
FT                   VDKIIMALVVTQWAYYARTIRGSALVERRRSYVDAARSMALSNRRILFRHILPNCLAPL
FT                   IVVATMRIAYAIMLEATLSFLGIGLPVTEPSLGLLISNGFEYLMSGDYWISFFPGLTLL
FT                   LLIVAINLVGDALRDILNPRN"
FT   gene            23825..25657
FT                   /locus_tag="PC1_0021"
FT   CDS_pept        23825..25657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0021"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: eca:ECA4420 ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11084"
FT                   /db_xref="GOA:C6DGJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGJ7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT11084.1"
FT                   /translation="MGIRGNEHMTAPIMSVSHLTTAFQVNGEWMNVVRDLSFTIGEKET
FT                   VAVVGESGSGKSVMAKSIMRLLPPGQSRIEGQIHFGDTELLSLPSKAMQDVRGNRIGMI
FT                   FQEPMTSLNPVLPIGYQITEVLRRHRGMGKAEARAEAVRLLEKVRIPAAKSRLNEYPQS
FT                   FSGGMRQRVVIAIALACHPKLLIADEPTTALDVTIQAQILTLIKTLQEEEGMSVLFITH
FT                   DMGVVAEVSDRTLVMYQGEMVENAVTREIFHHPQQPYTRMLLSAVPKLGSMSGSAWPQR
FT                   FPLIDLKTGERQSVPDAVNTVSGEEPVLTVKNLVTRFDIRSGFFRRLSGRVHAVENVSF
FT                   DLWPGETLALVGESGCGKSTTGRSIIRLNDAVSGDIQLLGKNILTADKRELTESRRQIQ
FT                   MVFQDPYESLNPRMRIGEAIAEPMLLHGLATRQNVSARVSELLEQVGLSGDMASRFPHQ
FT                   FSGGQRQRVCIARALALEPKVIIADESVSALDVSVKAQVINLMLDLQQKLGLSFLFISH
FT                   DMAVVERISHRVAVMYLGEIVEIGPRSAIFDNPQHDYTRRLISAVPVPDPDTRPVRNIT
FT                   NDELRSPVRAPDFHPPVRRYKQVGEGHFVLETVA"
FT   gene            complement(25733..25990)
FT                   /locus_tag="PC1_0022"
FT   CDS_pept        complement(25733..25990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0022"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   eca:ECA4414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11085"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGJ8"
FT                   /inference="protein motif:PFAM:PF07338"
FT                   /protein_id="ACT11085.1"
FT                   /translation="MKNVKFFAAAVVLSTLSFGAFAAEQVSSQQAQGLEKVGVVSATAR
FT                   SLDSLQAQLAQKAEKAGASAFTITSATGDNQLRGVAVIYK"
FT   sig_peptide     complement(25922..25990)
FT                   /locus_tag="PC1_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(26163..26963)
FT                   /locus_tag="PC1_0023"
FT   CDS_pept        complement(26163..26963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0023"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA4413 aliphatic sulfonates transport
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11086"
FT                   /db_xref="GOA:C6DGJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017875"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGJ9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT11086.1"
FT                   /translation="MTAFTDSATRAHSPSPLTKGTPLALDAITKHYGHRTVLNDVQLRI
FT                   PSGQFVAIVGRSGCGKSTLLRLLAGLEAASSGELLTGTAPLSSAKDDTRLMFQEARLLP
FT                   WKKVIDNVGLGLRGNWREKAQEALASVGLADRASDWPAALSGGQKQRVALARALIHHPR
FT                   LLLLDEPLGALDALTRIEMQSLIENLWLQHGFTVLLVTHDVSEAIALADRVILIEEGRV
FT                   GLDITVDLPRPRRRGSAKLAELEARVLERVLAPASSPLPQQAVI"
FT   gene            complement(26960..27754)
FT                   /locus_tag="PC1_0024"
FT   CDS_pept        complement(26960..27754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0024"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4412 putative
FT                   aliphatic sulfonates transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11087"
FT                   /db_xref="GOA:C6DGK0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGK0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT11087.1"
FT                   /translation="MARTPSSLAQRLAPFLLPVTLLVAWQVAVEFGWLSNRILPAPSSV
FT                   ITAGWSLIYSGELWQHLAISGWRALIGFAIGGTIGLTLGFITGLSRWGERLLDSSVQMI
FT                   RNVPHLALIPLVILWFGIDEAAKIFLVALGTLFPVYLNTYHGIKNIDRGLLEMARSYGL
FT                   SGLSLFYQVVLPGALPSIMVGIRFALGFMWLTLIVAETISANSGIGYLAMNAREFLQTD
FT                   VVVVAIILYALLGKLADISAQGLERIWLRWNPAYQTSSGDAS"
FT   gene            complement(27765..28907)
FT                   /locus_tag="PC1_0025"
FT   CDS_pept        complement(27765..28907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0025"
FT                   /product="Alkanesulfonate monooxygenase"
FT                   /EC_number="1.14.14.5"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   eca:ECA4411 alkanesulfonate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11088"
FT                   /db_xref="GOA:C6DGK1"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019911"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DGK1"
FT                   /inference="protein motif:PRIAM:1.14.14.5"
FT                   /protein_id="ACT11088.1"
FT                   /translation="MSLNVFWFLPTHGDGRYLGSTEGARHVDYGYLQQVAQAAERQGFG
FT                   GVLLPTGRSCEDSWLVAASLIPVTQRLKFLVALRPGVISPTIAARQAATLDRLSNGRAL
FT                   FNLVTGGDPEELAAEGLFLSHEERYEASAEFTHIWRRLLEGETVDFAGKHIQVKDAKLL
FT                   YPPVQQPRPPLYFGGSSEAAQNLAAEQVDLYLTWGEPPEQVKEKLAEVRDKAAAQGREV
FT                   RFGIRLHVIVRETTEEAWQAADRLISHLDEKTIADAQAALARFDSVGQQRMAALHGGKK
FT                   DKLEISPNLWAGIGLVRGGAGTALVGDGPTVAERIQEYADLGIDTFILSGYPHLEEAYR
FT                   VGELLFPHLDLAQQPTPLHAVNNAGEVVANRYVPRKVSQS"
FT   gene            complement(28966..29988)
FT                   /locus_tag="PC1_0026"
FT   CDS_pept        complement(28966..29988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0026"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; SMART:
FT                   extracellular solute-binding protein family 3; KEGG:
FT                   eca:ECA4410 alkanesulfonate transporter substrate-binding
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11089"
FT                   /db_xref="GOA:C6DGK2"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGK2"
FT                   /inference="protein motif:TFAM:TIGR01728"
FT                   /protein_id="ACT11089.1"
FT                   /translation="MSLMMKKSVTEIREKRTPLWKNVATQLRRIPTLLVASAVLFMSTA
FT                   YAQDSVPTQLRIGYQKGSISLVLAKSHLLLEKQFPNTKISWIEFPAGPQMLEALNVGSI
FT                   DLGGTGDIPPIFAQAAGADLLYVGVEPPKPQAEVILVREDSPVKTVADLKGRKVAFQKG
FT                   SSAHNTLLRALQRDGLKFTDIKPTYLTPADARAAFQQGNVDAWAIWDPYYSAALLEGGV
FT                   RVLVDSSGLEKTGSFYLAGRPYAEAHGTFIRQVLDELTKADALTISDRAQSVTLLANAV
FT                   GLPEKVIETALDHRPPTTIEPLDAATIKAQQSTADLFYENRLVPVKVNIAERVWRPKAN
FT                   "
FT   sig_peptide     complement(29845..29988)
FT                   /locus_tag="PC1_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 48"
FT   gene            30438..31883
FT                   /locus_tag="PC1_0027"
FT   CDS_pept        30438..31883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0027"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ent:Ent638_2482 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11090"
FT                   /db_xref="GOA:C6DGK3"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGK3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACT11090.1"
FT                   /translation="MALTDSSQDKAPRQEHSDSGRISGLALLVASAFFMEFLDGTVIAT
FT                   ALPDMAKAFGVTAIDLNIGISAYLLTLAVLIPANGWVAERFGARNVFTLALCIFTLSSL
FT                   LCGLSHNVTEFVLMRILQGVGGAMMVPVGRLVVLRTTPKDQLIKAIATLTWPALVAPII
FT                   GPPLGGFITTYASWHWIFFLNVPLGLIAIVLSLRMMPNQSANESKPFDFPGFIATGVTM
FT                   LCLVVGLEMLSQQNVSLIGAAVTIAIGLATLVWSVRHLLTCKTPLIGLSSLSVPSFRIS
FT                   MRGGFILRATISSAPFMLPLMFQVGFGMNAFEAGSMVLAVFAGNLAMKPATTPLIRYFG
FT                   FRKLLISNGIACVLTLLLCALLTPDSPHLITLTLLFLGGLSRSMQFTSISSLAFAEVPS
FT                   QEMSSANTLFSTSLQLASGLGVTMGALSIRLGNILSDELGYTAVPGMGFRLGFVVIAII
FT                   TAFGVYDMTRLAPNAGINVSQKK"
FT   gene            32221..32544
FT                   /locus_tag="PC1_0028"
FT   CDS_pept        32221..32544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0028"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG: eca:ECA4409
FT                   PTS system, cellobiose-specific IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11091"
FT                   /db_xref="GOA:C6DGK4"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGK4"
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /protein_id="ACT11091.1"
FT                   /translation="MKRIMLCCSAGMSTSLLVKKMKEAASTRGLDVDIAAYAAHEFDEQ
FT                   VGKYDVVLLGPQVKYMLASFQEKAEGKGVPVAAIDMMDYGMQRGDNVLDFAFSLIEKSG
FT                   QPL"
FT   sig_peptide     32221..32277
FT                   /locus_tag="PC1_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.835) with cleavage site probability 0.538 at
FT                   residue 19"
FT   gene            32541..33863
FT                   /locus_tag="PC1_0029"
FT   CDS_pept        32541..33863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0029"
FT                   /product="PTS system, lactose/cellobiose family IIC
FT                   subunit"
FT                   /EC_number="2.7.1.69"
FT                   /note="KEGG: eca:ECA4408 PTS system EIIC component;
FT                   TIGRFAM: PTS system, lactose/cellobiose family IIC subunit;
FT                   PFAM: phosphotransferase system EIIC"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11092"
FT                   /db_xref="GOA:C6DGK5"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="InterPro:IPR004796"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGK5"
FT                   /inference="protein motif:TFAM:TIGR00410"
FT                   /protein_id="ACT11092.1"
FT                   /translation="MSGLYQSMVNIIEQKITPLAGVVGQQRHIIAIRDGFIAALPFMII
FT                   GSFMLVFIFPPFAPDTTLGFARAWLDFSVAYREQLMLPYYLSMGVMTFFISVGIGASLG
FT                   KHYKLDPIMTGLLALMAFLLVAAPYHDKQISTQYFSGEGIFTAILTSIYAGEVYAWLKK
FT                   RNITIRLPKEVPTGVARSFEILIPVLVIVATLHPFNLFIQSATGMIIPEAIMHLLAPLI
FT                   SASDSLPAILISVFICQILWFAGIHGALIVTGIMNPFWMTNLALNQAALSAGAPLPHIY
FT                   LQGFWDHYLLIGGVGSTLPLAFLLLRSRAVHLRTIGRMGVVPSFFNINEPILFGAPIIM
FT                   NPLLFLPFIFVPMVNAVIAYTATKLGWIAQVVSLTPWTTPAPIGASWAANWAFSPVIMC
FT                   LLCMVMSAAMYYPFLKVYERTLLKQEQEKQQQAAGEASASA"
FT   gene            33889..35301
FT                   /locus_tag="PC1_0030"
FT   CDS_pept        33889..35301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0030"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   eca:ECA4407 putative glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11093"
FT                   /db_xref="GOA:C6DGK6"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGK6"
FT                   /inference="protein motif:PRIAM:3.2.1.21"
FT                   /protein_id="ACT11093.1"
FT                   /translation="MHDHLQKDFRFPANFWWGSASSAPQTEGESLNYGKSATVWDEWFA
FT                   TQPGRFHQQVGPADTSTFYQHWREDIALLKTLNHNTFRTSISWARLIPDGVGEPNPQAV
FT                   AFYNQVIDEMLAQGITPFINLFHFDMPMVMQRLGGWENRAVVVAYAGYAATCFRLFGDR
FT                   VKHWFTFNEPVVPVEGGYLYDFHYPNVVDFKRAATVAYHTMLAHSLAVKAYREQSQGGE
FT                   IGIILNLTPSYPRSQHPADVKAANIADLMFNRSFLDPALRGEYPQELVDLLQRYGQLPS
FT                   CQPDDRALLADGVVDLLGINYYQPRRIQCRDSLVNPDSPFMPEWFFSSYEMPGRKMNPY
FT                   RGWEIYEPGIYDILTNLRVNYGNPRCFISENGMGVENEQRFDANGQIQDDYRIDFVREH
FT                   LKYVHKGIAEGSNCLGYHMWTFIDNWSWSNAYKNRYGFVQLDLVTQKRTVKKSGEWFAT
FT                   IAAENGFQDVTS"
FT   gene            complement(35464..35721)
FT                   /locus_tag="PC1_0031"
FT   CDS_pept        complement(35464..35721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0031"
FT                   /product="protein of unknown function DUF1471"
FT                   /note="PFAM: protein of unknown function DUF1471; KEGG:
FT                   eca:ECA4406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11094"
FT                   /db_xref="InterPro:IPR010854"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036275"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGK7"
FT                   /inference="protein motif:PFAM:PF07338"
FT                   /protein_id="ACT11094.1"
FT                   /translation="MKNVKTIAAAVVLATMTFGASAAEYVAPSQTQNLEKVGVVTATAQ
FT                   DLSSLQAQLAAKAEKAGAKAYTITSATGNDQLRGSAVIFN"
FT   sig_peptide     complement(35653..35721)
FT                   /locus_tag="PC1_0031"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            35934..37238
FT                   /locus_tag="PC1_0032"
FT   CDS_pept        35934..37238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4405 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11095"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR022223"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGK8"
FT                   /inference="similar to AA sequence:KEGG:ECA4405"
FT                   /protein_id="ACT11095.1"
FT                   /translation="MLNKWGDVLSVEVQLTFNAAGHQLTNINCWSCDGDWLVYDIRPYG
FT                   SSFTGLTIERVHLTSRETEVIYRATAGAHVGVVTCSPQEPLRYVFIHGPENPDGEWQYD
FT                   FHHRRGTIVADCQRDEAITLDAFSITSPYQAGALRGGTHVHVFSPDASRLSFTYNDHVL
FT                   HERDPALNLRNVGVAVPLQAVTVEKRHPREYDGSHYCVLVSQTTPQPQPGSDEINRAYE
FT                   EGWVGTVGYIRQDGSRQRWALAFIGDTRAADGTTVPEIFIVDLPDALEDYAKEGDAPLA
FT                   GTATSMPAPPAGVQQRRLTFTHSRRYPGLVNQPRHWLRASPDGSEIAFLMRDEAGVVQL
FT                   WTISPNGGEPRQVTHTEHGVQSAFNWHPDGRSLAFVCDNSIMLCEAKSGELVRLTARTD
FT                   SAPSADAVVFSPDGKHIAYMREIDGFNQLFVVTSA"
FT   gene            complement(37274..37666)
FT                   /locus_tag="PC1_0033"
FT   CDS_pept        complement(37274..37666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0033"
FT                   /product="protein of unknown function DUF1375"
FT                   /note="PFAM: protein of unknown function DUF1375; KEGG:
FT                   eca:ECA4404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11096"
FT                   /db_xref="GOA:C6DGK9"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGK9"
FT                   /inference="protein motif:PFAM:PF07119"
FT                   /protein_id="ACT11096.1"
FT                   /translation="MTLLKSALFSFIITGSGAVATSGCSSVMTHTGSDQGYYSGMRASM
FT                   DMLRDDDTSWAMMPLVVIDLPFSAVADTVLLPYDYYRSGSDKNKMSTRERISHSEEQNQ
FT                   TASSQLATMPHNDTMPHNNTMPHNQL"
FT   sig_peptide     complement(37577..37666)
FT                   /locus_tag="PC1_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.805 at
FT                   residue 30"
FT   gene            38051..38464
FT                   /locus_tag="PC1_0034"
FT   CDS_pept        38051..38464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0034"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: eca:ECA4403
FT                   heat shock protein IbpA"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11097"
FT                   /db_xref="GOA:C6DGL0"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR023728"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DGL0"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACT11097.1"
FT                   /translation="MRNPDFSPLYRSAIGFDRLFNLLETGQTQSNGGYPPYNVELVDEN
FT                   QYRIAIAVAGFAEQELDITAHDNLLIVKGAHAGEQVARNYLYQGIAERNFERKFQLAEH
FT                   IQVKGANLENGLLYIDLERIVPEAMKPRRIEIK"
FT   gene            38620..39069
FT                   /locus_tag="PC1_0035"
FT   CDS_pept        38620..39069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0035"
FT                   /product="heat shock protein Hsp20"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: eca:ECA4402
FT                   heat shock chaperone IbpB"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11098"
FT                   /db_xref="GOA:C6DGL1"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR022848"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DGL1"
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /protein_id="ACT11098.1"
FT                   /translation="MRNYDLSPLLRQWIGFDKLASSMQGSQEPIDFPPYNIEKKDDNHY
FT                   RITLALAGFRQSDLDIEVEGPRLTVKGSPAPTEKAVEYLHQGLVFKPFTLSFTLAEHLH
FT                   VSDAHFENGLLHIDLVRDVPEALQPQRIAIGGGRPALNQQPAEDA"
FT   gene            39247..40905
FT                   /locus_tag="PC1_0036"
FT   CDS_pept        39247..40905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0036"
FT                   /product="YidE/YbjL duplication"
FT                   /note="TIGRFAM: YidE/YbjL duplication; PFAM: YidE/YbjL
FT                   duplication domain protein; TrkA-C domain protein; KEGG:
FT                   eca:ECA4401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11099"
FT                   /db_xref="GOA:C6DGL2"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGL2"
FT                   /inference="protein motif:TFAM:TIGR01625"
FT                   /protein_id="ACT11099.1"
FT                   /translation="MSDIALTVSMLALVAVLGLWIGNWRIYGVGLGIGGVLFGGIIVGH
FT                   VAHQYQIQLNDDMLHVIQEFGLILFVYTIGIQVGPGFFSSLRVSGLRLNAFALLTVFLG
FT                   CVVTVLLHKLLNIPLPIILGIFSGAVTNTPSLGAGQQILTDLGSSAALVNQMGTGYAMA
FT                   YPLGICGILLVMWLMRVLFRVAVENEAKQFEVSNGQHHEQLHTMNVSVTNTNLQGLAIQ
FT                   DVPILNRDTIVCSRLKRGDELMVPSPQTLIQLGDYLHLVGAKNDLEQARLVIGHEVETS
FT                   LSTRGTDLHVERVVVTNEKVLGRKIRELNLKQNYDVVISRLNRAGVELVASNQASLQFG
FT                   DILNLVGRKTAIDAVADIVGNAQQKLQQVQMLPVFIGIGLGVLLGSVPLMIPGFPVALR
FT                   LGLAGGPLVVALVLGRIGGIGKLHWFMPPSANLALRELGIVLFLSVVGLKSGGDFIDTL
FT                   LNGDGVWWIGYGALITIVPLLLVGILARTLGKMNYLTLCGMLAGSMTDPPALAFANGLH
FT                   PTSGAAALSYATVYPLAMFLRIMSPQLLAVLFLTL"
FT   gene            41490..42902
FT                   /locus_tag="PC1_0037"
FT   CDS_pept        41490..42902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0037"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter; Citrate transporter; KEGG: eca:ECA4400 putative
FT                   sodium:sulfate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11100"
FT                   /db_xref="GOA:C6DGL3"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGL3"
FT                   /inference="protein motif:TFAM:TIGR00785"
FT                   /protein_id="ACT11100.1"
FT                   /translation="MSANNSRFIKLLIILCIAGGLWLLPVPDGVKPDAWHLMAIFIATV
FT                   VGLILSPYPLGAMAMFSLTSVAILGLLSIKDVLAGFSDPTIWMIACAFFISRGFIKTGF
FT                   GRRIGLLFISKLGNSSLGLAYGLVFTDLLFAPAMPSTSARCGGIITPLFRSIAEAYDST
FT                   PEKGTQRRIGAFLVQSIFQCNAVTSAMFMTSMAGNPMVAKLASQFGIHISWTDWALATL
FT                   LPGFLSLALIPYLIYRFYPPELKKTSEMRAIAVERLREMGKMTRDEWVVLGVFLGLVTF
FT                   WVLGSTLNIDATLTALAGLSVLLLSRALSWDDVVGEKEAWHTVVWFAVLMTLAGQLNKM
FT                   GLIAWLGGLAGSAVSGMHWLPMLGLLLLVYYYSHYLMASAIAHISAMYAIFVSIALAAG
FT                   APPMLTVLVFGIFSNLFMSTTHYSSGPAPILFGTGYMPLGTWWKIGFSISLVIIPIWLG
FT                   VGSMWWKVLGFW"
FT   gene            43093..44721
FT                   /locus_tag="PC1_0038"
FT   CDS_pept        43093..44721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0038"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="KEGG: eca:ECA4399 sensory histidine kinase DcuS;
FT                   TIGRFAM: PAS sensor protein; PFAM: ATP-binding region
FT                   ATPase domain protein; PAS fold domain protein; PAS fold-4
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11101"
FT                   /db_xref="GOA:C6DGL4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGL4"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACT11101.1"
FT                   /translation="MGKKKAPLKLGTSVFLMVSVVLGAVLLVVYSLLFFRINQLSEDHL
FT                   REKAFAIARTFAASPVVIDELKGIGRPEEVQIAAETIRQRNQLLFVTVTDMDAVRHSHP
FT                   EPERIGEHFAGRDIYPALLGMENTAINRGTLDPALRVFTPVFDSNHKQVGVVALGIALT
FT                   SVQKVISDNRWMIPWTLLAGALVGWLGTLILVKVLKRIMLGFEPFEISNLFEQRNAMLK
FT                   HIKEGVIAVDQNGRITVINDEARRLFRQNKPQGSETPSSKPAERVSEQWLEHLHLKQVL
FT                   ESGTPRRDEEINFNGHLLLTNTVPVFVKGDIIGAIATFRDKTEISQLLQRLSGMSYYAD
FT                   ALRAQSHEFMNKLHVILGMLHLKYYSQLEDYILKTANNYQAEIGSIIRKVKSPVIAGFL
FT                   LGKINRARDLGITLSISEESLLPDTDDVDATNELITVLGNLIENAMDAIDGQENCEISV
FT                   SFHHQNGRLHCTVGDDGPGISPESQARIYEQGFSTKGSGRGIGLFLTKQSLEKIGGTIE
FT                   FESEPEVYTQFFVTIPYQARLFDHD"
FT   sig_peptide     43093..43164
FT                   /locus_tag="PC1_0038"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.615 at
FT                   residue 24"
FT   gene            44714..45436
FT                   /locus_tag="PC1_0039"
FT   CDS_pept        44714..45436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0039"
FT                   /product="response regulator receiver and unknown domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: eca:ECA4398 DNA-binding
FT                   transcriptional activator DcuR"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11102"
FT                   /db_xref="GOA:C6DGL5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGL5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACT11102.1"
FT                   /translation="MINVLIVDDDAMVAELNKSYLNQVSGFSCYATVPTLQQARNLLMQ
FT                   PDSEIDLVLLDIYMQQDNGLDLLPTIREFSEKTDVIIISSASDVYTIKKALHYGVVDYL
FT                   IKPFQFSRFEQALTAYREEANLFKHRDFVGQSDIDNLIRRTSSSTVSERKKLPKGLTSL
FT                   TLRTVCEWIEGNQGIEFSTEMLANAIGISRVSCRKYLIYLSDTGILTTNILYGSTGRPV
FT                   YLYRLLPEKQDSLRQYCE"
FT   gene            complement(45514..45918)
FT                   /locus_tag="PC1_0040"
FT   CDS_pept        complement(45514..45918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0040"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bte:BTH_I1429 metallo-beta-lactamase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11103"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11103.1"
FT                   /translation="MKKALSVLLLSGLLATSATISAQEIDPHAVPLATASEFIATGKSY
FT                   NVDFGDQKFRLDFKSPAEMTFTSPDGKNKADVAITTTKVGDGVYMIYWSRRAGQHVVHV
FT                   DDFKNGVSYTNIVLPDGSISRRQGTLIEIK"
FT   sig_peptide     complement(45850..45918)
FT                   /locus_tag="PC1_0040"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 23"
FT   gene            complement(45955..46509)
FT                   /locus_tag="PC1_0041"
FT   CDS_pept        complement(45955..46509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0041"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   elf:LF82_p421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11104"
FT                   /db_xref="GOA:C6DGL7"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGL7"
FT                   /inference="protein motif:PFAM:PF00258"
FT                   /protein_id="ACT11104.1"
FT                   /translation="MTNVAVVYFSGYGHTRRIAEDVAEGADAVLVAIDDDGHVDEQGWE
FT                   TLNAADAIIFGAPTYMGSVPWQFKKFADATSKAWFTRAWQDKIFGGFTNSASLNGDKQV
FT                   TLIYLQTLASQHGGIWVSLGLAPSNALATTRNDVNNLGGSVGLLVQSPSDAGAEAIPSG
FT                   DLDTARHYGKRVADIARRFKD"
FT   gene            46614..47012
FT                   /locus_tag="PC1_0042"
FT   CDS_pept        46614..47012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0042"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: azo:azo3515
FT                   putative transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11105"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGL8"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACT11105.1"
FT                   /translation="MTKNSATERKETEAGEQRYNVYLQGCPARMVLERLADKWALLIVG
FT                   LLRTGPLRFNQLRREIEGVSQKALSQTLKKLERDGLLSRKAFPTVPVTVEYALTPLGKT
FT                   LSEAVEPLARWAEKNIEDVLLAQSHYDQ"
FT   gene            complement(47050..48393)
FT                   /locus_tag="PC1_0043"
FT   CDS_pept        complement(47050..48393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0043"
FT                   /product="Citrate carrier protein"
FT                   /note="PFAM: Citrate carrier protein; KEGG: eca:ECA4395
FT                   Na(+)-malate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11106"
FT                   /db_xref="GOA:C6DGL9"
FT                   /db_xref="InterPro:IPR004679"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGL9"
FT                   /inference="protein motif:PFAM:PF03390"
FT                   /protein_id="ACT11106.1"
FT                   /translation="MKKIETDILCENNLALETQESFIGSFFKKKVGSVPVALFMAIAAI
FT                   VAIAAYEGYLPKNMIGGFAVIMTMGFLLAHIGSNIPVFKDIGGPAILCLMVPSVMVYFD
FT                   LFNDNTMKTVHLLMKEANFLYFVIACLVVGSILGMNRKILIQGMVRMFVPLVIGTATAL
FT                   ATGLLVGKLCGYSFYHTFFFIIVPIIGGGIGEGILPLSLAYSAILGQTPDVYVAQLAPA
FT                   AVVGNIFAILCAGVLSRLGMRRKDLNGEGRLVRSDEDNAMFAVNEAPKPVDFHLMGGGL
FT                   LMICAFFIVGGLFEKLVHIPGPVLMILIAVFCKYGRVIPAIMETGAHSVYKFVSSSLVW
FT                   PLMIGLGMLYIPLESVVAVFSVGYVIVCGSVVLSMALVSFLIAPYLNMYPIEASIVTTC
FT                   HSGLGGTGDVAILSASNRMSLMPFAQIATRIGGASTVIAATLLLGWFA"
FT   gene            49825..51432
FT                   /locus_tag="PC1_0044"
FT   CDS_pept        49825..51432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0044"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: eca:ECA4394 periplasmic dipeptide transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11107"
FT                   /db_xref="GOA:C6DGM0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGM0"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACT11107.1"
FT                   /translation="MEKSLVKSRVLKFGLGLLAMSVAAGVQAKTLVYCSEGSPEGFNPQ
FT                   LFTSGTTFDASSIPIYNRLVEFKDGTTDTSPGLAEKWDISEDGKTYTFHLRKGVKWQDS
FT                   KDFKPSREFNADDVIFSFMRQQDANHPYHKVSGGSYEYYQGMGMPELVSKIEKVDDYTV
FT                   RFVLNRPEAPFLANLAMDFASILSAEYADQMLKAGTPEKIDLNPIGTGPFQLQQYQKDS
FT                   RILYKAFEGYWGSKPGVDRLVFSITPDASVRYAKLQKDECQIMPYPNPADLAKMKEDKN
FT                   ITLMEQPGLNVGYLAYNVEKKPLDNVKIRQALNYAVNKTAIIEAVYQGAGQAATNLIPP
FT                   TMWGYNNDVKDYSYDPEKAKALLKEAGMADGFSIDLWAMPVQRPYNPNARRMAEMIQSD
FT                   WAKVGVKAKIVTYEWGEYLKRAKDGEHQTVLMGWTGDNGDPDNFFATLFSCDAAKNGSN
FT                   YSKWCYKPFEDLIQPARAVSDHEKRIELYKQAQVVMHDQAPALIVAHSTVYEPVRKNVK
FT                   GYVVQPRGVHSFNNVTLD"
FT   sig_peptide     49825..49911
FT                   /locus_tag="PC1_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 29"
FT   gene            51666..52685
FT                   /locus_tag="PC1_0045"
FT   CDS_pept        51666..52685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0045"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4393 dipeptide
FT                   transporter permease DppB"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11108"
FT                   /db_xref="GOA:C6DGM1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGM1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT11108.1"
FT                   /translation="MLQFILRRLGLVIPTFIGITLLTFAFVHMIPGDPVMIMAGERGIS
FT                   AERHAQLLAEMGLDKPLWQQYIHYIGGVLQGDLGISLKSRIPVWEEFVPRFKATLELGI
FT                   CAMLFAIAVGIPVGVLAAVKRGSIFDHTSVGLALTGYSMPIFWWGMMLIMLVSVQLNLT
FT                   PVSGRISDTIFLDDSMPLTGFMLIDTLFWGEKGDFIDAVEHMILPAIVLGTIPLAVIVR
FT                   MTRSAMLEVLGEDYIRTARAKGLSRLRVIVVHALRNAMLPVVTVIGLQVGTMLAGAILT
FT                   ETIFSWPGLGRWLIDALQRRDYPVVQGGVLLVATMIILVNLLVDVLYGVVNPRIRHKK"
FT   gene            52699..53601
FT                   /locus_tag="PC1_0046"
FT   CDS_pept        52699..53601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0046"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4392 dipeptide
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11109"
FT                   /db_xref="GOA:C6DGM2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGM2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT11109.1"
FT                   /translation="MTQVTEPVVNSAPKPMTPLQEFWHYFKRNKGAVVGMVYVVLMLVI
FT                   AIGANVLAPHAPAEQFRDALLRPPVWQEGGSWQFILGTDDVGRDVLSRLMYGARLSLLV
FT                   GCLVVALSLVLGVIFGLLAGYFGGVVDALIMRIVDIMLALPSLLLALVLVAVFGPSIVN
FT                   ASLALTFVALPHYVRLTRAAVLVEVNRDYVTASRVAGAGSARQMFVNILPNCLAPLIVQ
FT                   ASLGFSNAILDMAALGFLGMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAILLTVL
FT                   AFNLMGDGLRDALDPKLKQ"
FT   gene            53615..54595
FT                   /locus_tag="PC1_0047"
FT   CDS_pept        53615..54595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0047"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: eca:ECA4391 dipeptide transporter ATP-binding
FT                   subunit; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11110"
FT                   /db_xref="GOA:C6DGM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGM3"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACT11110.1"
FT                   /translation="MALLNVDKLSVHFGDEDLPFRAVDRISYQVEEGQVVGIVGESGSG
FT                   KSVSSLAIMGLIDYPGKVMADKLEFNQRDLKKISEKERRNLVGSEVAMIFQDPMTSLNP
FT                   CYTVGYQIMEAIKVHQGGNRKTRRQRAIDLLTLVGIPDPASRLDVYPHQLSGGMSQRVM
FT                   IAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQRENMALILITHDLALVAEAAH
FT                   HIIVMYAGQVVESGKAADIFSAPRHPYTQALLRALPEFAADKSRLASLPGVVPGKYDRP
FT                   NGCLLNPRCPYAQDRCRQEEPALRDIPGRQVKCHTPLDDAGRPTL"
FT   gene            54592..55602
FT                   /locus_tag="PC1_0048"
FT   CDS_pept        54592..55602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0048"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: eca:ECA4390 dipeptide transporter ATP-binding
FT                   subunit; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11111"
FT                   /db_xref="GOA:C6DGM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGM4"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACT11111.1"
FT                   /translation="MSELNATSQPYLLHAIDLKKHYPVKKGFFAPERMVKALDGVSFTL
FT                   ERGKTLAVVGESGCGKSTLGRLLTMIETPSDGELYYQGQDLLKPDPEAQKLRRQKIQIV
FT                   FQNPYGSLNPRKKVGQILEEPLLINTELSKAERREKALAMMAKVGLKTEHYDRYPHMFS
FT                   GGQRQRIAIARGLMLDPDVVIADEPVSALDVSVRAQVLNLMMDLQQDLGLSYVFISHDL
FT                   SVVEHIADEVMVMYLGRCVEKGSKDAIFNNPRHPYTQALLSATPRLNPDLRRERIKLTG
FT                   ELPSPLNPPPGCAFNARCQRCFSTCTQFQPQLKTYGEQQVACFAVDQDEQGIAVA"
FT   gene            complement(55696..55977)
FT                   /pseudo
FT                   /locus_tag="PC1_0049"
FT   gene            complement(56142..56579)
FT                   /locus_tag="PC1_0050"
FT   CDS_pept        complement(56142..56579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ecr:ECIAI1_0545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11112"
FT                   /db_xref="InterPro:IPR025850"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGM5"
FT                   /inference="similar to AA sequence:KEGG:ECIAI1_0545"
FT                   /protein_id="ACT11112.1"
FT                   /translation="MNKLIELASKYGEIKRQEIKLSECLSAITNFGYLVSDGLISFLQE
FT                   YNGLQGNHSAYKNNDAPSKYFYINPEKAILELYREQVESYEQITQCPLVPIGECDNGYI
FT                   ILMYGDGVIYGVFDECVYKYGQDIESCFDTLINGKEVAEIS"
FT   gene            complement(56584..60897)
FT                   /locus_tag="PC1_0051"
FT   CDS_pept        complement(56584..60897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0051"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; PFAM: PAAR
FT                   repeat-containing protein; YD repeat-containing protein;
FT                   KEGG: eca:ECA4278 rhs-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11113"
FT                   /db_xref="GOA:C6DGM6"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGM6"
FT                   /inference="protein motif:TFAM:TIGR01643"
FT                   /protein_id="ACT11113.1"
FT                   /translation="MLSDILNRVARVGAMHAGKGPTPPAERPQPGQGKAPTSPGKTIKH
FT                   KSFLGALAGAIAGAVVAAVVFAAAAAVAGAIAVAVVGTGGMGAALVVGAVKLAVGFGAV
FT                   SLLGGLISSVSSKVSAMVDSGSPPFGPVSSGSGTVFAEKQKISRAEVDTVACTKHNSPQ
FT                   LIAQGSETVYVNGSPAARIDDKTVCGATIKEGASTVFFGSGQQTCLKISDEFSWWEKAL
FT                   LIAVEFLVPPSRGMFKGLGKLFTRGPTAVLKGIRMGALRTAVGLRKAVRCASKGFKNNK
FT                   GLARIKEATRGFLKDPVYIPSGNVIEMRQDIELGQTLPLLFERTYRSSSTHTGLLGRGW
FT                   YDTWSETAQVSRDGLNTHVVITLAQGYDIDFTFHQDVQSVFCPLYPAFTLYRRAKGFSL
FT                   WDRDSLTWREFDVPQGDRLLLSSIHDPHDNRITLIRDPKGYLRKIRHSDDIELLLVWRG
FT                   ESLHQIQRIDTGQKTLLAEYRQDEQGRLIEADAAHAYHLFYDYDSENRLTRWHDNDQTW
FT                   ARYEYDYQGRCVYTTCADGYLTAHFEYLDDRVVMTDGLGQRSEFGFNALSLMSWEKSPL
FT                   GRITRYDYDDHGNLLREISPAGRVVEFRYLDDSGLVSAFTDGSGHTWAYDYDEAQRLCG
FT                   ITDPLGRIWQWAFDETGNPEKLTGPDTREVRFTWNRHGLLTQVSDQAGEVQARLRYDHR
FT                   QRLLSASDALGRTQQLRYDQQDRVVQWQRPDGAQYRLGYRRASWKLPEQLVRPDEKEEK
FT                   RQYDKHNNLLSYVDGNGALWRQSYGPFDLLTSRTDAQERTWRYEYDKESQQLVAVIAPD
FT                   GSRWQWWLDADARVIRERDMAGTDTHYTYDEDGHCIAIRNGEGETRHFLYDGRGLLIKE
FT                   TAPDDTQYYRYDAAGRLTEVTSTTSHVQLEYDLRDRVVREWLNGTLLTRQFDDTARTVT
FT                   RTLVWENESDNALVSAFSYSAAGELQQVQLPDGAELTLAHDAAGRESSRSGGAFVQHRE
FT                   YDVMGWLAREMSGQQQDGRLHATQTKEYLYDGAGNLAGVRHNRETRGYRLDATGRVLSV
FT                   LSGGAGRTVDTDEAYRYTRNGLPQETSRLTEWQAGRLTQHDDTHYQYDKAGRLIRKQVV
FT                   QPGYRPQVWHYRWDSRNQLRVVDTPTGERWFYRYDPFGRRTGKRCEQTQDDIRYLWDGD
FT                   QIAEVRHYRNGKQIARRHWVHNGWELLVQQRQNTDGRWETDFVTSSQNGEPQALYKPDG
FT                   TLRWQAPKSTLWGQRPGSTEDSADPGLAFAGQYRDSESGLCYNRFRYYDPNGGCYVSPD
FT                   PIGVLGGESNYAYVPNPNTWVDPFGLAGCSKELAQRKAQELRDSATSNTQRSKLPRATS
FT                   AVVDKATGKVYYGFSGRPLPSTIHPHLAERMPSPSLERWPVQNCAEFKGVNQALLDGAR
FT                   LENLEVHTVKTISGEAFPMCSNCQTTIFGTIVTSG"
FT   gene            complement(60909..61316)
FT                   /locus_tag="PC1_0052"
FT   CDS_pept        complement(60909..61316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0052"
FT                   /product="Domain of unknown function DUF1795"
FT                   /note="PFAM: Domain of unknown function DUF1795; KEGG:
FT                   eca:ECA4277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11114"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGM7"
FT                   /inference="protein motif:PFAM:PF08786"
FT                   /protein_id="ACT11114.1"
FT                   /translation="MYQMNEGTLAIPADWRDESLHVFVLPGDAINLVVNRTPIDFGLTA
FT                   ETVYQQTLAQFAAHLKGYEERGVWTLTLDGQPAHGLEYTWRSPEGPMHQVVVMQVRGEL
FT                   LLTFTVTVAGELSAEQKTAMLAVVETFKAAT"
FT   gene            complement(61325..63178)
FT                   /locus_tag="PC1_0053"
FT   CDS_pept        complement(61325..63178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0053"
FT                   /product="type VI secretion system Vgr family protein"
FT                   /note="TIGRFAM: type VI secretion system Vgr family
FT                   protein; Rhs element Vgr protein; PFAM: Rhs element Vgr
FT                   protein; KEGG: eca:ECA2867 putative rhs accessory genetic
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11115"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGM8"
FT                   /inference="protein motif:TFAM:TIGR03361"
FT                   /protein_id="ACT11115.1"
FT                   /translation="MANSTGLQFTVKVGALPASTFAVVDFQLSEALNQPFALSLNLASP
FT                   LPGIDFGAVLDQPCELLVWYEGELQRRVSGIVSAFAQGDTGFRRTRYQAEVRPTLWRLG
FT                   LRTNARIFQAQKPEAIIGALLEEAGITDYAFALRNEHAVREYCVQYRESDLAFIARLAA
FT                   EEGLFFFHEFEEGKHRVVFADDAGALAKGPELFFNLATQGLSEGAYVRRFRYAEAVSTA
FT                   EVALKDYSFKTPAYGLLHQKISGELEHQRESYQHFDYPGRFKQDPSGKAFTGYRLDALR
FT                   AGAMTGSGESNAAELMPGSSFTLTEHPNLALNIGWQLVAITHSGQQPQALEEESGGEPT
FT                   TYSNSFEVVKASTTWRADLPYKPMVDGPQIATVVGPAGEEIYCDQYGRVKLQFPWDRYG
FT                   ASDDQSSCWVRVSQGWAGGQYGLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPSP
FT                   YPLPANKTRTTLRTTTHKGAGFNELRFEDQAGQEEVFIHAQKDMNTVVLNNRSTSVNVD
FT                   HNENIGRDQTVVVQQNQTVSVIADQVTEIQGEQTVVVKKNRSTVVEDNETLRVTNNIFI
FT                   HAEDGSIQIGTGAGYISIKHSGDIEIVGNNLTLNGTRIDLN"
FT   gene            complement(63269..63787)
FT                   /locus_tag="PC1_0054"
FT   CDS_pept        complement(63269..63787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0054"
FT                   /product="type VI secretion system effector, Hcp1 family"
FT                   /note="TIGRFAM: type VI secretion system effector, Hcp1
FT                   family; PFAM: protein of unknown function DUF796; KEGG:
FT                   eca:ECA2866 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11116"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGM9"
FT                   /inference="protein motif:TFAM:TIGR03344"
FT                   /protein_id="ACT11116.1"
FT                   /translation="MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFK
FT                   HIVTVPTDPQSGQPSGQRVHKPFKFTVALNKAVPLMYNALASGEMLPTVTLKWYRTSVE
FT                   GKQEHFFSTVLTDSTIVDINCQMPHCQDPSKLDYTQLIEVSLAYRKIDWEHTVAGTSGS
FT                   DDWRAPIEA"
FT   gene            complement(64344..65594)
FT                   /locus_tag="PC1_0055"
FT   CDS_pept        complement(64344..65594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0055"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   eca:ECA4386 valine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11117"
FT                   /db_xref="GOA:C6DGN0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGN0"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACT11117.1"
FT                   /translation="MNFSLFGKKFTRHAGITQLMDDLNEGLRTPGAIMLGGGNPAHIPE
FT                   MDSYFQQLCQDMLEQGKLTEALCNYDGPQGKDTLLKALAELLSNELGWQIGPQNIALTN
FT                   GSQSAFFYLFNLFAGRHSDGSLKKVLFPLAPEYIGYSDSGLDDNMFVSVRPQIELLPEG
FT                   QFKYHVDFDNLSITDDIGLVCVSRPTNPTGNVLTDDELMRLDILAQQHKVPLLIDNAYG
FT                   VPFPGIIFTDATPLWNPNIILCMSLSKLGLPGSRCGIVIADEKVISAIGNMNGIISLSP
FT                   GAVGPALAHEMIQRGDLLRLSNDVIRPFYQQRVMETIAIIRRYLSPEQCLIHKPEGAIF
FT                   LWLWFKDLPITTEILYQRLKKRGVLMVPGHYFFPGLDQGWPHAHQCMRMNYVPEPEKIE
FT                   QGIAILAEEVEKAMQEG"
FT   gene            65988..67196
FT                   /locus_tag="PC1_0056"
FT   CDS_pept        65988..67196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0056"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11118"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGN1"
FT                   /inference="similar to AA sequence:KEGG:ECA4385"
FT                   /protein_id="ACT11118.1"
FT                   /translation="MKKLLAIGITLALTSWQLSAQTFVLTDAESSVEKGNWQIGSDALK
FT                   IKNQHFSIEQKVLHGGRQEGSKVITITSQDGLKIALSPTRGMNLLHVTGKNIRLGWDSP
FT                   VDEVVNPNTINLESRNGLGWLEGFNEMMVRCGFEWTGHPVVSEGMIYTLHGRAGNTPAS
FT                   KVVVEVSDSAPHTITVRGLLKENSFKKSNLETWTELRYVPGSESFTVHDVLTNKADYAR
FT                   DYQIIYHSNFGTPILEDGARFIAPVKEISPFNDHAKAGLATWQTYKGPTKDFDEMVFNI
FT                   TPYTDGQGKTLAALVNKAGDKGVSIAFDTHQLPLLTLWKNTDTEKQGYVTGIEPGTNYA
FT                   YPVTIEREQGRVKKLQPGQSTTFELTYSLLSSAEAVQKTEQKVKAIQGDNKTTLTEKPI
FT                   AIE"
FT   sig_peptide     65988..66050
FT                   /locus_tag="PC1_0056"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 21"
FT   gene            67360..68271
FT                   /locus_tag="PC1_0057"
FT   CDS_pept        67360..68271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0057"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: eca:ECA4384 amino acid metabolite
FT                   efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11119"
FT                   /db_xref="GOA:C6DGN2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGN2"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACT11119.1"
FT                   /translation="MSVKDALLALCVVVLWGVNFVVIKVGLNDMPPFLLAGLRFSLVAL
FT                   PAIFFVPFPRIPLKWLIAYGMTISFGQFGFLFLAIKLGMPAGIASLVLQAQAFFTLLVG
FT                   AVLLSEKLRWNHVVGILVAAIGMVVLAEGRTALQMSSGMTTTTLLLTLAAALSWAVGNI
FT                   VNKVIMSKNSDVRIMSLVVWGALVPVVPFFISSWLFEGRDAIVHSLTTIQLPTILSLAY
FT                   LAFAATIIGYGIWGSLLARYETWRVAPLSLLVPVVGLVSAAVFLGESLSLLQIMGAVLI
FT                   MAGLLVNVFGARLRSWLPVRQL"
FT   gene            complement(68345..69790)
FT                   /locus_tag="PC1_0058"
FT   CDS_pept        complement(68345..69790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0058"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: eca:ECA4383 altronate
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11120"
FT                   /db_xref="GOA:C6DGN3"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGN3"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ACT11120.1"
FT                   /translation="MKTLNRKDFPGACYPTKVIQFGEGNFLRAFVDWQLDVLNEKTDLQ
FT                   AGVTIVRPINTDFPPSLNTQDGLYTTVIRGLNEQGEAVSDARLIRSVNNEINPYQHFAD
FT                   YLALAHNAAIRFVFSNTTEAGISYHAGDSVNDTPPVSFPAKLTRLLLERFTHFNGENDK
FT                   GWVIIPCELIDYNGEALKALVLRYAQEWQLSPAFLDWIETANTFCSTLVDRIVTGYPRE
FT                   ESSAQEEELGYHDAFLDTAEHFYLFVIQGPGWLADELKLAECPLNIRIVDDIRPYKERK
FT                   VAILNGAHTALVPVAWLCGLDTVGEAMQDADVRRFVENTLHQEIIPVLDLPANELREFA
FT                   DAVTGRFQNPYIRHQLLSIALNGMTKFRTRILPQLLAGQRDARFPARLTFALAALIVFY
FT                   RGERAGETYPLQDDEQWLTRYRQLWPRVGTDLTVHELVNEVLADTAHWGEDLTQRSGLV
FT                   EQVAADLGNILTQGMRQALKAQG"
FT   gene            complement(69804..70826)
FT                   /locus_tag="PC1_0059"
FT   CDS_pept        complement(69804..70826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0059"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase GroES domain protein;
FT                   Alcohol dehydrogenase zinc-binding domain protein; KEGG:
FT                   eca:ECA4382 putative zinc-binding dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11121"
FT                   /db_xref="GOA:C6DGN4"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGN4"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACT11121.1"
FT                   /translation="MSTMNTLICQEPKKLIWKKREIPIPGEGETLIKIKSVGICGTDIH
FT                   AWGGNQPFFSYPRVLGHEICGEVVDTGKNVHQFKKGQQVAVIPYVACQQCPACKSGRTN
FT                   CCEKISVIGVHQDGGFSEYLAVPATNVLLAEGIDPQAAALIEPYAISAHAVRRAKVLQG
FT                   EQVLVVGAGPIGLGAAAIAKADGAHVVVADTSAARREHVIAHLNLSVVDPSAEDFEAQL
FT                   RAEFGGSLAEKVIDATGNQHAMNNTINLIRHGGSIVFVGLFKGDLQFSDPDFHKKETTM
FT                   MGSRNATPEDFSKVGRLMSEGKLTAEMMLTHRYSFSTLADIYEKDVINNRELIKGVITF
FT                   "
FT   gene            70969..71883
FT                   /locus_tag="PC1_0060"
FT   CDS_pept        70969..71883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0060"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: GntR domain protein; KEGG: eca:ECA4381
FT                   putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11122"
FT                   /db_xref="GOA:C6DGN5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGN5"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACT11122.1"
FT                   /translation="MSRSQNLRHNVINQIIDDMARGHIPSPLPSQNALAEMYNISRTTV
FT                   RHILVHLCDCGVLIQVGSDYVIARKPDHDDGFTCITAPMAEQNRIFEQAFFTMINQRLL
FT                   RVGETFSELQLARDAGVSPVVVREYLLKFGRYNLIQNEKRGQWSMKEFDQAYAEQLFEL
FT                   REMLETHALQHFLNLPDDDPRWLEAKTLLERHRMLRDSIGNSFRMFSQLDRSFHALLLS
FT                   AAENVFFDQSLEIISVIFHFHYQWDESDLKQRNIIAIDEHMTILSALICRSDLDATLAL
FT                   RNHLNSAKQSMIRSINQTVRADY"
FT   gene            72097..73446
FT                   /locus_tag="PC1_0061"
FT   CDS_pept        72097..73446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0061"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA4380 sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11123"
FT                   /db_xref="GOA:C6DGN6"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGN6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACT11123.1"
FT                   /translation="MEKNNITLDPRSSFDTRSSAPPEGIIQRSSRIKRIQTTAMILLFF
FT                   AAVINYLDRSSLSVANLTIRQELGLSATEIGALLSVFSLAYGIAQLPCGPLLDRKGPRI
FT                   MLGLGMFFWSLFQALSGMVHSFTQFVLVRIGMGIGEAPMNPCGVKVINDWFNIKERGRP
FT                   MGFFNAASTIGVAISPPILAAMMLVMGWRGMFITIGLFGILLAIGWYMLYRNREQIELT
FT                   ADEQAYLNAGSVNARRDPLSFIEWRSLFRNRTMWGMMLGFSGINYTAWLYLAWLPGYLQ
FT                   TAYNLDLKSTGLMAAIPFLFGAAGMLVNGYVTDWLVKRGMEPIKSRKICIIAGMLCSAA
FT                   FTFVVPQATTSIEAVLLISMALFCIHFAGTSCWGLIHVAVASRMTASVGSIQNFASFIC
FT                   ASFAPIVTGFIVDTTHSFRLALIICGCVTVLGALAYVFLVRQPISDPRKD"
FT   gene            73711..75489
FT                   /locus_tag="PC1_0062"
FT   CDS_pept        73711..75489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0062"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="KEGG: eca:ECA4379 gamma-glutamyltranspeptidase;
FT                   TIGRFAM: gamma-glutamyltransferase; PFAM:
FT                   gamma-glutamyltranspeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11124"
FT                   /db_xref="GOA:C6DGN7"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGN7"
FT                   /inference="protein motif:TFAM:TIGR00066"
FT                   /protein_id="ACT11124.1"
FT                   /translation="MKTKNTTSGKWLLSLSVAALLVSGAVQAASAPAVEAKNGMVVSSQ
FT                   YLASQIGVDIMKMGGNAIDAAVAVGYAQAVVNPCCGNIGGGGFMTLHLADGKDTFINFR
FT                   ETAPAAASANMYLNADGSVKKDASLYGYLAAGVPGTVLGLDTALQKYGKLTREQVMAPA
FT                   IKLAREGFELTRADTDILDTTVKRFKADPEAARIFLRPDGSPLQPGDKLVQTDLANTLA
FT                   AIAAKGPDAFYKGEIPQAVEKAAKQGGGILTAADFADYRITETAPVTCNYRGYQFVSSP
FT                   PPSSGGVTMCEILNIVEGYDMKSTGFNSAATVHVLTEAMRHAYMDRNTYLGDPAFVSNP
FT                   VERLLSKDYAAEIRKQIEPENATPSKNVQPGVGPHERPETTHYSIVDNQGNAVSTTYTV
FT                   NGRFGSVVIAPGTGFFLNNEMDDFTVKVGEKNLYGLVQGERNSIAPGKRPLSSMSPSLV
FT                   TKDGKVFMVLGSPGGSRIITITLQTALNIIDHGMAPQEAVDAPRIHHQWLPDEVYYEQR
FT                   GLSADTLNLLKQRGYKMVEQTPWGAAELILVGLPGAAGVTPADSGNDSAVSGKVREGYL
FT                   YGANDIRRPAGAAIGY"
FT   sig_peptide     73711..73797
FT                   /locus_tag="PC1_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 29"
FT   gene            complement(75526..75849)
FT                   /locus_tag="PC1_0063"
FT   CDS_pept        complement(75526..75849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0063"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pmr:PMI1126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11125"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGN8"
FT                   /inference="similar to AA sequence:KEGG:PMI1126"
FT                   /protein_id="ACT11125.1"
FT                   /translation="MNKNEIYVKMLILAIPYIRNVQSHKGRTDRSCYHEAELVHNLAYT
FT                   ILTPGFEDHDIYFLNNQARYYIENCSDEIALNYNEHKRLITELIKAVPCDLKDKLTWAG
FT                   PTQ"
FT   gene            complement(75934..76398)
FT                   /locus_tag="PC1_0064"
FT   CDS_pept        complement(75934..76398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: plu:plu3572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11126"
FT                   /db_xref="InterPro:IPR025459"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGN9"
FT                   /inference="similar to AA sequence:KEGG:plu3572"
FT                   /protein_id="ACT11126.1"
FT                   /translation="MNTVNSRITPPNPNYETCLECRAKLLIYPGEMHPDEVSAILNIEP
FT                   TQKNIIGDRKTNSLGRTREVKISGWFLSSEDFISSKDLRDHIDWIIAKLDPCQEGLKKL
FT                   QNIPGVKMTLSCVWWSAVGHCGPVLWPEQMKALADLDLECAFDIYFFPEE"
FT   gene            complement(76395..81566)
FT                   /locus_tag="PC1_0065"
FT   CDS_pept        complement(76395..81566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0065"
FT                   /product="filamentous hemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; adhesin HecA family; PFAM: protein of
FT                   unknown function DUF637 hemagglutinin putative; filamentous
FT                   haemagglutinin domain protein; Haemagluttinin
FT                   repeat-containing protein; KEGG: plu:plu3064 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11127"
FT                   /db_xref="InterPro:IPR006915"
FT                   /db_xref="InterPro:IPR008619"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025157"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGP0"
FT                   /inference="protein motif:TFAM:TIGR01901"
FT                   /protein_id="ACT11127.1"
FT                   /translation="MEKFNNRATRGLSYLLIYLTAIQPLHPAFAALTPDGPRTQVNNAG
FT                   AVPVINIATPNAAGVSHNTYKDFSVGTPGAVLNNSIAAGQSQLAGQLNANANLNGKAAE
FT                   LIINEVTGSTRSDLQGKIEVFGHKANVLIANPNGITCDGCGFINTPSATLTTGKPVLDQ
FT                   QGALEALEVKKGSITIGGKGLDGSATDYVDILSRATELNGKINAKNLTLTQGSNRVDVK
FT                   TGTVAPIAGEGAKPLLAVDTKALGGMYAERIRLVATEDGVGANVANLTSSQQGITLDSK
FT                   GKIQLGNVHAKTDLNLTAQQVDIAAGNTVKSDRDITLASTVLNNRGNIIAGEDMRLFND
FT                   SLTNTQATIQANNNLWIQKDATGNKGVKVENRSGTIKTNTGDLVIRTEQLDNVVEQFSV
FT                   NKISTPANSTSIDGQFGIMIDGTGPDSFVTIYTGVVDDRNLRWIGSFKFTESPYANTEK
FT                   NKYTFISSREGNISSGKNIYINSSELNNKYSTISALGDIISTGKNANILNHSIGDSNSY
FT                   VKLALKFDERDIGIDISPIPAGFNVDEYPLWGDAPVPLVRDGNKKTWFEKEYVSSKIHA
FT                   GGSLVLDFTDTIKIEDNAPENLTELSEKIYSTPHSYSITGKEIIFKSKDIKNQSSVKST
FT                   GNLSLLSEGNIKLTGGELNSAGDLSILASNGIDANQNKFLGRNITIISREGDTSLYTDS
FT                   AAKHFSVDGVRQFSTLNATENLSIQSGKDILLNGIEIGKAKNISLISGNNITVKNDEAI
FT                   LDPQKIGSTFTDPEKQKKFDYAFNHLGNITSTDSITLNARNVLDIAGISLEATKDINLT
FT                   AGDNINLNPREVNTIPEALFANSRQTELSSTINAGNQLLISSGKDLLAQSASLSANGNV
FT                   ALLAGNSLKLLATAYSAIDSQNDNNKDDRNVTAKVHAGKNLTVASNGELIATGTDFSSG
FT                   GDMTLSSGGKMEFNAVANHIYREGSNEYSESVTQKNVVLNSSGILTLLSNGSILFQATQ
FT                   LLAKGTLDAAAKGGFLYAQAVEESNHYEKTTTKRKWYGKKTTIRQTSHNVTNKVTEFTA
FT                   GGDINLLSRDDSTYEASKINAGKNAKLTSTQGSINFKAVKDTAFEQTITTSKGFFIKSN
FT                   DKGYTKDTWLLPSIYSGGQLTIDAATGITADAKTQNAQSLQNALLTLGNNPGTAWLKDL
FT                   NARPDVQWNAVQDAYSTWNHTTQSLNPVVGAVIAIAVAAVTAGTGLAAAAGQLAAGAVG
FT                   TGASATTIAVVNGAAYSGMTALTSQAAVALVDNKGNLSKTFQAMSSSDSVKSLVTSMVI
FT                   GGALAGFDEVMQFSQAANGTTVIDPAKAKLPMLSNGDWSKVAQRVAGQSVISSSIGTAI
FT                   NGGSFKDNFTTALLSNIGSQINAEGAKFIGDKGEVLGITGKTISHAVVAGVAAEISGGN
FT                   VKGAAAGALAAELAAISLGNTFVDPALREIQITSTGRIIGALAGAAITGKATGVNSGAS
FT                   AAESVLLYNFLMHDEPKTLAEKYAACKGSSDCESNVRKEMNQTSVKNQEIFEGCRAAGN
FT                   ATCVNDMLYGISEASGYDELGRLIGFDLSNSYKEMGQNAYDRANICGGDMSYGCGLKLW
FT                   ADQLPEELLGGILSWGIGKAVSPLIGKYFTETGILSAKETANRLVNGKWVDANGLPLPV
FT                   PPSVGAAGRVPVVLQTGGHTITARTANGLNKEFNKNLTSREWGRALESLKDDYSLRHDF
FT                   HGRILDNGNYIDKAGKIIGNIEDYLP"
FT   sig_peptide     complement(81474..81566)
FT                   /locus_tag="PC1_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.941 at
FT                   residue 31"
FT   gene            complement(81606..83288)
FT                   /locus_tag="PC1_0066"
FT   CDS_pept        complement(81606..83288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0066"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: Polypeptide-transport-associated domain
FT                   protein ShlB-type; Hemolysin activator HlyB domain protein;
FT                   KEGG: plu:plu3569 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11128"
FT                   /db_xref="GOA:C6DGP1"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR027282"
FT                   /db_xref="InterPro:IPR035251"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGP1"
FT                   /inference="protein motif:PFAM:PF08479"
FT                   /protein_id="ACT11128.1"
FT                   /translation="MCKTLSFISLIFLILCSSTFAATPISPTDRDALELQQKSLLEQAK
FT                   QQRLSLENSTTLTIPTVTASTAKDAVCFPIQRITFHDADALSIKDRTAIQQRYQNRCLD
FT                   LATVHNAVRETTNAYLNRGFVTSQAYLQEQDLSSGTLIISISEGKIEAIRMEGETPLAI
FT                   KMAFPGLEGRILNLRDIEQGMEQLNRLPSRQVAIDIQPGKQAGSSIVYLKRITKAHPAT
FT                   LSLSADNSGQKNTGREQLSTHLTLDNPLRLADRWWLTASRDSAFSHSYGSKALSGGMSL
FT                   PYGYWTLGYQYAWNDFFQPIPIGSSAYRYEGQSNTHRLSLNRTLYRDGKQKLALDSALS
FT                   RRRTENRMAGERLEISSPTVSSASIGLSYSTTLAGGYFTLNPMLSHGLRSWGATDDTKE
FT                   NRDLPRSEFRKFSASSSYFYPLTPSLYFLTSLYGQTTPDNLYTSERVSLGGEYSVRGFK
FT                   EQTLTGNRGFYWRNELNWQFTTLPFLGDIALTTAVDSGWIAGKTGKVDGGNMTGTSVGL
FT                   SASSRWVSQSVSLGVPLHFPDDLHPDNAVVYWQVTLPVTALFD"
FT   sig_peptide     complement(83223..83288)
FT                   /locus_tag="PC1_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(83546..84889)
FT                   /locus_tag="PC1_0067"
FT   CDS_pept        complement(83546..84889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0067"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: eca:ECA4378
FT                   putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11129"
FT                   /db_xref="GOA:C6DGP2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGP2"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACT11129.1"
FT                   /translation="MATRSTIMDTNSFRAEHADALSADIRTLTDKRSRVLGESYRLFYR
FT                   KPVHLVRGEGQYLWDADGKKYLDVYNNVASIGHCHPAVIEAVHQQMTMLNTHTRYLHER
FT                   ILDYSEQLLATAPAAINRAMYMCTGSEANDLAIRVARAWSGGTGVIVTREAYHGTSDLT
FT                   SGASPALGSGQPLAATTRLVPPPDAYRVNTPDLGVWFANEIQKQIDDMAAHGIKFAAFL
FT                   ADSIFSSDGVHPNPRGFLRPVVDVVHRNGGIFIADEVQPGFARTGDAFWGFARHDVVPD
FT                   IITTGKPMGNGIPVSGLLAKSDVLAAFSDQIPYFNTFGGNPVAMAAAQAVLKVIHDEQL
FT                   QEHSRVVGAQLLAELTTLQDKYASVGNVRGAGLFIGFELVSDRDSKTPDKTLALNLTEA
FT                   LRDRGVLTSVAGPYGNVLKLRPPLAFQTQDIDWLVGALDDCLGALTHA"
FT   gene            complement(84922..86283)
FT                   /locus_tag="PC1_0068"
FT   CDS_pept        complement(84922..86283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0068"
FT                   /product="ethanolamine transproter"
FT                   /note="TIGRFAM: ethanolamine transproter; PFAM: amino acid
FT                   permease-associated region; KEGG: eca:ECA4377 putative
FT                   ethanolamin permease"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11130"
FT                   /db_xref="GOA:C6DGP3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGP3"
FT                   /inference="protein motif:TFAM:TIGR00908"
FT                   /protein_id="ACT11130.1"
FT                   /translation="MTSKLKPTLGTLHLWGIAVGLVISGEYFGWSYGWGVAGTLGFLVT
FT                   TLFIAAMYTCFIFSFTELTTAIPHAGGPFAYSRLAFGDLGGLIAGMATLIEFVFAPPAI
FT                   SMAIGAYLNVQYPELNPKFAAVGAYLIFMSLNILGVKLAAMFELVVTLLAVMELLVFMG
FT                   VVAPGFSLSNFVAHGWAGQHEFSPAAISGMFAAIPFAIWFFLAIEGAAMAAEEAKDPKR
FT                   TIPRAYVSGILTLVVLAIGVMLMAGGVGDWRQLSDLNDPLPQAMKLIVGENSNWMHMLV
FT                   WIGLFGLIASFHGIILGYSRQFFALARAGYLPPGLAKLSRFHTPHRAILAGGAIGIAAI
FT                   FCDGINLQGMNLTAAMITMAVFGAIVMYIMSMLSLFRLRRSAPNMARSYRAPGYPIVPA
FT                   FALVCAIICLIAMLWFNPVIGGLFCTFMLLGYLYFLTTKARREHLLEPLVADAN"
FT   gene            86542..87549
FT                   /locus_tag="PC1_0069"
FT   CDS_pept        86542..87549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0069"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   eca:ECA4376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11131"
FT                   /db_xref="GOA:C6DGP4"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGP4"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACT11131.1"
FT                   /translation="MSAKQYDTLSNAEITALAHRALACYPAAVQGEVRLLCRSENATFL
FT                   VSSAGKRYALRLHRSHYHQKAEIESELLWLDALRETGIAVPEAVRNVDGERVQSLGLSD
FT                   GSCRYAVLFHWIDGEMPTTSIDPRAFQQLGEITARLHQHSRQWQKPDGFQRIVWDHHTM
FT                   VSAQSHWGNWRDAPNLSRGEHGIVEEAIGRMAAEMAEFGKAPHRYGLIHADLRLTNLLL
FT                   HRGETRVIDFDDCGMGWYLHDLAAAISFVEHHPRASEWVENWLCGYERVAHVSDEELAL
FT                   LPTLLIQRRIQLTAWVGSHAETEMAQSLGPDWAKHSVRLCRRYLETSDLPIGVA"
FT   gene            87722..88780
FT                   /locus_tag="PC1_0070"
FT   CDS_pept        87722..88780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0070"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: eca:ECA4375 AraC family
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11132"
FT                   /db_xref="GOA:C6DGP5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGP5"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACT11132.1"
FT                   /translation="MENMTYSSALNAAFSRNCGVLAAAATGLGDFIHDSGGDADRIFGI
FT                   SGVDPEQLASPTLSLGLVNYCRVMEEAARNSGVDNFGLRYGKQFKPQSLGLIGYIGLCS
FT                   DTLEQALHNVVKAFPCHQHDTLTRMVDKGDCWRLDYQVRHGAILHRRQDAELTLGMFLN
FT                   LIRHVLGKHWAPREVHFEHPRPEMWHEHCKVFDAPVYFDQPYNSLLIPKHQLVRTMPDR
FT                   DMTLLLVMQDAIRRLNETSPQQSIVEQVRTQVHLLLMQKEPTLEEVAEKVGLSSWSLQR
FT                   RLREEGLSFSLLVDKLRCEMATHYLQQKQLPISEMALLLGYSEVSAFSRAFRRWFGISP
FT                   RQWRKGEALNLS"
FT   gene            89012..90043
FT                   /locus_tag="PC1_0071"
FT   CDS_pept        89012..90043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: kpe:KPK_2618 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11133"
FT                   /db_xref="GOA:C6DGP6"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR039068"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGP6"
FT                   /inference="similar to AA sequence:KEGG:KPK_2618"
FT                   /protein_id="ACT11133.1"
FT                   /translation="MFNINEVKSSFTDDKYGFTASLLSYINDLNKIPSKKLAASIDDLL
FT                   FEAYEKSSVEAQRVVQNALFMIYQTNLSNPLSNPAKVQHDETLCLLRKKIEEKWLGDEF
FT                   KNIKPQKEPPDEENFAKFLITVWQEHRASHHELFDFLENEATSEQLYLFFKSDSALNLI
FT                   FFDLVAYTLIGSQPETRGTISENLWDEIGHGDNYFTHVNLYKNVLERRDISLPDNHYID
FT                   LYGVDALAGHNAFMLGAINRSHYYKLLGVMAMTEVLDPPQYTKLVKGCMRLGLLDKDVH
FT                   YYSEHITIDIKHGDDWLYNVINVITDAHPESKNEFYLGSLLRLQTAERYYDNLMKEMKK
FT                   IAK"
FT   gene            90232..91119
FT                   /locus_tag="PC1_0072"
FT   CDS_pept        90232..91119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0072"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: kpn:KPN_01754 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11134"
FT                   /db_xref="GOA:C6DGP7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGP7"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACT11134.1"
FT                   /translation="MAYLFLTLAAVFWGGNYVAGHILVQYINPYALSIIRWGLTTLLMF
FT                   SFYWKVIKKEWSILYGNIRINTVYAFLGQVCFPLTLYIGLQYTSSLNAAIYISSTPCLV
FT                   LIINAVFFKEKISLRNILGVAVSTVGVIYLAFSNAERGNQLSAFGIGDVLTIASALSWA
FT                   FYCALLRLKDKRVTNTAFVGFSSLIGTVIMVPIYLCYTFSSGDHFFFTTTPSVYPLLGV
FT                   AYLVVFPSWLAYVFWNKGVSLIGTTRSEIYTHIIPLSGGLLSIALLGEKLHMYHIISLL
FT                   LIVVGIICCSGKKK"
FT   gene            complement(91166..94660)
FT                   /locus_tag="PC1_0073"
FT   CDS_pept        complement(91166..94660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0073"
FT                   /product="cellulose synthase operon C domain protein"
FT                   /note="PFAM: cellulose synthase operon C domain protein;
FT                   TPR repeat-containing protein; Tetratricopeptide TPR_2
FT                   repeat protein; SMART: Tetratricopeptide domain protein;
FT                   KEGG: eca:ECA4374 cellulose synthase subunit BcsC"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11135"
FT                   /db_xref="GOA:C6DGP8"
FT                   /db_xref="InterPro:IPR008410"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGP8"
FT                   /inference="protein motif:PFAM:PF05420"
FT                   /protein_id="ACT11135.1"
FT                   /translation="MHNNTVNWLRFLPLLLVAAPQAYSAEIASPEQFLMEQVRLGEASN
FT                   KDDLVRQSLYRLELIDPNNPEVIAARLRLALRQGDQAQARQQLDKLKAVAPDSATYRQS
FT                   ATTLALTQDAARQQLQQARLLSTAGRYAEAKVQYDALFHGDPPTLELAVEYWRLVSRLP
FT                   DQQPLAIKQLEALDQVYPNNVPLRMVLARLLFSQNRNEQAYPLLKQLSNDPVGRSQAAS
FT                   LWLEIIGRMLVTPQSVAELNRFLTVFDEGEQADTARKELSRQQGILADPVYQGRLRALA
FT                   QIEDGGGNSATLSELNKALAATPNDPELIGAIGLVYLRAGDRAKALTQFQKALQADVNR
FT                   LNSGKWEGLIQSTQYWTTIAEGDNALKANNLSLARQKYQQARQMDNTNAYALIGLGDVA
FT                   VASKNDAAAQPLYQQALHLEPGNDNALRGLVGIYQRQSPEKALAYLNSLPRSQQNTMRE
FT                   TLAALQLNILKQQADQLSEQQQWTQAEEKYRQASQQDPNDIWLAYHYAQTLRQLGQTQQ
FT                   ADSVVQRATAVPPTSAEKNYVYSLYLSSTNRDEQALAHLNTLPTAQWSDDMRELSQRLT
FT                   IQTTLAKAEAMRDAGDEPAAIAFLRQQPADTRIDLLLADWALARGEYATALAEYQRIRT
FT                   REPQNPDAQLGEIDAFIAQGRQDDARQRLNQLPTQAVDTLNSQRRVANAWQAVGNPQKS
FT                   AALFRQLKIDAQKEPVGQTPIDQTTALIYRDAARVEQQQSQPEQAQQDYKQAMVASGIA
FT                   PTLPQSDDDYTRLTRNKSSDDWLQRSIRADAADLYRKQDITVTLDHDYSSSSGTGGISD
FT                   LSAHNTLLQVDMPLYDGRAFLRTDTVQMNAGSFSTGSNGAYRETFGTCATRDCFDGKSQ
FT                   KTTGTSVAAGWKNDRWSADLGTTPLGFDVVDVVGGASYSGDWRQIGWTATASRRPISSS
FT                   LLAFGGTKDPGTGITWGGVRATGVSLGLSYDRGEAHGVWSDFSLHQITGKNVADNDRAR
FT                   AMAGYYYKLINEDNRRVTVGLNSMWWRYQKDLSGYSLGQGGYYSPQQYFSLGVPVNYRQ
FT                   RTENWSWELGGSLSWSRSSTKDQRRYPLTGLLGNAALTDRDTIEQGSSSSGFGYTARAL
FT                   VERRLSSHWTLGVGIDIQQAKDYTPSHGLIYLRYSASGWQGDLDSPPQPLTPYADFK"
FT   sig_peptide     complement(94586..94660)
FT                   /locus_tag="PC1_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.889 at
FT                   residue 25"
FT   gene            complement(94642..95757)
FT                   /locus_tag="PC1_0074"
FT   CDS_pept        complement(94642..95757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0074"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: glycoside hydrolase family 8; KEGG:
FT                   eca:ECA4373 endo-1,4-D-glucanase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11136"
FT                   /db_xref="GOA:C6DGP9"
FT                   /db_xref="InterPro:IPR002037"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR019834"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGP9"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ACT11136.1"
FT                   /translation="MPRVLRYLIPTLLWLWASQATAAVCDWPAWEQYKQHYISAEGRVI
FT                   DTSTPNKITTSEGQSYAMFFALVANDRVMFDRLLQWTENNLSAGDLRAHLPAWLWGENK
FT                   DKQWTVLDPNSASDADLWIAYSLLEAGRLWKEARYQTVGTALLARIAKEEVVNIPGLGV
FT                   MLLPGKVGFAEKESWRLNPSYLPPQLLARFAPLSETWKAMQRTTQRLLLETAPKGFSPD
FT                   WVIWQKDKGWQPDTTKPNIGSYDAIRVYLWAGMMADSSKGKTDLIKQFQPMVQQTIEQG
FT                   LPPEKTDTATGTVTGQGSVGFSASLLPMLSRQSDALATQRQRLADNPPGDDAYFSASLT
FT                   LFGQGWDQKRYRFTSQGQLLPSRGSQCTTTP"
FT   sig_peptide     complement(95689..95757)
FT                   /locus_tag="PC1_0074"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.977 at
FT                   residue 23"
FT   gene            complement(95764..98082)
FT                   /locus_tag="PC1_0075"
FT   CDS_pept        complement(95764..98082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0075"
FT                   /product="cellulose synthase subunit B"
FT                   /note="PFAM: cellulose synthase subunit B; KEGG:
FT                   eca:ECA4372 cellulose synthase regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11137"
FT                   /db_xref="GOA:C6DGQ0"
FT                   /db_xref="InterPro:IPR003920"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGQ0"
FT                   /inference="protein motif:PFAM:PF03170"
FT                   /protein_id="ACT11137.1"
FT                   /translation="MTKKIIWFTALALGVSSLSQAVTAPHAQTPATGDAAQPSATATSA
FT                   TAMPAVPLAQPSTNAAVRNVMLPFAQIAPAPGTFALRGINPDGQIEFGVRSDEVVTQAS
FT                   LDLEFTPSPALIPTESHIKVYLNNELMGVTPLGKEQMGKSNRVRIPIDPRYITDFNRLQ
FT                   LVFVGHYQNICENPASTSLWLDVSKASTLNLQFQKLTLKDDLSPFPAPFFDSRDTRPLT
FT                   LPIVFAGQPDLVQQRAAAMLASWFGSKAQWRGQSFPALFNQLPESHGIVFATNDKRPDF
FT                   LRDTPAVNGPTVSIVSHPSDPHIKLLLVQGRDDNELLTAVQGIAQGNTLFRGQSVTIDK
FT                   VEQLAPRQPYDAPNWVRTDRPMTFAELQQYNEQLQTDGIVPRPISLTMNLPPDLFLIRS
FT                   QGIDMRLKYRYTAPQIQDGSRLSINLNNQFVQAFSLAPEHDQNSLLMRLPLTQGLWDSN
FT                   KSLSIPALKLGTTNQLRFDFNYTTLLSSGTADRCETYTPVVNHAVIDSNSTINFSGYRH
FT                   FMAMPDLRAFANAGYPFSRLADLSQTLVLVNKQPQPAQVSAMLNAIGNIGAQTGYPALA
FT                   VQLSDDWTQIDKQDSDILMIGAIPPALHDDSKINLLVEQTQSWIKQPTRQTAVLDIDPP
FT                   DADAKPDSKTTVSGDGPMSAIIGFQSPYHDQRSVVALLADSPQGYTLLNNALIDSEKRA
FT                   SLFGSVSVIRESGINNLRVGDIYYVGHLPWWERIWHALAQHPVWLAIISTLTVVIVAWL
FT                   LWRGLKFFSRRRLSPDERD"
FT   sig_peptide     complement(98017..98082)
FT                   /locus_tag="PC1_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.897 at
FT                   residue 22"
FT   gene            complement(98157..100856)
FT                   /locus_tag="PC1_0076"
FT   CDS_pept        complement(98157..100856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0076"
FT                   /product="cellulose synthase catalytic subunit
FT                   (UDP-forming)"
FT                   /note="TIGRFAM: cellulose synthase catalytic subunit
FT                   (UDP-forming); PFAM: glycosyl transferase family 2; type IV
FT                   pilus assembly PilZ; KEGG: spe:Spro_0148 cellulose synthase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11138"
FT                   /db_xref="GOA:C6DGQ1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR003919"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGQ1"
FT                   /inference="protein motif:TFAM:TIGR03030"
FT                   /protein_id="ACT11138.1"
FT                   /translation="MSGILRLFLVPPARQAIQQRYRGYRQQGASAFAAFFATLFAILGW
FT                   IFLRLESEGWQQIRAQRTYWFPHILPQRPRPADILRYLTQGLWLLTIKNGQLPTSRRNY
FT                   FSALPRWRQRYMNAQQALFVRFSHANADDREDSESDSAKTNSLQRLVTVILSLLCAALA
FT                   LLCITQPFDLLSQFIFMLLLWGIAMLVRNMPGRMPTLMMIALSFTVSCRYLWWRYTETL
FT                   NWDDPLSLVCGMLLLAAETYAWVVLVLGYFQTIWPLNRHPVSLPEDSKTWPTVDLMIPT
FT                   YNEPLSVVKPTVYAALGIDWPKDKLNIYILDDGGRAEFKAFAEEVGVHYIARVTHEHAK
FT                   AGNINNALKQAEGEFVAIFDCDHVPTRSFLQLTMGWFFKDKKLAMLQTPHHFFSPDPFE
FT                   RNLGRFRRTPNEGTLFYGLVQDGNDMWDATFFCGSCAILRRKPLDEIGGIAVETVTEDA
FT                   HTSLRLHRRGYSSAYIRIPQAAGLATESLSAHIGQRIRWARGMVQIFRLDNPLLGKGLK
FT                   LGQRLCYANAMMHFLSGIPRLIFLTAPLAFLLLHAYIIFAPALAIALYVLPHMVHASLT
FT                   NSRIQGRYRHSFWSEIYETVLAWYIARPTTVALFNPHKGKFNVTAKGGLVEEQHVDWVI
FT                   TRPYLVLVLLNIAGVVYGVWRLIYGPSEELMTVIISLIWVAYNMTILGGAVAVAVEAKQ
FT                   VRQAHRVEMSMSAAILRPDGHLFPCVLRDYSDGGVGIETRESGILQVGDSVSLLLKRGQ
FT                   QEYAFPFSVTRAFDNKIGLRMTNLTIRQHIDFIQCTFARADTWALWQDSFAQDKPVESL
FT                   VDVLALGFRGYLRLADYAPPIIRSIILVFLNIVVWVVSFIPRYVGKRTVTDQSGTALPE
FT                   KAAHQGKTPFAHETRFAQENLFAEKTVA"
FT   gene            complement(100853..101590)
FT                   /locus_tag="PC1_0077"
FT   CDS_pept        complement(100853..101590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0077"
FT                   /product="cellulose synthase operon protein YhjQ"
FT                   /note="TIGRFAM: cellulose synthase operon protein YhjQ;
FT                   PFAM: YhjQ family protein; KEGG: eca:ECA4369 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11139"
FT                   /db_xref="InterPro:IPR017746"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGQ2"
FT                   /inference="protein motif:TFAM:TIGR03371"
FT                   /protein_id="ACT11139.1"
FT                   /translation="MPVIALQGIRGGVGTTSIAAALGWAFQRLGEPALVIDFSPDNLLR
FT                   INFNMPFEQRRGWARAEADDAPWQTGAMQYLPGLDFLPFGRLNAQEVATLQQHYHQHPA
FT                   LWQNKLAQLSAAGRHRWILIDVPADNSPLTRQALATANTVFQVVVADANCHSRLHQQAL
FT                   PRQCHFLVNQFSTLSTLQQDLHQLWLHTLSHLLPLVVHRDEALAESLMLKQPLGECRPD
FT                   SVAAEEIMTLANWCLIHVKESGV"
FT   gene            complement(101593..101802)
FT                   /locus_tag="PC1_0078"
FT   CDS_pept        complement(101593..101802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0078"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11140"
FT                   /db_xref="InterPro:IPR024487"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGQ3"
FT                   /inference="similar to AA sequence:KEGG:ECA4368"
FT                   /protein_id="ACT11140.1"
FT                   /translation="MNNEPTRRDTSARADLTENARTEDDLRVLSQAFSLPEINYIDIAR
FT                   QARLSQMMARWPLLDELKEPAGSD"
FT   gene            102133..103737
FT                   /locus_tag="PC1_0079"
FT   CDS_pept        102133..103737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0079"
FT                   /product="cellulose biosynthesis protein BcsE"
FT                   /note="TIGRFAM: cellulose biosynthesis protein BcsE; KEGG:
FT                   eca:ECA4366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11141"
FT                   /db_xref="GOA:C6DGQ4"
FT                   /db_xref="InterPro:IPR017745"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGQ4"
FT                   /inference="protein motif:TFAM:TIGR03369"
FT                   /protein_id="ACT11141.1"
FT                   /translation="MKQNFSLGIRDLWDELVTLQQAGFYWVNIDRQVDAALFCQQIIHV
FT                   QNNDARMALIGCGERSDSLLTTLFSNEINGAEKKQLSCYILPENKAALLNLTDDLMRAL
FT                   RPKNRLLVLYAPASLWRDISPERLQRWVDDTAAWLHQRQCTLVVIGHSTGVTRLRNMLI
FT                   SQHRGLYGLASLQWQQDRAQYLVSWWATERGVRANQVQMLQSDNDGWHMLTEEQPILTP
FT                   SLDDDGLFLIEKSVLEGAPALSENWQLMDDNAILVQTGMLTHAATLVFALNQTSQVDTL
FT                   VKQVHSLRRQRGELLKIVVREMKPCLRASDERLLLACGANIIVSHSEPLSRFLARIESV
FT                   QGQRFTKHVPVDVEVLLTTMRPLQIKGYQPPETFRQSVQMLIDSTLMPEGSKGVLVALR
FT                   PVPGVRAAQALTLCTLRRFGDVVTIVQDRLFLFLSNCRLNELDIALKSIFRLPVNEVFS
FT                   NRIVWSQDLQILAEVKSLAQDGTPGQEQQLNDYVQLQKAESAPRGQTPRREPIAIDLLN
FT                   PDLLQPDLLARAPGEPS"
FT   gene            103734..103952
FT                   /locus_tag="PC1_0080"
FT   CDS_pept        103734..103952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11142"
FT                   /db_xref="GOA:C6DGQ5"
FT                   /db_xref="InterPro:IPR019995"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGQ5"
FT                   /inference="similar to AA sequence:KEGG:ECA4365"
FT                   /protein_id="ACT11142.1"
FT                   /translation="MNLLDIVQLVLLSAVVFFTLGYLAHRVIPHWLQYWKNRLLSPRYL
FT                   QPASVWMRSPSSTKTVSTKPTSAETKK"
FT   gene            103954..105615
FT                   /locus_tag="PC1_0081"
FT   CDS_pept        103954..105615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0081"
FT                   /product="cellulose synthase operon protein YhjU"
FT                   /note="TIGRFAM: cellulose synthase operon protein YhjU;
FT                   KEGG: eca:ECA4364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11143"
FT                   /db_xref="GOA:C6DGQ6"
FT                   /db_xref="InterPro:IPR017744"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGQ6"
FT                   /inference="protein motif:TFAM:TIGR03368"
FT                   /protein_id="ACT11143.1"
FT                   /translation="MDEKTRLQQPHMQKQQNLWRYWRGLGAWNLYFLLKFALLWFGYLN
FT                   FHPLLNLVFLAFLLFPIPNVTLHRWRHIIAIPLGIGLFYHDTWLPGINSIVSQGTQVAG
FT                   FSASYLLELLTRFINWQMVGAAVVITVAYLFFAQWIRITVFTVAALAWLNIVNLAGPAV
FT                   SLMPAASTTTAPSAATSPTGGDAALPEATLPPTNANLTAYLNQFYTREKARTTAFPAAL
FT                   PQDAQPFDLLIINICSLSWSDLDVAQLDNHPLWKKFDILFRQFNSATAYSGPASIRLLR
FT                   ASCGQQSHTDLYQPVNQQCYLFSNLVKLGFEEQLMLDHSGVFGNYLREVREEGDIQIPM
FT                   LSQEGISHQITSFDGEPIYNDLELLNRWLGERDKATTTRNATFFNLIPLHDGNRFVGTN
FT                   QSADYAPRAKILFDQLDAFFDVLQKSGRKVMVVVVPEHGAALAGDKMQMSGLRDIPSPS
FT                   ITHIPVGVKLFGLQAPHQGNALEVTSPSSYLAISELVARMVDGKVFTAPSVDWQTLTSA
FT                   LPQTEAISENENAIVMQYQGKPYIRLNGGDWVPYPQ"
FT   gene            105968..107152
FT                   /locus_tag="PC1_0082"
FT   CDS_pept        105968..107152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0082"
FT                   /product="diguanylate cyclase"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   GGDEF domain containing protein; SMART: GGDEF domain
FT                   containing protein; KEGG: eca:ECA4363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11144"
FT                   /db_xref="GOA:C6DGQ7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033419"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGQ7"
FT                   /inference="protein motif:PFAM:PF00672"
FT                   /protein_id="ACT11144.1"
FT                   /translation="MRLRRSLTIKQMTAVSAVALVTISLFIVIQLFHFVHQRREDYSRQ
FT                   LESIAYSVRQPLTDAVLQGEVQRAGNILDSLLPVAFLSRADVLLPDDFQTLHANFPKER
FT                   PVPDWIARVFRLPIRISIPLYSPPQTQYSAPLAHLVLQADSYRMYQFIVSTFSTMLATY
FT                   LLLALIMSIAITWCMNRLLIHPLRGIIIELQNLPPDAMLHRPLTLPPWHHDDELGALVR
FT                   SYNRNQQLLEQSLSAGTEGVGLPDKAHFMRRLEQRLADATPFSLLVFGLDSSASKQGDM
FT                   ATLATQLRVVIEEQNEAGLTCLARLDCDEFALIGKTLGSAGQAQDWAQNVMLAINLPFL
FT                   PADAQPARAVSVGILTITDPRPEAAALLLSQARFAMQLARHDKKCGIHCLTVPS"
FT   gene            107472..108764
FT                   /locus_tag="PC1_0083"
FT   CDS_pept        107472..108764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0083"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   eca:ECA4362 C4-dicarboxylate transporter DctA"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11145"
FT                   /db_xref="GOA:C6DGQ8"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DGQ8"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACT11145.1"
FT                   /translation="MKTSIFKSLYFQVLAAITIGILLGHFYPQLGEQMKPLGDGFVKLI
FT                   KMIIAPVIFCTVVTGIAGMESMKSVGRTGAVALLYFEIVSTIALIIGLVVVNIVQPGAG
FT                   MNIDPSTLDASAVAVYTQQASQQGLIPFLMDVIPASVVGAFASGNILQVLLFAVMFGFA
FT                   LHRLGAKGKVIFDVIDSFSKVIFGVINMIMKLAPLGAFGAMAFTIGKYGVGTLVQLGQL
FT                   IACFYITCVLFIFLVLGSIAKATGFSIFKFIRYIREELLIVLGTSSSESVLPRMLEKME
FT                   KVGCKKSVVGLVIPTGYSFNLDGTSIYLTMAAVFIAQATNSHMDIWHQITLLVVLLLSS
FT                   KGAAGVTGSGFIVLAATLSAVGHLPVAGLALILGIDRFMSEARALTNLIGNGVATIVVA
FT                   KYCRELDEKKLDAELSGTNKSDNAATPTAQS"
FT   gene            109118..110635
FT                   /locus_tag="PC1_0084"
FT   CDS_pept        109118..110635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0084"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   eca:ECA4361 putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11146"
FT                   /db_xref="GOA:C6DGQ9"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGQ9"
FT                   /inference="protein motif:PFAM:PF00675"
FT                   /protein_id="ACT11146.1"
FT                   /translation="MQGTKKALFVGGLLLAVVSSSVQAEALQPDPAWQQGKLDNGFTWQ
FT                   LLTTPQRPGDRVELRLVVNAGSLLENAQQVGFAHFLPRLALAPGDKLSAAQRPSTWMSD
FT                   ANGSRVLPPAIISYDFTSYNLSLPNNRPELLKEALTWLAESAGQMTFDEKSLQAALKVP
FT                   DQVATFPVNPQDPSWRYRLKGSPLLAHDPAQDVKPPLNGEQLQQFYKTWYTPDAMTLYI
FT                   VGHVDNRSVIEQIGKVFSPLEGKREAPAPLPTLSPLPTQAISLMNNNVQKDTLSLMWDA
FT                   PWHPIRESQALVRYWLGDMTREAMFWHLQQVLEKSPQKGNNLRFDCNVFYTRSQCAIHM
FT                   DVPNSEGVEPGVTFMARELATLREKGLTQQEFDALIARKTDELNKLFATYARTSTDILM
FT                   DQRLRSQQNGVVDIAPEQYQKLRQSYLSALTLDMLNQELHQQLVQDTTLMLIQQPGEPE
FT                   ANMKALQEAYDRIMTPATEPAASAATAAPEGAVPEGKKPQETAPAAQ"
FT   sig_peptide     109118..109192
FT                   /locus_tag="PC1_0084"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            110988..111155
FT                   /locus_tag="PC1_0085"
FT   CDS_pept        110988..111155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0085"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppg:PputGB1_2013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11147"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGR0"
FT                   /inference="similar to AA sequence:KEGG:PputGB1_2013"
FT                   /protein_id="ACT11147.1"
FT                   /translation="MSRTLKAAGVIALIAMLSGCLFPPPGGGGGGGGGRGGGGPFGGFQ
FT                   EQPVNQPGPR"
FT   sig_peptide     110988..111074
FT                   /locus_tag="PC1_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.819 at
FT                   residue 29"
FT   gene            complement(111251..112183)
FT                   /locus_tag="PC1_0086"
FT   CDS_pept        complement(111251..112183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0086"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: eca:ECA4360
FT                   2-dehydro-3-deoxygluconokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11148"
FT                   /db_xref="GOA:C6DGR1"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGR1"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACT11148.1"
FT                   /translation="MTTTNIAVIGECMIELSQKGTDLNRGFGGDTLNTAVYIARQVNAD
FT                   KLGVHYVTALGTDSFSTEMVAAWQKEGVKTDLIQRLDNKLPGLYFIETDASGERTFYYW
FT                   RNDAAARYWLDSPEAEKIGQSLAHFDYLYLSGISLAILNAESRQRLLALLRACRANGGK
FT                   VTFDNNYRPRLWQSKEETQQAYTDILSCTDIAFLTLDDEDMLWGTKPLEAVLERTHGLG
FT                   VSEVVIKRGADSCIVSERGQALVDVPAIKLPKEKVVDTTAAGDSFSAGYLSVRLNGGST
FT                   QEAAQRGHLTASTVIQYRGAIIPLEAMPA"
FT   gene            complement(112331..113347)
FT                   /locus_tag="PC1_0087"
FT   CDS_pept        complement(112331..113347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0087"
FT                   /product="ribonuclease"
FT                   /note="TIGRFAM: ribonuclease; PFAM: ribonuclease BN; KEGG:
FT                   eca:ECA4359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11149"
FT                   /db_xref="GOA:C6DGR2"
FT                   /db_xref="InterPro:IPR005274"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGR2"
FT                   /inference="protein motif:TFAM:TIGR00766"
FT                   /protein_id="ACT11149.1"
FT                   /translation="MPVPADPDRQSTSSTPEGDTSPQKPLSFLDKSKRLAARIQAIPSV
FT                   AHLIRAGERFNDRMGNQFGAAITYFSFLSLIPILMVSFAAVGFVLASNPDLLTGLINRI
FT                   VNSISDPNLANTLKNTVNTAVQQRTTVGITGLLIALYSGISWMGNLREAIRAQSRDVWE
FT                   RSPKDEEKIYFQYTRDFLSLTGLVIALIITLFLTSVAGTAQNMIVTALGLDGIEWLRPA
FT                   LTLIALSISIFANYLLFLWIFFVLPRHKPKRKALFRGTLIAAVGFEVIKFAMTVALPKL
FT                   ASSPSGAAFGSVIGLMAFFYFFARLTLFCAAWIATANYKGDTSTDRNEQEKEPPSDR"
FT   gene            113478..114677
FT                   /locus_tag="PC1_0088"
FT   CDS_pept        113478..114677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0088"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA4358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11150"
FT                   /db_xref="GOA:C6DGR3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR023008"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGR3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACT11150.1"
FT                   /translation="MPTPSPSEPALSGLRLNLRIVSIVAFNFASYLNIGLPLAVLPGYV
FT                   HDHLGYSAFWAGLVISLQYFSTLLTRPHAGRSADEKGPKKIVVWGLAGVMLSGVFYLLA
FT                   AFSDASPAITLLLLCLGRVVLGAGQSFAGTGATLWGVGVVGSRHIGRVISWNGIATYGA
FT                   MAIGAPLGVWLNHIGGLKLLSVCIILIAAVAIVLALPRPTVQVAPGKKIPFREVLGKVW
FT                   VYGIILAIASAGFGVIATFITLFYADRNWEGAALTLTIFSCAFVGARLVFPNSIQRFGG
FT                   LRVAMACFVVEIVGLLLVWGAALPLMAEVGAFLAGAGFSLVFPALGVVAVQAVSPQNQG
FT                   SALATYTIFLDLSLGIVGPVAGVLMAYTGIASIYLAAALLGLCGLALTWRLTQRTAVKE
FT                   "
FT   gene            complement(114723..115289)
FT                   /locus_tag="PC1_0089"
FT   CDS_pept        complement(114723..115289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11151"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGR4"
FT                   /inference="similar to AA sequence:KEGG:ECA4355"
FT                   /protein_id="ACT11151.1"
FT                   /translation="MSNVIKYLGVGLLVGLLAACDGKTDDAAKAGAQDKPAAEASAGQN
FT                   IELMEGKIAFTLPADMRDQSGKVGTQANNMHVYANDNGQKAVIVILGDNTTEELTVLAQ
FT                   RLEDQQRTRDANLQVVTNKTIDVDGKKLQQLDSIITSSGQQAYSSVVLGKVENQLLTLQ
FT                   ITLPASNQQQAQSEAEGIIHTLKLK"
FT   gene            115346..115492
FT                   /locus_tag="PC1_0090"
FT   CDS_pept        115346..115492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11152"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGR5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11152.1"
FT                   /translation="MAPYSDSKNKHFVVANRCGNLRYFYKTMSDLRGKGGVNSRPIGIN
FT                   GGC"
FT   gene            complement(115476..116153)
FT                   /locus_tag="PC1_0091"
FT   CDS_pept        complement(115476..116153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; PFAM:
FT                   protein of unknown function DUF165; KEGG: eca:ECA4354
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11153"
FT                   /db_xref="GOA:C6DGR6"
FT                   /db_xref="InterPro:IPR003744"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGR6"
FT                   /inference="protein motif:TFAM:TIGR00697"
FT                   /protein_id="ACT11153.1"
FT                   /translation="MYRFTPQQRLTALIWLSLFHVLIITSSNYLVQLPVLIFGFHTTWG
FT                   AFTFPFIFLATDLTVRIFGAPMARRIILTVMVPALVISYLVSSLFYQGSWQSFEALSQV
FT                   NIVVARIACASFMAYVLGQILDVHVFNRLRQNRAWWVAPAVSTVFGNFSDTLAFFFIAF
FT                   YHSTDAFMAANWVEIAMVDYAFKLLISLAFFLPMYGVMLNMVLKRLSEQKGSADYHSVS
FT                   SHH"
FT   gene            116370..116612
FT                   /locus_tag="PC1_0092"
FT   CDS_pept        116370..116612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0092"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: eca:ECA4353 cell
FT                   developmental protein SirA"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11154"
FT                   /db_xref="GOA:C6DGR7"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DGR7"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ACT11154.1"
FT                   /translation="MTDPFTNPDKTLDAQGLRCPEPVMMVRKTVRQMETGQTLLIIADD
FT                   PATTRDIPGFCVFMEHELLAQETEQLPYRYLLRKG"
FT   gene            complement(116672..119035)
FT                   /locus_tag="PC1_0093"
FT   CDS_pept        complement(116672..119035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0093"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: heavy metal translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; cadmium-translocating P-type ATPase; PFAM: E1-E2
FT                   ATPase-associated domain protein; Heavy metal
FT                   transport/detoxification protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: eca:ECA4352
FT                   zinc/cadmium/mercury/lead-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11155"
FT                   /db_xref="GOA:C6DGR8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGR8"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACT11155.1"
FT                   /translation="MHSHQHHSAEKSACCNNGVHHAPRSTAHSTKSCCNEHAQHSNHAD
FT                   HSCCSTKHTSDAAVQSACGTEQHSSDSGGSADSDDPDGGDSDRPRSNQRFSWKISGMDC
FT                   PSCARKIENAVKNLTGIEQAKVLFATEKLVVDAYIDIRPQVQHAVQQAGFTLQDTALPV
FT                   VPPNTSTVRRFVHEYGFLLLFTLLAAASWGLSLLSERGGQIAFIATTIVGLIPILKKAI
FT                   QLIRTGTPFAIETLMSVASIGALLIGATTEATVILLLFMLGEYLESYAANRARRGVTAL
FT                   MALLPEDATAIVNGQRRLVPVASLVPGDVIEVAPGGRLPADAELLNSDASFDESALTGE
FT                   SVPVERTPGEKIAAGSLCVDRVVQLRVVSQPGNSAIDRILQLIEEAEERRAPIERFLDK
FT                   FSRYYTPAIMLLSLLVILVPPLLLAQPWQEWIYRGLTLLLIGCPCALVISTPAAITSGL
FT                   AAATRRGALIKGGAALESLGSIKTIAFDKTGTLTEGKPQVTDVLPAAGISETALLTRTA
FT                   AVESGSHHPLAKAIVQHALSSSTFLPLAENRKALAGVGVEGTIGGKRIQVSAPTRVASD
FT                   LLDADWLQQIDALENEGKTVVVVQEDDRLLGLLALSDTLRHDAREALDALQQLGIRGVM
FT                   LTGDNPRAAAAIAARLGIDYRASLLPADKVTAVSDLSKQHPVAMVGDGINDAPAMKAAT
FT                   IGIAMGSGTDVALETADAALTHSRLTGLAAMISLSRATQRNIRQNITIALGLKAVFLVT
FT                   SILGITGLWLAVLADSGATALVTANALRLLRKQD"
FT   gene            complement(119130..119759)
FT                   /locus_tag="PC1_0094"
FT   CDS_pept        complement(119130..119759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0094"
FT                   /product="YhhN family protein"
FT                   /note="PFAM: YhhN family protein; KEGG: eca:ECA4351
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11156"
FT                   /db_xref="GOA:C6DGR9"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGR9"
FT                   /inference="protein motif:PFAM:PF07947"
FT                   /protein_id="ACT11156.1"
FT                   /translation="MLWSFIAVLFSGWLYVDASYRGPTWQRWLFKPVTMLLLLALAWQT
FT                   PLLGVPGYLIVLGLLATLVADTLLLLPTQRLLYAFGAYFLSHLLYTVSFFTGQIALTFF
FT                   WPLALTLVILAAILIAIIWGRLDTQRWPACAFIIMTTLMVWIAGERYFALGTNANFSLL
FT                   TGTVLLFIAHAAWLIHHYRFPFRAHQAIVAAGYFGGHFLIVRSLYF"
FT   gene            119951..120271
FT                   /locus_tag="PC1_0095"
FT   CDS_pept        119951..120271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0095"
FT                   /product="Domain of unknown function DUF1820"
FT                   /note="PFAM: Domain of unknown function DUF1820; KEGG:
FT                   eca:ECA4350 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11157"
FT                   /db_xref="InterPro:IPR014949"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGS0"
FT                   /inference="protein motif:PFAM:PF08850"
FT                   /protein_id="ACT11157.1"
FT                   /translation="MSSESALYRIQFINNGKNYQLYVRELVQSSLFGFIEIADFVFDSQ
FT                   SAVLVDPSTEKLKTEFSGVSRSFIPLQAIIRIDAVTEKGSARISDLGDNVTAFPYLPGK
FT                   KP"
FT   gene            120271..120630
FT                   /locus_tag="PC1_0096"
FT   CDS_pept        120271..120630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0096"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11158"
FT                   /db_xref="InterPro:IPR019635"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGS1"
FT                   /inference="similar to AA sequence:KEGG:ECA4349"
FT                   /protein_id="ACT11158.1"
FT                   /translation="MNDFPWLLALAVGAILVLAARQYRRQRQRDAQNDAAPLRIVAAEV
FT                   KHKREFPLTRRRARAHQMMAVEDMRYEVTFRPITGGATITLRLENADYHQLDTGMQGSL
FT                   QLKGTRFIRFVPQQR"
FT   sig_peptide     120271..120330
FT                   /locus_tag="PC1_0096"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.842) with cleavage site probability 0.772 at
FT                   residue 20"
FT   gene            complement(120634..120912)
FT                   /locus_tag="PC1_0097"
FT   CDS_pept        complement(120634..120912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0097"
FT                   /product="protein of unknown function DUF1145"
FT                   /note="PFAM: protein of unknown function DUF1145; KEGG:
FT                   eca:ECA4348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11159"
FT                   /db_xref="GOA:C6DGS2"
FT                   /db_xref="InterPro:IPR009525"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGS2"
FT                   /inference="protein motif:PFAM:PF06611"
FT                   /protein_id="ACT11159.1"
FT                   /translation="MILINLGRLLMLGVWGFLLLNLIQPFPKPLNIFMTVAMVFMILMH
FT                   GFQLLLLKSSQPKDSPALNRALQARIFLFGVFELLAWQKKQPKPPKP"
FT   gene            complement(120939..121514)
FT                   /locus_tag="PC1_0098"
FT   CDS_pept        complement(120939..121514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0098"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="KEGG: eca:ECA4347 16S rRNA
FT                   m(2)G966-methyltransferase; TIGRFAM: methyltransferase;
FT                   PFAM: Protein of unknown function methylase putative"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11160"
FT                   /db_xref="GOA:C6DGS3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGS3"
FT                   /inference="protein motif:TFAM:TIGR00095"
FT                   /protein_id="ACT11160.1"
FT                   /translation="MAKKNASSAAGQIRIIGGQWRGRKLPVPDSPGLRPTTDRVRETLF
FT                   NWLAPIIQQARCLDCFAGSGALGLEALSRYAAHATLLEMERAVAQQLTQNLALLRAENA
FT                   EVVNTDALSWLAQPGTPFDVVFLDPPFRKELLNNTLVLLEQQGWLAPDAWIYVETEAEN
FT                   AQLTIPENWQLHREKIAGQVAYRLYIRQ"
FT   gene            121864..123351
FT                   /locus_tag="PC1_0099"
FT   CDS_pept        121864..123351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0099"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /note="KEGG: eca:ECA4346 cell division protein FtsY;
FT                   TIGRFAM: signal recognition particle-docking protein FtsY;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11161"
FT                   /db_xref="GOA:C6DGS4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGS4"
FT                   /inference="protein motif:TFAM:TIGR00064"
FT                   /protein_id="ACT11161.1"
FT                   /translation="MSKEKKRGFFSWLGLGKQEEKQQEQPQEKPVVQEKIVVEEQSPAA
FT                   ESDAAASAHQTVEHAPEQVEKPLPEEPVVEAEELTQSVAERDVTAAADESAVVAPEANV
FT                   SESIASEPAVSTPAISETDDRDLIDRDVIDRDAADPIVQTEIAESATVVEAEPDVAQQE
FT                   EHEYEEQELAQPDDVPVVAQEQERPTKEGFFARLKRSLVKTRQNLGSGFIGLFRGKKID
FT                   DDLFDELEEQLLVADVGVETTRKIITSLTEHASRRQLKDADTLFVKLKDEMAEILAKVD
FT                   APLNIEGKTPYVILMVGVNGVGKTTTIGKMARQFQAQGKSVMLAAGDTFRAAAVEQLQV
FT                   WGQRNNVAVVAQHTGADSASVIFDAIQAAKARGVDVLIADTAGRLQNKAHLMEELKKIV
FT                   RVMKKLDEDAPHEVMLTLDASTGQNAVSQAKLFNEAVGLTGITLTKLDGTAKGGVIFAI
FT                   ADQFAIPIRYIGVGEGIEDLRPFKADDFIEALFARED"
FT   gene            123357..124028
FT                   /locus_tag="PC1_0100"
FT   CDS_pept        123357..124028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0100"
FT                   /product="Type II (General) Secretory Pathway (IISP) Family
FT                   protein"
FT                   /note="KEGG: eca:ECA4345 cell division protein FtsE;
FT                   TIGRFAM: Type II (General) Secretory Pathway (IISP) Family
FT                   protein; cell division ATP-binding protein FtsE; PFAM: ABC
FT                   transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11162"
FT                   /db_xref="GOA:C6DGS5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGS5"
FT                   /inference="protein motif:TFAM:TIGR00960"
FT                   /protein_id="ACT11162.1"
FT                   /translation="MIRFEQVSKAYLGGRQALQGVDFHLRPAEMAFLTGHSGAGKSTLL
FT                   KLICGIERPSAGQILFGGHNISRLKKREVPFLRRQIGMIFQDHHLLMERTVYDNVAMPL
FT                   IIAGASSEDIRRRVSAALDKVGLLDKAKNYPIQLSGGEQQRVGIARAVVNKPAVLLADE
FT                   PTGNLDEALSEGILRLFEEFNRVGVTVLMATHDTGLIARRNYRVLTLSDGRMVGGNHDG
FT                   E"
FT   gene            124018..124986
FT                   /locus_tag="PC1_0101"
FT   CDS_pept        124018..124986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0101"
FT                   /product="protein insertion ABC transporter, inner membrane
FT                   subunit FtsX"
FT                   /note="TIGRFAM: protein insertion ABC transporter, inner
FT                   membrane subunit FtsX; PFAM: protein of unknown function
FT                   DUF214; KEGG: eca:ECA4344 cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11163"
FT                   /db_xref="GOA:C6DGS6"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGS6"
FT                   /inference="protein motif:TFAM:TIGR00439"
FT                   /protein_id="ACT11163.1"
FT                   /translation="MANNVRNAKKPVAKSKALRGGWQEQWRYAWTNTLADMLRQPLATF
FT                   LTVMVIAISLALPSICYLVWKNVSQAATQWYPSPQLTVYLDKSLDDNAAQAVVTQLQSE
FT                   DGVDKVNYLSRNEAMGEFRNWSGFGGALDMLEENPLPAVAIITPKMSFQDSTTLTTLRD
FT                   RVAATQGVDEVRMDDSWFARLVALTNLVGQISATIGILMIVAVFLVIGNSVRLSIFSRR
FT                   ETINVMKLIGATDGFILRPFLNGGAAMGVGGAVLSLILSQALVWKLDAVVAQVASVFGT
FT                   TFAVKGLSWDESLLLLLIAGMIGWLAAWLATVQHLRRFTPQ"
FT   gene            125319..126176
FT                   /locus_tag="PC1_0102"
FT   CDS_pept        125319..126176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0102"
FT                   /product="RNA polymerase, sigma 32 subunit, RpoH"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoH; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   KEGG: eca:ECA4343 RNA polymerase factor sigma-32"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11164"
FT                   /db_xref="GOA:C6DGS7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGS7"
FT                   /inference="protein motif:TFAM:TIGR02392"
FT                   /protein_id="ACT11164.1"
FT                   /translation="MTKDMQTFTLVPQGSLEGYIRAANAYPMLTAEEERALAERLHYQG
FT                   DLDAAKHLILSHLRFVIHVARNYSGYGLPQADLIQEGNIGLMKAVRRFNPEVGVRLVSF
FT                   AVHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKTRLGWFNQDEVELVARELGV
FT                   TSKDVREMESRMAAQDMTFDPTPEEDSHDGKAMSPMLYLQDKSSDFADGIEEDNWDTHA
FT                   ADKLTYALEGLDERSQHIIRARWLDDDNKSTLQELADQYGVSAERVRQLEKNAMKKLRA
FT                   AIEA"
FT   gene            complement(126260..126706)
FT                   /locus_tag="PC1_0103"
FT   CDS_pept        complement(126260..126706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0103"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   eca:ECA4342 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11165"
FT                   /db_xref="GOA:C6DGS8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032900"
FT                   /db_xref="InterPro:IPR040448"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGS8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACT11165.1"
FT                   /translation="MKLTVECLTQFSPQDKIDLAKIWPHQNIDLLEAGLKPTRRLFAAR
FT                   FNDRLLGGMLVEIAGDYAELSDMMVREVTRRRGVGQLLVDEARRQLPEVNEWWLATANH
FT                   AAIKEEVLARFMVSCGFSPVSGGWRYIRRKETPLILDDINSEKP"
FT   gene            127111..128223
FT                   /locus_tag="PC1_0104"
FT   CDS_pept        127111..128223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0104"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   eca:ECA4341 leucine-specific binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11166"
FT                   /db_xref="GOA:C6DGS9"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGS9"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACT11166.1"
FT                   /translation="MKFSKGKVLLMGCMAAAFSHAVSAADIKVAVVGAMSGPVAQYGDM
FT                   EFIGARQAIADINAKGGVNGNKLVGVEYDDACDPKQAVAVANKVINDGIRYVIGHLCSS
FT                   STQPASDIYEEEGVIMITPAATNADLTTRGYKMVLRTTGLDSDQGPTAAKYIVETIKPQ
FT                   RIAVVHDKQQYGEGLARSVQDSLKKAGANVVLFEGVTAGDKDFSTLVARLKKENVDFVY
FT                   FGGYYPEMGQILRQSRQAGMTTKFMGPEGVGNSSLSNIAGDASEGMLVTLPKRYDQVPA
FT                   NQPIVDALKAKKLDPTGPFVWTTYAALQSLTTAMTRTGSDEPEKLVADLKAKSVDTVMG
FT                   PLSWDAKGDLKGFEFGVFEWHKDGTSSAVK"
FT   sig_peptide     127111..127185
FT                   /locus_tag="PC1_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 25"
FT   gene            128379..129305
FT                   /locus_tag="PC1_0105"
FT   CDS_pept        128379..129305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0105"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: eca:ECA4340
FT                   branched-chain amino acid transporter permease subunit
FT                   LivH"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11167"
FT                   /db_xref="GOA:C6DGT0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGT0"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACT11167.1"
FT                   /translation="MSEQFLYFFQQMFNGLTLGSTYALIAIGYTMVYGIIGMINFAHGE
FT                   VYMIGSYVSFIVIAALMMMGIDAGWLLIGAAFIAAVVISSAYGWSIERVAYRPVRTSKR
FT                   LIALISAIGMSIFLQNYVSLNQGSRDVALPSLVTGQWVLGESNGFAATISSMQLIIWIV
FT                   TFLAMLALTLFIRYSRMGRACRACAEDLKMASLLGISTDRVISLTFVIGALMAAVAGVL
FT                   LGQFYGVINPYIGFMAGMKAFTAAVLGGIGSIPGAMIGGLILGVAEALTSAYLSTEYKD
FT                   AVSFALLIVVLLVMPTGILGRPEVEKV"
FT   gene            129302..130576
FT                   /locus_tag="PC1_0106"
FT   CDS_pept        129302..130576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0106"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: eca:ECA4339
FT                   leucine/isoleucine/valine transporter permease subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11168"
FT                   /db_xref="GOA:C6DGT1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGT1"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACT11168.1"
FT                   /translation="MKQLNLFNALVSAFMLLVLASFLMGMQLALDGTKLVVRGADEVRW
FT                   YWIGAGCVVVFFFQLIRPFFQQSIKKFSAPPLVLPSFDGSTPRQKVLAAALIIAAIAWP
FT                   FLVSRGTVDIATLTLIYVMLGLGLNVVVGLSGLLVLGYGGFYAIGAYTYALLNHYYGLG
FT                   FWESLPLAGMAAALSGFLLGFPVLRLRGDYLAIVTLGFGEIVRILLLNNTEITGGPNGI
FT                   SQIPKPTFFGLEFSRSARDGGWDTFHNFFGLQYDPSDRIIFLYLVALLLVVLTLFVINR
FT                   LLRMPLGRAWEALRDDEIACRSLGLSPTRIKLTAFTISAAFAGFAGTLFAARQGFVSPE
FT                   SFTFAESAFVLAIVVLGGMGSQFAVILAAILLVVSRELMRDLNEYSMLLLGALMVLMMI
FT                   WRPQGLLPMKRPEMKLKVAKKEEQA"
FT   sig_peptide     129302..129391
FT                   /locus_tag="PC1_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.921 at
FT                   residue 30"
FT   gene            130573..131343
FT                   /locus_tag="PC1_0107"
FT   CDS_pept        130573..131343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0107"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA4338 leucine/isoleucine/valine transporter
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11169"
FT                   /db_xref="GOA:C6DGT2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGT2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT11169.1"
FT                   /translation="MSAQPLLSVRGLMMRFGGLLAVNNVEMDIHAGEIVSLIGPNGAGK
FT                   TTVFNCLTGFYRPSGGTIMLRDRHLEGLPGQAIARMGVVRTFQHVRLFREMTVIENLLV
FT                   AQHQHLKSGVFAGLLKTPGFRRAEADAQERAAVWLERIGLLDLANRQAGNLAYGQQRRL
FT                   EIARCMVTRPELLMLDEPAAGLNPKETDELNQLIAELRDSHQVSVLLIEHDMKLVMGIS
FT                   DRIYVVNQGTPLAQGTPAEIRNNPDVIRAYLGEG"
FT   gene            131349..132050
FT                   /locus_tag="PC1_0108"
FT   CDS_pept        131349..132050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0108"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA4337 leucine/isoleucine/valine transporter
FT                   ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11170"
FT                   /db_xref="GOA:C6DGT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGT3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT11170.1"
FT                   /translation="MLSLHQVSAHYGKIQALHQVSLHINQGEIVTLIGANGAGKTTLLG
FT                   TLCGDPRATEGTITFDGKDITNWQTAQIMREAIAIVPEGRRVFSRMTVEENLAMGGFFA
FT                   DREQYQERIARVYDLFPRLYERRAQRSGTMSGGEQQMLAIGRALMSQPRLLLLDEPSLG
FT                   LAPIIILQIFDTIQQLREEGMTIFLVEQNANQALKLADRGYVLENGHVVLEDTGAALLA
FT                   NEAVRSAYLGG"
FT   gene            132080..133270
FT                   /locus_tag="PC1_0109"
FT   CDS_pept        132080..133270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0109"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   eca:ECA4336 putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11171"
FT                   /db_xref="GOA:C6DGT4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGT4"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACT11171.1"
FT                   /translation="MAIEGLLAHRIAQLKSSAIRELLKHSKMENIISLAGGIPSDALFD
FT                   FEGLSQATHLAITEQPKTAFQYGLTEGSGVLRDRIAELCAVRGVKTRGDDIVVTAGSQQ
FT                   ALDLIMRSMVDPGDVFVVERPTYLAALQTLELAQAQVMSVSSDANGMVVDELEELLKKQ
FT                   RIKGVYIVPNFGNPSGVTLSYERRLQLIQLAERYGFVIIEDDPYGELRFTEERNPTLFQ
FT                   LAQEKLGSTEYVLYTSTFSKVLAPGLRLGWAILPDWLLHKVAIIKQAADLHASALSQTV
FT                   AECYLGLGRLDSQIEKIRHAYKHKGELLAQLVEKELGDVITFNQPKGGMFLWAKFRQND
FT                   FNTTEWLKKTLDQGVVFVPGEFFFPDNVDYSTLRLSFATATDEQMHEAVARLRRAL"
FT   gene            complement(133360..135006)
FT                   /locus_tag="PC1_0110"
FT   CDS_pept        complement(133360..135006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0110"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; KEGG: eca:ECA4335 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11172"
FT                   /db_xref="GOA:C6DGT5"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGT5"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACT11172.1"
FT                   /translation="MKNMSLGKMLGTGFTLIIVIGFLVAILGRVQLEKLGGNIQLLSQM
FT                   RITNLLLMQEVKDNVNIAARSIRNIALLSDQQQMKVEKDRIEQTIARNSELLAKIRKNL
FT                   VDDDAKTLLSTLDQVRPAYTSSMKKATELAMSNEHDAFRNFLLTEVRTTQASVFDILDK
FT                   MVEMQKQLTVELANDSENNALHAGTLMLIIALCSALLGGVVAWWITRKIKRQLGGEPAY
FT                   TLEVTRQVAQGNLAIAIDRRDGDTTSVLAAMEEMRQSLSNIVGQVHQSSESIATGASQI
FT                   AIGNTDLSQRTEEQAANLQETAASMEEMNTTVKQNADTVRSAAQLANAASAAARKGGDV
FT                   VNNVVRTMEEITASSRKIGDIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGE
FT                   VRSLAQRSASAAREIKDLISISVGKVEAGELLVNEAGVTIEEVVEQSQRVANLINEIGL
FT                   TTHEQEQGVSQVNDAVNQLDQVTQQNAALVEESASAADSLNQQARHLVELMSVFKIDGI
FT                   QPQRAAPQAATLPRPKLALAANSSHTNWETF"
FT   gene            complement(135598..137268)
FT                   /locus_tag="PC1_0111"
FT   CDS_pept        complement(135598..137268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0111"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; KEGG: eca:ECA4334 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11173"
FT                   /db_xref="GOA:C6DGT6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGT6"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACT11173.1"
FT                   /translation="MNLIKNSSLGKMLGTGFTLVIAIGFLVAVFGRIQLDKLGENIQLL
FT                   SQVRITNLIMMQEFKDNINTNAIAIRNLTMQEDSRQMQQEKVRIEEMVSRNNALLTKIH
FT                   DSATEKHAQELVAELERVRPAYSSSYTNAITLAMTNKNSEAQHLLLTDVRAKQEAVFKA
FT                   LNDMVNWQEKLTVDIADQSLKNATHAGTLMVIIALLSVVLGAMISWWITRTIKRQLGGE
FT                   PAYTLEVTRQVAQGNLAVAIELRDGDTTSVLAAMEDMRQNLSNLVGQVHQSSESIATGA
FT                   TQIAMGNTDLSQRTEEQAANLQETAASMEQMNTTVKQNAATVRTATELAHSASTTAQKG
FT                   GDAVNNVVRTMEDITASSRKIGDIIGVIDSIAFQTNILALNAAVEAARAGEQGRGFAVV
FT                   AGEVRSLAQRSASAAREIKDLINASVANVEMGEKMVNDAGITIKDIVEKSQHVANLLSE
FT                   IGLTTHEQEQGVAQVNDAVNQLDQVTQQNAALVEESASAADSLSQQARTLLELMGVFKI
FT                   SGVQAQAPRLSAQVKQPTAPRLALASQSGSTSSDNWETF"
FT   sig_peptide     complement(137173..137268)
FT                   /locus_tag="PC1_0111"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.766) with cleavage site probability 0.599 at
FT                   residue 32"
FT   gene            complement(138182..139852)
FT                   /locus_tag="PC1_0112"
FT   CDS_pept        complement(138182..139852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0112"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; KEGG: eca:ECA4333 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11174"
FT                   /db_xref="GOA:C6DGT7"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGT7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACT11174.1"
FT                   /translation="MQHTKKMKLGTQVGSGFAIVIIIGLLVAIFGRMHLVGLGNTTDRL
FT                   AKHHLANLIVLQELKDNLNVTIKATLRMLIATEQKVLEDNQKLIETTSAKNTQLVTQLE
FT                   TNLRATEVRNILGELQQNRTEFARVGRQAVALSLSNRQAESIELVKTQLEPIQTKLFNN
FT                   LNTMIQLQRDYTTQTATNAIEESYYDGNSLLILAVIASLFGAGIAWLITRHIKKQLGGE
FT                   PAYATQVTQEIAQGNLAIPVDLASGDNTSLLFAMNNMRKSLSSIVEQVRESSESIATGA
FT                   RQIAAGSADLSQRTEEQAANLQQTAASTEEMSQTVRQNTDTVRNAAQLAQAASNTAAKG
FT                   GEAVGNIVVTMKEITDSSHKINDIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVV
FT                   AGEVRSLAQRSATAAKEIKELIGHSVEKVETGSALVSDAGTTIEELVRQARHVADLINE
FT                   IGITTQEQESGVSQIHEAVNQLDQVTQQNAALVEQSASAADSLSEQAAHLVELMKVFIV
FT                   EGGAPQRLAPQLKRPDSAKLSLANPKSTTGSDKQNWETF"
FT   gene            complement(140132..141811)
FT                   /locus_tag="PC1_0113"
FT   CDS_pept        complement(140132..141811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0113"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: eca:ECA4332
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11175"
FT                   /db_xref="GOA:C6DGT8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGT8"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACT11175.1"
FT                   /translation="MNFLAKMKLGTMLGAGFASVIIIGLMVAVLGRAHLVDLGEDIESL
FT                   SEKNLTSLILIQDAKNGFDAVARSVRNIGLTDDRSRIQEEKRLIDQQIARNTEILTKLY
FT                   EHMSEPETRDTLESLTQARPAYRDTVNKAVELGLSENAEERARAVQIMVNEMQVTQAPV
FT                   FAALDSMREFQKTRTLDMTTSAMQEARSDGNMLIVFAAIAVLVGILVSVLITRTIKGLL
FT                   GGEVAYAAQIAQAVAQGNLAVAVNLRPGDDRSVLAAMNGMRKSLSSIVEQVRESSESIA
FT                   TGASQIAAGSTDLSQRTEEQAANLQQTAASMEEMSQTVRQNSDTVRNAAQLAQAASNTA
FT                   AKGGEAVGNIVVTMKEITDSSHKIGDIISVIDGIAFQTNILALNAAVEAARAGEQGRGF
FT                   AVVAGEVRSLAQRSATAAKEIKELIGHSVEKVETGSALVSDAGTTIEELVRQARHVADL
FT                   INEIGVTTQEQESGVSQIHDAVNQLDQVTQQNAALVEQSASAADSLSDQAAHLVELMKV
FT                   FVVEGGSSQRLAPQLKRPDSAKLSLANSRSRAGSDTQNWEQF"
FT   sig_peptide     complement(141710..141811)
FT                   /locus_tag="PC1_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.919) with cleavage site probability 0.403 at
FT                   residue 34"
FT   gene            complement(142116..143474)
FT                   /locus_tag="PC1_0114"
FT   CDS_pept        complement(142116..143474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0114"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: eca:ECA4331 inner
FT                   membrane permease YgbN"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11176"
FT                   /db_xref="GOA:C6DGT9"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGT9"
FT                   /inference="protein motif:TFAM:TIGR00791"
FT                   /protein_id="ACT11176.1"
FT                   /translation="MATSLLLCIAIAGVLLLLLMVIKFKIQPFVALLVVSLLVALATGI
FT                   PTEEIMKVMSSGMGGVLGSITMIIGLGAMLGRMIEISGGAESLARKFTQTLGEKRVIAA
FT                   LTMAAFILGIPVFFDVGFIILAPIIYGFAKVAKVSPLKFGLPVAGVMLTVHVALPPHPG
FT                   PVAAASLLKADVGWLTILGLAISIPVGIIGFWVAKYINRRQYALSVDVLEQLQLTKTED
FT                   KSEAVQHKNAPSASLVTALIVIPIAIIMLGTVAATLFPVGHPLRNITTLVGSPAVALLI
FT                   ALALAFYFIAMRRGWSLEKTGNVMGDAMPAAAVVIMVTGAGGVFGKVLVESGVGKALAD
FT                   TLTSIHLPLVPAAFLLSLALRASQGSATVAILTTCGLLSEAVSGLNQMQLVLVTLSACF
FT                   GGLGLSHVNDSGFWIVTKYLGLSVADGLRTWTVLTTILGLAGFLFTWALWLVM"
FT   gene            complement(143665..144447)
FT                   /locus_tag="PC1_0115"
FT   CDS_pept        complement(143665..144447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0115"
FT                   /product="Hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: eca:ECA4330 putative isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11177"
FT                   /db_xref="GOA:C6DGU0"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGU0"
FT                   /inference="protein motif:PRIAM:5.3.1.22"
FT                   /protein_id="ACT11177.1"
FT                   /translation="MPKFAANLSMLFTDVPFLDRFKAAADAGFTSVEYLFPYEYPAPLL
FT                   AEKLRENGLKQVLFNTAPGNIAAGEWGVSALPDRIEDARRDIDNALEYALALNCPSVLV
FT                   MGGVVPPGEDRAAYQQTFIDNLRYAADKFAPHGINIMIEALSAKVKPNYLFASQYQALE
FT                   LSNLIDRPNVYIQLDFFHAQIVDGNLTQIIHDLDGRIGHIQIASVPARHEPDEGEINYP
FT                   FIFAELDRVNYGGWVGCEYNPRGKTEDGLGWIKPWLKK"
FT   gene            complement(144481..145137)
FT                   /locus_tag="PC1_0116"
FT   CDS_pept        complement(144481..145137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0116"
FT                   /product="L-fuculose-phosphate aldolase"
FT                   /EC_number="4.1.2.17"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: eca:ECA4329 putative aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11178"
FT                   /db_xref="GOA:C6DGU1"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGU1"
FT                   /inference="protein motif:PRIAM:4.1.2.17"
FT                   /protein_id="ACT11178.1"
FT                   /translation="MSEKHHNTEAALNSEQRARAEMVKLGASFFQRGYATGSAGNLSLL
FT                   LDDGTLLATPTGSCLGDLDAERLSKVSLSGEWISGDKPSKEVSFHLSIYRNDPECKAIV
FT                   HLHSTYLTALSCLEGLDTQDAIKPFTPYVVMRVGKVPVVPYYRPGDARLGEDLAKLASR
FT                   YKAFLLANHGPVVTGKDLRAAADNMEELEETAKLIFILDDRKIRYLTADDIAELS"
FT   gene            complement(145134..146408)
FT                   /locus_tag="PC1_0117"
FT   CDS_pept        complement(145134..146408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0117"
FT                   /product="type III effector Hrp-dependent outers"
FT                   /note="PFAM: type III effector Hrp-dependent outers; KEGG:
FT                   eca:ECA4328 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11179"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGU2"
FT                   /inference="protein motif:PFAM:PF07005"
FT                   /protein_id="ACT11179.1"
FT                   /translation="MIKLGVIADDFTGATDIASFLVNNGLPTVQLNGVPPSDFKVDTQA
FT                   VVISLKSRSCPAEQAVADSLKALAWLQQQGCQQFYFKYCSTFDSTAKGNIGPVTDALLE
FT                   QLGETQTIISPALPVNGRTVYQGHLFVMDQLLSESGMRHHPVTPMTDSNLMRVMEQQAA
FT                   GQCGLVPYAVMDQGAEAVKQRLAQLKEQGIRYVVLDTLNEQHLLTQGEALRDMKLVTGG
FT                   SGLAIGLARQLADSTKQTGSATEAGKPQSGAGVVLSGSCSVMTNKQVAHYLKQAAGRAI
FT                   DVARCLESDDAQQAYVQELADWVKAHRDDALAPLLYATSSPDELAQIQQRWGAEASSQA
FT                   VEKLFAAVARQLQQDGFQRFIIAGGETSSIVVQTLGIHAFHIGPSISPGVPWVRSTNHP
FT                   LSLALKSGNFGDEDFFARAQKEFAA"
FT   gene            complement(146405..147319)
FT                   /locus_tag="PC1_0118"
FT   CDS_pept        complement(146405..147319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0118"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: eca:ECA4327 putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11180"
FT                   /db_xref="GOA:C6DGU3"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGU3"
FT                   /inference="protein motif:PRIAM:1.1.1.60"
FT                   /protein_id="ACT11180.1"
FT                   /translation="MKKTSDYAVAVIGLGSMGFGAAASCINAGLTTYGVDINPQALERL
FT                   RQAGAAQADTRIDAFADKLDAVVLLVVNAAQVNGILFGEPQVAAKLKPGTVVMVSSTIS
FT                   AQDAKNIEQRLAEHQLIMLDAPVSGGAAKAAAGDMTVMASGSDLAFEKLKPVLDAVAGK
FT                   VYRIGEEIGLGATVKIIHQLLAGVHIAAGAEAMALAARADIPLDIMYDVVTNAAGNSWM
FT                   FENRMRHVVDGDYTPKSAVDIFVKDLGLVTDTAKSLHFPLPLASTAFNMFTAASNAGFG
FT                   KEDDSAVIKIFNGITLPEKKEAP"
FT   sig_peptide     complement(147233..147319)
FT                   /locus_tag="PC1_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.473 at
FT                   residue 29"
FT   gene            147656..148414
FT                   /locus_tag="PC1_0119"
FT   CDS_pept        147656..148414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0119"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; SMART: regulatory protein DeoR; KEGG:
FT                   eca:ECA4325 DeoR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11181"
FT                   /db_xref="GOA:C6DGU4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGU4"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACT11181.1"
FT                   /translation="MIPVERHQQILALIAERGVVSINELTERLGVSHMTVRRDVQKLEQ
FT                   DGLLLSVSGGVRSPERLAIEPSHQDKSVMFSQQKAAMGKLAAQHIPLNSCIYLDAGTTT
FT                   LSLARELAERDDLLIVTNDFAIAAFLIESSQCRMIHTGGTLCRENRSCIGEAVAQALRN
FT                   LFIDIAFISASSWSLRGLSTPNEDKVVVKRAAVEASSKCVLLCDTSKYGRIATHLATPL
FT                   SVFDSIITDDGLPAAAKEALSKMGVEVLVA"
FT   gene            148530..149225
FT                   /locus_tag="PC1_0120"
FT   CDS_pept        148530..149225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4324 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11182"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGU5"
FT                   /inference="similar to AA sequence:KEGG:ECA4324"
FT                   /protein_id="ACT11182.1"
FT                   /translation="MSVRSEIIDGRQASGVTYGLIYTEVLGWIDLGHAKGDDIKDIIQQ
FT                   MYVGENTEDGMPYYDVTYKQGMIGLRRSVTINRFIKWRIKKGRSLQERHSIALAMMLTV
FT                   AKRFESMQASFPFNLVTDSGFSGEDLVSDLLGFYRVVSTPNPFYLLRPVSKEEALKRWD
FT                   FYGPIGNFKNIGFRPILFPDPELMSYAQPRLGFLPSFMQTIQPYNDFESGNVGIASYDG
FT                   TELTTNFFK"
FT   gene            149227..149643
FT                   /locus_tag="PC1_0121"
FT   CDS_pept        149227..149643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11183"
FT                   /db_xref="GOA:C6DGU6"
FT                   /db_xref="UniProtKB/TrEMBL:C6DGU6"
FT                   /inference="similar to AA sequence:KEGG:ECA4323"
FT                   /protein_id="ACT11183.1"
FT                   /translation="MKKKIIIPLVISLLIALPLIYYWPAMVILTEGSSRYTEQDTRRYE
FT                   MLTDEIIKNCPRISSIYDFGYATVDGPALEVSNITFQNTNDATSIRGYLASLGFTLSYT
FT                   DTAGEYWKSTDSDKTIHIGIINDPKTVIVDVIRK"
FT   sig_peptide     149227..149310
FT                   /locus_tag="PC1_0121"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.610) with cleavage site probability 0.340 at
FT                   residue 28"
FT   gene            149754..150032
FT                   /locus_tag="PC1_0122"
FT   CDS_pept        149754..150032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0122"
FT                   /product="Protein of unknown function DUF1778"
FT                   /note="PFAM: Protein of unknown function DUF1778; KEGG:
FT                   ecf:ECH74115_4726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11184"
FT                   /db_xref="GOA:C6DHI4"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHI4"
FT                   /inference="protein motif:PFAM:PF08681"
FT                   /protein_id="ACT11184.1"
FT                   /translation="MKPETKEAPINIRAKASQWDLIDRAANLVSKSRTDFMLEAACREA
FT                   QDILLDQRLFILDNEQFDGLLAELDAPITAERHARINDLMCRQSPWE"
FT   gene            complement(150108..150401)
FT                   /locus_tag="PC1_0123"
FT   CDS_pept        complement(150108..150401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0123"
FT                   /product="plasmid stabilization system"
FT                   /note="PFAM: plasmid stabilization system; KEGG:
FT                   son:SO_A0079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11185"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR028344"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHI5"
FT                   /inference="protein motif:PFAM:PF05016"
FT                   /protein_id="ACT11185.1"
FT                   /translation="MYKLSNLAAEDFAGIFEYTLINYGISQADNYTESLENTLILLAES
FT                   PYIGQEYPEISQGVRRFDHRQHAIFYRIREEDLLIIRILHQQMEPMCHFFDI"
FT   gene            complement(150394..150636)
FT                   /locus_tag="PC1_0124"
FT   CDS_pept        complement(150394..150636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0124"
FT                   /product="putative addiction module antidote protein,
FT                   CopG/Arc/MetJ family"
FT                   /note="TIGRFAM: addiction module antidote protein, CC2985
FT                   family; PFAM: protein of unknown function UPF0156; KEGG:
FT                   son:SO_A0078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11186"
FT                   /db_xref="GOA:C6DHI6"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022789"
FT                   /db_xref="InterPro:IPR038296"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHI6"
FT                   /inference="protein motif:TFAM:TIGR02606"
FT                   /protein_id="ACT11186.1"
FT                   /translation="MPRTTSITIGEQLDDFVSKLIDSGRYSSTSEVIRSALRLLEQQES
FT                   KTEALKKAIYAGEQSGESSLTLREIAAKKKRERNV"
FT   gene            150833..152167
FT                   /locus_tag="PC1_0125"
FT   CDS_pept        150833..152167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0125"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: eca:ECA4322 glycerol-3-phosphate transporter
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11187"
FT                   /db_xref="GOA:C6DHI7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHI7"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACT11187.1"
FT                   /translation="MFNNTTRKTHAIRTAAACVALALMSASAQAATEIPFWHSMEGELG
FT                   KEVNSLADRFNKAHSDVKIVPVYKGNYEQNLAAGIAAYRAGNAPAILQVYEVGTATMMA
FT                   SKAIKPVYEVFKESGINFDESVFVPTVSGYYTDAKSGHLLSQPFNSSTPVLYYNKDAFK
FT                   KAGLDPEQPPKTWQQMAEYTAKLRAAGMKCGYASGWQGWIQIENFSAWHGLPVASKNNG
FT                   FDGTDAVLEFNKPTQVKHIQLLQDMNKKGDFTYFGRKDEPTEKFYNGDCAITTASSGSL
FT                   ANIREHAKFNYGVGMMPYDADAKGAPQNAIIGGASLWVMGGKDAATYKGVAEFMKFLAE
FT                   PENAAEWHQKTGYLPITTAAYELTQKQGFYEKNPGADIATRQMLNKPPLPFTKGLRLGN
FT                   MPQIRTVVDEELESVWTGKKTPQQALDSAVERGNALLRRFEQSTK"
FT   sig_peptide     150833..150925
FT                   /locus_tag="PC1_0125"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            152240..153127
FT                   /locus_tag="PC1_0126"
FT   CDS_pept        152240..153127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0126"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4321
FT                   glycerol-3-phosphate transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11188"
FT                   /db_xref="GOA:C6DHI8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHI8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT11188.1"
FT                   /translation="MTSSRPVFRSSWLPYVLVLPQLLITVIFFIWPAGQALWYSVQNLD
FT                   PFGLSSEFVGMENFKQLFNNPYYLDSFYTTLIFSFLVAGFGMLISLFLAALVDYVIRAS
FT                   RLYQTLIILPYAVAPAVAAVLWMFLFNPGLGLITHFLGLMGYTWNHAQHSGQAMFLVVL
FT                   ASVWKQISYNFLFFLAALQSIPRSLVEAGAIDGAGPVRRFFNLVLPMISPVSFFLLVVN
FT                   LVYAFFDTFPIIDAATAGGPVQSTTTLIYKIYREGFAGLDLSSSAAQSVVLMMLVIGLT
FT                   IIQFRFVERKVNYQ"
FT   gene            153140..153985
FT                   /locus_tag="PC1_0127"
FT   CDS_pept        153140..153985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0127"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4320
FT                   glycerol-3-phosphate transporter membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11189"
FT                   /db_xref="GOA:C6DHI9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR030165"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHI9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT11189.1"
FT                   /translation="MIENRRGLDIFSHVMLIVGILAVLFPLYVGFVAATLDNQEVFQAP
FT                   MTLIPGTHLWENLRYIWLHGAGNNTTPFGLMLLNSFVMALAITVGKITVSILSAYAIVY
FT                   FRFPLRNLFFWMIFLTLMLPVEVRIFPTVEVIARLDMMDSYTGLTLPLMASATATFLFR
FT                   QFFMTLPDELMEAARIDGASPMRFFFDMVLPLSKTNLAALFVITFIYGWNQYLWPLLII
FT                   SDANLGTAVAGIKSMIASGDGATQWNQVMAAMLLTMLPPLLVVLLMQRWFVRGLVDSEK
FT                   "
FT   gene            154011..155084
FT                   /locus_tag="PC1_0128"
FT   CDS_pept        154011..155084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0128"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: eca:ECA4319
FT                   glycerol-3-phosphate transporter ATP-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11190"
FT                   /db_xref="GOA:C6DHJ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017922"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHJ0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT11190.1"
FT                   /translation="MACLKLQAVTKSYDGKIQIIQPIDLDVADGEFVVMVGPSGCGKST
FT                   LLRMVAGLERTTSGDIYIDNQRVTDLEPKDRGIAMVFQNYALYPHMNVFDNMAYGLKIR
FT                   GFGKAQIRERVEDAARILELMPLLQRKPRELSGGQRQRVAMGRAIVREPAVFLFDEPLS
FT                   NLDAKLRVQMRLELQQLHQRLKTTSLYVTHDQVEAMTLAQRVIVMNKGIAEQIGAPADI
FT                   YRRPASLFVASFIGSPAMNLWSGRISDDGCRFEIGGDIALALPEPKPQWRGKALTLGVR
FT                   PEHIQLATRETDGIPLQIDTLELLGADNLAHGKWGGQNVIARLSYEHCPAIGSTLWLHL
FT                   PTSSWHLFDSQSGLRME"
FT   gene            155084..155833
FT                   /locus_tag="PC1_0129"
FT   CDS_pept        155084..155833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0129"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: eca:ECA4318 cytoplasmic glycerophosphodiester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11191"
FT                   /db_xref="GOA:C6DHJ1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHJ1"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACT11191.1"
FT                   /translation="METIWPYPNIVAHRGGGSLAPENTLAAIDVGASLGHKMIEFDAKL
FT                   SQDGQIFLLHDDTLERTSNGWGIAGELPWDKLVGLDVGGWYGHKFVGERLPLLSEVAKR
FT                   CVQYGMAANIEIKPTTGYETETGRVIALAARQLWADHPVAPLLSSFSIDALEAAQQAAP
FT                   ELPRGLLLDEWDEDWLTLTQRLGCVSIHLNHQLLTAERVAELKAAGLRILVYTVNQPDR
FT                   AQTLLDWGVDCICTDRIDLIGASFATG"
FT   gene            155909..156865
FT                   /locus_tag="PC1_0130"
FT   CDS_pept        155909..156865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0130"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: eca:ECA4317
FT                   putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11192"
FT                   /db_xref="GOA:C6DHJ2"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHJ2"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ACT11192.1"
FT                   /translation="MPAFIVSLWHQIFLSLPLFVLIALGYSLIRYGKWPTTVTDGMTRF
FT                   VFSVAMPAMLFRLMSDFSQRPVVDARLLIAFFGGCLLVFVLGRIVARKIFHLDGVSGSL
FT                   FALSGIFSNNVMLGLPIATLMLGEEAIPSVALVVVFNGLILWTLVTVSVEWARNGALSL
FT                   QGFTKTALGVLKNPLIIGILSGTAFSLTGLPLPSYIDQPLSMLGQIAAPLSLVALGMGL
FT                   AEYRVRDGWQISTAICTIKLLVQPLVIWGIAIALSLPEMETRAVVLLGSMAVGVNVYLM
FT                   SRQFGVLGGPVASSLLLSTAMAALTTPLILTLMGVRL"
FT   gene            complement(156879..157175)
FT                   /locus_tag="PC1_0131"
FT   CDS_pept        complement(156879..157175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0131"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4316 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11193"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHJ3"
FT                   /inference="similar to AA sequence:KEGG:ECA4316"
FT                   /protein_id="ACT11193.1"
FT                   /translation="MKHPTTLLACTVLLGLPLLASANTTQAPTPQQQFESGISSQKQLQ
FT                   QNMQQSQKVQQQQLNQQLQQRNQQLQQQRQQQLQKDLERSQRTTPPPPIKQNP"
FT   sig_peptide     complement(157107..157175)
FT                   /locus_tag="PC1_0131"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.936 at
FT                   residue 23"
FT   gene            157372..157836
FT                   /locus_tag="PC1_0132"
FT   CDS_pept        157372..157836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0132"
FT                   /product="tRNA/rRNA methyltransferase (SpoU)"
FT                   /note="PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   eca:ECA4315 putative RNA-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11194"
FT                   /db_xref="GOA:C6DHJ4"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHJ4"
FT                   /inference="protein motif:PFAM:PF00588"
FT                   /protein_id="ACT11194.1"
FT                   /translation="MFHIALYEPQIAPNTGNIIRLAANNGCTLHLIEPLGFDFEEKKLR
FT                   RAGLDYHDLANVSRHKNYQDFLAAVPGKRIFACTTKGSRPYDQPAYQPGDVLLFGSETS
FT                   GLPDEIRNGFESDFRIRIPMQSNNRSLNLSNAVAIISYEAWRQNGFGGCL"
FT   gene            complement(157847..158647)
FT                   /locus_tag="PC1_0133"
FT   CDS_pept        complement(157847..158647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4314 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11195"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR021488"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHJ5"
FT                   /inference="similar to AA sequence:KEGG:ECA4314"
FT                   /protein_id="ACT11195.1"
FT                   /translation="MGRQARLLLVTPSIVLACILSFCTQATSVNAAPSTVNAANTTVDA
FT                   TRYQDFWLWAAVKPQPILHQAQTLYLHQGEVARRQGKVVFLRQGIPPSQLRVNRVWLAF
FT                   RMTTLELSDRHLNRMLKLREKWQRHGNQIVGIQIDFDAKSYQLAGYVAFLTQLRERLPE
FT                   DCQLSITGLLDWSKTGDVSALNRLQGKLDEVVVQTYQGRNTITNYAEYLPALMKLTLPF
FT                   RVGLVQNGKWEPQWQQRLATSPYYRGEVVFLVNPPLKKSATGRL"
FT   sig_peptide     complement(158552..158647)
FT                   /locus_tag="PC1_0133"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.973 at
FT                   residue 32"
FT   gene            complement(158617..160791)
FT                   /locus_tag="PC1_0134"
FT   CDS_pept        complement(158617..160791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11196"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHJ6"
FT                   /inference="similar to AA sequence:KEGG:ECA4313"
FT                   /protein_id="ACT11196.1"
FT                   /translation="MKGVTLLAGVLTALMSSQAFSSSDGVCGFSDSECGMSALPYLQPG
FT                   NDTRTNLMLLQSRLHGISLPLPHPLPDQARSRIDPFTAYRVMGIAATETPQTSESGEDV
FT                   TADAPYLSTLNKAKQLHLPLSVQSTISTFSPDDNEGRHISNALSTLEAFFDVLLADKPL
FT                   TEEQRTLLAHQRVNILNPLYTKDALNEGLASLPDEGHAGALMQYLFAVLAFYQGHFDEA
FT                   ESGFQALVSSPQPWVAETSRYMLIRVAINKAMENALDEYNMFDAGKADKATAQLAVQHI
FT                   DDYLKQYPEGQYVDSANGLYRRAYWIMNDTNALAKTYQHELDGTTDVEDLLELNDEIDN
FT                   KLLENRQFTSAPGSAPLTMVQDLKRLRSDEGWLALPALSTEELAAQKPLFEQDNMQDAF
FT                   SYLQAAQLFYGQKDYAAVVNSVPATQENDLTDTVRFSLQVLRGRALVRLERWDEAEVHW
FT                   RQLLTRKMGYTQNQFLQLALAETLVKAGHPERIFTADSPVKNLRFRSAVLKISANADLL
FT                   RQQTGAQQSHEERAIALHTLLTKSLTHGDYASYLKDVQLRKDIAPLVSSENQSWNQEDL
FT                   TAFDWDGSDTEEDYQCPALNDVVTTLNQRPNDARAINCLGEFFLRTNNSVGFDWGEGSM
FT                   LSGLTNAPTQFVGTEYNRLDGYMKVIADPKAPPEDKTYALYRAVYCYAPSGYNDCGPQE
FT                   ISKATRKAWFTQLKTKYKGSVWADKLDYYW"
FT   sig_peptide     complement(160726..160791)
FT                   /locus_tag="PC1_0134"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 22"
FT   gene            complement(160982..162352)
FT                   /locus_tag="PC1_0135"
FT   CDS_pept        complement(160982..162352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0135"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   eca:ECA4312 two-component sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11197"
FT                   /db_xref="GOA:C6DHJ7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR032404"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038515"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHJ7"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACT11197.1"
FT                   /translation="MINSLTARIFAIFWLTLALVLMLVLMVPKLDSRQLTALLENEQRQ
FT                   GIMLEQHIEADLANTPANDLRWWLRLFWVLEKWAPPGQRLFLVTSEGRIFGVEKHETPI
FT                   VRNFIGLSDNADHPQKKNYGRIELLGPFAIRDGDDNYQLYLIRPASSPQSDFISLLFDR
FT                   PLLLLIFTMLISSPLLLWLAWSLAKPARKLKHAADEVAKGNLRQHPELESGPQEFQATG
FT                   VSFNQMVSALERMVTAQQRLLSDISHELRTPLTRLQLATALLRRRQGEGNELNRIETET
FT                   QRLDSMINDLLVLSRNQHKNELTREFLRADELWGNVLDDAAFEAEQMGKTLEVPYPPGP
FT                   WTLFGNPASLDSALENIVRNALRYSHNHIEVAFSVDNQGITIKVDDDGPGVSPEDREQI
FT                   FRPFYRTDEARDRESGGSGLGLAIVETAITQHKGWVKAEDSPLGGLRLIIWLPLHQR"
FT   sig_peptide     complement(162254..162352)
FT                   /locus_tag="PC1_0135"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.628) with cleavage site probability 0.597 at
FT                   residue 33"
FT   gene            complement(162349..163047)
FT                   /locus_tag="PC1_0136"
FT   CDS_pept        complement(162349..163047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0136"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: eca:ECA4311 DNA-binding transcriptional
FT                   regulator CpxR"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11198"
FT                   /db_xref="GOA:C6DHJ8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHJ8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACT11198.1"
FT                   /translation="MNKILLVDDDRELTSLLKELLEMEGFNVVVAYDGEQALQVLDNTI
FT                   DLLLLDVMMPKKNGIDTLKELRQQHQTPVIMLTARGSELDRVLGLELGADDYLPKPFND
FT                   RELVARIRAILRRSNWTDQQQAGDNSAPTLEVDGLRLNPGRQEASFDDIVLDLTGTEFT
FT                   LLYLLAQRLGQVVSREHLSQEVLGKRLTPFDRAIDMHISNLRRKLPERKDGLPWFKTLR
FT                   GRGYLMVSAA"
FT   gene            163201..163725
FT                   /locus_tag="PC1_0137"
FT   CDS_pept        163201..163725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0137"
FT                   /product="putative stress resistance protein"
FT                   /note="KEGG: eca:ECA4310 putative stress resistance
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11199"
FT                   /db_xref="GOA:C6DHJ9"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHJ9"
FT                   /inference="similar to AA sequence:KEGG:ECA4310"
FT                   /protein_id="ACT11199.1"
FT                   /translation="MQQFATLSLASLLMLGTFTAVAAESGDAPASGWHIDDSATKGVSG
FT                   QQGMFDGVRLTEQQRQQMRDLMHQSRQDKPAFNAEDVKAMHKLVTAETFDEAAVRAQIT
FT                   RMMSVQIERQIQMTRVRNQMYNLLTPAQKEILDVKHKQRMKEMQQQISMFNQMAAPAPG
FT                   TTNQTETENPE"
FT   sig_peptide     163201..163269
FT                   /locus_tag="PC1_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.976 at
FT                   residue 23"
FT   gene            164123..165310
FT                   /locus_tag="PC1_0138"
FT   CDS_pept        164123..165310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0138"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA4309 sugar efflux transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11200"
FT                   /db_xref="GOA:C6DHK0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHK0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACT11200.1"
FT                   /translation="MTRSSRSTAWLRVVSLSLAAFIFNTAEFAPVALLSDIAASFSMSA
FT                   AQVGLIITIYAWVVGLMSLPCMLLSSDMERRSLLIKIFILFAISNVLSGLAWNYWVLVI
FT                   ARIGVALAHAIFWSITASLVVRLAPADKKAQALSLLATGTALALVLGLPLGRVVGQYLG
FT                   WRVTFVLIGLIAAAIMVGLMKLLPVLPSSNSGSLKSLPLLLKRPALLCVYGLIVMIVTA
FT                   HFTAYSYIEPFIQKVALLSENFTTILLLIFGGAGIIGSMLFSRYSSKYPAGFLIVSFAF
FT                   LAVCLLLLLPLSFSGWSLSTLCIVWGIAIMALSLGMQVKVLTLASDATDVAMALYSGIY
FT                   NIGIGGGALLGNQVIIHLGLPDIGFMGAAMAMLATVCCILTFVRYSRVLKTSLTS"
FT   sig_peptide     164123..164227
FT                   /locus_tag="PC1_0138"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.336 at
FT                   residue 35"
FT   gene            165354..166256
FT                   /locus_tag="PC1_0139"
FT   CDS_pept        165354..166256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0139"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG: eca:ECA4308
FT                   ferrous iron efflux protein F"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11201"
FT                   /db_xref="GOA:C6DHK1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR023783"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHK1"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACT11201.1"
FT                   /translation="MNPHYARLVTLAAVSATAVALVLFIMKVFAWWHTGSVSLLASLVD
FT                   SLVDIAASLVNLLVVRYSLQPADTEHAFGHGKAESLAALAQSMFISGSALFLILTGLQH
FT                   SLEPQTLHAPEVGMWVTLIALVATLLLVSFQRWVVKRTHSQAVRADMLHYQSDLLMNGA
FT                   ILVALALSWKGITRADSLFALGIGGYILYSALRMGYDAVQSLLDRALPDDEHRAIAEVI
FT                   VNWPGIRGAHALRTRRSGPTRFIQLHLEMDDALPLVQAHQIADDLEQALLKRFPGADII
FT                   IHQDPVSAVPENQRGRLTA"
FT   sig_peptide     165354..165446
FT                   /locus_tag="PC1_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.897 at
FT                   residue 31"
FT   gene            166464..167426
FT                   /locus_tag="PC1_0140"
FT   CDS_pept        166464..167426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0140"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /note="KEGG: eca:ECA4307 6-phosphofructokinase; TIGRFAM:
FT                   6-phosphofructokinase; PFAM: phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11202"
FT                   /db_xref="GOA:C6DHK2"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHK2"
FT                   /inference="protein motif:TFAM:TIGR02482"
FT                   /protein_id="ACT11202.1"
FT                   /translation="MIRRIGVLTSGGDAPGMNAAIRGVVRAALTEGLEVYGIYDGYQGL
FT                   YEDRMEQLDRYSVSDVINRGGTFLGSARFPQFRDEAVRQVCVENMKRRGLDALVVIGGD
FT                   GSYMGAKRLTEMGFPCIGLPGTIDNDVAGTDYTIGYFTALETVLEAIDRLRDTSSSHQR
FT                   ISIVEVMGRHCGDLTLAAAIAGGCEFIVLPEVPFSPEDLVCEIKAGIEKGKKHAIVAIT
FT                   ELVCDVDELAKYIEKETGRETRATVLGHIQRGGSPVAYDRILASRMGAYSIELLQQGYG
FT                   GRCVGIQNEKMVHHDIVDAIENMKRPFKGDWLDTAKKLF"
FT   gene            167946..168875
FT                   /locus_tag="PC1_0141"
FT   CDS_pept        167946..168875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0141"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: eca:ECA4305 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11203"
FT                   /db_xref="GOA:C6DHK3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHK3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACT11203.1"
FT                   /translation="MNIDLRQLRHFIALIEHRNFTSAAQAMKLSQSAFSRSIQSLEQTI
FT                   GTRLIDRMNQLEPTPKGLVVLEHARRLINQTHDLFNDIQQFNEKEAGEVNFGCGPAPAA
FT                   WLMPQVIGDFSRHYPKVRMVFRVDNWQALGHRLMAEELDFIVADMRNFEFDTRYRVQPL
FT                   SQHRWGFCCRSGHPLAAQEEITVEQFFSYPLAATIRPPNLHRALVQLSGKLDIRTSIEC
FT                   ENGYSLLDVVRHSDAIGTTNHFNEPERHGLHMLKIAGLDDNTDEFYTHYGIIYLADARL
FT                   SLLARKLIDTFVQVDSDLHGTPAVLTAE"
FT   gene            complement(168862..169590)
FT                   /locus_tag="PC1_0142"
FT   CDS_pept        complement(168862..169590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0142"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4304 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11204"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHK4"
FT                   /inference="similar to AA sequence:KEGG:ECA4304"
FT                   /protein_id="ACT11204.1"
FT                   /translation="MPPPGGTLQDITMTDPGCTENTLLLSLQADDTHDIIDSPHRSTFI
FT                   WSTDSIGQPLRWQVEQEDPDRTTIQTTPEHLALESAAGLTIWLDAPLSGTYRIAFTREV
FT                   LVADRPYDRVSDLNQFWGARDLHHPNLFTRYGKLNEYDSLNLYYVGMGGNWNSTTRFRY
FT                   YDGHGERLLLGEYTDATHLLRPNHRYRIVIEVDRRETRFWVDDVLYFHASYPNIPAPGY
FT                   FGFRTVFSRQEISDFSITPL"
FT   gene            complement(169590..172349)
FT                   /locus_tag="PC1_0143"
FT   CDS_pept        complement(169590..172349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0143"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA4303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11205"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHK5"
FT                   /inference="similar to AA sequence:KEGG:ECA4303"
FT                   /protein_id="ACT11205.1"
FT                   /translation="MNKMPYSRRRFLRDSTLLALSAPFWNATAPRASAYAGESAPQVNL
FT                   RWLDGQRPRAFTGVTWGVPWPQGAVRNDSGFQLHDAQQHAYDLQSWPLARWPDGSIKWS
FT                   AHALGGDTPPEDGLTLRPIPAKDGSMGSAMVREHEHGWTVETGRIRYEIPRSGTRLISE
FT                   IWRNNRLALTNGRLVLRMQRGAETESTLTLDAYQGVIDTVTVEQNGAQRTVIALRGTHH
FT                   APQQGVTRIPFIIRLYSYANTDSLRVLHTLIYDNDDDLVSLKGLGLAFDVPLQGELHDR
FT                   HIRFVSDQGGLFREAVRGLSGLRRDPGSAVIAAQLAGQATPPIADFSPEVGKRLDYIPA
FT                   FGSYRLTQHHPDGFQIHKRTVAGQGWLLSATGERAAGVGYLGTPTGGVAFGIRHFWQSY
FT                   PACLEIDNAHTDVATVTLWLWSPWAEPMDMRFYHDGLGQDTHDKQREGLAITYEDYEPG
FT                   FGSAVGVARTSELFIDVLPATPDAEDLVNRARRMQQPPLLVADAQDLQRAQAFGSMWAP
FT                   SSATTPARIRLEKQLDAYFDVYQQEVEQRKWYGFWDFGDVMHTYDSDRHVWRYDVGGYA
FT                   WDNSELSTDLWLWYYFLHSGRAEAFRLAEAMTRHTGEVDVHHLGRFSPLGSRHNVRHWG
FT                   DSAKQLRISTVANRRFLYYLTADERIGELMDEQVEALRTLSAVLPGRKIGQTHPDSPNH
FT                   ISLGFGTDWGAVAAAWLTAWERHSDPSMRERLLNSMQTLASQPHGFFTGSAAIDPDTGR
FT                   FLPAPADQVEISHLSAVFGLTEICSELVEALPDPAFTRAWLDYCRLYNDPIALSTAVGK
FT                   TVKKLNLAQGHARLTAFAARRLNDRALAQRAWAEFTAGSGGIAHPTLEQRRVTPPAVLY
FT                   PINEPVIDSTIDKHSGSTMAVNLATNAVAQWGLTAIALLALLDDIPSS"
FT   sig_peptide     complement(172239..172349)
FT                   /locus_tag="PC1_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.722 at
FT                   residue 37"
FT   gene            complement(172354..174624)
FT                   /locus_tag="PC1_0144"
FT   CDS_pept        complement(172354..174624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0144"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: eca:ECA4302 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11206"
FT                   /db_xref="GOA:C6DHK6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHK6"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACT11206.1"
FT                   /translation="MYLKKHQQYLKEHQRKITSGILMSCVLTLPAMARAADPQITTDNV
FT                   PRTEATTAAPVQLKRVKVNAQRTPVQPPTTLASVIDGKTLEEERVYRFEELSQLVTGLD
FT                   VDTVDVMDTTVTIRGIGDGGESGTNIGMPGSVGLFVDGVYLSRPGVISNDLLDIDSTRV
FT                   LKGPQGAAYGFNTTGGAIDIRTRKPTFTPEYSLEQSFGQRGYLQSKLMASGPLSDHWAG
FT                   RINLSRTERGGNVTNIENGHKLGGSTNNGVRGQLLYQPNDSFSLRITGDYSDSTQRPVS
FT                   VLVSATDDFRNRAQQTGLKVVGDRQVAMDDENVIRVAQGGGSVEANWRLKNGYSVNSLS
FT                   SLRYFRVLPSTADNWNIPLYHDSGADVRDRVWSQSFWLDSPKGNTFDYSLGVDYWGENL
FT                   DTEANSRYYNDNRVRTWVGNGYQGINVQRFGTLDDTVYSVYGRGTWHAADKLDVIVGLR
FT                   QTYEKKEGTFVRKNRATFDSGPLSQTNRLPSGSISLNWFAAPNVTPYVTLGYGEKSGGL
FT                   NVSSGAARQLGIDSLYVDPEKTRSAELGVKTHWLQRKVEWNTALFWSVVEDFQNNAYDE
FT                   ETDTSYLINAGKFRSRGGETQLTVRPIDGLSISLAGTVLDARYLNFPNARCPAEISAVS
FT                   CDMSGKRVFKSPTLSYNTRVRYQWDTPNNLQASVSGQWSWRSWAYGTLDDSEYNRIPAY
FT                   GVLNLSSGLSGKQGDNRWNVSLWVKNALDKNYYRSVRGSSATTGVIGEPRMVGISVGYD
FT                   FKG"
FT   sig_peptide     complement(174517..174624)
FT                   /locus_tag="PC1_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.939 at
FT                   residue 36"
FT   gene            complement(174710..175717)
FT                   /locus_tag="PC1_0145"
FT   CDS_pept        complement(174710..175717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0145"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   eca:ECA4301 putative sulfate ester binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11207"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHK7"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACT11207.1"
FT                   /translation="MKTSGRKWLVTSLLAMGMAWSGIASAITEIRIAAPDIGAGTKPSG
FT                   GGLLDVIHSQKLLEREFGKDGISVRWTFIKGAGPVINEAFGNHQVDVAYLGDLASIIGR
FT                   ARGLDTRVIAVASRGINHYLAVAKGSGIEKIADLKGKRIGIFRGTAGELSFVSALDSQG
FT                   LKPSDVKLINLDFAAASAALAAGQIDATWGGSNTLSLRDKGLADIPLSSRDLNGAGQLS
FT                   GFLLVDEKFAKGNEDILRRLVKVQREAANWASDEKNKDEFIRLLATQSGYPENILRVEW
FT                   DTLPPLTERLSPELDPAFVEKLKRAVTLAYESRLIRQPFDVDKWLDDSYLKATQ"
FT   sig_peptide     complement(175637..175717)
FT                   /locus_tag="PC1_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.785 at
FT                   residue 27"
FT   gene            176370..177233
FT                   /locus_tag="PC1_0146"
FT   CDS_pept        176370..177233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0146"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; PFAM: Gram-negative
FT                   tonB protein; KEGG: eca:ECA4300 TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11208"
FT                   /db_xref="GOA:C6DHK8"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHK8"
FT                   /inference="protein motif:TFAM:TIGR01352"
FT                   /protein_id="ACT11208.1"
FT                   /translation="MTELLYAGAVSGSRSYSPEPTPHASRVNGVVQSRVPALNTTVSSR
FT                   PERWLAAIATLLLHAAVLALFSSASTPPVTVPARPQPISIELVAAVAEPVLQAEPAEPE
FT                   VVAPPPELTPPVVDKPVDDNALLPPEPEKKEPERKAPEKKPEPAPKKVAVKKNPPAPTP
FT                   KPQAETVSASAPVTPAPVAQQAVAPPVDAPLTPPLANADYLHNPAPSYPDVAISRGYEG
FT                   TVLLNVQVRADGKVQTIRIHQSSGYPSLDEAARDTVLRWSFVPARRGNQPVSGWVVVPV
FT                   DFSLNS"
FT   gene            177245..177961
FT                   /locus_tag="PC1_0147"
FT   CDS_pept        177245..177961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0147"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   eca:ECA4299 putative biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11209"
FT                   /db_xref="GOA:C6DHK9"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHK9"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ACT11209.1"
FT                   /translation="MTLGHIELFSAEGAVILLLLLFSLVTWGLGLLKFVQYGRAQRRDR
FT                   RFRAAFWQQDDVSQTPETSAKQPGSLANLALAAVKAPEQMSGQLALNIHLPDRVERALQ
FT                   QQIQRERRTLESGLAVLASIGSTSPFIGLFGTVWGIMAALQEIGLSGSASLDTVAGPIG
FT                   NALIATGIGIAVAVPAVLIYNYFLRRLKLAVADMDDFAHDVYSVMQAHDFHVSTVHASV
FT                   DPSSATFSVKNLREVV"
FT   gene            177963..178364
FT                   /locus_tag="PC1_0148"
FT   CDS_pept        177963..178364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0148"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   eca:ECA4298 putative biopolymer transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11210"
FT                   /db_xref="GOA:C6DHL0"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHL0"
FT                   /inference="protein motif:PFAM:PF02472"
FT                   /protein_id="ACT11210.1"
FT                   /translation="MAFTSRNDEDVMSEMNITPLVDVMLVLLVVFIVTAPMLTNAIPIQ
FT                   LPKTSAVAPADRADPVVISIDGEQRVFINKENLAREQLVPRLQQAKASNADLVVQVQAD
FT                   KDANYGAVAALLADVEQAGITRLSLLTQK"
FT   gene            178386..179984
FT                   /locus_tag="PC1_0149"
FT   CDS_pept        178386..179984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0149"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4297 sulfate ester
FT                   ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11211"
FT                   /db_xref="GOA:C6DHL1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHL1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT11211.1"
FT                   /translation="MMPKYPLRIRPAPDASLTAAALSAGYSALVVSLVVPLLVLAGWWL
FT                   ASRHGWMSEQILPSPLAVIDSARAFIPEELVHQLPISLLRLAIGFSGGIALGLVLGSLF
FT                   GLNRRLNALFMPLFTVIAQIPTLAWIPLLMLSLGIGEALKLVVLVKSVTVPVTLYTCAG
FT                   IQQTPQKLHEMARSLRLPPAAFLRYLILPAMLPYVMTGVRLAFSTGWVALIAVELLASS
FT                   EGLGYLLVQSRQLFMLDLVFVCILIIGILGFAGERVLLKLERRWIHWPAPVLGRDSLGY
FT                   ALPSLSLTPWLAPLVLVVLWQVSSTYEWVNVAFLPAPSRVIDALWTGLVQGGLLIDLHA
FT                   SLLRALQGFTLGSAIGVLVGAVLGGWRIADRLFNPALSALRCVALFAWLPLITAWFGLG
FT                   ESAKIVFIAVAAFFPVMLATRQGIAQLPPALLEVAQVLRLTPVQTLRTLILPSVLPPLF
FT                   SGLRLALMHAWTGAIGAEYFMPSGEGLGGMMIRAQQLLESDRIMAGVVLIAAVAALFSR
FT                   LITLSERRLTRWRFA"
FT   sig_peptide     178386..178511
FT                   /locus_tag="PC1_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.891) with cleavage site probability 0.709 at
FT                   residue 42"
FT   gene            180002..180760
FT                   /locus_tag="PC1_0150"
FT   CDS_pept        180002..180760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0150"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA4296 sulfate ester ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11212"
FT                   /db_xref="GOA:C6DHL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHL2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT11212.1"
FT                   /translation="MSLHFQHITKHFIVNGTPLTVLQDIDLSLHAGELVAIIGASGCGK
FT                   STLLRLAAGIDTTERGRILIGERPVRGIPDDVSLVFQEPRLFPWLTVTDNIRLGMLNLN
FT                   LSPAEVERRIAHYLQMMGLEGFADAWPHQLSGGMAQRVAIARGLVSTPHILLLDEPFGA
FT                   LDALTKQQLQARLAEIRQQTDLTILLVTHDVEEAVFLADRVVVMSPRPGRISRILPINL
FT                   TYPRDRTSTALLEQRQAVSQALHQADAVEA"
FT   gene            complement(180801..180938)
FT                   /pseudo
FT                   /locus_tag="PC1_0151"
FT   gene            181270..182154
FT                   /locus_tag="PC1_0152"
FT   CDS_pept        181270..182154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0152"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /note="TIGRFAM: N-carbamoylputrescine amidase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: eca:ECA4274 putative
FT                   carbon-nitrogen hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11213"
FT                   /db_xref="GOA:C6DHL3"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHL3"
FT                   /inference="protein motif:TFAM:TIGR03381"
FT                   /protein_id="ACT11213.1"
FT                   /translation="MKKVTVAATQMACSWDLPKNIENAEKLVRQAHAKGAQVILIQELF
FT                   AAPYFCIDQSPEHYALAQELETSPLIKHFSALAAELNVVLPLSFFERANNAYYNSLVMI
FT                   DADGAVLDVYRKTHIPNGPAYQEKQFFIPGDTGFKVWQTRYAKIGVGICWDQWFPETAR
FT                   SLALQGAELIFYPTAIGSEPAYPDIDSQPHWTRVQQGHAAANLVPVIASNRIGTEASKY
FT                   IDGLEMTFYGSSFIADQTGALVAQANKTDEAILVHEFDLEAIAAQRASWGLFRDRRPDM
FT                   YGTIATSDGKTWR"
FT   gene            182158..183261
FT                   /locus_tag="PC1_0153"
FT   CDS_pept        182158..183261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0153"
FT                   /product="agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="KEGG: eca:ECA4273 agmatine deiminase; TIGRFAM:
FT                   agmatine deiminase; PFAM: Porphyromonas-type
FT                   peptidyl-arginine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11214"
FT                   /db_xref="GOA:C6DHL4"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHL4"
FT                   /inference="protein motif:TFAM:TIGR03380"
FT                   /protein_id="ACT11214.1"
FT                   /translation="MSQPATPSLTTPHQDGFAMPAEWAPHDAVWMIWPYRTDNWREQGI
FT                   PAQKTFARVAEAIAQNTPVIMGVPARYMANAQQVMPVNVTLVEMESDDAWMRDTGPTIV
FT                   LNQAGERRGIDWQFNAWGGELGGLYEDWRQDEKVAAQVLDYHQAGRYAAPLILEGGSIH
FT                   VDGEGTLLTTAECLLNPNRNPHLSKAEIEQLMRDYLSISTIIWLEEGVYNDETDGHIDN
FT                   MCCFVRPGEVALHWTDDENDPQYARSVAAYEVLSAARDAQGRELKIWKLPAPGPLYATK
FT                   EEAQGVDSGDAVERLAGSRLAGSYVNFLISNQQIIFPLLDEKTDDVARDLLQQMFPGYL
FT                   ISGVPAREILLGGGNIHCITQQIPAVK"
FT   gene            complement(183401..184168)
FT                   /locus_tag="PC1_0154"
FT   CDS_pept        complement(183401..184168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0154"
FT                   /product="triosephosphate isomerase"
FT                   /note="TIGRFAM: triosephosphate isomerase; PFAM:
FT                   triosephosphate isomerase; KEGG: eca:ECA4272
FT                   triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11215"
FT                   /db_xref="GOA:C6DHL5"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR022896"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHL5"
FT                   /inference="protein motif:TFAM:TIGR00419"
FT                   /protein_id="ACT11215.1"
FT                   /translation="MRHPLVMGNWKLNGSTHMVNELIAGLRKELSTVDGCGVAIAPPAI
FT                   YLDQANHQLAGSRIALGAQNVDVNLSGAFTGETSADMLKDIGAKYIIIGHSERRTYHKE
FT                   SDEFIAKKFGVLKDAGLIPVLCIGETEAENEAGQTEAVCARQLDAVLNTLGAKAFENTV
FT                   IAYEPVWAIGTGKSATPAQAQAVHKFIRDHIAKQDAAVAEQVIIQYGGSVNAANAAELF
FT                   TQPDIDGALVGGASLKADAFAVIVKAAADAKRG"
FT   gene            complement(184334..184933)
FT                   /locus_tag="PC1_0155"
FT   CDS_pept        complement(184334..184933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0155"
FT                   /product="protein of unknown function DUF1454"
FT                   /note="PFAM: protein of unknown function DUF1454; KEGG:
FT                   eca:ECA4271 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11216"
FT                   /db_xref="InterPro:IPR009918"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHL6"
FT                   /inference="protein motif:PFAM:PF07305"
FT                   /protein_id="ACT11216.1"
FT                   /translation="MTRKRIASLLVLSSLVLYQTHAAADPTFPPKPSANAPYLLAGAPT
FT                   FDQTITQFRSRYNLSNPTLPIGEFRVVDTGNITSMLTRAASRINDHLYASTALEKGTGK
FT                   IKTLQITWLPQPQSDQETAARRKQAIDYMAALARTFAPSLTEEQSMKKVTELLEKGKGQ
FT                   RFYPQTEGALRYVVADDGEKGLTFAVEPIKLTLSEP"
FT   sig_peptide     complement(184859..184933)
FT                   /locus_tag="PC1_0155"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.705 at
FT                   residue 25"
FT   gene            185131..185553
FT                   /locus_tag="PC1_0156"
FT   CDS_pept        185131..185553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0156"
FT                   /product="protein of unknown function DUF805"
FT                   /note="PFAM: protein of unknown function DUF805; KEGG:
FT                   eca:ECA4270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11217"
FT                   /db_xref="GOA:C6DHL7"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHL7"
FT                   /inference="protein motif:PFAM:PF05656"
FT                   /protein_id="ACT11217.1"
FT                   /translation="MTLQQWCFSFKGRIGRRDFWLWMAIWVALMAVLFTLSGQSWLDTQ
FT                   STAFGLVVLLWPTAAIMVKRLHDRNKSGWWALLLVVAWMLASGNWTMFSTIWQWGIGRF
FT                   LPILIVVMTLLDCGVFLGTKGENRFGAEAEPFRFRR"
FT   sig_peptide     185131..185259
FT                   /locus_tag="PC1_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.746) with cleavage site probability 0.681 at
FT                   residue 43"
FT   gene            complement(185571..186317)
FT                   /locus_tag="PC1_0157"
FT   CDS_pept        complement(185571..186317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0157"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; Oxidoreductase FAD-binding domain protein; KEGG:
FT                   eca:ECA4269 ferredoxin-NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11218"
FT                   /db_xref="GOA:C6DHL8"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHL8"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACT11218.1"
FT                   /translation="MAEWVTGKVVQVENWTESLFSIRVHAPTDSFTAGQYGKLALEIEG
FT                   EKVQRAYSYVNAPSDPTLEFYLVTVPEGKLSPHLHALQPGSEVMVVKEPAGFFVLEEVP
FT                   DCETLWMLATGTGIGPYLSILQEGKDLERFKNIVLVHAARFSRDLSYLPLMQQLQQRYH
FT                   GKLRIQTVVSREEETGSLTGRVPQLISNGTLEAAVGLPMNAETSHVMLCGNPQMVRDTQ
FT                   LLLKEERQMTKHLRRRPGHMTAENYW"
FT   gene            complement(186435..187445)
FT                   /locus_tag="PC1_0158"
FT   CDS_pept        complement(186435..187445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0158"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /note="KEGG: eca:ECA4268 fructose 1,6-bisphosphatase II;
FT                   TIGRFAM: fructose-1,6-bisphosphatase, class II; PFAM: GlpX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11219"
FT                   /db_xref="GOA:C6DHL9"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHL9"
FT                   /inference="protein motif:TFAM:TIGR00330"
FT                   /protein_id="ACT11219.1"
FT                   /translation="MKRELAIEFSRVTEAAALAGYKWLGRGDKNAADNAAVQAMRIMLN
FT                   QVNINGQIVIGEGEIDEAPMLFIGEQVGTGKGDAVDIAVDPIEGTRMTAMGQANALAVL
FT                   AVGEKGAFLHAPDMYMEKLIVGPEAKGAIDLNLPLADNLRNIALKLGKPLSQLTVTTLA
FT                   KPRHDACIAEMQQLGVKVFAIPDGDVAASILTCMPDSEVDVLYGIGGAPEGVISAAVIR
FT                   ALDGDMQGRLLARHQVKGDSAENRRIGEDELARCRQMGIEAGSVLKLDDMARNDNVIFS
FT                   ATGITKGDLLDGIARKGNMATTETLLIRGKSRTIRRIKSTHYLDRKDRTLHEFLL"
FT   gene            complement(187700..189211)
FT                   /locus_tag="PC1_0159"
FT   CDS_pept        complement(187700..189211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0159"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: eca:ECA4267 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11220"
FT                   /db_xref="GOA:C6DHM0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHM0"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ACT11220.1"
FT                   /translation="MNPEKKYIVALDQGTTSSRAIVLDHDANIVSVSQREFTQIYPKAG
FT                   WVEHDPMEIWASQSSTLVEVLAKADISSDEVAGIGITNQRETTVVWEKESGKPIYNAIV
FT                   WQCRRTADICEKLKKDGLEEYVRNTTGLVVDPYFSGTKVKWILDHVEGSRERAKRGELL
FT                   FGTIDTWLIWKMTQGRVHVTDYTNASRTMLFNIHTLEWDTRMLEALDIPREMLPEVRAS
FT                   SEVYGQTNIGGKGGTRIPIAGIAGDQQAALYGQLCVNPGQAKNTYGTGCFLLMNTGKEA
FT                   VLSKHGLLTTIACGPRGEVNYALEGSVFVGGASIQWLRDELKLIGDSMDSEYFATKVKD
FT                   TNGVYVVPAFTGLGAPYWDPYARGAIFGLTRGVNANHIIRATLESIAFQTRDVLDAMQA
FT                   DADTRLKALRVDGGAVANNFLMQFQSDILGTRVERPEVRESTALGAAFLAGLATGFWND
FT                   LDEVKSKATIEREFRPSIETVERNYRYSGWQKAVARARNWEDHDA"
FT   gene            complement(189265..190104)
FT                   /locus_tag="PC1_0160"
FT   CDS_pept        complement(189265..190104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0160"
FT                   /product="MIP family channel protein"
FT                   /note="TIGRFAM: MIP family channel protein; PFAM: major
FT                   intrinsic protein; KEGG: eca:ECA4266 glycerol uptake
FT                   facilitator protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11221"
FT                   /db_xref="GOA:C6DHM1"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHM1"
FT                   /inference="protein motif:TFAM:TIGR00861"
FT                   /protein_id="ACT11221.1"
FT                   /translation="MSQAERSTLKGQCIAEFLGTGLLIFFGVGCVAALKLAGASFGQWE
FT                   ISIIWGLGVAMAIYLTAAISGAHLNPAVTIALWLFACFDGRKVVPYILAQIAGAFCAAA
FT                   LVYGLYHNLFVDFEQTNNMVRGSTESLSLAGIFSTYPNPHISVMQALLVETVITAILMC
FT                   LILALTDDGNGIPRGPLAPLLIGILIAVIGASMGPLTGFALNPARDFGPKLFAFLAGWG
FT                   NVAFTGAREIPYFLVPIFGPIIGACLGAFGYRALIGRNLPCDVCEPEAETTTRRESR"
FT   gene            190258..190470
FT                   /locus_tag="PC1_0161"
FT   CDS_pept        190258..190470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0161"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypy:YPK_0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11222"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHM2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11222.1"
FT                   /translation="MSVFAYKMTRRGFSHKVDSNAQVKFINTYPSYFKLYVRWLPLLTP
FT                   VTYWCKLLGIRAIAAFLQFELFWVT"
FT   gene            190801..191040
FT                   /locus_tag="PC1_0162"
FT   CDS_pept        190801..191040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0162"
FT                   /product="protein of unknown function DUF904"
FT                   /note="PFAM: protein of unknown function DUF904; KEGG:
FT                   eca:ECA4265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11223"
FT                   /db_xref="GOA:C6DHM3"
FT                   /db_xref="InterPro:IPR009252"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHM3"
FT                   /inference="protein motif:PFAM:PF06005"
FT                   /protein_id="ACT11223.1"
FT                   /translation="MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEQNNALSQDVQAAA
FT                   GSREALVRENEQLKEEQVVWQERLRALLGKMEEV"
FT   gene            complement(191160..191645)
FT                   /locus_tag="PC1_0163"
FT   CDS_pept        complement(191160..191645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0163"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="TIGRFAM: regulator of ribonuclease activity A; PFAM:
FT                   Dimethylmenaquinone methyltransferase; KEGG: eca:ECA4264
FT                   ribonuclease activity regulator protein RraA"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11224"
FT                   /db_xref="GOA:C6DHM4"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHM4"
FT                   /inference="protein motif:TFAM:TIGR01935"
FT                   /protein_id="ACT11224.1"
FT                   /translation="MKYDTSELCDIYHEEVNVVEPLFSNFGGRTSFGGKITTVKCFEDN
FT                   GLLFDLLEENGLGRVLLVDGGGSVRRALINAEIARLATQNEWEGIVVYGAVRQVDDLAE
FT                   LDIGIQAMAAIPVGAGSEGIGESDIRVNFGGVTFFSGDHLYADNTGIILAEDPLDIE"
FT   gene            complement(191771..192697)
FT                   /locus_tag="PC1_0164"
FT   CDS_pept        complement(191771..192697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0164"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   eca:ECA4263 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11225"
FT                   /db_xref="GOA:C6DHM5"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHM5"
FT                   /inference="protein motif:TFAM:TIGR00751"
FT                   /protein_id="ACT11225.1"
FT                   /translation="MTLSTHSSKTKAWLDSLRPKTLPLAFASIVTGSAIASWHSSFKPG
FT                   VALLALLTAGLLQILSNLANDYGDAVKGSDTEDRIGPLRGIQTGAITLTQLRNALIVTV
FT                   VLTIISGVSLVILACEKPADIFGFLILGLLAIFAAITYTVGNKPYGYIGLGDISVLIFF
FT                   GWLSVAGSYYLQTGHFDSIVMLPATACGLLATAVLNINNLRDIDNDRISGKNTLAVRLG
FT                   AEKARFYHTMLLLLAPVCLGLFATFYLHSLAGWLFILTLPLLIKQARYVLRETSAFSMR
FT                   PMLEKTVKGALLTNILFAVGVILSSCG"
FT   sig_peptide     complement(192587..192697)
FT                   /locus_tag="PC1_0164"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.967 at
FT                   residue 37"
FT   gene            complement(192843..194174)
FT                   /locus_tag="PC1_0165"
FT   CDS_pept        complement(192843..194174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0165"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: eca:ECA4262 ATP-dependent protease ATP-binding
FT                   subunit; TIGRFAM: heat shock protein HslVU, ATPase subunit
FT                   HslU; PFAM: ATPase AAA-2 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11226"
FT                   /db_xref="GOA:C6DHM6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHM6"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ACT11226.1"
FT                   /translation="MSEMTPREIVSELDSYIIGQHKAKRAVSIALRNRWRRMQLDEALR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DSAIKMVRLQSIEKNRFRAEEMAEDRILDVLIPPAKNNWGQAESTPEPSAARQAFRKKL
FT                   REGQLDDKEIEIDLAAAPVGVEIMAPPGMEEMTNQLQSMFQNLAGQKQKARKIKIKDAF
FT                   KLLIEEEAAKLVNPEELKQQAIEAVEQHGIVFIDEIDKICKRGESSGPDVSREGVQRDL
FT                   LPLVEGCTVSTKHGMVKTDHILFIASGAFQVASPSDLIPELQGRLPIRVELQALTTEDF
FT                   ERILTEPSASLTEQYKALMATEGVDISFTADGIRRIAEAAWQVNESTENIGARRLHTVM
FT                   ERLIEDVSYDASEMNGQSVTIDADYVRNHLDELVADEDLSRFIL"
FT   gene            complement(194184..194714)
FT                   /locus_tag="PC1_0166"
FT   CDS_pept        complement(194184..194714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0166"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   eca:ECA4261 ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11227"
FT                   /db_xref="GOA:C6DHM7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHM7"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ACT11227.1"
FT                   /translation="MTTIVSVRRNGQVVIGGDGQATLGNTVMKGNVRKVRRLYHDRVIA
FT                   GFAGGTADAFTLFELFERKLELHQGHLVKAAVELAKDWRTDRMLRKLEALLAVADENAS
FT                   LIITGNGDVVQPENDLIAIGSGGPYAQAAARALLENTELGARDIVEKSLGIAGDICIYT
FT                   NQFHTIEELASKA"
FT   gene            complement(194798..195571)
FT                   /locus_tag="PC1_0167"
FT   CDS_pept        complement(194798..195571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0167"
FT                   /product="cell division protein FtsN"
FT                   /note="TIGRFAM: cell division protein FtsN; PFAM:
FT                   Sporulation domain protein; KEGG: eca:ECA4260 cell division
FT                   protein FtsN"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11228"
FT                   /db_xref="GOA:C6DHM8"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011930"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHM8"
FT                   /inference="protein motif:TFAM:TIGR02223"
FT                   /protein_id="ACT11228.1"
FT                   /translation="MIALAVAVLVTFAGGLYFIAHNKPDESPVLPHQNVGKGNGLPPKP
FT                   EERWRYIKELENRQLGVTTPTEPSAGGEIRSPVQLTDEQRQLLEQMQSDMRRQPTQLSE
FT                   VPYNDQTQVPRSQVTIKPSTQPMQQPPVVTTQPATRAPAVTQTTPVVPRQETPRQETPK
FT                   QEAPKQQPVKQPEAPKAEKTQRWAIQCGSFKTMDPAESVRAQLAFAGIESRITSNGGWN
FT                   RIMLGPYNNRAAADSMIQRLKSAGASNCIPLASGG"
FT   gene            complement(195887..196930)
FT                   /locus_tag="PC1_0168"
FT   CDS_pept        complement(195887..196930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0168"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; SMART:
FT                   regulatory protein LacI; KEGG: eca:ECA4259 DNA-binding
FT                   transcriptional regulator CytR"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11229"
FT                   /db_xref="GOA:C6DHM9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHM9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACT11229.1"
FT                   /translation="MKQKKGVTTATMKDVADEAGVSTATVSRTLMNPEKVSATTRRKVE
FT                   QAVIAVGYSPHALNRNLKRNESRTILTIVPDICDPYFSEIFRGIEETAAEHGYLVLIGD
FT                   CAHQHQKEKTFVDLIITKQIDGMLLLGSNLPFDAGQEEQRNLPPMVMANEFSPDLALPT
FT                   VHIDNLTAAFEAVHYLYQAGHQRIACIAGPEHMHLSQYRLQGYIQALRRNGILIDNQYI
FT                   FRGDFTYETGINGLIALMQHPQPPSAVFCHSDLMALGVLAQARKMGLDIPRDLSVIGFD
FT                   DIEQAQYCWPPLTSVAQPRYQIGREAMLLLLEQLQGNTVQSGSRLLSSELVIRDSVAAP
FT                   NFARNRL"
FT   gene            complement(197207..199405)
FT                   /locus_tag="PC1_0169"
FT   CDS_pept        complement(197207..199405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0169"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: eca:ECA4258 primosome assembly protein PriA;
FT                   TIGRFAM: primosomal protein N'; PFAM: DEAD/DEAH box
FT                   helicase domain protein; helicase domain protein; type III
FT                   restriction protein res subunit; SMART: DEAD-like helicase
FT                   ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11230"
FT                   /db_xref="GOA:C6DHN0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHN0"
FT                   /inference="protein motif:TFAM:TIGR00595"
FT                   /protein_id="ACT11230.1"
FT                   /translation="MSVAQVALPVPLARTFDYLLPAGGIAPQVGARVSVSFGNRKAIGI
FT                   ITALSDTSELPLEQLKPVHDVLDEQPLFPPSLWRILLWAVEYYHYPIGEVLFHALPILL
FT                   RQGKPAHRAPLWQWFATEQGRATPLSTLKRAVKQQQALAALLQSPIYRHQVSEIGLTET
FT                   ALQALRSKGLCELQAAEQTLHDWRQNFSLSTDRLRLNTEQATAVGAIRSEDNHFAAWLL
FT                   AGITGSGKTEVYLSVLENVLAQGKQALVLVPEIGLTPQTIARFRERFNAPVDVLHSALN
FT                   DSERLAVWLRARSGEAAIVIGTRSALFTPFARLGLIVIDEEHDSSYKQQEGWRYHARDL
FT                   AVFRAREEDIPIVMGTATPALETLYNVQIGKYRRLNLTKRAGNAALAKQHVIDLKGLPL
FT                   TAGLSQPLITRIRHHLTNDNQVILFLNRRGFSPVVMCHECGWIAECQRCDHYYTYHQHQ
FT                   KMLRCHHCDSQRPVPQQCPSCGSTNMVPVGLGTEQLEQSLAPIFPNVPITRIDRDTTSR
FT                   KGALEQQLSQVRQGGARLLIGTQMLAKGHHFPDVTLVALLDVDGSLFSADFRAAERFAQ
FT                   LYTQVAGRAGRAGKAGEVALQTHHPEHPLLQTLLQQGYDAFASQALTERKSVFLPPFTS
FT                   HILFRADDHDNQQAALFLQQLRNLLEASPLRDESLWLLGPVPALQPKRAGRFRWQLLLQ
FT                   HPSRALLQKLVRTSMALIGTLPQARKVKWMLDVDPTDS"
FT   gene            199720..199935
FT                   /locus_tag="PC1_0170"
FT   CDS_pept        199720..199935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0170"
FT                   /product="ribosomal protein L31"
FT                   /note="TIGRFAM: ribosomal protein L31; PFAM: ribosomal
FT                   protein L31; KEGG: eca:ECA4257 50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11231"
FT                   /db_xref="GOA:C6DHN1"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHN1"
FT                   /inference="protein motif:TFAM:TIGR00105"
FT                   /protein_id="ACT11231.1"
FT                   /translation="MKKGIHPNYSAVTVTCSCGNVIKTHSTVGRDLNLDVCGECHPFYT
FT                   GKQRDVATGGRVDRFNKRFSVPGTKK"
FT   gene            complement(200062..200472)
FT                   /locus_tag="PC1_0171"
FT   CDS_pept        complement(200062..200472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0171"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   pen:PSEEN5229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11232"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHN2"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ACT11232.1"
FT                   /translation="MFYPIAIEAGDDTHAYGVTVPDLPGCFSAGDTLDDAITNAKEAIT
FT                   GHIELLVEMGQDIPTVSTVGQLAKRSEYAGYTWAVVDIDVTRLMGGSEKINVTLPKSLI
FT                   DRIDRCVASNPEFKSRSGFLAQAALERISSSR"
FT   gene            complement(200500..200679)
FT                   /locus_tag="PC1_0172"
FT   CDS_pept        complement(200500..200679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0172"
FT                   /product="YcfA family protein"
FT                   /note="PFAM: YcfA family protein; KEGG: bte:BTH_II1999
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11233"
FT                   /db_xref="GOA:C6DHN3"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHN3"
FT                   /inference="protein motif:PFAM:PF07927"
FT                   /protein_id="ACT11233.1"
FT                   /translation="MDSRTLIAEIKADGWELIRVNGSHHHFMHPSKPGLVTIPHPKKDL
FT                   PIGTVKSIRKQAGI"
FT   gene            complement(200777..201787)
FT                   /locus_tag="PC1_0173"
FT   CDS_pept        complement(200777..201787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0173"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   eca:ECA4256 putative iron(III) ABC transporter permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11234"
FT                   /db_xref="GOA:C6DHN4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHN4"
FT                   /inference="protein motif:PFAM:PF01032"
FT                   /protein_id="ACT11234.1"
FT                   /translation="MSPTSSRYAATFVVALLILAGLMLVNIATGSTTIPLTQVASVLGL
FT                   SSADVSPMASRIILELRIPRSLLAALCGAGLAMVGAFLQTATRNDLADPFLFGLSAGAS
FT                   AGAVAVITRFGEQLGDWALPMAAFCGGILSAVAVTVLFLLQQARGAERLIICGLAISFL
FT                   FGALTNYLVFSGDQRAASSILFWSLGGLGLARWDTLPFAVFSVLLLFGLTALRWRALDA
FT                   LLAGGQTAASMGVNLSRVRVEIFICCAFATSLLVALTGVIGFIGLMIPHLARPLSGVLH
FT                   KRLLPMTAVLGAILLCGGDWLSRQLLAPQELPIGIITAGLGGVFVLGMLVKRQQG"
FT   sig_peptide     complement(201695..201787)
FT                   /locus_tag="PC1_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.776 at
FT                   residue 31"
FT   gene            complement(201784..202746)
FT                   /locus_tag="PC1_0174"
FT   CDS_pept        complement(201784..202746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0174"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: eca:ECA4255
FT                   putative iron(III) ABC transporter, periplasmic-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11235"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHN5"
FT                   /inference="protein motif:PFAM:PF01497"
FT                   /protein_id="ACT11235.1"
FT                   /translation="MKITLLSGLLALTSCWAHASDFPVTVDSCGQPLTFTQPPQRAVIH
FT                   DLNMTEMAFALGLQKSIVGLTGITGWYKAPPDFIKQQGTIPELAAKYPTLENLLAVHPD
FT                   FFFAGWNYGMKVGGEVTPQALKKYGIQTLVLSESCVFTEPQQQRPRASMDLLYGDMLKL
FT                   GKIFGKQELAQKQIDDWKQHIATLQTRIGDRPKQTVFLYDSGDDKPFTSGKFAMPTAII
FT                   EAAGGKNVMDDMATSWASTSWENVAAREPDFIILLDYQTGNGADALRRFLESHPLMKFT
FT                   PAVQQHRYLKLQYAELTPGPANIAAVDKLAHALYPDAFK"
FT   sig_peptide     complement(202687..202746)
FT                   /locus_tag="PC1_0174"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 20"
FT   gene            complement(202756..203553)
FT                   /locus_tag="PC1_0175"
FT   CDS_pept        complement(202756..203553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0175"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA4254 putative iron(III) ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11236"
FT                   /db_xref="GOA:C6DHN6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHN6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT11236.1"
FT                   /translation="MTEPLSTRPVLLQLHHVSVADANRAPRLSDISLSMQAGERLALIG
FT                   PNGSGKSTLLRVLTSELGTTTGYIHLNGQPLNSLSRHERAKRIAILAQNDTPDLRLRVA
FT                   EYVALGRIPHHGFSTPAYDRQLIEEALDDTGLLPLRHRLLGTLSGGERQRAALARAFAQ
FT                   TPQLLLLDEPTNHLDPLARAQLLSLVRKRGISTLAVLHDLPLITPFADRVAVLQQGILL
FT                   RWGTPAHALSADCVKSVFGMESFTVSHPINGSPIRIFEAPELH"
FT   gene            complement(203769..204086)
FT                   /locus_tag="PC1_0176"
FT   CDS_pept        complement(203769..204086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0176"
FT                   /product="methionine repressor, MetJ"
FT                   /note="PFAM: Methionine repressor MetJ; KEGG: eca:ECA4253
FT                   transcriptional repressor protein MetJ"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11237"
FT                   /db_xref="GOA:C6DHN7"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHN7"
FT                   /inference="protein motif:PFAM:PF01340"
FT                   /protein_id="ACT11237.1"
FT                   /translation="MAEWNGEYVSPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRQ
FT                   VNNLRHATNSELLCEAFLHAFTGQPLPNDEDLRKERSDEIPEAAKIIMREMGIDPDTWE
FT                   Y"
FT   gene            204274..205434
FT                   /locus_tag="PC1_0177"
FT   CDS_pept        204274..205434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0177"
FT                   /product="O-succinylhomoserine (thiol)-lyase"
FT                   /EC_number="2.5.1.48"
FT                   /note="KEGG: eca:ECA4252 cystathionine gamma-synthase;
FT                   TIGRFAM: O-succinylhomoserine (thiol)-lyase; PFAM: Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11238"
FT                   /db_xref="GOA:C6DHN8"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHN8"
FT                   /inference="protein motif:TFAM:TIGR02080"
FT                   /protein_id="ACT11238.1"
FT                   /translation="MTRKQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNQPRAHD
FT                   YSRRGNPTRDVVQRALAELEGGAGAVMTSSGMSAIMLVCTVFLRPGDLLVAPHDCYGGS
FT                   YRLFDSLNKRGAFRVKFVDQSDTAALNAALAEKPKLVLVESPSNPLLRVVDIAAICQAA
FT                   REAGAVSVVDNTFLSPALQKPLELGADLVVHSCTKYLNGHSDVVAGAVIAKDADTITEL
FT                   AWWANNIGVTGAAFDSYLLLRGLRTLAPRMAAAQRNAQQIVEFLQTQPLVKALYHPSLP
FT                   NNPGHDIARRQQSGFGAMLSFELDGDEDTLRRFLASLELFTLAESLGGVESLISHAATM
FT                   THAGMAPEARAAAGISETLLRISTGIEDGDDLVADLDRAFQAAAKR"
FT   gene            205437..207872
FT                   /locus_tag="PC1_0178"
FT   CDS_pept        205437..207872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0178"
FT                   /product="aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /EC_number="1.1.1.3"
FT                   /note="KEGG: eca:ECA4251 bifunctional aspartate kinase
FT                   II/homoserine dehydrogenase II; TIGRFAM: aspartate kinase;
FT                   PFAM: homoserine dehydrogenase; homoserine dehydrogenase
FT                   NAD-binding; aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11239"
FT                   /db_xref="GOA:C6DHN9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041743"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHN9"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACT11239.1"
FT                   /translation="MSALGVAPSVTGRQLHKFGGSSLADVKCYLRVAGIMAEYSHPGDL
FT                   MVVSAAGSTTNQLISWLKLSQSDRLSAHQVQQALRRYHSELIAGLLPAQTAETLTAQFI
FT                   RDLERLATLLDGKITDAVYAEVVGHGEIWSARLMSAVLNQLDMNAAWLDARDFLCAERA
FT                   AQPQVDEGRSWPLLQQYLTQHAGQRLVVTGFICRNNAGETVLLGRNGSDYSATQIGALA
FT                   GVERVTIWSDVAGVYSADPRKVKDACLLPLLRLDEASELARLAAPVLHTRTLQPVSGSD
FT                   IDLQLRCSYQPEQGSTRIERVLASGTGAKIVTSHDDVCLIEVQVPSEHDFVLLQKEVEQ
FT                   LLNRAQLKPLAIGVHQDRNLLQLCYTSEVVESALQLLSQAALPVELNQRDGLAMVAMVG
FT                   AGVGKNPLHSHRFYQQLKDQPIEFVRQADDGISLVAVLRVGPTEHLIRGLHHSLFRAEK
FT                   RIGLVLFGKGNIGSRWLELFAREQSNLSARTGFEFVLAGVVDSTRSLLNYDGLDASRAL
FT                   AFFESEAQERDGEDLFLWMRAHPFDDLVVLDVTASDSVADLYLDFASYGFHVISANKLA
FT                   GASGGNNYRQIRDAFAKTDRHWLYNATVGAGLPVNFAVRDLRESGDSILAISGIFSGTL
FT                   SWLFLQFDGTVPFTELVDQACQQGLTEPDPRVDLSGQDVMRKLVILAREAGYDIEPSQV
FT                   RVESLVPSGCEQGSVDYFFENGDSLNDQMLRRLEAAQEMGLVLRHVARFDSNGKARVGV
FT                   EAVRPDHPLASLLPGDNVFAIESRWYRDNPLVIRGPGAGRDVTAGALQSDLNRLAQLL"
FT   gene            208361..209527
FT                   /locus_tag="PC1_0179"
FT   CDS_pept        208361..209527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0179"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA4250 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11240"
FT                   /db_xref="GOA:C6DHP0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHP0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT11240.1"
FT                   /translation="MQKTTSSAAAPHIVIDHLHVGYGTTAVLNDIHLEIAQGEFVALLG
FT                   SSGCGKTTLLRTVAGFSSPRSGTIRVNGQDMTQAPPEKRGMALVFQSYALWPHMTVAQH
FT                   IAYGLRLRRVPRAEIASRVAELETMLGLTGLSARKPAELSGGQRQRVALGRALAVRPDI
FT                   LLLDEPLSNLDARIRLQLRDEIRALQQRLGLTAIHVTHDREEAMVMADRIVILNQGRIM
FT                   QAGSPQEVYHHPASSFVAAFMGAENRLVLDARYDGDTLMISGDAESHSLVPANTSLPPG
FT                   PIEARFRAEAACLYDAADAPLIQPGMLMRYGTVQAQSYPGGYWLHTISSGTWRIQVHAT
FT                   HPYAIGQRVAVQIPAEALFLFPLAHETTSLSAVPDTTSRYSPLPGLTA"
FT   gene            209550..210683
FT                   /locus_tag="PC1_0180"
FT   CDS_pept        209550..210683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0180"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: eca:ECA4249 ABC transporter periplasmic binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11241"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHP1"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACT11241.1"
FT                   /translation="MKRIFAATLMLSTPLAAVQAQELTVLTAGDQNMVDYVNEYLGPLF
FT                   EKQHPGVKVRAVGTGPGDAGSQKILERFNAQQAAGAKVWDTDVAVVHEKFVGPMVQKGD
FT                   LLKYRDDIASGKLVSMAAADKAMGTDVKGYVMPMFSSQTALAYNPDMVANPPKSYDEIQ
FT                   QWAAANPKMFGYNGIKGGASGVSFVMGWIYAYGGDAQKLMNGPFDEAEAKKWQPAFERL
FT                   KAFNKNVTLTPGNAGTLDMLSRGEIAMGPVWVDMFYSWKASGQLPDNFKLLLPAPGMPG
FT                   QPMHYVIPAQAPNRELAKQFVELATSAKVQAEGIVERFNWYPGIDAKYVQAELKPAVWQ
FT                   RLFTDVTPDELANKGKTFPIAPYHTAILNAYEQAMAK"
FT   sig_peptide     209550..209612
FT                   /locus_tag="PC1_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.978 at
FT                   residue 21"
FT   gene            210756..211595
FT                   /locus_tag="PC1_0181"
FT   CDS_pept        210756..211595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0181"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4248 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11242"
FT                   /db_xref="GOA:C6DHP2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHP2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT11242.1"
FT                   /translation="MLQVSQFSSRLAGIALVLPALAVVAICFITPLGLSVGGAFVSQNG
FT                   VGIDNFVTALTLYLPDILFTLLIVSLATLLIGLLSVMIGGYLTLGESPRMVALLRWVYR
FT                   WPLFIPFIVTGQILRTFLAKNGWLNGALDTLGIVDMASASNWLDWRGIVFAFVWKQTPF
FT                   VALLVAGAMASLDRTMIESARNLGASRLRILCEIVVPQIGQTLLTGLILSFVTMMSVLS
FT                   VPMMINAQSPTMLTANIAFRINAYGDYGVANALGVISLLMTGLFAVIYLRLNMRDKA"
FT   sig_peptide     210756..210824
FT                   /locus_tag="PC1_0181"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.932) with cleavage site probability 0.771 at
FT                   residue 23"
FT   gene            211592..212398
FT                   /locus_tag="PC1_0182"
FT   CDS_pept        211592..212398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0182"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA4247 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11243"
FT                   /db_xref="GOA:C6DHP3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHP3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT11243.1"
FT                   /translation="MKNVLWWIPRMLILGTLIFLIFGPLANLLLWSVAEKWFYPHLLPN
FT                   DWGFAFWKRVFSPRGVAWEALGNSVLVAVFTVLASLSLAIPAGYALARLPLPARGLILL
FT                   IFLIPQAFPNLTVYVNIARLFYQWGLNGTLLGVVLVHTVHGLVFAVWIASAAFSAVGRE
FT                   MEQAARSIGAGPWRAFVDITLPLAMPGLMASAIFVFLESLDEFTGSYFVGAPDVQMMPL
FT                   LLYTAGAGGNYQIASITALVLLIPSVLFMLVVERFLKADVMARIGK"
FT   sig_peptide     211592..211672
FT                   /locus_tag="PC1_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.855) with cleavage site probability 0.713 at
FT                   residue 27"
FT   gene            212395..213399
FT                   /locus_tag="PC1_0183"
FT   CDS_pept        212395..213399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0183"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: eca:ECA4246 putative sugar binding transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11244"
FT                   /db_xref="GOA:C6DHP4"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHP4"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACT11244.1"
FT                   /translation="MTVGKQGYVSAQDVARRAGVSRSAVSRSFTPGASVSAATYAKVMT
FT                   AAQELGYQVNDLARGLLANSSRLVGLVVTQPEVGFRANLVAELSQALIQRGSIPVLINT
FT                   GHVREAMAAARSILFGHRAEATIVLSGSPPKEFVELAQLNGQPLIVIGRHEPACDSVHI
FT                   DNDSAARMAARLFASSGRTRLALAGAASATPNIIEREQAFCDEAQALGLPVAVVRGGDT
FT                   DYDDGLVVGQTLFSLPEAVRPDAVFCVNDLVAFGVIDRAKQFGLAVPQDLMVIGFDDIP
FT                   AAGWDAYALTTFRQDPATMAAQALALLDRRQSQVQEPACRAKVAAPLIRRQSA"
FT   gene            213447..214208
FT                   /locus_tag="PC1_0184"
FT   CDS_pept        213447..214208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0184"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: eca:ECA4245
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11245"
FT                   /db_xref="GOA:C6DHP5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHP5"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACT11245.1"
FT                   /translation="MKLIQLSDLHLTAQGGNLHGRDPEQQLKAAIADINAHHRDTDLVV
FT                   ISGDLSDDGSAASYTFLASVLAELQVPWRVTMGNHDDREMFLAQFPTLVDENGFVQSVT
FT                   TVGDDCVILLDSLHAGEVAGTLCSERLTWFARQLQAAEGKNVFLFLHHPPMSIGLPALD
FT                   SVRLAPEAAEALYQVCHRFGNVRHISAGHVHRPASGGWRGISFSTIRGTNHQSALRFAP
FT                   GFEVSLEAPQYAIFLTTEEGHTVHFHDFPGG"
FT   gene            214712..215608
FT                   /locus_tag="PC1_0185"
FT   CDS_pept        214712..215608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0185"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /note="KEGG: eca:ECA4244 5,10-methylenetetrahydrofolate
FT                   reductase; TIGRFAM: 5,10-methylenetetrahydrofolate
FT                   reductase; PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11246"
FT                   /db_xref="GOA:C6DHP6"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHP6"
FT                   /inference="protein motif:TFAM:TIGR00676"
FT                   /protein_id="ACT11246.1"
FT                   /translation="MSFFHANQREALNQSLAELQGRINVSFEFFPPRTSDMEETLWNSI
FT                   DRLSNLKPKFVSVTYGANSGERDRTHSIIKTIKERTGLEAAPHLTCIDASREQLREIAQ
FT                   DYWQSGIRHIVALRGDLPPEGGKPDMYAADLVSLLKEVGDFDISVAAYPEVHPEAKSAQ
FT                   ADLINLKHKIDAGANRAITQFFFDVESYLRFRDRCVATGIDVEIVPGILPVSNFKQLQK
FT                   FATMTNVRVPNWMTAMFDGLDNDPETRKMVGASIAMDMVKILSREGVKDFHFYTLNRAE
FT                   LSYAICHTLGVRPDVAR"
FT   gene            complement(215846..215986)
FT                   /pseudo
FT                   /locus_tag="PC1_0186"
FT   gene            216089..216997
FT                   /locus_tag="PC1_0187"
FT   CDS_pept        216089..216997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0187"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: eca:ECA4243 DNA-binding transcriptional
FT                   regulator OxyR"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11247"
FT                   /db_xref="GOA:C6DHP7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHP7"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACT11247.1"
FT                   /translation="MNIRDLEYLVALAEHRHFRRAADSCHVSQPTLSGQIRKLEDELGV
FT                   MLLERTSRKVLFTQAGLLLVEQARTVLREVKVLKEMASQQGETMSGPLHIGLIPTVGPY
FT                   LLPQIIPMLHRTFPKLEMYLHEAQTHQLLAQLDSGKLDCAILAMVKESEAFIEVPLFDE
FT                   PMKLAIYQDHPWANRERVAMSDLAGEKLLMLEDGHCLRDQAMGFCFQAGADEDTHFRAT
FT                   SLETLRNMVAAGSGITLLPSLSVPHERERDGVCYLPCYKPEPKRTIALVYRPGSPLRGR
FT                   YEQLADTIREHMQGYMENLSK"
FT   gene            complement(216989..218395)
FT                   /locus_tag="PC1_0188"
FT   CDS_pept        complement(216989..218395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0188"
FT                   /product="pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region"
FT                   /note="PFAM: pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; HI0933 family
FT                   protein; KEGG: eca:ECA4242 soluble pyridine nucleotide
FT                   transhydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11248"
FT                   /db_xref="GOA:C6DHP8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR022962"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHP8"
FT                   /inference="protein motif:PFAM:PF02852"
FT                   /protein_id="ACT11248.1"
FT                   /translation="MTLEHQFDYDAIVIGSGPGGEGAAMGLAKHGAKIAVIERHYNVGG
FT                   GCTHWGTIPSKALRHAVSRIIEFNQNPLYSDNSRIIRSSFSDILRHADSVIGQQTRMRQ
FT                   GFYERNQCELFSGEASFIDAHTIAVHYPDNTHETLTAANIIIATGSRPYHPAEVDFNHP
FT                   RIYDSDSILQLDHEPQHVIIYGAGVIGCEYASIFRGLSVKVDLINTRDRLLAFLDQEMS
FT                   DALSYHFWNNGVVIRHNEEFESIEGLSDGVIVNLKSGKKMKADCLLYANGRTGNTETLG
FT                   LENIGLSTDSRGQLKVNSMYQTALAHIYAIGDVIGYPSLASAAYDQGRLAAQAIIKGDA
FT                   SAHLIEDIPTGIYTIPEISSVGKTEQELTAMKVPYEVGRAQFKHLARAQIVGMNVGSLK
FT                   ILFHRETKQILGIHCFGERAAEIIHIGQAIMEQKGEGNTIEYFVNTTFNYPTMAEAYRV
FT                   AALNGLNRLF"
FT   gene            218595..219236
FT                   /locus_tag="PC1_0189"
FT   CDS_pept        218595..219236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0189"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: eca:ECA4241
FT                   DNA-binding transcriptional repressor FabR"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11249"
FT                   /db_xref="GOA:C6DHP9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023764"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHP9"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACT11249.1"
FT                   /translation="MGSIMGVRAQQKERTRRSLIEAAFSQLSAERSFASLSLREVAREA
FT                   GIAPTSFYRHFRDVDELGLTMVDESGLMLRQLMRQARQRIAKTGSVIRTSVSTFMEFIG
FT                   NNPNAFRLLLRERSGTSAAFRAAVAREIQHFIAELADYLEVENHIPRSFAEAQSEAMVT
FT                   IVFSAGAEALDVSLEQRKQLEERLVLQLRMIAKGAYYWYRKEHDSSFTVP"
FT   gene            219272..219658
FT                   /locus_tag="PC1_0190"
FT   CDS_pept        219272..219658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0190"
FT                   /product="protein of unknown function DUF1422"
FT                   /note="PFAM: protein of unknown function DUF1422; KEGG:
FT                   eca:ECA4240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11250"
FT                   /db_xref="GOA:C6DHQ0"
FT                   /db_xref="InterPro:IPR009867"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHQ0"
FT                   /inference="protein motif:PFAM:PF07226"
FT                   /protein_id="ACT11250.1"
FT                   /translation="MTEKPHQEKGTLVLALIAGLSVNGAFAALFSSIVPFSIFPLIALV
FT                   LSVYCLHQRYLHHSMPEGIPMLAAASFLLGLLIYSAIVRVEYPAIGSNFIPSILCVVLV
FT                   FWIGLKLRRRKGSDSVSAEESETL"
FT   sig_peptide     219272..219355
FT                   /locus_tag="PC1_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.993 at
FT                   residue 28"
FT   gene            complement(219699..220802)
FT                   /locus_tag="PC1_0191"
FT   CDS_pept        complement(219699..220802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0191"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /note="KEGG: eca:ECA4239 tRNA
FT                   (uracil-5-)-methyltransferase; TIGRFAM: tRNA
FT                   (uracil-5-)-methyltransferase; PFAM:
FT                   (Uracil-5)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11251"
FT                   /db_xref="GOA:C6DHQ1"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHQ1"
FT                   /inference="protein motif:TFAM:TIGR02143"
FT                   /protein_id="ACT11251.1"
FT                   /translation="MTPEILPIEQYDDQLAEKTERLRGMMAPFNAPEPVVFRSPVSHYR
FT                   MRAEFRIWHEGDELYHIMFDQQTKQRIRVDRFPAASELINRLMPELLAAIQPDSVLRRK
FT                   LFQIDYLSTLSGEVIVSLLYHRALDEEWQEHARALRDSLTAQGFRLQLIGRATKTKICL
FT                   DRDYVDECLPVAGRDMIYRQVENSFTQPNAAINIQMLEWALDATAGSTGDLLELYCGNG
FT                   NFSLALARNFERVLATEIAKPSVAAAQYNIAANQIENVQIIRMAAEEFTQAMQGVRQFN
FT                   RLQGIDLTSYQCETIFVDPPRSGLDDETVKLVQAYPRILYISCNPETLSHNLQTLSETH
FT                   DIRRLALFDQFPYTHHMECGVLLEKRQ"
FT   misc_binding    220932..221165
FT                   /bound_moiety="adenosylcobalamin"
FT                   /note="Cobalamin riboswitch as predicted by Rfam(RF00174),
FT                   score 98.89"
FT   gene            221231..223126
FT                   /locus_tag="PC1_0192"
FT   CDS_pept        221231..223126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0192"
FT                   /product="TonB-dependent vitamin B12 receptor"
FT                   /note="TIGRFAM: TonB-dependent vitamin B12 receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: yen:YE0139 vitamin B12/cobalamin outer membrane
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11252"
FT                   /db_xref="GOA:C6DHQ2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010101"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHQ2"
FT                   /inference="protein motif:TFAM:TIGR01779"
FT                   /protein_id="ACT11252.1"
FT                   /translation="MIKKISLLTALSVTAFSGWAQENQNSSSEKNADDMVVTANRFAQP
FT                   VSSVLAPIDVVTRDDINRWQAKNVLEVMRRLPGVNIAQTGGVGQSASMYIRGSEARHTL
FT                   VLIDGVPIAKYGITGNPDFNLIPIALVQRIEFMRGPRSAVYGADAIGGVINIITQTTEN
FT                   KTVLSTGIGSNRYQEYSGSLHQSVGDNTRVSLAGAYQDSRGFNVYPNSSNQALDSDKDG
FT                   WRNKTFWAGVEHQFNDSISGFFRGYGYGTNSDYDALSDDTYGPINDEQQVYNHTYSGGL
FT                   RFSHENYASQLIASYQKYTSIQYLSTQGRYGAYNSQDDIDQYDMLWGNTLALSHGMVSA
FT                   GVDWRRQKLTSEGVSFNTLNRESNRYKQDNSGAYLTAQQQYGAVILEGSVRGDDNEKFG
FT                   RHGTWQLASGWEFFPDYRVTLSYATGFQAPTLGQLYGQKRFDIESNENLKPEESKQWEA
FT                   GLEGVTGPLSWRLSGYINKIDNLIAYEYAFATNTGTYYNVDAATMKGLEWTGSFETGVL
FT                   NHQVTLDYLDARNDENDKVLARRAKQQAKYQVDWNLYDVDFNLSYQYVGKRFDNAANTR
FT                   RLPSYSTVDLAASYPVTSHLTVRGRIANLFDKDYETAYGYRTAGREYYLTGSYTF"
FT   sig_peptide     221231..221293
FT                   /locus_tag="PC1_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 21"
FT   gene            223071..223928
FT                   /locus_tag="PC1_0193"
FT   CDS_pept        223071..223928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0193"
FT                   /product="glutamate racemase"
FT                   /EC_number="5.1.1.3"
FT                   /note="KEGG: eca:ECA4237 glutamate racemase; TIGRFAM:
FT                   glutamate racemase; PFAM: Asp/Glu/hydantoin racemase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11253"
FT                   /db_xref="GOA:C6DHQ3"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHQ3"
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /protein_id="ACT11253.1"
FT                   /translation="MATARQGENTISPEAIPSNLPSRPTVLVFDSGVGGLSVYDEIRQL
FT                   LPDLHYIYAFDNEAFPYGEKSQQFIIERVVEIVNAVQLRHQLALVVIACNTASTISLPA
FT                   LRERFTFPVVGVVPAVKPAAKLTRNGVVGLLATRATVQRPYTHELIARFATDCQILSLG
FT                   SSELVELAEAKLQGETISISELQKILRPWLRLPEPPDTVVLGCTHFPLLAEELKAALPD
FT                   GTRLVDSGAAIARRTAWLIANLDNPPLSTDKNLVYCLAITPKVATLWPILQRYGFDSLE
FT                   KLPL"
FT   gene            224316..225845
FT                   /locus_tag="PC1_R0001"
FT   rRNA            224316..225845
FT                   /locus_tag="PC1_R0001"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            225938..226013
FT                   /locus_tag="PC1_R0002"
FT                   /note="tRNA-Glu1"
FT   tRNA            225938..226013
FT                   /locus_tag="PC1_R0002"
FT                   /product="tRNA-Glu"
FT   gene            226275..229180
FT                   /locus_tag="PC1_R0003"
FT   rRNA            226275..229180
FT                   /locus_tag="PC1_R0003"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            229309..229423
FT                   /locus_tag="PC1_R0004"
FT   rRNA            229309..229423
FT                   /locus_tag="PC1_R0004"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            229579..230616
FT                   /locus_tag="PC1_0194"
FT   CDS_pept        229579..230616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0194"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="KEGG: eca:ECA0213
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; TIGRFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase; PFAM:
FT                   UDP-N-acetylenolpyruvoylglucosamine reductase domain
FT                   protein; FAD linked oxidase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11254"
FT                   /db_xref="GOA:C6DHQ4"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHQ4"
FT                   /inference="protein motif:TFAM:TIGR00179"
FT                   /protein_id="ACT11254.1"
FT                   /translation="MASSIISLKSYNSFSLPVSASCIKVADTQEKLIEGWRVASASQEP
FT                   ILLLGEGSNVLFLEDFLGTILLNRLKGIDIREEGDGWYIHVGAGENWHQLVEYTLKCGI
FT                   AGLENLALIPGCVGSAPIQNIGAYGIELQHVCDYVDVLDLAEGDVMRFTSEECQFDYRE
FT                   SIFKHQYRSGFAITAVGLFLKKEWSPILNYGDLVKLDPTTVTPQQIFDSVCHMRRSKLP
FT                   DPAVTGNAGSFFKNPIITQQHAERVLREYPNAPQYLQTDGNVKLAAGWLIDQCELKGFQ
FT                   LGGAAVHEKQALVLINKNNAKSSDVVELARYVRSQVAEKFSIELEPEVRFIAAHGEVNA
FT                   IEVLS"
FT   gene            230613..231572
FT                   /locus_tag="PC1_0195"
FT   CDS_pept        230613..231572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0195"
FT                   /product="bifunctional BirA, biotin operon
FT                   repressor/biotin--acetyl-CoA-carboxylase ligase"
FT                   /EC_number="6.3.4.15"
FT                   /note="KEGG: eca:ECA0214 biotin--protein ligase; TIGRFAM:
FT                   biotin/acetyl-CoA-carboxylase ligase; biotin operon
FT                   repressor; PFAM: biotin/lipoate A/B protein ligase;
FT                   Helix-turn-helix type 11 domain protein; biotin protein
FT                   ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11255"
FT                   /db_xref="GOA:C6DHQ5"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHQ5"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACT11255.1"
FT                   /translation="MKDTTVPLKLIKILSDGEFYSGELLGEMMGMSRAAINKHIQTIRD
FT                   WGIDVFTVTGKGYSLPAPMQLLDEEVILKHLPEGGVTVLPVVDSTNQYILDRLDILSSG
FT                   DACLAEYQQSGRGRRGRQWFSPFGANLYLSLYWRLEQGPAAAVGVSLVIGIVMAEVLHK
FT                   LGADGVRVKWPNDLYLKDRKLAGILVELTGKTGDAANLVIGAGINLQMREPAPDTISQG
FT                   WINLQEAGIDINRNTLASTLISELRGALAIFELQGLEPFIPRWEKLDNYFNRPVRLIIG
FT                   NREIYGIDRGIDRQGALLLENDGLVTPYIGGEISLRGA"
FT   gene            complement(231614..232564)
FT                   /locus_tag="PC1_0196"
FT   CDS_pept        complement(231614..232564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0196"
FT                   /product="pantothenate kinase"
FT                   /note="TIGRFAM: pantothenate kinase; KEGG: eca:ECA0215
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11256"
FT                   /db_xref="GOA:C6DHQ6"
FT                   /db_xref="InterPro:IPR004566"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHQ6"
FT                   /inference="protein motif:TFAM:TIGR00554"
FT                   /protein_id="ACT11256.1"
FT                   /translation="MSNREQSLATPYLQFNRSQWAALRDSVPLTLTEEEIVKLKGINED
FT                   LSLDEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTDGQKIPYIIGIAGSVAVGKSTT
FT                   ARVLQALLSRWPEHRSVELITTDGFLHPNKVLKERDLMKKKGFPQSYDMHSLVKFVSDI
FT                   KSGTHKVTAPTYSHLTYDIVPNNNKVLEQPDILILEGLNVLQSGMDYPHDPHRVFVSDF
FT                   VDFSIYVDAPETLLQTWYINRFLKFRQGAFSNPNSYFHNYAKLTEEEAVGIASQLWKEI
FT                   NGLNLKENILPTRERASLIMTKSANHAVECVRLRK"
FT   gene            complement(232775..233323)
FT                   /locus_tag="PC1_0197"
FT   CDS_pept        complement(232775..233323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0197"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   yen:YE0277 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11257"
FT                   /db_xref="GOA:C6DHQ7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHQ7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACT11257.1"
FT                   /translation="MKTVQLNAATLPVYREELANLLIDAVEKGASVGYQSPLHHKEAIE
FT                   YFHSLQISVANGERILWVARDEEGIIGSVQLELCQKPNGRNRAEIQKLLVHSRARRTGI
FT                   GRQLIHLLEKHALFQQRGLLYLDTQAGSPAEAFYRALGYRHLGELPDYACTPDGYYHPT
FT                   AIYYKRLFAVNGLGKAIAS"
FT   gene            233656..233731
FT                   /locus_tag="PC1_R0005"
FT                   /note="tRNA-Thr1"
FT   tRNA            233656..233731
FT                   /locus_tag="PC1_R0005"
FT                   /product="tRNA-Thr"
FT   gene            233749..233833
FT                   /locus_tag="PC1_R0006"
FT                   /note="tRNA-Tyr1"
FT   tRNA            233749..233833
FT                   /locus_tag="PC1_R0006"
FT                   /product="tRNA-Tyr"
FT   gene            233963..234037
FT                   /locus_tag="PC1_R0007"
FT                   /note="tRNA-Gly1"
FT   tRNA            233963..234037
FT                   /locus_tag="PC1_R0007"
FT                   /product="tRNA-Gly"
FT   gene            234044..234119
FT                   /locus_tag="PC1_R0008"
FT                   /note="tRNA-Thr2"
FT   tRNA            234044..234119
FT                   /locus_tag="PC1_R0008"
FT                   /product="tRNA-Thr"
FT   gene            234227..235411
FT                   /locus_tag="PC1_0198"
FT   CDS_pept        234227..235411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0198"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: esa:ESA_04403
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11258"
FT                   /db_xref="GOA:C6DG79"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C6DG79"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACT11258.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGNAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPVVRGSALKALEGEAEWEAKIIELAEHLDSYIPEPERAIDKPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIVKVGEEVEIVGIKDTAKSTCTGVEMFRKLLDEGRAGENVGVLLRG
FT                   IKREEIERGQVLAKPGSIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVIA"
FT   gene            235650..236033
FT                   /locus_tag="PC1_0199"
FT   CDS_pept        235650..236033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0199"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: eca:ECA0217
FT                   preprotein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11259"
FT                   /db_xref="GOA:C6DHQ9"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHQ9"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ACT11259.1"
FT                   /translation="MSANTEAQDSGRGLEVIKWLVVGALLVVAIVGNYYYREFSLPLRA
FT                   LAVVILIAAAGGVALLTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTAVM
FT                   SLILWGLDGILVRLVSFITGLRF"
FT   gene            236035..236580
FT                   /locus_tag="PC1_0200"
FT   CDS_pept        236035..236580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0200"
FT                   /product="NusG antitermination factor"
FT                   /note="KEGG: eca:ECA0218 transcription antitermination
FT                   protein NusG; TIGRFAM: transcription
FT                   termination/antitermination factor NusG; PFAM: NGN domain
FT                   protein; KOW domain protein; SMART: NGN domain protein; KOW
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11260"
FT                   /db_xref="GOA:C6DHR0"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHR0"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ACT11260.1"
FT                   /translation="MSEAPKKRWYVVQAFSGFEGRVAQSLREHIKLHNMEELFGEVMVP
FT                   TEEVVEIRGGQRRKSERKFFPGYVLVQMVMEDASWHLVRSVPRVMGFIGGTSDRPAPIS
FT                   DKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVS
FT                   IFGRATPVELDFAQVEKG"
FT   gene            236743..237171
FT                   /locus_tag="PC1_0201"
FT   CDS_pept        236743..237171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0201"
FT                   /product="ribosomal protein L11"
FT                   /note="KEGG: eca:ECA0219 50S ribosomal protein L11;
FT                   TIGRFAM: ribosomal protein L11; PFAM: ribosomal protein
FT                   L11; SMART: ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11261"
FT                   /db_xref="GOA:C6DHR1"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHR1"
FT                   /inference="protein motif:TFAM:TIGR01632"
FT                   /protein_id="ACT11261.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAK
FT                   TESVEKGLPIPVVITVYSDRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTSA
FT                   QVREIAETKAADMTGSDVDAMARSIAGTARSMGLVVED"
FT   gene            237175..237879
FT                   /locus_tag="PC1_0202"
FT   CDS_pept        237175..237879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0202"
FT                   /product="ribosomal protein L1"
FT                   /note="TIGRFAM: ribosomal protein L1; PFAM: ribosomal
FT                   protein L1; KEGG: eca:ECA0220 50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11262"
FT                   /db_xref="GOA:C6DHR2"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHR2"
FT                   /inference="protein motif:TFAM:TIGR01169"
FT                   /protein_id="ACT11262.1"
FT                   /translation="MAKLTKRMRVIRDKVDVTKQYDINEAVALLKELATAKFVESVDVA
FT                   VNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAEFVGMEDLAEQI
FT                   KKGEMGFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVNNAKAGQVRY
FT                   RNDKNGIIHTTIGKVDFDSNKLKENLEALLVALKKAKPSQAKGVYIKKVSLSTTMGAGV
FT                   AVDQSGLNAAAN"
FT   gene            238196..238693
FT                   /locus_tag="PC1_0203"
FT   CDS_pept        238196..238693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0203"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: eca:ECA0221 50S
FT                   ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11263"
FT                   /db_xref="GOA:C6DHR3"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHR3"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ACT11263.1"
FT                   /translation="MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAG
FT                   REAGVYMRVVRNTLLRRVVEGTQFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKANA
FT                   KFEVKAAAFEGELIPAAQIDRLATLPTYEEALARLMSTMKEAAAGKLVRTLAAVRDAKE
FT                   AA"
FT   gene            238760..239125
FT                   /locus_tag="PC1_0204"
FT   CDS_pept        238760..239125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0204"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: ent:Ent638_0196 50S ribosomal protein
FT                   L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11264"
FT                   /db_xref="GOA:C6DHR4"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHR4"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ACT11264.1"
FT                   /translation="MSITKDQILEAVAAMSVMDVVELVSAMEEKFGVSAAAAVAVAAGP
FT                   AEVAEEKTEFDVVLKGIGANKVAVIKAVRGATGLGLKEAKDLVESAPAVLKEGVSKDDA
FT                   EALKKSLEEAGAEVEVK"
FT   gene            239453..243481
FT                   /locus_tag="PC1_0205"
FT   CDS_pept        239453..243481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0205"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /note="KEGG: eca:ECA0223 DNA-directed RNA polymerase
FT                   subunit beta; TIGRFAM: DNA-directed RNA polymerase, beta
FT                   subunit; PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase
FT                   Rpb2 domain 7; RNA polymerase Rpb2 domain 3; RNA polymerase
FT                   Rpb2 domain 2; RNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11265"
FT                   /db_xref="GOA:C6DHR5"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHR5"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ACT11265.1"
FT                   /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPEG
FT                   QYGLEAAFRSVFPIKSYSGNSELQYVSYRLGEPVFDVKECQIRGVTFSAPLRVKLRLVI
FT                   YEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALGYSTEQILD
FT                   LFFDKIVYEINGNKLQMDLVPERLRGETASFDIEANGKVYIEKGRRITARHIRQLEKDG
FT                   IERIEVPVEYIAGKVLSKDYIDESTGELIGAANMELSLDLLAKLSQSGHKRIETLFTND
FT                   LDHGAYMSETVRVDPSNDRLSALVEIYRMMRPGEPPTREAAETLFENLFFSEDRYDLSA
FT                   VGRMKFNRSLLRDEIEGSGILSKDDIIEVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLS
FT                   VYAQTNEYGFLETPYRRVRDNVVTDEIHYLSAIEEGNFVIAQANTNLDEEGRFIDELVT
FT                   CRNKGESSLFSRDQVEYMDVSTQQVVSVGASLIPFLEHDDANRALMGANMQRQAVPTLR
FT                   ADKPLVGTGMERAVAVDSGVTAVAKRGGTVQYVDASRIVIRVNDDEMYPGEAGIDIYNL
FT                   TKYTRSNQNTCISQMPCVSLGEPVERGDVLADGPSTDLGELALGQNMRVAFMPWNGYNF
FT                   EDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIV
FT                   YIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTIID
FT                   VQVFTRDGVEKDKRALEIEEMQLKQAKKDLTEELQILEAGLFARIHAVLVSGGVEADKL
FT                   DKLPRERWLELGLTDEDKQNQLEQLAEQYDELKHEFEKKLEAKRRKITQGDDLAPGVLK
FT                   IVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPYDENGTPVDIVLNPLGVPSRM
FT                   NIGQILETHLGMAAKGIGEKINAMLKQHEEVTKLREFIQRAYDLGDDVRQKVDLSTFSD
FT                   EEVMRLAENLKKGMPIATPVFDGAKEKEIKELLQMGGIPTSGQITLYDGRTGEKFERQV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMPESFNVLLKEIRSLGINIELEEE"
FT   gene            243588..247811
FT                   /locus_tag="PC1_0206"
FT   CDS_pept        243588..247811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0206"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: eca:ECA0224 DNA-directed RNA polymerase
FT                   subunit beta'; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   Rpb1 domain 5; RNA polymerase Rpb1 domain 3; RNA polymerase
FT                   alpha subunit; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11266"
FT                   /db_xref="GOA:C6DHR6"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHR6"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ACT11266.1"
FT                   /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGH
FT                   IELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVVEGGMTNLERRQILTEE
FT                   QYLDALEEFGDEFDAKMGAEAIQALLKNMDLEQECEQLREELTETNSETKRKKLTKRIK
FT                   LLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKK
FT                   MVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDC
FT                   VNAKGEGMVLTGPKEAERVYRAGLASLHARVKVRITEEIKSIEGDVTHQTSIIDTTIGR
FT                   AILWMIVPKGLPYSIVNQPLGKKAISKMLNTCYRILGLKPTVIFADQTMYTGFAYAARS
FT                   GASVGIDDMVIPEKKAEIIEEAETEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERVA
FT                   KAMMENLSVEDVVNRDGVVEQQVSFNSIFMMADSGARGSAAQIRQLAGMRGLMAKPDGS
FT                   IIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVTED
FT                   DCGTHEGIMMTPVIEGGDVKEPLRERVLGRVTAEDVIKPGTADILVPRNTLLNEQWCDM
FT                   LEENSVDAVKVRSVVSCETDFGVCANCYGRDLARGHIINKGEAIGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRAAAESSIQVKNKGSLKLSNAKFVVNSNGKLVITSRNTELKLIDEFG
FT                   RTKESYKVPYGAAMAKGDGAEVSGGETVANWDPHTMPVITEVSGNIRFTDMIDGQTITR
FT                   QTDELTGLSSIVVLDSAERTGSGKDLRPALKIVDDKGEDVLIPGTDMPAQYFLPGKAIV
FT                   QLEDGVKISSGDTLARIPQESGGTKDITGGLPRVADLFEARRPKEPAILAEISGIISFG
FT                   KETKGKRRLVISPLDGSDAYEEMIPKWRQLNVFEGEVVERGDVVSDGPESPHDILRLRG
FT                   VHAVTRYITNEVQEVYRLQGVKINDKHIEVIVRQMLRKGTIVNAGSTEFLEGEQAEVSR
FT                   IKIANRQLEADGKITATFSRDLLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGYAYHQDRMRRRQAGEAPIVPQVSADEASANLAELLNAGFG
FT                   SSDDE"
FT   gene            248141..249538
FT                   /locus_tag="PC1_0207"
FT   CDS_pept        248141..249538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0207"
FT                   /product="metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS)"
FT                   /note="TIGRFAM: metabolite/H+ symporter, major facilitator
FT                   superfamily (MFS); PFAM: major facilitator superfamily
FT                   MFS_1; General substrate transporter; KEGG: eca:ECA0225
FT                   shikimate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11267"
FT                   /db_xref="GOA:C6DHR7"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHR7"
FT                   /inference="protein motif:TFAM:TIGR00883"
FT                   /protein_id="ACT11267.1"
FT                   /translation="MDTSTTPTLSQPGGSVLHQDDSISSDNALQTQSVSHSQNKAKRAA
FT                   WGSFVGAVVDWYDFLLYGIVAALVFNTEFFPQVSPTMGTLAAFGTFGVGFLFRPLGGMV
FT                   FGHFGDKLGRKRMLMITVWMMGISTALIGLLPSFDSIGWWAPVLLVMLRAIQGFAVGGE
FT                   WGGAALLAVESAPKKKKAFYSSGVQVGFGVGLLLATGSVSLVSNLTTNEEFITWGWRLP
FT                   FLFSLILVAIAWWVRNGMDESQEFEANKTLGERANKLRSFPIMEALRQHPKAFLLIIAL
FT                   RLGELLTMYIVTAFALNYSTTHLGLSRDIFLNIGLLVGAISCVSIPFFAYLADSFGRRR
FT                   IYVTGALIGAASAVPFFMALESHNTLLILFFAIMLANIAHDMIVSVQQPMFTELFGTAY
FT                   RYSGAGVGYQVASVVGGGFTPFIAVLLVQFMDGSWHAVAAYLAIGCLLSAIVGMQMKAK
FT                   SADALPR"
FT   gene            complement(249634..249825)
FT                   /locus_tag="PC1_0208"
FT   CDS_pept        complement(249634..249825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0208"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   eca:ECA0226 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11268"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHR8"
FT                   /inference="protein motif:PFAM:PF06568"
FT                   /protein_id="ACT11268.1"
FT                   /translation="MEFHENRSQKPFRESPFWLMLILPYRLWKAWRARAQTLKILRNMS
FT                   DDGLKDIGLKRSDLDRFR"
FT   gene            249999..251423
FT                   /locus_tag="PC1_0209"
FT   CDS_pept        249999..251423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0209"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: aminotransferase class I and II; regulatory
FT                   protein GntR HTH; SMART: regulatory protein GntR HTH; KEGG:
FT                   eca:ECA0227 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11269"
FT                   /db_xref="GOA:C6DHR9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHR9"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACT11269.1"
FT                   /translation="MTRYQHLAGLLEQRIEQGLYQSGERLPSVRALSTEHGVSISTVQQ
FT                   AYHLLETRQLIMPQPRSGYFVTPRKATPPVPALTRPAQRPVEITQWESVLELVNVRLET
FT                   NVLKFGSGMPDVSQPTIKPLWKEMARLCQYQDPRILQYDSVYGVPALREQIARLTVDCG
FT                   CQLTQDDIVVTTGCQEALFVAVRAVCQPGDIVAVESPAFPGTMQILRGLDIKAIEIPTD
FT                   SVTGISLEALRLALDQWPIKAVLLVPSCNNPLGFIMPDARKKSLVTLAQHFDIAIIEDD
FT                   AYGELAYEYPRPRAIKSFDEDGRVLLCSSFSKNLAPGLRVGWIAPGRYLERVIHTKYIS
FT                   TGSTVVQPQLAVAEFIRQGHYQPHLRRMRAQYKANLSTFTCWVREYFPSNICVSRPQGG
FT                   FLMWIELPEYFDSLKLTREVRKSGIQIAAGSLFSASGKYRNCIRLNYANRFTEEMREGL
FT                   RIVGNEVAKMMHTPPD"
FT   gene            complement(251420..251671)
FT                   /locus_tag="PC1_0210"
FT   CDS_pept        complement(251420..251671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11270"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHS0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11270.1"
FT                   /translation="MRLASQSENYTEDNILRIAPRNMTFGLSPRSVTKNTVASLAGLSI
FT                   TALAGRSRLPLIGSAHQPADTGLILTRIGPSLTLSEAI"
FT   gene            complement(251815..252936)
FT                   /locus_tag="PC1_0211"
FT   CDS_pept        complement(251815..252936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0211"
FT                   /product="thiazole biosynthesis protein ThiH"
FT                   /note="TIGRFAM: thiazole biosynthesis protein ThiH; PFAM:
FT                   biotin and thiamin synthesis associated; Radical SAM domain
FT                   protein; KEGG: eca:ECA0228 thiamine biosynthesis protein
FT                   ThiH"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11271"
FT                   /db_xref="GOA:C6DHS1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR012726"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034428"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHS1"
FT                   /inference="protein motif:TFAM:TIGR02351"
FT                   /protein_id="ACT11271.1"
FT                   /translation="MSVDFQTVWEQLDWDDLTLRINGKTAQDVERALTAPHLTHDDFMA
FT                   LISPAASAYLEPLAQRAQQLTRQRFGNTVSFYVPLYLSNLCSNDCTYCGFSMSNHIKRK
FT                   TLDEAEILRECAAIKELGFEHLLLVTGEHQRKVGMDYFRRVFPLIRPLFSSLMIEVQPL
FT                   SQDEYAELKALGLDGVMVYQETYHTATYQLHHLKGQKQDFHWRLATPDRLGRAGIDKIG
FT                   LGALIGLSNSWRTDCYMVAEHLLHLQQHYWQSRYSISFPRLRPCAGGIEPASLMDEAQL
FT                   MQVICAFRLLAPDIELSLSTRESPFFRDHAIPIAINNVSAFSKTQPGGYADDHPELEQF
FT                   SPHDSRRPEDVAQAIVRAGLQPVWKDWDGYLGR"
FT   gene            complement(252933..253718)
FT                   /locus_tag="PC1_0212"
FT   CDS_pept        complement(252933..253718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0212"
FT                   /product="thiazole biosynthesis family protein"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   eca:ECA0229 thiazole synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11272"
FT                   /db_xref="GOA:C6DHS2"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHS2"
FT                   /inference="protein motif:PFAM:PF05690"
FT                   /protein_id="ACT11272.1"
FT                   /translation="MLHIADTTLTSRLLTGTGKFATPELMLAALEASGSQLVTMAMKRV
FT                   DLNGGNDAILAPLRQLGIKLLPNTSGAKTADEAIFAARLAREALGTHWLKLEIHPDVKY
FT                   LLPDPIETLKAAEQLVKEGFTVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQGLQT
FT                   RDFLRIIIEQARVPVIVDAGIGAPSQAADALEMGADAVLVNTAIAVARDPVAMARAFRL
FT                   AVEAGGLARQAGLGSKQFVASATSPLTGFLHQQAEGAVR"
FT   gene            complement(253720..253920)
FT                   /locus_tag="PC1_0213"
FT   CDS_pept        complement(253720..253920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0213"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: eca:ECA0229A sulfur carrier
FT                   protein ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11273"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHS3"
FT                   /inference="protein motif:TFAM:TIGR01683"
FT                   /protein_id="ACT11273.1"
FT                   /translation="MRITLNDEPFEFPEAITVEALLSQINRLQPGTALAINQTIIPHAT
FT                   WSQHQVQDGDDILLFQAIAGG"
FT   gene            complement(253917..254696)
FT                   /locus_tag="PC1_0214"
FT   CDS_pept        complement(253917..254696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0214"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   MoeZ/MoeB domain protein; KEGG: eca:ECA0230 thiamine
FT                   biosynthesis protein ThiF"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11274"
FT                   /db_xref="GOA:C6DHS4"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHS4"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ACT11274.1"
FT                   /translation="MATHHHSTPAGLSDSEFMRYSRQLMLEDIGPEGQDKLKAASVLLV
FT                   GLGGLGAPASLYLAAAGIGTLLLADDDALHISNLQRQILYRTSDTDKPKAVLAQRQLQA
FT                   LNPHSEAIALTERLSGETLDNAVSRVDLVLDCSDNMATRHAVNAACFRAGKPLISGSAV
FT                   GFSGQLAVFTPPYHSGCYACLYPDTTEPQRNCRTAGMLGPVVGVIGTLQALEAIKLLAG
FT                   MPSALDGKLRMFNGKQQSWNTLQLTRAPHCSVCGGAA"
FT   gene            complement(254698..255339)
FT                   /locus_tag="PC1_0215"
FT   CDS_pept        complement(254698..255339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0215"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="KEGG: eca:ECA0231 thiamine-phosphate
FT                   pyrophosphorylase; TIGRFAM: thiamine-phosphate
FT                   pyrophosphorylase; PFAM: thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11275"
FT                   /db_xref="GOA:C6DHS5"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHS5"
FT                   /inference="protein motif:TFAM:TIGR00693"
FT                   /protein_id="ACT11275.1"
FT                   /translation="MTDSTPFAPTAQRLGLYPVVDSVEWIERLLGVGVKTIQLRIKDRS
FT                   DEQAEADVIQAIALGRRYQAQLFINDYWKLAVKHQAYGVHLGQEDLDTADLTAIKQAGL
FT                   RLGISTHDDRELARAVAINPSYIALGHIFPTQTKDMPSAPQGLAELTRHITDLQDRFPT
FT                   VAIGGISIDRVPAVRKTGVGSIAVVSAITQAPDWRQATATLLRMIEGREA"
FT   gene            complement(255336..257291)
FT                   /locus_tag="PC1_0216"
FT   CDS_pept        complement(255336..257291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0216"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiC; PFAM:
FT                   thiamine biosynthesis protein ThiC; KEGG: eca:ECA0232
FT                   thiamine biosynthesis protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11276"
FT                   /db_xref="GOA:C6DHS6"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR025747"
FT                   /db_xref="InterPro:IPR037509"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHS6"
FT                   /inference="protein motif:TFAM:TIGR00190"
FT                   /protein_id="ACT11276.1"
FT                   /translation="MSTDPLSINTVSSKSGRREQRAAAQQFIETLQGTAFPNSKRIYLT
FT                   GSRDDIAVPMREIQLSPTLLGGSKDNPQYEPNEPIPVYDTSGPYGDPAAQPDVRIGLAK
FT                   LRASWIAERSDTEALSGVSSDFTQQRLADAGLDHLRFEHLPRPLRAKAGKRVTQLHYAR
FT                   QGIITPEMEFIALRENMGRERIRTDVLRQQHPGQSFGALLPENITPEFVRQEVAAGRAI
FT                   IPSNINHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLST
FT                   GRYIHETREWILRNSPVPIGTVPIYQALEKVNGVAENLNWEMFRDTLLEQAEQGVDYFT
FT                   IHAGVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHKESFLYEHFREICEICAAYDVAL
FT                   SLGDGLRPGSIQDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQMIRRNMTE
FT                   ELEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKE
FT                   DVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPQTARAYHD
FT                   ETLPQESGKVAHFCSMCGPKFCSMKISQEVRDYAAKQEAEAKPIEVGMAQMSQEFRSRG
FT                   SELYHSATSLQAEENQ"
FT   misc_binding    complement(257414..257567)
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam(RF
FT                   00059), score 66.15"
FT   gene            complement(257690..258151)
FT                   /locus_tag="PC1_0217"
FT   CDS_pept        complement(257690..258151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0217"
FT                   /product="regulator of RpoD, Rsd/AlgQ"
FT                   /note="PFAM: regulator of RNA polymerase sigma(70) subunit
FT                   Rsd/AlgQ; KEGG: eca:ECA0233 anti-RNA polymerase sigma 70
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11277"
FT                   /db_xref="GOA:C6DHS7"
FT                   /db_xref="InterPro:IPR007448"
FT                   /db_xref="InterPro:IPR023785"
FT                   /db_xref="InterPro:IPR038309"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHS7"
FT                   /inference="protein motif:PFAM:PF04353"
FT                   /protein_id="ACT11277.1"
FT                   /translation="MLNQLQSLTEYVGGNNALIDQWLQARKQLLVAYYHLVGIKPNKEA
FT                   LSLLDEEALDNFCQNLVDYLSTGHFHLYEKMLHEAATHSEQLLALSTQLDFALQSNTQQ
FT                   IMTFYDNHLATAIDHDNCLEFQQALSSVGETLEERFTLEDNMIRLVYDN"
FT   gene            258260..259042
FT                   /locus_tag="PC1_0218"
FT   CDS_pept        258260..259042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0218"
FT                   /product="NAD(+) diphosphatase"
FT                   /EC_number="3.6.1.22"
FT                   /note="PFAM: NUDIX hydrolase; NADH pyrophosphatase-like ;
FT                   Zinc ribbon NADH pyrophosphatase; KEGG: eca:ECA0234 NADH
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11278"
FT                   /db_xref="GOA:C6DHS8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR022925"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHS8"
FT                   /inference="protein motif:PRIAM:3.6.1.22"
FT                   /protein_id="ACT11278.1"
FT                   /translation="MEQTLKGDETGWWVVSDAVQIWLPQGELPCGTATKWSLQGKTARQ
FT                   IGEWQEQPVWLVCQGRDTDMASVRQLLDQDVGLFQLAGRGVQLAEFYRSHRFCGYCGHE
FT                   MVRSKTELACLCHHCKERYYPQIAPCIIVAIRRGEEILLAQHNRHRGNMYTVLAGFVEV
FT                   GETLEQTVVREVMEESQVQIKNLRYVSSQPWPFPHSLMMAFMAEYAGGEIKHDPKELRD
FT                   AGWFRYDQLPQLPPPGTVARRLIEDTVVLCRAYHENEG"
FT   gene            259191..260255
FT                   /locus_tag="PC1_0219"
FT   CDS_pept        259191..260255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0219"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /note="KEGG: eca:ECA0235 uroporphyrinogen decarboxylase;
FT                   TIGRFAM: uroporphyrinogen decarboxylase; PFAM:
FT                   Uroporphyrinogen decarboxylase (URO-D)"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11279"
FT                   /db_xref="GOA:C6DHS9"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHS9"
FT                   /inference="protein motif:TFAM:TIGR01464"
FT                   /protein_id="ACT11279.1"
FT                   /translation="MTDLKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAQAGD
FT                   FMSLCKNAELACEVTLQPLRRYALDAAILFSDILTIPDAMGLGLYFEAGEGPRFHSPIT
FT                   SHADVVNLPIPDPEQELGYVMNAVRTIRKNLAGEVPLIGFSGSPWTLATYMVEGGSSKA
FT                   FTVIKKMMFAEPKTLHLLLDKLADSVILYLNAQIRAGAQAVMVFDTWGGALSGRDYKEF
FT                   SLRYMHKIVDGLQRENEGRRVPVTLFTKGGGQWLEAMAETGCDALGLDWTSDIADARRR
FT                   VGDKVALQGNMDPSMLYADPARIEQEVASILAGFGQGNGHVFNLGHGIHQDVPPEHAGV
FT                   FVEAVHRLSRPYHA"
FT   gene            260271..260960
FT                   /locus_tag="PC1_0220"
FT   CDS_pept        260271..260960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0220"
FT                   /product="Deoxyribonuclease V"
FT                   /EC_number="3.1.21.7"
FT                   /note="PFAM: Endonuclease V; KEGG: spe:Spro_0288
FT                   endonuclease V"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11280"
FT                   /db_xref="GOA:C6DHT0"
FT                   /db_xref="InterPro:IPR007581"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHT0"
FT                   /inference="protein motif:PRIAM:3.1.21.7"
FT                   /protein_id="ACT11280.1"
FT                   /translation="MIDTQQLRAEQLARASDVIRHDDLPFEQPAFIAGADVGFEQEGSV
FT                   TRAAIAVMRYPSLELVEYKIARISTTMPYIPGFLSFRECPGLLAAWALLEQKPDLLFVD
FT                   GHGISHPRRLGVASHFGLLVDVPTIGVAKSRLCGRFEPLTESVGSQQPLLDKGEQIGWV
FT                   WRSKARCNPLFVATGHRVSQDSALHWVQSCMRGYRLPEPTRWADAVASNRPAFVRWQRQ
FT                   QAANVLS"
FT   gene            261038..261628
FT                   /locus_tag="PC1_0221"
FT   CDS_pept        261038..261628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0221"
FT                   /product="protein of unknown function DUF416"
FT                   /note="PFAM: protein of unknown function DUF416; KEGG:
FT                   eca:ECA0237 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11281"
FT                   /db_xref="InterPro:IPR007338"
FT                   /db_xref="InterPro:IPR023381"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHT1"
FT                   /inference="protein motif:PFAM:PF04222"
FT                   /protein_id="ACT11281.1"
FT                   /translation="MLRNPIHLRLEKLASWQHVTFMACLCERMYPNYHEFCRQTEFGDA
FT                   MVYRRILDLVWETLVVKDAKVNFDSQLEKLEEAIPAAEDYDLYGVYPAIDACIALGELI
FT                   HSRLSGETLEHAIAISETSIRTVAMLEMTQAGKEMTDDELKVLPAIEEEWDIQWEIFRL
FT                   LAACEERDIELIKGLRSDLREAGSSNIGINLHQ"
FT   gene            261833..262105
FT                   /locus_tag="PC1_0222"
FT   CDS_pept        261833..262105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0222"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; KEGG:
FT                   yen:YE0300 transcriptional regulator HU subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11282"
FT                   /db_xref="GOA:C6DHT2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHT2"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ACT11282.1"
FT                   /translation="MNKTQLIDVIADKADLSKAQAKAALESTLAAITESLKEGDAVQLV
FT                   GFGTFKVNHRNERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
FT   gene            262110..262796
FT                   /locus_tag="PC1_0223"
FT   CDS_pept        262110..262796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0223"
FT                   /product="protein of unknown function DUF1481"
FT                   /note="PFAM: protein of unknown function DUF1481; KEGG:
FT                   eca:ECA0239 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11283"
FT                   /db_xref="InterPro:IPR010858"
FT                   /db_xref="InterPro:IPR016500"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHT3"
FT                   /inference="protein motif:PFAM:PF07356"
FT                   /protein_id="ACT11283.1"
FT                   /translation="MSVKSLSRGAFSPLLLLRRWCGVGLMLTAVVACSSRTAPPEFFAS
FT                   GYVADRGIVRLWRKDDAQNTTALTTVFNPLQGNALVVTRYTFQQDKLREIQRNQLGTQK
FT                   EDMRLRFAEDGTVSFMQRQLAERRESVSDDDVALYQFDAKRMLELSDVLRAGKVILKQG
FT                   KWLEGQVQSCDGTAVRPDFDNDSREWIAEQKMHATRPLNVAWLEAPEGTQLLLVVEDDV
FT                   CQWQPK"
FT   sig_peptide     262110..262223
FT                   /locus_tag="PC1_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.817 at
FT                   residue 38"
FT   gene            complement(262866..264152)
FT                   /locus_tag="PC1_0224"
FT   CDS_pept        complement(262866..264152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0224"
FT                   /product="phosphoribosylamine/glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="KEGG: eca:ECA0240 phosphoribosylamine--glycine
FT                   ligase; TIGRFAM: phosphoribosylamine/glycine ligase; PFAM:
FT                   phosphoribosylglycinamide synthetase; protein of unknown
FT                   function DUF201"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11284"
FT                   /db_xref="GOA:C6DHT4"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHT4"
FT                   /inference="protein motif:TFAM:TIGR00877"
FT                   /protein_id="ACT11284.1"
FT                   /translation="MNILVIGNGGREHALAWKAAQSPLAKRVYVAPGNAGTALEAALTN
FT                   VDIAATDVPALVAFAQENHIDLTIVGPETPLVIGVVDAFQSAGLKIFGPSQAAAQLEGS
FT                   KAFTKDFLARHNIPTAEYQNFTEVEPALAYVRSKGAPIVIKADGLAAGKGVIVAMTLQE
FT                   AENAIEDMLAGNAFGDAGHRIVVEEFLDGEEASFIVMVDGKNVLPMATSQDHKRVGDKD
FT                   TGPNTGGMGAYSPAPVVTDEIHQRVMDQVIWPTVNGMAAEGNTYVGFLYAGLMISADGQ
FT                   PKVIEFNCRFGDPETQPIMLRLRSDLVELCLAACDGTLDQKDSVWDERPSLGVVLAAGG
FT                   YPADYNTGDVISGLPQQDAEDGKVFHAGTKLNGINVVTNGGRVLCVTALGNTVAEAQQR
FT                   AYEIAAGIQWQGVFCRKDIGYRAIEREQA"
FT   gene            complement(264170..265759)
FT                   /locus_tag="PC1_0225"
FT   CDS_pept        complement(264170..265759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0225"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="3.5.4.10"
FT                   /note="KEGG: eca:ECA0241 bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; TIGRFAM:
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase; PFAM:
FT                   AICARFT/IMPCHase bienzyme formylation region; MGS domain
FT                   protein; SMART: AICARFT/IMPCHase bienzyme formylation
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11285"
FT                   /db_xref="GOA:C6DHT5"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DHT5"
FT                   /inference="protein motif:TFAM:TIGR00355"
FT                   /protein_id="ACT11285.1"
FT                   /translation="MQQRRPIRRALLSVSDKAGIVEFAQALSHRGVELLSTGGTARLLA
FT                   DAGLAVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRDQDDAIMAQHDIKPIDIVVVN
FT                   LYPFAQTVARENCTLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYSAIINEIDAN
FT                   EGSLTYETRFDLAIKAFEHTAAYDSMIANYFGALVPPYHGETDKPSGNFPRTLNLNYIK
FT                   KQDMRYGENSHQQAAFYIEENIHEASVATSTQLQGKALSYNNIADTDAALECVKEFAEP
FT                   ACVIVKHANPSGVAIGGSILDAYERAYKTDPTSAFGGIIAFNRELDEETAQAIISRQFV
FT                   EVIIAPSASEAALKVTAAKQNVRVLTSGNWQQRVPGLDFKRVNGGLLIQDRDLGMVDAS
FT                   QLRVVTERQPSEQELRDALFCWKVAKFVKSNAIVYARDNMTIGIGAGQMSRVYSAKIAG
FT                   IKAGDEGLEVKGSAMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEVIAAANEHGI
FT                   AMIFTDMRHFRH"
FT   gene            266371..267898
FT                   /locus_tag="PC1_R0009"
FT   rRNA            266371..267898
FT                   /locus_tag="PC1_R0009"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            267977..268053
FT                   /locus_tag="PC1_R0010"
FT                   /note="tRNA-Ile1"
FT   tRNA            267977..268053
FT                   /locus_tag="PC1_R0010"
FT                   /product="tRNA-Ile"
FT   gene            268096..268171
FT                   /locus_tag="PC1_R0011"
FT                   /note="tRNA-Ala1"
FT   tRNA            268096..268171
FT                   /locus_tag="PC1_R0011"
FT                   /product="tRNA-Ala"
FT   gene            268383..271288
FT                   /locus_tag="PC1_R0012"
FT   rRNA            268383..271288
FT                   /locus_tag="PC1_R0012"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            271417..271531
FT                   /locus_tag="PC1_R0013"
FT   rRNA            271417..271531
FT                   /locus_tag="PC1_R0013"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(271814..272575)
FT                   /locus_tag="PC1_0226"
FT   CDS_pept        complement(271814..272575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0226"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA0242 L-amino acid ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11286"
FT                   /db_xref="GOA:C6DHT6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHT6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT11286.1"
FT                   /translation="MNQTALTQSTDHMITLENVNKWYGQFHVLKDINLQVRQGERIVLC
FT                   GPSGSGKSTTIRCINHLEEHQQGRIVVDGIELNNDLRNIEKIRTEVGMVFQHFNLFPHL
FT                   TVLQNCTLAPCWVRNMPKKEAEELAMHYLERVRIAAHAHKFPGQLSGGQQQRVAIARSL
FT                   CMKPKIMLFDEPTSALDPEMVKEVLDTMLGLAQDGMTMLCVTHEMGFARTVADRVIFMD
FT                   QGEIVEQAPPDIFFSSPRSERTQSFLSQILH"
FT   gene            complement(272584..273672)
FT                   /locus_tag="PC1_0227"
FT   CDS_pept        complement(272584..273672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0227"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: eca:ECA0243 L-amino
FT                   acid ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11287"
FT                   /db_xref="GOA:C6DHT7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHT7"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACT11287.1"
FT                   /translation="MNHYTQGRQSSLFRAMQWARRNLFSSISNSLLTLFCLWLLWVAIP
FT                   PLLNWAIFQANWIGTTRNDCTRDGACWVFIHARFGHFMYGLYPAAEIWRINFALTIGLL
FT                   SILPMFLKSIPYRGRYIAVWAVAYPLIAWWLLYGGFGGLSRVETYQWGGLTLTLIIAAV
FT                   GIAGALPLGILLALGRRSTLPIVRMLSVVFIEFWRGVPLITVLFMSSVMLPLFLTEGTT
FT                   IDKLLRALVGVILFQSAYVAEVVRGGLQALPKGQYEAAESLGLGYWRMQGLVILPQALK
FT                   MVIPGLVNTIISLFKDTSLVIIIGLFDLFSSIQQATVDPTWLGMSTEGYVFAAMVYWIF
FT                   CFSMSRYSQHLESRFNTGHKSH"
FT   gene            complement(273687..274865)
FT                   /locus_tag="PC1_0228"
FT   CDS_pept        complement(273687..274865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0228"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: eca:ECA0244 L-amino
FT                   acid ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11288"
FT                   /db_xref="GOA:C6DHT8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHT8"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACT11288.1"
FT                   /translation="MLQRPTVKGDLSLTNPAVRAWLYQIVVVIAVLAVAAYLLHNTVTN
FT                   LAQRGITSGFDFLNKSAGFGIVQHLIDYQQGDTYARVFLVGLFNTLLVSALCIVFASIL
FT                   GFTIGLARLSDNWLLRKISNIYIEIFRNIPPLLQIFFWYFAVLRNLPGPRQSISAFDVA
FT                   FLSNRGFYLPSPELGPGAAAFFLSLIITLVVTWGVFRRNQRYHALTGQPRRTWPLALGL
FT                   LLGLCALSHLIFGAAFHWDMPELKGFNFRGGMVLIPELAALTVALSVYTSSFIAEIIRS
FT                   GIQSVSHGQHEAARSLGLPNPVTLRKVILPQALRVIIPPLTSQYLNIVKNSSLAAAIGY
FT                   PDMVSLFAGTVLNQTGQAIETIAITMSVYLIISLLISLLMNLYNRKIALVER"
FT   gene            complement(274931..275956)
FT                   /locus_tag="PC1_0229"
FT   CDS_pept        complement(274931..275956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0229"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   eca:ECA0245 general L-amino ABC transporter binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11289"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHT9"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACT11289.1"
FT                   /translation="MKRIVISTLVAGASLFAAINQAHAGATLDAIQKKGFVQCGISDGL
FT                   PGFSYADASGKYSGIDVDVCRGLAAAVFGDANKVKYTPLTAKERFTALQSGEVDVLSRN
FT                   TTWTSSRDGGMGMLFTGVTYYDGIGFLTHNKAGLTSAKELDGATVCIQAGTDTELNVAD
FT                   YFKTHKMQYTPVTFDRSDESAKALESGRCDTLASDQSQLYALRIKLSKPAEFIVLPEVI
FT                   SKEPLGPVVRRGDEEWFSIVRWTLFAMLNAEEMGVTSKNVDQLAAKPTTPDMSHLLGHE
FT                   GSYGKDLKLPNDWAFKIIKQVGNYGEIFERNVGMGSELKIKRGLNELWNKGGIQYAPAV
FT                   R"
FT   sig_peptide     complement(275882..275956)
FT                   /locus_tag="PC1_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.971 at
FT                   residue 25"
FT   gene            complement(276322..276987)
FT                   /locus_tag="PC1_0230"
FT   CDS_pept        complement(276322..276987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0230"
FT                   /product="polar amino acid ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: polar amino acid ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: eca:ECA0246
FT                   putative amino-acid transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11290"
FT                   /db_xref="GOA:C6DHU0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHU0"
FT                   /inference="protein motif:TFAM:TIGR01726"
FT                   /protein_id="ACT11290.1"
FT                   /translation="MPPWLQLMADSFWSLLSAGLKFTVPLAILSFIFGLALGIIIALVR
FT                   LYGPKPLKWLGDFYVWVIRGTPLLVQLFLIFYGLPSAGITLDAFPAALIGFTISVGAYS
FT                   SEIVRGAILSVPKGQWNAAYSLGMNGRQAIRWVIFPQSVFVSLPPLSNTFISLIKDTSL
FT                   AAVITVPEMFLSAQRIVSVTYEPLILYVEAALIYLMFSTVLSQLQVKLEKYYQRHITH"
FT   gene            complement(277030..277797)
FT                   /locus_tag="PC1_0231"
FT   CDS_pept        complement(277030..277797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0231"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   SMART: extracellular solute-binding protein family 3; KEGG:
FT                   eca:ECA0247 putative cystine-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11291"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHU1"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACT11291.1"
FT                   /translation="MKKIRFALLTSALLATSVFAHADDLSDIKSAGVLKIGTEGTYAPY
FT                   TYHDKSGQLVGFDVDIGRAVAEKLGVKAQFIEGRWDGLIAGIDAKRYDAVINQVGVTKE
FT                   RQAKYDFSKPYIDSKAVLVVRGDNTTLKDFSDLKGKKAAQSLTSNYSKQATSYGADIVP
FT                   TDGFNQSLDLVLSGRADATLNDNLSFLDFKKHKPDANVKIAATSKDGEPSAILVRKNQA
FT                   TLVEALNKALDEIKADGTYKTISVRYFGEDVSQ"
FT   sig_peptide     complement(277729..277797)
FT                   /locus_tag="PC1_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.970 at
FT                   residue 23"
FT   gene            278118..279263
FT                   /locus_tag="PC1_0232"
FT   CDS_pept        278118..279263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0232"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   eca:ECA0251 endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11292"
FT                   /db_xref="GOA:C6DHU2"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C6DHU2"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACT11292.1"
FT                   /translation="MKIRIASYNVENLFHRTAILNLPDSRQIDALLQQVRQLQHLLEQP
FT                   QYDDALKDQVFRLSIALRPYIDIRTDAGTLGRWKKEDAGTGFRINKSCRGRGDWIGEIV
FT                   FKAQEFSSQQRKNTGKIITLLNADILCAVEVENMDVLRDFNNQVLGDDKFSQFVMIDSP
FT                   NDPRGIDVACLTRYRIAQLRTHIFDAGKRFDPVFSRDCLEVTLDAGLKQPIYILCNHFK
FT                   SQSGQTEEERLRGAEKRRDQAERVAEIVQQTYDLKKDYVVILGDLNEDSSNPWHSLAPL
FT                   FSLSDLHPVIDPERPEKERYTYYFAGGKKGARLNQLDYIFLSAPLHQAVVEWGVERRGI
FT                   YNIDKIAAKEGAEPVTPLPEVTSWDTAASDHAALWVEVDIT"
FT   gene            279331..279732
FT                   /locus_tag="PC1_0233"
FT   CDS_pept        279331..279732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0233"
FT                   /product="protein of unknown function DUF437"
FT                   /note="PFAM: protein of unknown function DUF437; KEGG:
FT                   eca:ECA0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11293"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR009326"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIJ3"
FT                   /inference="protein motif:PFAM:PF04266"
FT                   /protein_id="ACT11293.1"
FT                   /translation="MSKQGLEQYPDALRWSFGDSPALADELLQLVLEGHKTATCSSYHA
FT                   FKNEETPQVGDYNIVLDGAGQPSCVIRTRSLTLVRYCDVTAEMAAKEGEGDKSLTFWRE
FT                   GHQTFFEREGTFAPDMLLVFEEFELIEVF"
FT   gene            complement(279804..280868)
FT                   /locus_tag="PC1_0234"
FT   CDS_pept        complement(279804..280868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0234"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: ent:Ent638_0045
FT                   DNA-O6-methylguanine--protein-cysteine S-methyltransferase
FT                   / transcriptional regulator Ada; TIGRFAM:
FT                   methylated-DNA/protein-cysteine methyltransferase; PFAM:
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; Ada metal-binding domain protein; SMART:
FT                   helix-turn-helix- domain containing protein AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11294"
FT                   /db_xref="GOA:C6DIJ4"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIJ4"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACT11294.1"
FT                   /translation="MKVLDNDQCDVWYQALLERDSGYTGVFFVGVITTGVFCISVCRAR
FT                   KPKRENVEFYKDVKSALDAGFRPCKVCRPTENAHSAPLLIEQALELVRANPKTRISDTE
FT                   LRKHDISPERVRRWFLQNHGITFQAFQRMQRVNVALQELKGGRNATEVAFDSGYESLSG
FT                   FGYTYKRLTGVSPTEQSQVIMIHRFTTPLGPMFVCATERGVCLLEFTDRRMLETEFRDL
FT                   QRLLNARIMSGENIHTRQTEKEISEYFSGTRQQFTLLLDTPGSDFQRTVWQELRAVPYG
FT                   HTSHYQALSGLIGKPNAVRAVAAANGANRVAIVIPCHRIIGKDGTMTGYGGGIARKKWL
FT                   IEHEKTMLNHPTES"
FT   gene            complement(280852..281628)
FT                   /locus_tag="PC1_0235"
FT   CDS_pept        complement(280852..281628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ent:Ent638_0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11295"
FT                   /db_xref="GOA:C6DIJ5"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIJ5"
FT                   /inference="similar to AA sequence:KEGG:Ent638_0044"
FT                   /protein_id="ACT11295.1"
FT                   /translation="MNFTERHHQSPPLLIANVWDASSAIAAQHAGYQALGTSSAAIAAM
FT                   LGYEDGEAMSFDELLYIVTRIKSVSHLPLSVDVEAGFGRTASEITVNLKRLASLGVVGV
FT                   NLEDSRVVNGVRQLDDAVAFSRTLKEIRHALTIENDQLFFNIRTDTFLLGHEQALQETL
FT                   LRGRLYEEAGADGLFVPCLTSENDIAIISREINLPLNVMCMPDLPAFDRLKTLGVNRLS
FT                   MGNFVHSAIQSTFKNIMLTIQSQQSFAGVFVDESSR"
FT   gene            complement(281871..282167)
FT                   /locus_tag="PC1_0236"
FT   CDS_pept        complement(281871..282167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0236"
FT                   /product="transcriptional regulator, Fis family"
FT                   /note="PFAM: helix-turn-helix Fis-type; KEGG: eca:ECA0255
FT                   DNA-binding protein fis"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11296"
FT                   /db_xref="GOA:C6DIJ6"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIJ6"
FT                   /inference="protein motif:PFAM:PF02954"
FT                   /protein_id="ACT11296.1"
FT                   /translation="MFEQRVNSDVLTVSTVNSQAQVTQKPLRDSVKQALKNYFAQLNGQ
FT                   DVSDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN"
FT   gene            complement(282191..283156)
FT                   /locus_tag="PC1_0237"
FT   CDS_pept        complement(282191..283156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0237"
FT                   /product="TIM-barrel protein, nifR3 family"
FT                   /note="TIGRFAM: TIM-barrel protein, nifR3 family; PFAM:
FT                   dihydrouridine synthase DuS; KEGG: eca:ECA0256
FT                   tRNA-dihydrouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11297"
FT                   /db_xref="GOA:C6DIJ7"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR024036"
FT                   /db_xref="InterPro:IPR032887"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIJ7"
FT                   /inference="protein motif:TFAM:TIGR00737"
FT                   /protein_id="ACT11297.1"
FT                   /translation="MHIGQFQLTNRLIAAPMAGISDRPFRALCHAMGAGMTVSEMLSSN
FT                   PEVWRSDKSRLRMVHSDEPGIRAVQIAGCDPDEMAAAARINADSGAQIIDINMGCPAKK
FT                   VNRKMAGSALLQYPDLVKQILSSVVKAVDVPVTLKIRTGWAPEHRNCVEIAKLAEDCGI
FT                   QALTIHGRTRACLFNGSAEYDSIRAVKQAVSIPIIANGDITDPHKARAVLDYTGADALM
FT                   IGRAAQGRPWIFREIQHYLDTGELLAPMPLAEVKRLLIEHIRELHDFYGPGKGFRIARK
FT                   HVSWYLQEHAPNDQFRRTFNAIEDASEQLEALKAYFENLA"
FT   gene            complement(283513..284247)
FT                   /locus_tag="PC1_0238"
FT   CDS_pept        complement(283513..284247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0238"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: eca:ECA0257 carbonic
FT                   anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11298"
FT                   /db_xref="GOA:C6DIJ8"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018338"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="InterPro:IPR036398"
FT                   /db_xref="InterPro:IPR041891"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIJ8"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ACT11298.1"
FT                   /translation="MKGKLSIVLMLSACFPVLAADPVNWGYEGNGDPAHWGKLSPDFSL
FT                   CETGKNQSPINIRQALNAQHDPLQLAFLPGTQQIINNGHTVQVNVGPGNTLLLDNETFT
FT                   LQQFHFHAPSENEIDGKQFPLEGHFVYKDASGALTVIALMFQEGEANQPLATAWQQIPA
FT                   QVNQAEEVRTPIAIQSLLPTSLNYYRFSGSLTTPPCSEGIRWLVLDHPVTASAEQINQF
FT                   RSVMHHANNRPIQPLNGRVIIH"
FT   sig_peptide     complement(284188..284247)
FT                   /locus_tag="PC1_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 20"
FT   gene            complement(284423..285310)
FT                   /locus_tag="PC1_0239"
FT   CDS_pept        complement(284423..285310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0239"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /note="TIGRFAM: ribosomal protein L11 methyltransferase;
FT                   PFAM: ribosomal L11 methyltransferase; Methyltransferase
FT                   type 12; methyltransferase small; putative RNA methylase;
FT                   KEGG: eca:ECA0258 ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11299"
FT                   /db_xref="GOA:C6DIJ9"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIJ9"
FT                   /inference="protein motif:TFAM:TIGR00406"
FT                   /protein_id="ACT11299.1"
FT                   /translation="MPWIQLKINTSGNVAEQLGDAMIESGAVSVTFQDTHDTPVFEPLP
FT                   GETRLWGDTDAIALYDAETDMNDVIAMLEQEPLLGVGFKHKIEQLEDKDWEREWMDNFH
FT                   PMQFGKRLWICPSWRDIPDPTAVNVMLDPGLAFGTGTHPTTALCLQWLDGLDLEGKTII
FT                   DFGCGSGILAIAALKLGAARAIGIDIDPQAIQASRDNAQRNGVSERLELYLPKDQPADL
FT                   SADVVVANILAGPLRELAPLISDLPKAGGHLGLSGVLATQADGVAEAYADKFTLDPVAE
FT                   REEWCRITGQRRAS"
FT   gene            complement(285328..286779)
FT                   /locus_tag="PC1_0240"
FT   CDS_pept        complement(285328..286779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0240"
FT                   /product="sodium/pantothenate symporter"
FT                   /note="TIGRFAM: sodium/pantothenate symporter; SSS sodium
FT                   solute transporter superfamily; PFAM: Na+/solute symporter;
FT                   KEGG: eca:ECA0259 sodium/panthothenate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11300"
FT                   /db_xref="GOA:C6DIK0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011849"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIK0"
FT                   /inference="protein motif:TFAM:TIGR02119"
FT                   /protein_id="ACT11300.1"
FT                   /translation="MQIEILLPLIGYLLLVFGLSVYAYRRRQAGNFLNEYFLGGRSMGG
FT                   FVLAMTLIGTYVSASSFIGGPGAAYKYGLGWVLLSMIQLPTMLLSLGILGKKFAILARR
FT                   YNAITLNDMLYARYNSPLLVWFASISLLVAFIGAMAVQFIGGARLLETAANIPYDIGLL
FT                   IFGVTIALYTTFGGFRASVLNDAMQGIVMLIGTVILLVGVIYAAGGLHSAVDKLQQIDP
FT                   MLVSPQGSGGILSMPFMASFWVLVCFGVIGLPNTAVRCISYRDSKALHRGIIIGTIVIG
FT                   ILMLGMHLAGALGRAVMPNLTIPDQVLPALMVTVLPPLAAGIFLAAPMAAIMSNINAHL
FT                   LQASATIIKDLYLSVRPQQIHNERRIKILSSMTTLLLGLLVLLASLRPPDMIIWLNLLA
FT                   FGGLEAVFLWPLVLGLYWERANAAGALSAMFSGAICYTLLASFNLQLAGYHPIVPSLLL
FT                   SLMAFIIGNRFGHNPPAPVAASSSL"
FT   gene            complement(286769..287011)
FT                   /locus_tag="PC1_0241"
FT   CDS_pept        complement(286769..287011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0241"
FT                   /product="protein of unknown function DUF997"
FT                   /note="PFAM: protein of unknown function DUF997; KEGG:
FT                   spe:Spro_4419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11301"
FT                   /db_xref="GOA:C6DIK1"
FT                   /db_xref="InterPro:IPR010398"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIK1"
FT                   /inference="protein motif:PFAM:PF06196"
FT                   /protein_id="ACT11301.1"
FT                   /translation="MDTRFPQAHREARWAFGLTLVYLVAWALAAYLPDNTQGITGLPHW
FT                   FEMACLLLPLVFTLLCWLMVHVIFRDISLESDDAN"
FT   gene            287557..287985
FT                   /locus_tag="PC1_0242"
FT   CDS_pept        287557..287985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0242"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein; KEGG: eum:ECUMN_3055
FT                   putative molybdenum-pterin-binding-protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11302"
FT                   /db_xref="GOA:C6DIK2"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIK2"
FT                   /inference="protein motif:PFAM:PF03459"
FT                   /protein_id="ACT11302.1"
FT                   /translation="MSVSARNQLSGVVSSIVEGAVNNEVALTLESGDKLTTVITRASCQ
FT                   SMDLAVGKPAIALVKAPWVILASAECGLNFSARNQFHGKVSSVTKGAVNSTVQLVTAGG
FT                   LTLTSTVTNESLEEMNIDVGNELIALVKASSIILATRK"
FT   gene            complement(288258..289601)
FT                   /locus_tag="PC1_0243"
FT   CDS_pept        complement(288258..289601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0243"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxylase;
FT                   PFAM: Carbamoyl-phosphate synthase L chain ATP-binding;
FT                   biotin carboxylase domain protein;
FT                   phosphoribosylglycinamide synthetase; Carbamoyl-phosphate
FT                   synthetase large chain domain protein; KEGG: eca:ECA0260
FT                   acetyl-CoA carboxylase biotin carboxylase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11303"
FT                   /db_xref="GOA:C6DIK3"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIK3"
FT                   /inference="protein motif:TFAM:TIGR00514"
FT                   /protein_id="ACT11303.1"
FT                   /translation="MLDKIVIANRGEIALRILRACKELGIKTVAVHSSADRDLKHVLLA
FT                   DETVCIGPAPSTKSYLNIPAIISAAEITGAVAIHPGYGFLSENADFAEQVERSGFIFIG
FT                   PRAETIRLMGDKVSAITAMKKAGVPTVPGSDGPLTDDMDANRVHAKRIGYPVIIKASGG
FT                   GGGRGMRVVRSDKELEQSINMTRAEAKAAFNNDMVYMEKYLENPRHVEIQILADGQGHA
FT                   VYLAERDCSMQRRHQKVVEEAPAPGITDELRRNIGDRCAKACIDINYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHPVTEMITGVDLIKEQLRIAAGLPLSIKQKDVKVRGHAVECRIN
FT                   AEDPNTFLPSPGKITRFHAPGGFGVRWESHIYAGYTVPPYYDSMIGKLITYGETREIAI
FT                   SRMKNALAELIIDGIKTNIELQMKIMSDENFQRGGTNIHYLEKKLGLQ"
FT   gene            complement(289613..290080)
FT                   /locus_tag="PC1_0244"
FT   CDS_pept        complement(289613..290080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0244"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /note="TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl
FT                   carrier protein; PFAM: biotin/lipoyl attachment
FT                   domain-containing protein; KEGG: eca:ECA0261 acetyl-CoA
FT                   carboxylase biotin carboxyl carrier protein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11304"
FT                   /db_xref="GOA:C6DIK4"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIK4"
FT                   /inference="protein motif:TFAM:TIGR00531"
FT                   /protein_id="ACT11304.1"
FT                   /translation="MDIRKIKKLIELVEESGIAELEISEGEESVRISRAPAAVNYPMMQ
FT                   QAYATPMMQPQPALAAAVAPAPVEAAAAPAAISGHIVRSPMVGTFYRTPSPDAKAFVEV
FT                   GQQVNVGDTLCIVEAMKMMNQIEADKAGVVKAILLESGQPVEFDEPLVVIE"
FT   gene            complement(290105..290557)
FT                   /locus_tag="PC1_0245"
FT   CDS_pept        complement(290105..290557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0245"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number="4.2.1.10"
FT                   /note="KEGG: eca:ECA0262 3-dehydroquinate dehydratase;
FT                   TIGRFAM: 3-dehydroquinate dehydratase, type II; PFAM:
FT                   dehydroquinase class II"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11305"
FT                   /db_xref="GOA:C6DIK5"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIK5"
FT                   /inference="protein motif:TFAM:TIGR01088"
FT                   /protein_id="ACT11305.1"
FT                   /translation="MAEKFHILLLNGPNLNLLGTREPDKYGKTTLADIVSELETQAQAL
FT                   NVKFSHLQSNAEHVLIDTIHQARGNTDFILINPAAFTHTSVALRDALLAVSIPFIEIHL
FT                   SNVHAREPFRHHSYLSDVAVGVICGLGADGYQYALQTAVKRLSTSN"
FT   gene            complement(290811..291410)
FT                   /locus_tag="PC1_0246"
FT   CDS_pept        complement(290811..291410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0246"
FT                   /product="Ferric reductase domain protein protein
FT                   transmembrane component domain protein"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; KEGG: eca:ECA0263 putative sulfite
FT                   oxidase subunit YedZ"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11306"
FT                   /db_xref="GOA:C6DIK6"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIK6"
FT                   /inference="protein motif:PFAM:PF01794"
FT                   /protein_id="ACT11306.1"
FT                   /translation="MRLTLQHITRLKVLLHLAGFLPLLWLILSVDQGWFSADPAKDIQH
FT                   FTGRMALKLLLATLLVTPLARYGKQPLLIRCRRLLGLWCFFWATLHLVSYALLELGLDH
FT                   LALLGKELISRPYLTLGVISWLILLALAVTSPQIMMRKLGSQWQKLHNFVYLVAILAPI
FT                   HYLWSVKTLSPQPILYALAALILLLFRYKKFRQWWR"
FT   gene            complement(291490..292491)
FT                   /locus_tag="PC1_0247"
FT   CDS_pept        complement(291490..292491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0247"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   eca:ECA0264 putative sulfite oxidase subunit YedY"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11307"
FT                   /db_xref="GOA:C6DIK7"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIK7"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACT11307.1"
FT                   /translation="MHKHRKPTEADVTPESLFYQRRRILKALGISAAALSLPFSAQADL
FT                   LAWFKGTDKPKAPPGKPLTFSQPADWKLDLPLTPEDKVTGYNNFYEFGLDKADPAANAG
FT                   GLKTEGWTIKIDGDVAKPLTLDIDDLLKRFPLEERIYRFRCVEAWSMVIPWVGFELAKL
FT                   IKFAEPTSNARYVAFQTLYDPEQMPGQKDRFMGGGLDYPYVEGLRMDEAMNPLALLAVG
FT                   VYGKTLPPQNGAPIRLVTPWKYGFKNIKSIVHIRFTREKPPCTWNLAAPDEYGFYANVN
FT                   PHVDHPRWSQATERVIGSGGLLNVERQPTLLFNGYAEQVASLYRGLNLRDNF"
FT   sig_peptide     complement(292360..292491)
FT                   /locus_tag="PC1_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 44"
FT   gene            complement(292636..292717)
FT                   /pseudo
FT                   /locus_tag="PC1_0248"
FT   gene            complement(292795..293772)
FT                   /locus_tag="PC1_0249"
FT   CDS_pept        complement(292795..293772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0249"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="TIGRFAM: quinone oxidoreductase, YhdH/YhfP family;
FT                   PFAM: Alcohol dehydrogenase zinc-binding domain protein;
FT                   Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   eca:ECA0265 putative zinc-binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11308"
FT                   /db_xref="GOA:C6DIK8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIK8"
FT                   /inference="protein motif:TFAM:TIGR02823"
FT                   /protein_id="ACT11308.1"
FT                   /translation="MQALVLEQSDGLTHAQIREIDAEQLPTGDVTVDINWSGINYKDAL
FT                   AITGKGKIIRNFPMVPGIDFAGTVRHSDSDRFTAGQPVILTGWGVGENHWGGLAQQARV
FT                   KSDWLVPLPASLDARKAMILGTAGFTAMLCVMALEDGGITPESGDIIVTGASGGVGSTA
FT                   VALLAELGYQVTAVSGRADNTDYLKKLGAKQVLDRSEFSGSPRPLEKQRWAGAVDTVGD
FT                   NVLATLLAQMDYNATVAACGLAGGIALPTTVMPFILRNVRLQGVDSVMAPLARRQQAWE
FT                   RLATILPESFYQQVTQEIGLEDVPATAAALLENKVTGRTLVKIS"
FT   gene            293799..293948
FT                   /locus_tag="PC1_0250"
FT   CDS_pept        293799..293948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA3326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11309"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIK9"
FT                   /inference="similar to AA sequence:KEGG:ECA3326"
FT                   /protein_id="ACT11309.1"
FT                   /translation="MGKSLTTIYPSHFKLHVHWHRLVTQITYLSKLIGMPSLAAFLQLG
FT                   LFRV"
FT   gene            294076..296013
FT                   /locus_tag="PC1_0251"
FT   CDS_pept        294076..296013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0251"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="KEGG: eca:ECA0266 regulatory protein CsrD; TIGRFAM:
FT                   diguanylate cyclase; PFAM: EAL domain protein; GGDEF domain
FT                   containing protein; SMART: EAL domain protein; GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11310"
FT                   /db_xref="GOA:C6DIL0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033423"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIL0"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACT11310.1"
FT                   /translation="MGFTTRFSILVVLLTVLAIFLMLFSSIFSLCYYSQLRTEQQLREV
FT                   TASIDQALLVQSPENIQYWLPSMMKTAGIVVLDIQDNDSTLYSIQLPEAGWERTHLYHE
FT                   VEFPLMHHLNMTIAIRYVDPLIGLPRFVVSMLSVLLAAGLMLLMLYFSIRWLRRQAAGQ
FT                   EELEERAQRILKGERESVMQGSVREWPVNTSGALDQLLSDLVEAREERGRVDTLIRAFA
FT                   AQDAETGLSNRLFFDNQLTTQLEDGEEVGTHGVVMMIRVPDFETLQETHGYSSALQEYR
FT                   FTLVNLLSTFVMRYPSALLARYFSSDFTVLLPHSTLKEANAIATQLVKSIDILPACPLI
FT                   DREEVLHIGICAYRGGQSAEQVMESVEDATRNAVLQGGNSWCVFDRQVPEKGRGSVKWR
FT                   TLLEQTLARGGPRLYQKPAVTKEGVVHHREMMSRIYDGEQELLAAEYMPLVQQLGLAAS
FT                   YDRQLVARIIDLSANWPGETLALPVSVDSLLQKPFLRWLKEVLLQCPKTQRQRILFELA
FT                   EADVCQYIGRLRPVLTVILGLGCRLAVTQAGLTLVSTTYIKSLPVEIIKLHPGLVRSLE
FT                   RRPENQLFVQSLTEACKGTQTRVFAAGVRTKEEWRMLLGKGVYGGQGDFFAASVLVTDE
FT                   LKKYSSQHRV"
FT   sig_peptide     294076..294180
FT                   /locus_tag="PC1_0251"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.670 at
FT                   residue 35"
FT   gene            296330..297373
FT                   /locus_tag="PC1_0252"
FT   CDS_pept        296330..297373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0252"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: eca:ECA0267 rod shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11311"
FT                   /db_xref="GOA:C6DIL1"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIL1"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ACT11311.1"
FT                   /translation="MFKKFRGMFSNDLSIDLGTANTLIYVKGQGIILNEPSVVAIRQDR
FT                   AGSQKSVAAVGHDAKQMLGRTPGNIVAIRPMKDGVIADFQVTEKMLQHFIKQVHSDSFM
FT                   RPSPRVLVCVPVGATQVERRAIRESALGAGAREVFLIEEPMAAAIGAGMPVSEATGSMV
FT                   VDIGGGTTEVAVISLNGVVYSSSVRIGGDRFDEAIINYVRRNYGSLIGEATAERIKHEI
FT                   GSAYPGDEVLEIEVRGRNLAEGVPRGFTLNSNEILEALQEPLTGIVSAVMAALEQCPPE
FT                   LASDISERGMVLTGGGALLRNLDRLLMEETGIPVVVAEDPLTCVARGGGKALEMIDMHG
FT                   GDLFSEE"
FT   gene            297549..298532
FT                   /locus_tag="PC1_0253"
FT   CDS_pept        297549..298532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0253"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: eca:ECA0268 cell
FT                   wall structural complex MreBCD transmembrane component
FT                   MreC"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11312"
FT                   /db_xref="GOA:C6DIL2"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIL2"
FT                   /inference="protein motif:TFAM:TIGR00219"
FT                   /protein_id="ACT11312.1"
FT                   /translation="MKPLFSRGPSLQLRLFLAVVTAIVVIVADSRLGSFVKIRTYMDTA
FT                   VSPFYFLANGPRQVLDNMSASLATREQLGLENTALRQELLMKNSDLLMLGQLKQENARL
FT                   RELLGSPLRQDEQKMVTQVMSAGTDPYSDQVVIDKGQTNGVYEGQPVISDKGVVGQVVA
FT                   VGQFTSRVLLICDVSHALPIQVLRNDIRVIAAGNGCADDLQLEHLPNNTDIRVGDVLVT
FT                   SGLGGRFPEGYPVAVVSSVKADTQRAYTIIQARPTAGLQRLRYLLLLWGVENNSNTSLP
FT                   PAEVHRVANERLMQMMPQVLPSPDDMGPPLPPDTAAPTVEPQRGRQ"
FT   gene            298529..299017
FT                   /locus_tag="PC1_0254"
FT   CDS_pept        298529..299017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0254"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD; KEGG: eca:ECA0269 rod
FT                   shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11313"
FT                   /db_xref="GOA:C6DIL3"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIL3"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ACT11313.1"
FT                   /translation="MNRYRRHGNWIIWLSFLIAMVLQIMPWPDEIYMFRPSWLTLFLIY
FT                   WVMALPHRVNVGTGFILGLIMDLILGSTLGVRALALSIIAYLVAFKFQLFRNMALWQQA
FT                   LIVMLLSLLMDLTVFWAEFLVINVSFRPETFWNSVVDGVLWPWLFLLMRKIRRQFTVQ"
FT   gene            299026..299619
FT                   /locus_tag="PC1_0255"
FT   CDS_pept        299026..299619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0255"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: eca:ECA0270 Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11314"
FT                   /db_xref="GOA:C6DIL4"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIL4"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ACT11314.1"
FT                   /translation="MTQLYLASASPRRRELLTQLDIPFAVLNVAVEEQRLPEEAAEVYV
FT                   RRLAHEKAAAGVAAAPLDLPVLGADTIVVLNGQVLEKPQDEAHAAEMLSQLSGKPHQVM
FT                   TAVALADKDDILSCLVITDVVFRPLSQQDIERYIASGEPMDKAGAYGIQGKGGCFVRSL
FT                   NGSYYAVVGLPLVETHELFSNFAALRSARGKHDC"
FT   gene            299609..301078
FT                   /locus_tag="PC1_0256"
FT   CDS_pept        299609..301078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0256"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="KEGG: eca:ECA0271 ribonuclease G; TIGRFAM:
FT                   ribonuclease, Rne/Rng family; PFAM: RNA binding S1 domain
FT                   protein; SMART: RNA binding S1 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11315"
FT                   /db_xref="GOA:C6DIL5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIL5"
FT                   /inference="protein motif:TFAM:TIGR00757"
FT                   /protein_id="ACT11315.1"
FT                   /translation="MTAELLVNVTPSETRVAYIDGGILQEIHIERDAKRGIVGNIYKGR
FT                   VSRVLPGMQAAFVDIGLDKAAFLHASDIMPHTECVAGDEQKNFHVRDIAELVRQGQDLM
FT                   VQVVKDPLGTKGARLTTDITLPSRYLVFMPGASHVGVSQRIESEAERERLKKTVAEYCD
FT                   DDGGFIIRTAAEGIGEEELSQDAAFLKRLWGKVMERKKRNQTKCKLYGEVALAQRILRD
FT                   FAGAALDRIRIDSRLTYEALLEFTSEYIPEMTRKLEHYAGKQPIFDLFDVENEIQRSLD
FT                   RKVELKSGGYLIIDQTEAMTTIDINTGAFVGHRNLDETIFNTNTEATQAIARQLRLRNL
FT                   GGIIIIDFIDMNNDDHRRRVLHSLEQALSKDRVKTSINGFSQLGLVEMTRKRTRESIEH
FT                   VLCHECPTCHGRGTVKTVESVCYEIMREIVRVHHAYDTDRFLVYASPAVGEALKSEESH
FT                   ALAEVEIFVGKQVKVQIEPLYSQEQFDVVMM"
FT   gene            301120..304950
FT                   /locus_tag="PC1_0257"
FT   CDS_pept        301120..304950
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0257"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11316"
FT                   /db_xref="GOA:C6DIL6"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIL6"
FT                   /inference="similar to AA sequence:KEGG:ECA0272"
FT                   /protein_id="ACT11316.1"
FT                   /translation="MRRLPGIVVITGATLVVMVALLVSGLRLVLPQLDHFRPQLVAWAQ
FT                   SAAGVPLEIGSMTGRWESFGPTLEIEKLRTSLPESDWQVDRITLALDVWQSLLHGRWQF
FT                   RDLTFHQLKLDINSPFTGQQQDSKLMESGKVSDLFLRQFDHFDLRDSHITFLTPSGSRA
FT                   ELSIPQLTWLNSDKRHRAEGLISLSSFNGQHGVVQMRMDLHDEQGLLSNGTFYLQADNI
FT                   DMKPWLSRWMKNNTGLESADFSLAAWLNVRDGGIHSGDVFLNQGTANWGDGPDAHRLNV
FT                   DDMTLHVSRQENGWQVDVPELNLATDGTAWPKGRLSALWLPKNEHMLGPDRQEELRIRA
FT                   SNLALERVSTLLPLLSSTTPALKERWAELQPTGTLNTVAVDIPLQQPERSRFQANWQDV
FT                   SWKQWKLLPGVDHFSGSARGSAERGQVSVALKQSTLPYVDMFRAPLEIQQASGTIDWRN
FT                   DAQGLALWSHGLDVQAKSLWANGDFRYEQPVKQEPKLDILAGIRLTDAADAWRYYPEQF
FT                   MGTELVDYLSGALKGGRVDNATLIFAGNPQHFPYTHNEGQFEVWVPVKGATFEFQPGWP
FT                   ALTPLDINLDFANNGLWMFAPQTWLGKVEGKNISAVIPDYEKEMLLIDGELEGPGPEVG
FT                   NYFNQTPLKSSLGTALDELKIGGPVKGSLHLDIPLVGDDVHASGDIALNNNSLYIKPLN
FT                   TTIKNLTGKFRYENGNLRSDTLQANWMNQPMAVNFTTEEQAKAFLVNVGLQGDWQPALL
FT                   PGLPASASKALSGTAGWKSTVAVNLPHTGKTTYEVDVQADLNKVSSHLPNPLNKPAGES
FT                   LPLEVKASGDLNGFAIQGRLGKDNRFNSQWLLKGDTVTLARASWQNAATASPALPDDSS
FT                   LVLDLPSLDAESWLGLLPSLRASASAEGRKAQSSLRFPEAVTLRTPELQLLGQQWHDLE
FT                   ITRKNTLAGSEVKAKGREIDGTVEIPNRGMWRSDINYLYYNPQWKGNEATNPVALAEKK
FT                   SPLNDPSISFEDWPSLAVNCRQCWIIGQNMGRIQGTLLPEKEKLTLTDGIIDTGKARLT
FT                   VNGTWQENAEGVRTALKGRLTGDSLEQNANWFGVDSPLKAGSFDVDYDLYWRGTPWAPD
FT                   IASLSGILHTRIGKGEIAEVGAGQAGQLLRLLSFDALMRKLRFDFSDTFGRGFYFDSIR
FT                   STAWIKDGVLHTDDMLIDGLEADIAMKGDLDLAKRQVNMEAVIAPEISATVGVATAFAV
FT                   NPVIGAAVFAASKVLAPLWNKISLIRYQISGSLDQPKIQEVLREPNKKKGE"
FT   sig_peptide     301120..301179
FT                   /locus_tag="PC1_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.629) with cleavage site probability 0.194 at
FT                   residue 20"
FT   gene            305007..306452
FT                   /locus_tag="PC1_0258"
FT   CDS_pept        305007..306452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0258"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   eca:ECA0273 protease TldD"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11317"
FT                   /db_xref="GOA:C6DIL7"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIL7"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ACT11317.1"
FT                   /translation="MSLSFVSEQLLTANKLNLDDLAAVLGSLNERRLDYADLYFQSSYH
FT                   ESWVLEDRIIKDGSYNIDQGVGIRAIDGEKTGFAYADQITLNALHQSAQAARSIVREQG
FT                   TGTARTLGEVSHRALYPTLNPLDSLTREDKIALLQRADTVARAADARVQEVSASLTGVY
FT                   ELVLVAATDGTLAADVRPLVRLSISVLVEAEGKRERGSSGGGMRGGYDYFWEVADGEAR
FT                   VDAWAKEAVRMALVNLSAVAAPAGPMPVVLGAGWPGVLLHEAVGHGLEGDFNRRGTSVF
FT                   SGQMGKLVASELCTVVDDGTLSGRRGSLSMDDEGVPGQYNVLIENGILKGYMQDKLNAR
FT                   LMGVAPTGNGRRESYAHLPMPRMTNTYMLAGKSTPEEIISSVEYGLYAPNFGGGQVDIT
FT                   SGKFVFSTSEAYLIEKGRITTPVKGATLIGSGIEAMQQISMVGNDLALDKGVGVCGKEG
FT                   QSLPVGVGQPTLKLESLTVGGTA"
FT   gene            complement(306537..307130)
FT                   /locus_tag="PC1_0259"
FT   CDS_pept        complement(306537..307130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0259"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0274 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11318"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIL8"
FT                   /inference="similar to AA sequence:KEGG:ECA0274"
FT                   /protein_id="ACT11318.1"
FT                   /translation="MKIFKVGDTQSALCNTCQSLETATFQLRDVPFSDNSGVVRQVLVG
FT                   VCNRCGNVAIIPHQSTPMIKKARDVQRKALESRVPAHMIDILNLASCELGGEPDFIPTL
FT                   MKYYLHTLAADRAAAQDIPRFLQSDLAKGKSEKRLSLKGRHVATDIDVLKTTTNISSTT
FT                   DLLKGIVLKIKEDVLVQRDEIHIRQLKSIIAAVS"
FT   gene            complement(307140..307478)
FT                   /locus_tag="PC1_0260"
FT   CDS_pept        complement(307140..307478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0260"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11319"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIL9"
FT                   /inference="similar to AA sequence:KEGG:ECA0275"
FT                   /protein_id="ACT11319.1"
FT                   /translation="MDKVRINSYNIGEGMGFKDAKKQLIVCLQSGTVLHEARGNISTKN
FT                   LLATGQASITELIDIIYQSSGTSYSSSPHHFAAHIDVHIIRCRHRGISWYIKWYFAEPN
FT                   CVFISVHH"
FT   gene            complement(307589..308524)
FT                   /locus_tag="PC1_0261"
FT   CDS_pept        complement(307589..308524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0261"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: eca:ECA0276 putative DNA-binding
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11320"
FT                   /db_xref="GOA:C6DIM0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIM0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACT11320.1"
FT                   /translation="MERLKSMSVFARVVEFGSFTAAARQLQMSVSAVSQTVTKLEDELQ
FT                   IKLLNRSTRSIGLTEAGKIYYHGCRRMLHEAHEVHEQLYAFNNTPIGTLRIGSSSTMAQ
FT                   NVLSTMTAAMLKEYPGLSVNLVTGIPAPDLIADGLDIVIRVGALQDSSLFSKRLGSMPM
FT                   VICAAKSYLAQHGTPDKPADMVNFSWLEYSVRPDSEFELIAPEGISTRVTPQGRFVTND
FT                   PQTLVRWLKAGAGIAYVPLMWVVDEINRGEIEILFNRYHSDPRPVYALYTRKDNLPLKV
FT                   QVCINYMTEYFKNVALTYQGYRQDHGEEKK"
FT   gene            308950..309153
FT                   /locus_tag="PC1_0262"
FT   CDS_pept        308950..309153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0262"
FT                   /product="protein of unknown function DUF1656"
FT                   /note="PFAM: protein of unknown function DUF1656; KEGG:
FT                   eca:ECA0277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11321"
FT                   /db_xref="GOA:C6DIM1"
FT                   /db_xref="InterPro:IPR012451"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIM1"
FT                   /inference="protein motif:PFAM:PF07869"
FT                   /protein_id="ACT11321.1"
FT                   /translation="MSSLPVMVLFGLSFPPVFFVLLVSLTLFFVVNCLLQPTGIYDFVW
FT                   HPALFNSALFCCLFYLLFRYGL"
FT   gene            309161..310126
FT                   /locus_tag="PC1_0263"
FT   CDS_pept        309161..310126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0263"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   eca:ECA0278 p-hydroxybenzoic acid efflux subunit AaeA"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11322"
FT                   /db_xref="GOA:C6DIM2"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR022871"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIM2"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACT11322.1"
FT                   /translation="MKAFFLTLFRQQAVLIKKMSRVAITLVIVLCAIVAIFRVWAFYTE
FT                   SPWTRDAKFTADVVAIAPDVSGLLSDVRVTDNQLVNKGDVLFVIDQPRYHQAVAQAEAD
FT                   VAYYQALVTEKRRESGRRARLGISAMSQENIDQSSNALETATHQLAKAQVVLSLAQLEL
FT                   ERTVVRAPADGWVTNLHVQSGEFIERGNTAVALVKKDSFYLLAYMEETKLEGVRRGYRA
FT                   EITPLGSEKIFYGTVDSVAAGVNNSSSSANNKGLANVDSNLEWVRLAQRVPVKIRLDRQ
FT                   MGDLYPAGTTATVVITGEQVNNDKKPSPLIRLLYRLREFG"
FT   sig_peptide     309161..309286
FT                   /locus_tag="PC1_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.957) with cleavage site probability 0.955 at
FT                   residue 42"
FT   gene            310138..312126
FT                   /locus_tag="PC1_0264"
FT   CDS_pept        310138..312126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0264"
FT                   /product="Fusaric acid resistance protein conserved region"
FT                   /note="PFAM: Fusaric acid resistance protein conserved
FT                   region; KEGG: eca:ECA0279 p-hydroxybenzoic acid efflux
FT                   subunit AaeB"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11323"
FT                   /db_xref="GOA:C6DIM3"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="InterPro:IPR023706"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIM3"
FT                   /inference="protein motif:PFAM:PF04632"
FT                   /protein_id="ACT11323.1"
FT                   /translation="MKTPSLTGPVFFTTPKFARLRFAFKLSFAIVLSLFLGFHLQLETP
FT                   RWSVLTAAIVAAGPAFAAGGEPFSGAIRHRGMLRVVGTFIGCIGALIIIIATVRAPVVM
FT                   LMLCCIWAGLCTWVSSLVKVENAYVFGLAGYTTLIIIVSTQGTPLLTPQFAVERCSEIV
FT                   LGIVCAILADLLFSPRSIKQDVDRSMGELLVDQYRLLQLSMSGAEKETIDAAWHALVRK
FT                   TTALSGMRSSLMLESSRWQNSNRRLTSLHTQSLTMITQACETYLVLQDAPTPVKSSLKL
FT                   VLDQPVESFRDVHCRVKALRHLIAADSRDVPPTLVSWVGAATRYLLLAKGVQTNGRITT
FT                   IEADVLNSEVEIKAPSAETHHAMINGLRTGVATALGCLFWLSTGWTSGSVCMVMIAVVT
FT                   SLAMRLPNPQMMAKDFLFGTIYALPLGALMFMFIMPSTQQSMLLLCLSLGAMAFFLGLE
FT                   VQKRRLGSLGALASTINILVLDNPMTFHISQFLDSAIGQIIGCFLALMVILLIRDNTKA
FT                   HTGRTLLNRFVYGAVSALTTNTTRRKENHLPALYQQLFLLLNRFPDDIAKYRLALWLII
FT                   MHQRLRTLDIPQNAALSAFHRQIRATAEQVILARRDTTRSRYFTQLLGELERYQQMLTE
FT                   QQLPASVTAPVGRLTGILRDYQHALSN"
FT   sig_peptide     310138..310326
FT                   /locus_tag="PC1_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.981 at
FT                   residue 63"
FT   gene            312266..313720
FT                   /locus_tag="PC1_0265"
FT   CDS_pept        312266..313720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0265"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: eca:ECA0280
FT                   succinate-semialdehyde dehydrogenase [NADP+]"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11324"
FT                   /db_xref="GOA:C6DIM4"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIM4"
FT                   /inference="protein motif:TFAM:TIGR01780"
FT                   /protein_id="ACT11324.1"
FT                   /translation="MSGQNLQDHELFKTGYFAAGKWQQGTATFEVVNPATGETIASVAK
FT                   AGKKETQAAIDAAYAAFPAWKRKTAKERSEILYRWYELILENKRYLAELMTAEQGKPVQ
FT                   EAEGEVVYAASFIQWFAEQGKRANGEIIPSAKPGSKIYATREPVGVVVAITPWNFPLAM
FT                   LTRKLGPALAAGCTGVIKPANNTPLSAFALLALAQQAGVPDGVLNGVAGDTQAISDTVM
FT                   ASDKVRKISFTGSTTVGKTLVRNAADTMKKVSMELGGNAPYIVFDDADIQAAVKGAIAN
FT                   RFRNAGQVCVSANRFYIQDGVYDEFVSLLAEEVKRLKVGNGMDDGVVLGPLIDDAAVEK
FT                   VEKHVNDAVEKGGKALVGGQRHKLGHSFFEPTVIVDANEAMLLAQEETFGPVAPCFRFK
FT                   TEEEVIERANNTPFGLAAYFYSQNLQRVFRVAEALESGMVGINECAVSTELAPFGGVKE
FT                   SGLGREGSVLGLDEFLEVKTWHLGGL"
FT   gene            complement(313816..314367)
FT                   /locus_tag="PC1_0266"
FT   CDS_pept        complement(313816..314367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0266"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   eca:ECA0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11325"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIM5"
FT                   /inference="protein motif:PFAM:PF04751"
FT                   /protein_id="ACT11325.1"
FT                   /translation="MKQKYEDWLNDVPDNQEDDEDDEIIWVSKSEIKRDAEALKDLGAE
FT                   LVDLGKNALEKIPLDDDLRAAVELAQRIKKEGRRRQLQLIGKMLRARDPEPIQTALDKL
FT                   NNRHNQQVALFHKLEQLRDRLIEEGDDVVPDILALYPHADRQQLRSLVRNAQKEKAANK
FT                   PPKSARQIFQYLRELAETTD"
FT   gene            314665..316005
FT                   /locus_tag="PC1_0267"
FT   CDS_pept        314665..316005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0267"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   eca:ECA0282 peptidase PmbA"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11326"
FT                   /db_xref="GOA:C6DIM6"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIM6"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ACT11326.1"
FT                   /translation="MTITTQVAEQRKALELAVAQALELARAGSDAAEVAVTKTTGISVS
FT                   TRYGDVENVEFNSDGALGITVYHQQRKGSASSTDLSPDAIARTVQAALDIARYTSVDPF
FT                   AGPADRDLLAFDAPDLDLFHPTELDADRGIELAARAEQAALQADKRITNTEGGSFNSHY
FT                   GVKVFGNSHGLLKSYCSSRHSMSSCVIAEVNGDMERDYAYTVGRALDDLLSPEWVGEEC
FT                   ARRTLSRLSPRKLPTMQAPVMFSAEVATGLFGHLVGAISGGSVYRKSTFLLDKLGQQIL
FT                   PEWLTIEEQPHLLKGLASTPFDSEGVRTQAREIVKAGVLQTWLMTSYSARKLGMKSTGH
FT                   AGGIHNWRIAGQGLDFNGMLKQMGKGLLVTELMGQGVSGVTGDYSRGASGFWVENGEIQ
FT                   YPVSEITIAGNLKDMLRNIVTVGNDIETRSNIQCGSVLLPDMKIAGE"
FT   gene            316445..319624
FT                   /locus_tag="PC1_0268"
FT   CDS_pept        316445..319624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0268"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; FAD-binding domain protein;
FT                   flavodoxin/nitric oxide synthase; oxidoreductase
FT                   FAD/NAD(P)-binding domain protein; KEGG:
FT                   bur:Bcep18194_C6803 cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11327"
FT                   /db_xref="GOA:C6DIM7"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR023206"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIM7"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ACT11327.1"
FT                   /translation="MSGKTAVPQPPIKPVIGNLADVDPRNSIDSLMKLAKTYGPFFKMR
FT                   IFSDEFYVASSQELVNELSDESFFEKKLSAELLELRYLGGDGLFTAHTHEPNWGKAHRI
FT                   LMPALGPLGVRSMFDKMLDISEQMFLRWERFGPDVDIDVADNMTRLTLDTIALCGFDYR
FT                   FNSFYRDDLLPFVKAIVGSLKEAGLRVRRPGIVNKLMIPSTRQYRTDKALMYSVVEQLI
FT                   AARKMDPKASEKNDLLNRMLNGVDPQTGEKLSDENIAHQMLTFLVAGHETTSGMLSFTV
FT                   YFLLKNPNVLNKARAIVDEVLGDEIPRIEHLAQLRYLEQILMESLRMWPTAGGHVVSPT
FT                   QDTILAGKYPLTPKDSIVILQPQLHRDVKAWGDDANLFKPERFGPDNAENLLPNSWQPF
FT                   GSGKRACIGRMFAMQEAQLVLAMMLQRFDFELSDPSYELKIVEHLTIKPDNLKIRIRVR
FT                   KPSKTLARGVTPKETSNKMAVMPVAKAQHHQDLIPLLVLHGGNTGSSEAFANRIAADAQ
FT                   RYGFASTLAALDDYAEKLPQTGALIVITASYEGMPPNNARHFVPWVEGLADDALSGLKF
FT                   SVFGCGNLQWVRTYQAIPKRVDLALEHAGGERIHERGVADSGGDFFGNFDDWYTKLWPA
FT                   LTTAFGRQGAVAEDATELELEFVHTDRVSTLQIPDMGRGVVVENRELVDMTSPFARSKR
FT                   HIEIRLPEGMAYRAGDYLAVLPRNSDDQIDRVLRRFGLSPDMMLVINQAPDVTGLPIGQ
FT                   PISCAELLGNYVELSQPATRAQVAALAAATRCPPEKMELEKLATEHYENDVLAPRLSVL
FT                   DLLYRFQSCPTDFRRYLTMLPSIKARQYSISSSPAWKPDHVTLTVAVVDSPALSGIGRY
FT                   KGVASNYLASLKPDDRIAIVVRPSSPFFHLPDDPSIPIILIGAGSGIAPFRGFLQERAL
FT                   QQAAGVRVGPALLFFGTGHPDVDYLYRDELAAWEKSHIVTVLPAFSHQPDGEVTFVQHR
FT                   VWADRERIKTLFCNGGSLFVCGDGLRMVPEVRDMLLRIYREATGSNETDAMLWADKLER
FT                   EQGRYVVDMFI"
FT   gene            complement(319764..320174)
FT                   /locus_tag="PC1_0269"
FT   CDS_pept        complement(319764..320174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0269"
FT                   /product="GreA/GreB family elongation factor"
FT                   /note="KEGG: eca:ECA0283 nucleoside diphosphate kinase
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11328"
FT                   /db_xref="GOA:C6DIM8"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028625"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIM8"
FT                   /inference="similar to AA sequence:KEGG:ECA0283"
FT                   /protein_id="ACT11328.1"
FT                   /translation="MTKPNLTISELDAERLDMLLEQPAFADSDIAQALNEELDRAEILP
FT                   SASIPSHVVTMNSRVRFRDLNTNEEHIRTLVYPAAVKDSQEPLSVMAPLGAALLGMHVG
FT                   NAITWQLPNGEETRIEVLELLYQPEAAGEYHR"
FT   gene            complement(320345..320617)
FT                   /locus_tag="PC1_0270"
FT   CDS_pept        complement(320345..320617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0270"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphoryl transfer system HPr; KEGG: eca:ECA0284
FT                   phosphohistidinoprotein-hexose phosphotransferase component
FT                   of N-regulated PTS system (Npr)"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11329"
FT                   /db_xref="GOA:C6DIM9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIM9"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ACT11329.1"
FT                   /translation="MTVRQTVEIKNKLGMHARPAMKLFELVQSFDAEVILRNDSGTEAE
FT                   ASSVIAMLMLDSAKGRLIEVEATGPDEAQALAAVIGLFEAGFDED"
FT   gene            complement(320649..321506)
FT                   /locus_tag="PC1_0271"
FT   CDS_pept        complement(320649..321506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   eca:ECA0285 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11330"
FT                   /db_xref="GOA:C6DIN0"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIN0"
FT                   /inference="protein motif:PFAM:PF03668"
FT                   /protein_id="ACT11330.1"
FT                   /translation="MVLMIVSGRSGSGKSVALRALEDMGFYCVDNLPVVLLPELANTLA
FT                   ARNISAAVSIDVRNMPESPEIFEHAMEQLPPSFSPQLLFLDADRNTLIRRYSDTRRLHP
FT                   LSSKNLSLESAIDEESDLLEPLRSRADLIIDTSEMSVHELAEMLRTRLLGKRERELTMV
FT                   FESFGFKHGIPIDADYVFDVRFLPNPHWDPKLRPMTGLDKPVASFLDRHTEVHNFIYQT
FT                   RSYLELWLPMLETNNRSYLTVAIGCTGGKHRSVYVAEQLADYFRSRGKNVQSRHRTLEK
FT                   RKPS"
FT   gene            complement(321667..322167)
FT                   /locus_tag="PC1_0272"
FT   CDS_pept        complement(321667..322167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0272"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: eca:ECA0286
FT                   sugar-specific enzyme IIA component of PTS"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11331"
FT                   /db_xref="GOA:C6DIN1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIN1"
FT                   /inference="protein motif:TFAM:TIGR01419"
FT                   /protein_id="ACT11331.1"
FT                   /translation="MKASLSENKMNHDPVLQLSTVLRPECTRSTVHCQSKKRALEIISE
FT                   LAARQLNIPSQIIFDAILTRERMGSTGIGGGIAIPHGKLEDDNALGAIGVFIQLEQPIA
FT                   FDAIDNQAVDLLFALLVPAEQCKTHLHTLSLVAKRLADKTVCRRLRAAQSDEELYQIMT
FT                   EAG"
FT   gene            complement(322237..322524)
FT                   /locus_tag="PC1_0273"
FT   CDS_pept        complement(322237..322524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0273"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   eca:ECA0287 putative sigma(54) modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11332"
FT                   /db_xref="GOA:C6DIN2"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIN2"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ACT11332.1"
FT                   /translation="MQLNITGHHIEITEPLRDFVNGKFAKLEQYFDRINQVNVVLRVEK
FT                   VQQIAEATIHVNGGELHATSEAEDMYAAIDLLIDKLARQLNKHKDKLKQH"
FT   gene            complement(322548..323981)
FT                   /locus_tag="PC1_0274"
FT   CDS_pept        complement(322548..323981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0274"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 DNA-binding domain protein; sigma-54 factor
FT                   core-binding region; sigma-54 factor; KEGG: eca:ECA0288 RNA
FT                   polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11333"
FT                   /db_xref="GOA:C6DIN3"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIN3"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ACT11333.1"
FT                   /translation="MKQGLQLRLSQQLAMTPQLQQAIRLLQLSTLELQQEIQQALESNP
FT                   LLEQTDQHDEIESFEKADSDSLDTGEALEQRDMPEELPIDATWDEIYSAGTPSGTGTDY
FT                   RDEELPIYQGETTQTLQDYLMWQVELTPFSDTDAAIATSIVDAVDNTGYLTVPLEDILD
FT                   SIGDDDVTLEEVEAVLKRVQRFDPVGVAARDLRDCLLVQLSQFADSTPRLAEARLIVSD
FT                   HLDLLANHDFRSLIRVTRLKEEVLKEALALIQSLDPRPGQSINTGESEYVIPDVLVRKV
FT                   QGIWAVELNTDSIPRLQINQQYAALGNSARNDSDGQFIRSNLQEARWLIKSLESRNDTL
FT                   LKVTRCIVEQQQDFFEQGEEFMKPMVLADIAQAVDMHESTISRVTTQKFLHSPRGIFEL
FT                   KYFFSSHVNTDSGGEASSTAIRALVKKLIAAENPVKPLSDSKLTALLSDQGIIVARRTV
FT                   AKYRESLSIPPSNQRKQLI"
FT   gene            complement(324031..324756)
FT                   /locus_tag="PC1_0275"
FT   CDS_pept        complement(324031..324756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0275"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA0289 putative ABC transporter ATP-binding
FT                   protein YhbG"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11334"
FT                   /db_xref="GOA:C6DIN4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIN4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT11334.1"
FT                   /translation="MATLTAENLAKAYKGRKVVENVSLTVNSGEIVGLLGPNGAGKTTT
FT                   FYMVVGIVPRDEGRIVIDDDDISLLPLHERALRGIGYLPQEASIFRRLSVYDNLMAVLQ
FT                   IRKDLTTEQQEDRANELMEEFHIIHLRDSLGQSLSGGERRRVEIARALAANPKFILLDE
FT                   PFAGVDPISVLDIKKIIEHLRDSGLGVLITDHNVRETLDVCERAYIVSQGNLIAHGSPT
FT                   DILADEQVKRVYLGEGFRL"
FT   gene            complement(324760..325332)
FT                   /locus_tag="PC1_0276"
FT   CDS_pept        complement(324760..325332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0276"
FT                   /product="lipopolysaccharide transport periplasmic protein
FT                   LptA"
FT                   /note="TIGRFAM: lipopolysaccharide transport periplasmic
FT                   protein LptA; PFAM: OstA family protein; KEGG: eca:ECA0290
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11335"
FT                   /db_xref="GOA:C6DIN5"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIN5"
FT                   /inference="protein motif:TFAM:TIGR03002"
FT                   /protein_id="ACT11335.1"
FT                   /translation="MKSKTNNLMRNTLIASSLFAVSVSAFAVTGDSNQPIRIDSAQQSL
FT                   DMQGNTVTFTGNVVVKQGTIEVKADKVVVTRPQGTQGSEVVEGYGNPVTFYQMQDNGKP
FT                   VKGHAQKIRYELAKDLLVLTGNAYLEQQDSNVKGDRITYLVKQQQMEATSEKGKRVTTV
FT                   LVPSQLQDKENKSQPSRSQQPQPRVTE"
FT   sig_peptide     complement(325249..325332)
FT                   /locus_tag="PC1_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 28"
FT   gene            complement(325313..325879)
FT                   /locus_tag="PC1_0277"
FT   CDS_pept        complement(325313..325879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0277"
FT                   /product="protein of unknown function DUF1239"
FT                   /note="PFAM: protein of unknown function DUF1239; KEGG:
FT                   eca:ECA0291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11336"
FT                   /db_xref="GOA:C6DIN6"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIN6"
FT                   /inference="protein motif:PFAM:PF06835"
FT                   /protein_id="ACT11336.1"
FT                   /translation="MSKTKRWLTAFLALLVLILIGWNIADDDTVAAPDANDPAVPVYTS
FT                   EKTNTQVYSPAGKLSYRLISEKAEYFNDEQLSWFTAPVATLFNEQGTATWSVRADRAKL
FT                   TKDKMLYLYGHVEVNSLTKDAQLQRITTNNAQVNLVTQDVSSDDEVTLYGTSFTSSGMK
FT                   MRGNLRNKTAELIEKVKTSYEIQNQ"
FT   sig_peptide     complement(325802..325879)
FT                   /locus_tag="PC1_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.940) with cleavage site probability 0.773 at
FT                   residue 26"
FT   gene            complement(325876..326442)
FT                   /locus_tag="PC1_0278"
FT   CDS_pept        complement(325876..326442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0278"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family"
FT                   /EC_number="3.1.3.45"
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase, YrbI family; hydrolase, HAD-superfamily,
FT                   subfamily IIIA; KEGG: eca:ECA0292
FT                   3-deoxy-D-manno-octulosonate 8-phosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11337"
FT                   /db_xref="GOA:C6DIN7"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIN7"
FT                   /inference="protein motif:TFAM:TIGR01670"
FT                   /protein_id="ACT11337.1"
FT                   /translation="MSEVRAQTDTCYGPVDQQVLDKAREVRLLICDVDGVMSDGLIYMG
FT                   NHGEELKAFNVRDGYGIRCLLTSGIEVAIITGRSAKLLEDRCKTLGINHLYQGQSDKVL
FT                   AFNDLLDKLSVTANQVAYIGDDMIDWPVMAQVGLSVAVADAHPLLLPRADYVTRIAGGR
FT                   GAVRELCDLILFSQDKLEHAKGLSI"
FT   gene            complement(326461..327552)
FT                   /locus_tag="PC1_0279"
FT   CDS_pept        complement(326461..327552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0279"
FT                   /product="KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /note="KEGG: eca:ECA0293 D-arabinose 5-phosphate isomerase;
FT                   TIGRFAM: KpsF/GutQ family protein; PFAM: sugar isomerase
FT                   (SIS); CBS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11338"
FT                   /db_xref="GOA:C6DIN8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIN8"
FT                   /inference="protein motif:TFAM:TIGR00393"
FT                   /protein_id="ACT11338.1"
FT                   /translation="MSQFEQDAHLKQQSDRALSDHATQADHAPQADHTRQKSHELPADF
FT                   DFQQAGKQVISIERDGLAQLDQYIDDNFTLACKKIFDCQGKVVVMGMGKSGHIGCKMAA
FT                   TFASTGTPAFFVHPGEASHGDLGMVTPHDIVIAISNSGESHEILSLIPVLKRQKVFLIC
FT                   MTSAPESTMGKAADIHLCVHVPQEACPLGLAPTSSTTATLVMGDALAVALLQARGFTAE
FT                   DFALSHPGGALGRKLLLRVSDIMHSGDEIPHVPHDASLRDALVEITRKNLGMTVICEAD
FT                   MKIQGIFTDGDLRRIFDMNIDLNSARIADVMTAGGIRVAPQTLAVDALNLMQSRHITSV
FT                   LVAENDRLVGIVHMHDMLRAGVV"
FT   gene            complement(327593..328558)
FT                   /locus_tag="PC1_0280"
FT   CDS_pept        complement(327593..328558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0280"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG: eca:ECA0294
FT                   putative calcium/sodium:proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11339"
FT                   /db_xref="GOA:C6DIN9"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIN9"
FT                   /inference="protein motif:TFAM:TIGR00367"
FT                   /protein_id="ACT11339.1"
FT                   /translation="MLFATLLLFVGLLLLVYGADRLVYGAAVLARSLGLPPFVIGITIV
FT                   GFGTSLPELIVSVTAALNDQNDMAVGNVIGSNIANILLILGSAALIRPLTVHSAILRRE
FT                   LPLMLSVTLLCGVLLHDSYLSRADGMMLLFAAILCLVLILRMAQQAQREGGDSLTREQL
FT                   AELPQDDSNQMVAVLWLILGMIILPMAARMVVDNATVIARYFDVSELTIGLTILAIGTS
FT                   LPELATAIVGTLKKEDDIALGNLIGSNIFNIAIVLGVPALLSPGALNPQVFQRDYWVML
FT                   AASVLLTALCLSKKRRIGQGAGALLCCAFIAYLTVLFCFS"
FT   sig_peptide     complement(328502..328558)
FT                   /locus_tag="PC1_0280"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.763 at
FT                   residue 19"
FT   gene            328860..329672
FT                   /locus_tag="PC1_0281"
FT   CDS_pept        328860..329672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0281"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: eca:ECA0295 putative ABC transporter ATP-binding
FT                   protein YrbF"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11340"
FT                   /db_xref="GOA:C6DIP0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIP0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT11340.1"
FT                   /translation="MHHEATNLVEIRGLSFRRGEREIFTDITLNVPKGKVTAIMGPSGI
FT                   GKTTLLRLIGGQLQPDSGEIWFDGENIPRLSRSELYNARKKMSMLFQSGALFTDLNVFD
FT                   NVAWPLREHTRLPESLLRSIVMMKLEAVGLRGAAELMPAELSGGMARRAALARAIALDP
FT                   QLIMFDEPFVGQDPITLGTLVKLIDELNHALGVTCIVVSHDVPEVMSIADYAYIVADKR
FT                   VVAEGTADQLRANNDPQVRQFLDGIADGPVPFRFPAGDYKTSLLGSGG"
FT   gene            329680..330462
FT                   /locus_tag="PC1_0282"
FT   CDS_pept        329680..330462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0282"
FT                   /product="protein of unknown function DUF140"
FT                   /note="PFAM: protein of unknown function DUF140; KEGG:
FT                   eca:ECA0296 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11341"
FT                   /db_xref="GOA:C6DIP1"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIP1"
FT                   /inference="protein motif:PFAM:PF02405"
FT                   /protein_id="ACT11341.1"
FT                   /translation="MLLRTLASLGRQGISTSAAFGRAGLMLFNALVGKPEFRKQWPLLV
FT                   KQLYSVGVQSLLIIMVSGLFIGMVLGLQGYIVLTTYSAEASLGMMVALSLLRELGPVVT
FT                   ALLFAGRAGSALTAEIGLMKATEQLSSMEMMAVDPLRRVVAPRFWAGLISMPLLAVIFV
FT                   AVGIWGGALVGVDWKGIDSGFFWSAMQGAVDWRQDVLNCVIKSVVFAITVTWIALFNGY
FT                   DAIPTSEGISRATTRTVVHSSLAVLGLDFVLTALMFGN"
FT   gene            330467..331033
FT                   /locus_tag="PC1_0283"
FT   CDS_pept        330467..331033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0283"
FT                   /product="Mammalian cell entry related domain protein"
FT                   /note="PFAM: Mammalian cell entry related domain protein;
FT                   KEGG: eca:ECA0297 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11342"
FT                   /db_xref="GOA:C6DIP2"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIP2"
FT                   /inference="protein motif:PFAM:PF02470"
FT                   /protein_id="ACT11342.1"
FT                   /translation="MQTKKTEVWVGVFMLIALAAILFLCLKVADLKSIGSEPTYRLYAT
FT                   FDNIGGLKARSPIRIGGVVIGRVADISLDEKTYLPRVAMDIQQRYDHIPDTSSLAIRTS
FT                   GLLGEQYLSLNIGFEDEDMGTTILKDGGVIQDTKSAMVLEDLIGQFLYKSGGNSEDNAG
FT                   QSGTEPGADPAATSEHHNEPVPSHP"
FT   gene            331046..331675
FT                   /locus_tag="PC1_0284"
FT   CDS_pept        331046..331675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0284"
FT                   /product="toluene tolerance family protein"
FT                   /note="PFAM: toluene tolerance family protein; KEGG:
FT                   eca:ECA0298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11343"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIP3"
FT                   /inference="protein motif:PFAM:PF05494"
FT                   /protein_id="ACT11343.1"
FT                   /translation="MFKRLLMVALLVVAPLANAADQTNPYRLMNEAAEKTFDRLKSEQP
FT                   KIKQSPDYLRTVVREELLPYVQVRYAGALVLGRYYKDATPAQRDAYFKAFEAYLEQAYG
FT                   QALAMYNGQTYQIAPEQPLGNADIISIRVTIIDNGGRPPVRLDFQWRKNSKTGNWQAYD
FT                   MIAEGVSMITTKQNEWATILRQKGVDGLTQQLESSAKQTITLDQKK"
FT   sig_peptide     331046..331105
FT                   /locus_tag="PC1_0284"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 20"
FT   gene            331683..331979
FT                   /locus_tag="PC1_0285"
FT   CDS_pept        331683..331979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0299 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11344"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIP4"
FT                   /inference="similar to AA sequence:KEGG:ECA0299"
FT                   /protein_id="ACT11344.1"
FT                   /translation="MNMANALNWQAQDDTLALTGDLDRETLLPFWQQRESLLMGKTVLD
FT                   VSGLNRVDSAGLALLMHVYQQPSSGREITIVGASDRLKTLIALYNLNEIIPVS"
FT   gene            332114..332368
FT                   /locus_tag="PC1_0286"
FT   CDS_pept        332114..332368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0286"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: eca:ECA0300
FT                   putative BolA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11345"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIP5"
FT                   /inference="protein motif:PFAM:PF01722"
FT                   /protein_id="ACT11345.1"
FT                   /translation="MENNEIKDVLMNALALEEAHVSGDGSHFQVIVVGGLFAGMSRVKK
FT                   QQAVYAPLMEYIADNRIHALSIKAYTPEEWQRDRKLNGF"
FT   gene            332451..333713
FT                   /locus_tag="PC1_0287"
FT   CDS_pept        332451..333713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0287"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   eca:ECA0301 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11346"
FT                   /db_xref="GOA:C6DIP6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIP6"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACT11346.1"
FT                   /translation="MDKFRVQGPTRLAGEVTISGAKNAALPILFAALLAEEPVEIQNVP
FT                   KLRDIDTTMKLLGQLGARVERNGSVHVDASNVNVFCAPYDLVKTMRASIWALGPLVARF
FT                   GQGQVSLPGGCAIGARPVDLHIYGLEQLGAQIVLEEGYVKATVDGRLKGAHIVMDKVSV
FT                   GATVTIMSAATLAEGTTIIENAAREPEIVDTANFLNTLGAKISGAGSDKITIEGVARLG
FT                   GGVYRVVPDRIETGTFLVAAAVSRGQIICRNTRPDTLDAVLAKLREAGAEIEIGEDWIS
FT                   LDMHGKRPKAVTVRTSPHPGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMHVPELIR
FT                   MGAQAEIESNTVICHGVDKLSGAQVMATDLRASASLVLAGCIAEGVTIVDRIYHIDRGY
FT                   DRIEDKLRALGANIERVKEHE"
FT   gene            complement(333821..334933)
FT                   /locus_tag="PC1_0288"
FT   CDS_pept        complement(333821..334933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0288"
FT                   /product="periplasmic serine protease DegS"
FT                   /note="KEGG: eca:ECA0302 serine endoprotease; TIGRFAM:
FT                   periplasmic serine protease DegS; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein; SMART:
FT                   PDZ/DHR/GLGF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11347"
FT                   /db_xref="GOA:C6DIP7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011783"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIP7"
FT                   /inference="protein motif:TFAM:TIGR02038"
FT                   /protein_id="ACT11347.1"
FT                   /translation="MLAKLLRSALFGALVAGIILAILPFIGSGTSFLKSSDRQTDGSPI
FT                   SYHQGVSRAAPAVVNIYNRVANQEKPSEVAIHPLGSGVIMNEKGYILTNKHVINNVQQI
FT                   QIELSDGRLYEARVIGSDSLTDLAVLQIDGVNLPVIPINADRIPHVGDVVMAIGNPYNL
FT                   GQTITQGIISATGRVSLSAYGQQRSQVGRQNLLQTDASINHGNSGGALVNTLGELVGIN
FT                   TLSFDKSSNGETPEGISFAIPVALATKVMGKLIRDGRVVRGYIGVNGVQIENIENSTLA
FT                   NNRGVQGRLSGILVQTIDPGGPADKAGIRVEDVIVSVNNKPARSIIETMEQVSEIHPGT
FT                   VIPVTIERNNDNNDTKQITLQMTIQEFPTQ"
FT   sig_peptide     complement(334832..334933)
FT                   /locus_tag="PC1_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.760 at
FT                   residue 34"
FT   gene            complement(335148..336518)
FT                   /locus_tag="PC1_0289"
FT   CDS_pept        complement(335148..336518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0289"
FT                   /product="protease Do"
FT                   /EC_number="3.4.21.108"
FT                   /note="KEGG: eca:ECA0303 exported protease; TIGRFAM:
FT                   protease Do; PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; SMART: PDZ/DHR/GLGF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11348"
FT                   /db_xref="GOA:C6DIP8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIP8"
FT                   /inference="protein motif:TFAM:TIGR02037"
FT                   /protein_id="ACT11348.1"
FT                   /translation="MKKTSLLFSALAMSIGLTLSTLPVANAALPAVVQGQQTPSLAPML
FT                   EKVLPAVVSVHVEGTQVQRQRVPEEFKFFFGPNFPTDKQSSRPFEGLGSGVIIDAAKGY
FT                   VLTNNHVINNADKIRVQLNDGREYEAKLIGRDEQTDIALLQLNDAKNLVAVKMADSDQL
FT                   RVGDFAVAVGNPFGLGQTATSGIISALGRSGLNLEGLENFIQTDASINRGNSGGALVNL
FT                   NGELIGINTAILAPGGGNIGIGFAIPSNMAQNLAQQLVEFGEVKRGLLGIKGSEMTSEM
FT                   AKAFNVDAQRGAFVSEVLPKSAAAKAGIKAGDVLTTLDGKPISSFAELRAKVGTTAPGK
FT                   TVKIGLLRDGKPQEVSVVLDNSSSASTSAETLSPSLQGASLTNGQLKDGSKGVQIDNVA
FT                   KDTPAAQVGLQKGDIIIGVNRERIENITQLRKLLEAKPSVLALNIVRGEETIYLLLR"
FT   sig_peptide     complement(336435..336518)
FT                   /locus_tag="PC1_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.929 at
FT                   residue 28"
FT   gene            complement(336794..337198)
FT                   /locus_tag="PC1_0290"
FT   CDS_pept        complement(336794..337198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0290"
FT                   /product="protein of unknown function DUF1043"
FT                   /note="PFAM: protein of unknown function DUF1043; KEGG:
FT                   eca:ECA0304 cytochrome d ubiquinol oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11349"
FT                   /db_xref="GOA:C6DIP9"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIP9"
FT                   /inference="protein motif:PFAM:PF06295"
FT                   /protein_id="ACT11349.1"
FT                   /translation="MTWEYALIGLVVGIIIGAVAMRFGNRKLRQQQVLQNELEKSKTEL
FT                   EDYRQELVGHFARSAELLDNMADDYRQLYQHMAKSSNNLLPNVPGQDNPFKYRLTESEA
FT                   DNDQAPVNMPPRDYSDGASGLLRGERPIRK"
FT   gene            337414..338565
FT                   /locus_tag="PC1_0291"
FT   CDS_pept        337414..338565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0291"
FT                   /product="AFG1-family ATPase"
FT                   /note="PFAM: AFG1-family ATPase; KEGG: eca:ECA0305 putative
FT                   ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11350"
FT                   /db_xref="GOA:C6DIQ0"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIQ0"
FT                   /inference="protein motif:PFAM:PF03969"
FT                   /protein_id="ACT11350.1"
FT                   /translation="MATPQTTRQQTTPLALYQQALSAGEYQPDEVQRQTVVRLEAIHQA
FT                   LCERAADDNAGASGRVGKWRSWLGLREKRESAPVQGLYMWGGVGRGKTWLMDMFFHSLP
FT                   AERKMRLHFHRFMLRVHEELNQFQGQENPLEKVADGFKAETDVLCFDEFFVSDITDAML
FT                   LAELLRALFARGIALVATSNIPPDDLYRNGLQRARFLPAIELIKQHCEVRNVDAGIDYR
FT                   LRTLTQAHLYLSPLNEDTEATMQQMFTRLTGKRWQTPGPVLEINHRPLATLGVSEGVLA
FT                   VDFHTLCTEARSQNDYIALSRLYHTMLLHNVTVMETKEENTARRFLALVDECYERRIKL
FT                   IISAQASMFEIYQGEHLKFEYQRCLSRLQEMQSEEYLRQPHLA"
FT   gene            338803..339231
FT                   /locus_tag="PC1_0292"
FT   CDS_pept        338803..339231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0292"
FT                   /product="ribosomal protein L13"
FT                   /note="TIGRFAM: ribosomal protein L13; PFAM: ribosomal
FT                   protein L13; KEGG: eca:ECA0306 50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11351"
FT                   /db_xref="GOA:C6DIQ1"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIQ1"
FT                   /inference="protein motif:TFAM:TIGR01066"
FT                   /protein_id="ACT11351.1"
FT                   /translation="MKTFTAKPETVKRDWYVVDANGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVLNADKVAVTGNKRNDKIYYHHTGHIGGIKQATFEEMIARRPERVIEIA
FT                   VKGMLPKGPLGRAMFRKLKVYAGTEHNHAAQQPQVLDI"
FT   gene            339247..339639
FT                   /locus_tag="PC1_0293"
FT   CDS_pept        339247..339639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0293"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: set:SEN3177 30S
FT                   ribosomal subunit protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11352"
FT                   /db_xref="GOA:C6DIQ2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIQ2"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ACT11352.1"
FT                   /translation="MAENQYYGTGRRKSSAARVFIKPGNGNIVINQRSLEQYFGRETAR
FT                   MVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRGELRKAGFV
FT                   TRDARQVERKKVGLRKARRRPQFSKR"
FT   gene            339970..340611
FT                   /locus_tag="PC1_0294"
FT   CDS_pept        339970..340611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0294"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   eca:ECA0308 stringent starvation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11353"
FT                   /db_xref="GOA:C6DIQ3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIQ3"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ACT11353.1"
FT                   /translation="MAVAANKRSVMTLFSGPSDIFSHQVRIVLAEKGVSVEIEQVDMDN
FT                   LPQDLIDLNPYGSVPTLVDRELTLYESRIIMEYLDERFPHPPLMPVYPVARGNSRLMMH
FT                   RIESDWYSLLKKITHGSAQEADAARKQLREELLAIAPVFNEAPYFMSEEFSLVDCYLAP
FT                   LLWRLPQLGIELSGSGAKELKGYMTRVFERDAFLASLTEVEREMRLQTRG"
FT   gene            340617..341120
FT                   /locus_tag="PC1_0295"
FT   CDS_pept        340617..341120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0295"
FT                   /product="Stringent starvation protein B"
FT                   /note="PFAM: Stringent starvation protein B; KEGG:
FT                   eca:ECA0309 ClpXP protease specificity-enhancing factor"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11354"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIQ4"
FT                   /inference="protein motif:PFAM:PF04386"
FT                   /protein_id="ACT11354.1"
FT                   /translation="MALSQLSPRRPYLLRAFYDWLLDNQLTPHLVVDVTLPGVMVPMEF
FT                   ARDGQIVLNIAPRAVGGLELADDSVRFNARFGGVPRQVYVPMAAVMAIYARENGAGTMF
FT                   EPEPAYEESAGEFEDFQEGAPSGTVMSIVDSSPDSEAPDGGSGSDDEPPQPPKGGRPSL
FT                   RVVK"
FT   gene            complement(341202..341975)
FT                   /locus_tag="PC1_0296"
FT   CDS_pept        complement(341202..341975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0296"
FT                   /product="acetoin reductase"
FT                   /note="TIGRFAM: acetoin reductase; PFAM: short-chain
FT                   dehydrogenase/reductase SDR; KR domain protein; KEGG:
FT                   eca:ECA0310 acetoin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11355"
FT                   /db_xref="GOA:C6DIQ5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014007"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIQ5"
FT                   /inference="protein motif:TFAM:TIGR02415"
FT                   /protein_id="ACT11355.1"
FT                   /translation="MAVEVALVTGAGQGIGRAIALRLAADGFAVAIVDYNQETAHSVAQ
FT                   EIEKAGGQAIALQADVADREAVFAAVAAAKKRFGDFNVIVNNAGVAPSTLIEDITPEVI
FT                   DRVYNINVKGVIWGIQAALDAFKSLGHGGKIINACSQAGHVGNPELAVYSSSKFAVRGL
FT                   TQTAARDLAPLGITVNGYCPGIVKTPMWDEIDRKISESAGKPRGYATEEFAKRITLGRL
FT                   SEPEDVAACVSYLASHDSDYMTGQSLLIDGGMVFN"
FT   gene            342354..342767
FT                   /locus_tag="PC1_0297"
FT   CDS_pept        342354..342767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0297"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: sse:Ssed_1053 glutathione-dependent
FT                   formaldehyde-activating, GFA"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11356"
FT                   /db_xref="GOA:C6DIQ6"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIQ6"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ACT11356.1"
FT                   /translation="MHQGRCLCGGVTISTAHSVRDVAACHCGMCQTWGGGPLMAVECTD
FT                   PAIEIEGEENITVWPSSEWAERGFCRVCGTHLFYRLRGGDAYHIPAGFFADETDKKLIS
FT                   QIYIDKKPGYYSFVEKTPTLTEQDIIALYAGKD"
FT   gene            complement(342834..344252)
FT                   /locus_tag="PC1_0298"
FT   CDS_pept        complement(342834..344252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0298"
FT                   /product="glutamate synthase, small subunit"
FT                   /note="TIGRFAM: glutamate synthase, small subunit; PFAM:
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: eca:ECA0311 glutamate synthase
FT                   subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11357"
FT                   /db_xref="GOA:C6DIQ7"
FT                   /db_xref="InterPro:IPR006006"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIQ7"
FT                   /inference="protein motif:TFAM:TIGR01318"
FT                   /protein_id="ACT11357.1"
FT                   /translation="MSQNVYQFIDLQRVDPPKKPLKIRKIEFVEIYEPFSESQSKAQAD
FT                   RCLACGNPYCEWKCPVHNYIPNWLKLANEGRIIEAAELSHQTNSLPEVCGRVCPQDRLC
FT                   EGSCTLNDEFGAVTIGNIERYINDKAIEMGWKPSVANVKPTGKRVAIIGAGPAGLACAD
FT                   VLARNGVQAVVFDRHPEIGGLLTFGIPSFKLEKEVMVKRREIFTEMGIEFRLNTEVGKD
FT                   VQMKALLDEYDAVFLGVGTYQSMRGGLDNEDAQGVYDALPFLIANTKQLMGFEAAADEP
FT                   YVSMQGKRVVVLGGGDTAMDCVRTSIRQGSTHVTCAYRRDEENMPGSKREVKNAREEGV
FT                   EFKFNLQPLSVEINGAGKVCGVKMARTALGAPDANGRRRPEIVEGSEHVLEADAVIMAF
FT                   GFRPHKMAWLAEHDVKLDDQGRIVAPESCDNAFQTSNPKIFAGGDAVRGSDLVVTAIAE
FT                   GRKAADGIMNYLEV"
FT   gene            complement(344262..348722)
FT                   /locus_tag="PC1_0299"
FT   CDS_pept        complement(344262..348722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0299"
FT                   /product="Glutamate synthase (ferredoxin)"
FT                   /EC_number="1.4.7.1"
FT                   /note="PFAM: ferredoxin-dependent glutamate synthase;
FT                   glutamate synthase alpha subunit domain protein; glutamate
FT                   synthase; glutamine amidotransferase class-II; KEGG:
FT                   eca:ECA0312 glutamate synthase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11358"
FT                   /db_xref="GOA:C6DIQ8"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIQ8"
FT                   /inference="protein motif:PRIAM:1.4.7.1"
FT                   /protein_id="ACT11358.1"
FT                   /translation="MLYDASQERDNCGFGLIAHIEGEPSHKVVRTAIHALARMQHRGAI
FT                   LADGKTGDGCGLLLQKPDRFFRLVAEEHGWRLAKNYAVGMMFLNQDEELARATRRIVEE
FT                   ELQNETLSVLGWREVPTNPDVLGEIALSSMPRIEQIFVNAPAGWRQRDMERRLFMARRR
FT                   IEKRIEDKDFYVCSFSNLVTIYKGLCMPADLPRFYLDLADLRLESSICLFHQRFSTNTV
FT                   PRWPLAQPFRYLAHNGEINTIAGNRQWARARAYKFKTPLIPDLQDAAPFVNETGSDSSS
FT                   LDNMLELFLSGGMDIIRAMRLLVPPAWQNNPDMDPELRAFFDFNSMHMEPWDGPAGIVM
FT                   SDGRYAACNLDRNGLRPARYVITKDKLITCASEVGIWDYQPDEVVEKGRVGPGELMVID
FT                   TRSGRILHSAETDNDLKSRHPYKEWMEKNVKRLVPFEELPDDQVGSREFNDDLLETYQK
FT                   QYGYSSEELDQVIRVLGENGQEATGSMGDDTPFAVLSSRPRIIYDYFRQQFAQVTNPPI
FT                   DPLREAHVMSLATSIGREMNVFCEAEGQAHRLSFKSPILLYSDFTQLTSQDELHYRADT
FT                   LDLTFDPSQQTLQQTIEKLCDEAESKVRDGAVLLVLSDRGISESRLPVPAPMAVGAVQR
FT                   RLVEKSLRCDANIIVETASARDPHHFAVLLGFGATAIYPYLAYETLARMVDNHTIDKPY
FT                   RAVMLNYRNGINKGLYKIMSKMGISTIASYRCSKLFEAVGLHKDVSTQCFLGVVSRIGG
FT                   ANYSDFEQDLLNLSKRAWLKRKTLEQGGLLKFVHGGEYHAYNPDVVTTLQTAVKSGEYS
FT                   DYEQYAKLVNERPAATLRDLLALKPQEGAAIAIDSVEPASEMFKRFDTAAMSIGALSPE
FT                   AHESLAEAMNGLGGFSNSGEGGEDPARYGTNKVSRIKQVASGRFGVTPAYLVNADVIQI
FT                   KVAQGAKPGEGGQLPGDKVTPYIARLRYSVPGVTLISPPPHHDIYSIEDLAQLIFDLKQ
FT                   VNPKAMISVKLVSEPGVGTIATGVAKAYADLITIAGYDGGTGASPLSSVKYAGCPWELG
FT                   LVETQQALVSNGLRHKIRLQVDGGLKTGLDIVKAAILGAESFGFGTGPMVALGCKYLRI
FT                   CHLNNCATGVATQDEKLRRDHYHGLPERVTNYFQFIAHETRVLMAELGVSRLVDLIGRT
FT                   DLLVELDGFSAKQNKLDLSPLLHAAQPQPGKALYCTESNLSFDKGLLNKELLAQAQPHI
FT                   DSKQGKALYFDIRNTDRSVGATLSGAIAEKHGDQGLAGDPIKAYFSGTAGQSFGVWNAG
FT                   GVELKLTGDANDYVGKGMAGGSISVRPPVGSAFRSHEASIIGNTCLYGATGGKLFAAGR
FT                   AGERFAVRNSGCITVVEGIGDNGCEYMTGGIVCVLGRTGVNFGAGMTGGFAYVLDEDGE
FT                   FRKRVNPELVEVLDVEELAIHEEHLRGLITEHVQNTGSHRGEEILANWPTWAPKFALVK
FT                   PKSSDVKALLGHRSRSAAELRVQAQ"
FT   gene            349374..350303
FT                   /locus_tag="PC1_0300"
FT   CDS_pept        349374..350303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0313 hypothetical protein; TIGRFAM:
FT                   conserved hypothetical protein; PFAM: Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11359"
FT                   /db_xref="GOA:C6DIQ9"
FT                   /db_xref="InterPro:IPR005911"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIQ9"
FT                   /inference="protein motif:TFAM:TIGR01212"
FT                   /protein_id="ACT11359.1"
FT                   /translation="MQLQKLINMFGGNLQRRYGEKIHKLTLHGGFNCPNRDGTLGRGGC
FT                   TFCNVASFADEQMQQRSIAQQLETQAGKVNRAKRYLAYFQAYTSTYAEVQVLESMYQEA
FT                   LKQAEMVGLCVGTRPDCVPDAVLDLLSRYHEQGYEVWLELGLQSACDKTLHRINRGHDF
FT                   ACYQETTRRARERGLKVCSHLIVGLPGEDAQHCLSTLEQVVETGVEGIKLHPLHIVEGS
FT                   TMAKAWRAGRLPELALDRYVETAGEMIRHTPPEVIYHRISASARRPTLLAPLWCENRWT
FT                   GMVELDRYLQTHGVQGSALGTPYRYDEV"
FT   gene            350423..352792
FT                   /locus_tag="PC1_0301"
FT   CDS_pept        350423..352792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0301"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: eca:ECA0314 aerobic respiration control sensor
FT                   protein ArcB; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; response
FT                   regulator receiver; Hpt domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; Hpt domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11360"
FT                   /db_xref="GOA:C6DIR0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR014409"
FT                   /db_xref="InterPro:IPR027460"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR040642"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIR0"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACT11360.1"
FT                   /translation="MKQIRLLAQYYVDLMVKLGLVRFSLLLASVLVLLAMVVQMAVTLL
FT                   LSGEVENIDVVRSIFFGLLITPWAVYFLSVVVEQLEESRQRLSKLVAKLEEMRHRDLEL
FT                   NEQLQENIAQLNQEIADRIKAEDARVLVMSRLKEEMSRREQAQIELEQQSALLRSFLDA
FT                   SPDLVYYRNEDKEFSGCNRAMELLVGKSQKQLIGLTPQDVYSPDIAEKVMETDEKVFRH
FT                   NVSLTYEQWLVYPDGRKACFELRKVPFYDRMGKRHGLMGFGRDITERKRYQDALENASR
FT                   EKTTFISTISHELRTPLNGIVGLSRILLDTQLDPEQQKYLKTIHVSAITLGNIFNDVIE
FT                   MDKQERRKVQLDNQPIDFTGFLVDLENLGGLLAEPKGLKLIMDQHYPLPQKVITDGTRL
FT                   RQILWNLLSNAVKFTPKGENGEKGEIVVRVWHEKGDRLSFEVEDSGMGIPADELEKIFA
FT                   MYYQVKDQHGGKPATGTGIGLAVSKRLAQNMGGDIQVSSTQGKGSCFTLTVIAPSVDEA
FT                   GSGLDDDDDLPLPALHVLLVEDIELNVVVARSVLEKLGNSVDVAMTGQDALDMFDPDEF
FT                   DLVLLDIQLPDMTGLDVARQLRARYGNRSLPPLVALTANVLKDKREYLDAGMDDVLSKP
FT                   LSVPALTAVIKQFWDTHTVWTEEPVIEEGTEMAKAEEDLLDIPMLEQYLDLVGPKLIHQ
FT                   SLEMFEQMMPGYLAILDSNMTARDQKGITEEGHKIKGAAGSVGLRHLQQVAQQIQTSSL
FT                   PAWWDNVQEWVDELKHDWRHDVQVLRDWVAKAEKES"
FT   sig_peptide     350423..350548
FT                   /locus_tag="PC1_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.935) with cleavage site probability 0.908 at
FT                   residue 42"
FT   gene            353254..353907
FT                   /locus_tag="PC1_0302"
FT   CDS_pept        353254..353907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0302"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG: eca:ECA0316
FT                   isoprenoid biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11361"
FT                   /db_xref="GOA:C6DIR1"
FT                   /db_xref="InterPro:IPR026041"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIR1"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACT11361.1"
FT                   /translation="MKRVGIVLSGCGVYDGSEIHEAVLTLLALDRAGAQAVCFAPDKPQ
FT                   LQVVNHLTGDVTGENRNVLAESARIARGKIQPLSTANAQDLDALIVPGGFGAAKNLSDF
FT                   ATQGSACQIDETLQLLTQEIYKQNKPIGFICISPALLPTILGEPVRVTIGNDIDTAEAV
FT                   EEMGGIHVVCPVDDIVVDEEHKIVTTPAYMLANSISEAAQGIDKLVARVLDLTE"
FT   gene            353904..354638
FT                   /locus_tag="PC1_0303"
FT   CDS_pept        353904..354638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0303"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /note="TIGRFAM: monofunctional biosynthetic peptidoglycan
FT                   transglycosylase; PFAM: glycosyl transferase family 51;
FT                   KEGG: eca:ECA0317 monofunctional biosynthetic peptidoglycan
FT                   transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11362"
FT                   /db_xref="GOA:C6DIR2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIR2"
FT                   /inference="protein motif:TFAM:TIGR02070"
FT                   /protein_id="ACT11362.1"
FT                   /translation="MKWSRGRGGLLAWLKRLIVRSVLVVIGAWLAGILLFSFLPVPFSA
FT                   VMVDRQISAWLKGEFSYVAHSDWVSMEEIAPEMALAVMAAEDQKFPDHWGFDLDAIGQA
FT                   LKHNERNTQRIRGASTLSQQMVKNLFLWDGRSWVRKGLEAGITTGVELVWTKRRILTVY
FT                   LNIAEFGPGIFGVEAAARRYFNKPASRLTASESALLAAVLPNPIRFRANAPSSYVIQRQ
FT                   QWILRQMRQMGGDAFLRANNLN"
FT   gene            354709..356004
FT                   /locus_tag="PC1_0304"
FT   CDS_pept        354709..356004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11363"
FT                   /db_xref="GOA:C6DIR3"
FT                   /db_xref="InterPro:IPR008397"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIR3"
FT                   /inference="similar to AA sequence:KEGG:ECA0318"
FT                   /protein_id="ACT11363.1"
FT                   /translation="MRLRYWSGLLVALCCVASVARADAEPKASSPDNPYAFLQQHQLSS
FT                   VKQQLQQKTEKPQTRMAYEQLISEADRALKIANPSVTEKKSTPPSGSKHDYLSLSAYWW
FT                   PDPDKADGLPWIRRDGQVNPASKDEETDGVRLAKFTAQTQALTLAWYFSGKQAYADKAI
FT                   SMIRTWFIDPATRMNPNLDFAQGVPGIAPGRGSGVLDGRYFSTRIVDSLLILRHAPGWT
FT                   TQDEQQMQKWMSDYLHWLQTSKLGKKEATAQNNHGSWYTVQVAGIAWYLGKIDVVKSMA
FT                   QLQREKLDHQLQPDGSQPEELARTRSFHYSYFNLQAITDMAILASRVGENIWQYQTPKG
FT                   SSVIKALDFMAPYLDENKAWPRKTMDRQSSRLIPLLLQAERGVKAPRYQTQIKQAGFAE
FT                   LLSGAASERDKEPSHISVETRRALWLLNPVAP"
FT   sig_peptide     354709..354777
FT                   /locus_tag="PC1_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.958 at
FT                   residue 23"
FT   gene            complement(356131..356703)
FT                   /locus_tag="PC1_0305"
FT   CDS_pept        complement(356131..356703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0305"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   eca:ECA0319 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11364"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIR4"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ACT11364.1"
FT                   /translation="MRISSAFAVLSIALLLQGCVGVVAVGSAVATKTATDPRTVGTQVD
FT                   DGTLEVRVTNAISKDEQLKKEARIIATAYQGKVLLTGQAPNTEMANRAKQIALGVEGAA
FT                   EVYNEIRQGTPVSMGTASMDTWITTKVRSQILASDTVKSSNVKVTTENGEVFLLGLVTQ
FT                   REGTSAAEIASKVGGVKHVTTAFTYLQ"
FT   sig_peptide     complement(356629..356703)
FT                   /locus_tag="PC1_0305"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.626 at
FT                   residue 25"
FT   gene            complement(356715..357305)
FT                   /locus_tag="PC1_0306"
FT   CDS_pept        complement(356715..357305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0306"
FT                   /product="DnaA initiator-associating protein DiaA"
FT                   /note="KEGG: eca:ECA0320 DnaA initiator-associating protein
FT                   DiaA"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11365"
FT                   /db_xref="GOA:C6DIR5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR023070"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIR5"
FT                   /inference="similar to AA sequence:KEGG:ECA0320"
FT                   /protein_id="ACT11365.1"
FT                   /translation="MLDRIKVCFTESIQTQIAAAEALPDAISRGAIAMVQSLLNGNKIL
FT                   CCGNGTSAANAQHFAASMINRFEAERPSLPAIALNADNVVLTAIANDRLHEEVYAKQVR
FT                   ALGQAGDVLLAISTRGNSRDIVKAVESAVTRDMTIVALTGYDGGELAGLLGPQDVEIRI
FT                   PSHRSARIQEMHMLTVNCLCDLIDNTLFPHQND"
FT   gene            complement(357369..357725)
FT                   /locus_tag="PC1_0307"
FT   CDS_pept        complement(357369..357725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0307"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   spe:Spro_4337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11366"
FT                   /db_xref="GOA:C6DIR6"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIR6"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ACT11366.1"
FT                   /translation="MNQRAAGAVYEQQARRYLERAGLTFTAANVTLRGGELDLIMRDRH
FT                   IWVFVEVRYRRNAHFGDAAASVTRHKQQRLLHAAAVWLAQRGASFDTVDCRFDVLAITG
FT                   DRFDWIPNAFATQG"
FT   gene            complement(357722..359740)
FT                   /locus_tag="PC1_0308"
FT   CDS_pept        complement(357722..359740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0308"
FT                   /product="LppC family lipoprotein"
FT                   /note="PFAM: LppC family lipoprotein; KEGG: eca:ECA0322
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11367"
FT                   /db_xref="GOA:C6DIR7"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIR7"
FT                   /inference="protein motif:PFAM:PF04348"
FT                   /protein_id="ACT11367.1"
FT                   /translation="MLPFHFVRTQAGRAIPVLLAALFLAGCPSQAPQSPPPEVQGKADA
FT                   SSDYYLQQMQQSSDNNKADWQLLAIRSLLQEGKAPQASQQFNALPEKLSAAQKQEQQLL
FT                   SAELSVAQNNMDAAKAALSQLDVSALSDQQKQRYYQTQIKTAQGRTSIELLRAYIAQEP
FT                   LLKGDEHQMNLDQTWLALTQMSPQESGALLINANENVLQGWVDLLNNYQNNRESPDQLQ
FT                   SAIQDWQTRYPHHPAAKKLPTQLNQVINYQPSSVSSIALLLPLNGQAQVFANAIQQGFN
FT                   AAKNGQIATAPVSAPAAPVTDTTQDGQVTPSSDGQSAQSPAPYSDQAVASTTQAPEAQP
FT                   TSAGLSNSLPVKVYDTSSQPLANILTQAQQDGASLVIGPLLKNEVDQLANSQSPLNILA
FT                   LNQPEHVENSPNICYFALSPEDEARDAAKFIHQQGKQQPLVLAPRGALGDRIVNAFAQA
FT                   WNQQSGTSPLQQRFGNTAELKQAINSGAGLSLSGQPVSVSQQQAQPGTTIGGLTIPSQV
FT                   QPTVSSSVSGNIDAVYIIATPDELALIKPMIDMRTTSRARPALYASSRSFQAGLGPDFR
FT                   LEMEGLQFSDIPLLAGANPALMQQVSSQFKNDYSLVRLYAMGMDAWTLASHFGEMRQIP
FT                   GHQIPGATGMLSSGPDCTINRQLTWQQYRQGQLVPVL"
FT   gene            359802..360689
FT                   /locus_tag="PC1_0309"
FT   CDS_pept        359802..360689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0309"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: eca:ECA0323
FT                   putative tetrapyrrole methylase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11368"
FT                   /db_xref="GOA:C6DIR8"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIR8"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACT11368.1"
FT                   /translation="MNQDQQADISASTLYIVPTPIGNLGDITQRALAVLASVDLIAAED
FT                   TRHTGLLLQHFAINARLFALHDHNEQQKADVLLAKLQSGQSIALVSDAGTPLINDPGYH
FT                   LVRRCREAGVRVVPLPGACAAITALSASGLASDRFCYEGFLPAKTKARKDTLRDLGEEP
FT                   RTLIFYESTHRLLDSLQDISEVLGAERYVVLAREITKTWESIHGAPVGELLAWVKEDEN
FT                   RRKGEMVLIVEGHQADDSALSAEALRTLMLLRAELPLKKAAALAAEIHGVKKNALYRYG
FT                   LEQEGDSGESGDDK"
FT   gene            360775..361077
FT                   /gene="rnpB"
FT                   /locus_tag="PC1_R0014"
FT   ncRNA           360775..361077
FT                   /gene="rnpB"
FT                   /locus_tag="PC1_R0014"
FT                   /product="RNA component of RNaseP"
FT                   /note="Bacterial RNase P class A as predicted by Rfam(RF000
FT                   10), score 268.28"
FT                   /ncRNA_class="RNase_P_RNA"
FT   gene            362525..363310
FT                   /locus_tag="PC1_0310"
FT   CDS_pept        362525..363310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0310"
FT                   /product="Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B"
FT                   /note="PFAM: Extradiol ring-cleavage dioxygenase class III
FT                   protein subunit B; KEGG: eca:ECA0327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11369"
FT                   /db_xref="GOA:C6DIR9"
FT                   /db_xref="InterPro:IPR004183"
FT                   /db_xref="InterPro:IPR014436"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIR9"
FT                   /inference="protein motif:PFAM:PF02900"
FT                   /protein_id="ACT11369.1"
FT                   /translation="MSNTSRMPALFLGHGSPMNVLENNVYTQAWQTLGETLPRPKAIIA
FT                   VSAHWYTRGTAVTAMENPRTIHDFGGFPQALFDTQYPAPGSPELAARIQQVLAPYPVTA
FT                   DQSQWGLDHGSWGVLIKMYPDADIPVVQLSVDGTQPAAYHYELGRKLAALRDEGFMIVA
FT                   SGNVVHNLRMVKWDGDAEPYPWAISFNQFVRDNLTYQGDDHPLVNFMQHEGAALSNPTP
FT                   DHYFPLLYVLGSWDGKEAISIPVDGLEMGSLSMLSVQVG"
FT   gene            complement(363380..364540)
FT                   /locus_tag="PC1_0311"
FT   CDS_pept        complement(363380..364540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0311"
FT                   /product="Trypanothione synthase"
FT                   /EC_number="6.3.1.9"
FT                   /note="PFAM: glutathionylspermidine synthase; KEGG:
FT                   eca:ECA0328 putative glutathionylspermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11370"
FT                   /db_xref="GOA:C6DIS0"
FT                   /db_xref="InterPro:IPR005494"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIS0"
FT                   /inference="protein motif:PRIAM:6.3.1.9"
FT                   /protein_id="ACT11370.1"
FT                   /translation="MKRIDITARPDWQEKATEFGFRFHTMYGEPYWSEEAYYQFTLAQI
FT                   EELEETTAELHQMCLQVVEKVINSDALLAKFRIPKHTWEFVRHSWRTNQPSLYSRLDLA
FT                   YDGKSPAKLLENNADTPTSLYEAAFFQWLWLEDQINAGNLPQNSDQYNSIQEKLIERFE
FT                   ELKLNHGFGLLHFACCQDTEEDRGTVQYLQDCALEAGLPSEFLYIEEIGLGEKGQFTDP
FT                   ENQVISNLFKLYPWEFMLREMFSTKLEDAGVRWLEPAWKSIISNKALLPMLWEMFPDHP
FT                   NLLPAYFAEDEHPKLDSYVTKPLFSREGANIQIIENGKEIASADGPYGEEGMIVQQYHP
FT                   LPKFGDSYTLIGSWLVNDQPCGIGVREDRALITQDLSRFYPHTILD"
FT   gene            complement(364552..365226)
FT                   /locus_tag="PC1_0312"
FT   CDS_pept        complement(364552..365226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0312"
FT                   /product="protein of unknown function DUF1190"
FT                   /note="PFAM: protein of unknown function DUF1190; KEGG:
FT                   eca:ECA0329 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11371"
FT                   /db_xref="InterPro:IPR009576"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DIS1"
FT                   /inference="protein motif:PFAM:PF06693"
FT                   /protein_id="ACT11371.1"
FT                   /translation="MKRTKNINQEMFRKEWRTHRLAPVALAVSAVFFLAGCEQTDETVS
FT                   LYQNADDCSSANPSMAAQCTTAYNNALKEAEKTAPKYATKEDCVAEFGEAQCTQTPAPA
FT                   QAGMAAESQQGGGMSWMPLMAGYMMGRMMGGGAGFAQQPLFSPKTPASPANGQFVDASG
FT                   KNYGNATTGRTMTVPKTALAPKPATTSTITRGGFGETVAKQNSMQRSSASSSSSSSRSM
FT                   GG"
FT   sig_peptide     complement(365116..365226)
FT                   /locus_tag="PC1_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.635 at
FT                   residue 37"
FT   gene            complement(365493..366884)
FT                   /locus_tag="PC1_0313"
FT   CDS_pept        complement(365493..366884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0313"
FT                   /product="type I secretion outer membrane protein, TolC
FT                   family"
FT                   /note="TIGRFAM: type I secretion outer membrane protein,
FT                   TolC family; PFAM: outer membrane efflux protein; KEGG:
FT                   eca:ECA0330 outer membrane channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11372"
FT                   /db_xref="GOA:C6DIS2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIS2"
FT                   /inference="protein motif:TFAM:TIGR01844"
FT                   /protein_id="ACT11372.1"
FT                   /translation="MKKLLPLLIGLSLGGFSAMSQAENLLQVYQQAKSTNPDLRSSAAT
FT                   RDAAFEKINESRSPLLPQLGINAGYTYNKGYRDSNGVNNNEKSATLQLTQTLFDMSKWR
FT                   ALTLQEKQAGIEDVTYQTAQQNLMLNTATAYFNVLRAIDSLSYINAQKQAIYRQLDQTT
FT                   QRFNVGLVAITDVQNARAQYDSVLANEVLTRNTLDNALESLRQITGNFYPQLAGLNIER
FT                   FSTQKPEAVNNLLKEAENRNLNLLSARLSQDLAREQIRSAETGYMPTLDLTASTGVSDT
FT                   RYSGSRTNSGNFNDTDAGQHRVGINFTLPLYSGGATNSQVKQAQHSYVSASELLESAHR
FT                   SVIQTVRSSFNNISASISSINAYKQAEVSAQSSLDAMEAGYQVGTRTIVDVLDATTTLY
FT                   NAKQQLSSARYDYLINQLNIKSAQGTLNEADLQALNAALGQPVSTTPTVTDNSAPLATT
FT                   ASAQR"
FT   sig_peptide     complement(366816..366884)
FT                   /locus_tag="PC1_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.928 at
FT                   residue 23"
FT   gene            complement(367019..367174)
FT                   /locus_tag="PC1_0314"
FT   CDS_pept        complement(367019..367174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11373"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIS3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11373.1"
FT                   /translation="MADSAVIILIIVFERLLGVTSAKGISVHRITFRYLTEQQNVALDH
FT                   PTGQFT"
FT   gene            367217..367849
FT                   /locus_tag="PC1_0315"
FT   CDS_pept        367217..367849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0315"
FT                   /product="ADP-ribose diphosphatase"
FT                   /EC_number="3.6.1.13"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: eca:ECA0331 ADP-ribose
FT                   pyrophosphatase NudF"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11374"
FT                   /db_xref="GOA:C6DIS4"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR004385"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIS4"
FT                   /inference="protein motif:PRIAM:3.6.1.13"
FT                   /protein_id="ACT11374.1"
FT                   /translation="MASSVSGPVTFTKDDVEIIARETLYDGFFSLELYRFRHRLFNGGM
FT                   SGEVSREILERGHAVVLLPYDPVRDEVVLIEQIRIAAYDTSASPWLFELVAGMIEPGES
FT                   HEEVARREAQEEAGLRVGRCRPIINYLASPGGTSERLAVMVGEVDTRTAKGIHGLSEEN
FT                   EDIRVHVVSREQSYQWVEEGIVDNAASVIALQWLTLHHEELKRAWVD"
FT   gene            367853..368284
FT                   /locus_tag="PC1_0316"
FT   CDS_pept        367853..368284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0316"
FT                   /product="protein of unknown function DUF1249"
FT                   /note="PFAM: protein of unknown function DUF1249; KEGG:
FT                   eca:ECA0332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11375"
FT                   /db_xref="InterPro:IPR009659"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIS5"
FT                   /inference="protein motif:PFAM:PF06853"
FT                   /protein_id="ACT11375.1"
FT                   /translation="MKRYTPDFPAMMRLCETNFMQLRRLLPKIDEVGEIAVYHVNNAIY
FT                   QLTILESTRYTSLVEIKQTAPAVSYWSLPMMSVRLYHDALVAEVCASQQIFRFKARYDY
FT                   PNKKLHQRDEKHQINQFLADWLKYCLAYGSMSIPVFDTQ"
FT   gene            368392..369219
FT                   /locus_tag="PC1_0317"
FT   CDS_pept        368392..369219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0317"
FT                   /product="Calcineurin phosphoesterase domain protein"
FT                   /note="PFAM: Calcineurin phosphoesterase domain protein;
FT                   metallophosphoesterase; KEGG: eca:ECA0333 cyclic
FT                   3',5'-adenosine monophosphate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11376"
FT                   /db_xref="GOA:C6DIS6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIS6"
FT                   /inference="protein motif:PFAM:PF08413"
FT                   /protein_id="ACT11376.1"
FT                   /translation="MESLLTLPVASGARVRILQITDTHLFAGEHETLLGINTYRSYHAV
FT                   LNAIKARQDAFDLIVATGDLAQDHTLEAYHHFSRGIAQIPAPCVWLPGNHDFQPAMVDA
FT                   LAEAGIAPSKHVLLGDKWQIILLDSQVFGVPHGELSEYQLEWLERSLKSQPDRFTLLLL
FT                   HHHPHPSGCTWLDQHSLRNAHSLSAVLDRYPQVNTVLCGHIHQEMDFDWHGRRLLATPS
FT                   TCVQFKPHCTNFTIDDVAPGWRYLDLFPDGRLETEVYRLSGSEFLPDMDSDGY"
FT   gene            369219..369800
FT                   /locus_tag="PC1_0318"
FT   CDS_pept        369219..369800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0318"
FT                   /product="protein of unknown function UPF0227"
FT                   /note="PFAM: protein of unknown function UPF0227; KEGG:
FT                   eca:ECA0334 esterase YqiA"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11377"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIS7"
FT                   /inference="protein motif:PFAM:PF05728"
FT                   /protein_id="ACT11377.1"
FT                   /translation="MPTLLYLHGFNSTPQSAKATALKTWLAEQHPEIDMIIPQLPPYPA
FT                   EAAEMMESLIMERAGRPVGIVGSSLGGYYATWLSQCFMLPAVVVNPAVRPFELLLDHLG
FT                   EYQNPYTGEQYVLESRHVYDLKVMQVDRLESPDLLWLLLQTGDEVLDYRQAVAYYTACR
FT                   QTVESGGNHAFVGFEHFFTPIVNFLGLTTD"
FT   gene            369893..371788
FT                   /locus_tag="PC1_0319"
FT   CDS_pept        369893..371788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0319"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: eca:ECA0335 DNA topoisomerase IV subunit B;
FT                   TIGRFAM: DNA topoisomerase IV, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   DNA gyrase subunit B domain protein; ATP-binding region
FT                   ATPase domain protein; SMART: DNA topoisomerase II;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11378"
FT                   /db_xref="GOA:C6DIS8"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIS8"
FT                   /inference="protein motif:TFAM:TIGR01055"
FT                   /protein_id="ACT11378.1"
FT                   /translation="MAQSSYNADAIEVLSGLEPVRRRPGMYTDTTRPNHLGQEVIDNSV
FT                   DEALAGHARRIDVILHADQSLEVIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSGK
FT                   NYQFSGGLHGVGISVVNALSTRVEVTVKRDGQVYDIAFANGDKVQDLTVTGTCGRRNTG
FT                   TRVHFWPDEKFFDSARFSVSRLTHLLKAKAVLCPGVEIIFKDKVNNTEQRWCYQDGLND
FT                   YLCEAVNGLITLPEKPFLGSITGDTEAVDWALLWLPEGGELLMESYVNLIPTPMGGTHV
FT                   NGLRQGLLDAMREFCEFRNILPRGVKLSADDIWERCAYVLSVKMQEPQFAGQTKERLSS
FT                   RQCAAFVSGVVKDAFSLWLNQNVQAAEQLAELAISSAQRRMRAAKKVVRKKLTSGPALP
FT                   GKLADCTSQDLSRTELFLVEGDSAGGSAKQAREREFQAIMPLKGKILNTWEVSSDEVLA
FT                   SQEVHDISVAIGIDPDSDDLSQLRYGKICILADADSDGLHIATLLCALFVRHFRALVQG
FT                   GHVYVAMPPLYRIDLGKEVYYALDEEEKAGVLEQLKRKKGKPNVQRFKGLGEMNPLQLR
FT                   ETTLDPNTRRLVQLTIKEDDIDQTMAMMDMLLAKKRSEDRRNWLQEKGDKAEIEV"
FT   gene            371982..372995
FT                   /locus_tag="PC1_0320"
FT   CDS_pept        371982..372995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0320"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: eum:ECUMN_1766
FT                   putative aryl-alcohol dehydrogenase (NADP(+))"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11379"
FT                   /db_xref="GOA:C6DIS9"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIS9"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACT11379.1"
FT                   /translation="MQYTKLGNSDLTVSRICMGCMGFGDASTGQHSWTLGEAESREIIR
FT                   YGLENGINFYDTAIAYQRGSSERYVGKALRDMAKRDDVVVATKFLPRTQQQISDGLSGQ
FT                   HAIAQSLDQSLHNLGMDYIDLYICHIWDYNTPILDVLDALHRAVKAGKVRAIGISNCHA
FT                   WQLAKANAIAERENLTPFVSVQSHYNLIMREDERELFGLCAEDNIALTPYSALASGRLS
FT                   RLEGVESLRLKEDTYAKGKYDTTAEQDRIIIDRVAELAARHRASMTEISLAWLLTKVTA
FT                   PVVGATKKHHIDGAVKAVNLTLSDDEIRYLEESYQPHRLVGVMAQNAPQTQAKKQA"
FT   gene            373173..374069
FT                   /locus_tag="PC1_0321"
FT   CDS_pept        373173..374069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0321"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: eca:ECA0336 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11380"
FT                   /db_xref="GOA:C6DIT0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIT0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACT11380.1"
FT                   /translation="MKVTLEELQAFVVVIDTGSITAAAEQLGQTTSGISRALRRLEDKL
FT                   GTTLLHRTTRRLSLSEEGTMFLEHARGVLHAVEHAEEQVLLRHEQPSGRLRVNSASAFM
FT                   QHVIVPLVPEFRRRYPKIILELNTDDFVIDLLEQHTDIAIRIGTLKDSTIHARPLGASK
FT                   LHIVASPEYLQQHGTPRTVESLADHICLGFTQVESLNHWPLRHGLQNFYPITPALLASN
FT                   GEILRQLALRGEGIVRMSTFLIRDDLAAGRLVPILTEETVEASLPVYAVYYRNSQLAAR
FT                   ITCFLDFMSETLTENPL"
FT   gene            complement(374110..374691)
FT                   /locus_tag="PC1_0322"
FT   CDS_pept        complement(374110..374691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0322"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone); KEGG:
FT                   eca:ECA0337 putative modulator of drug activity B"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11381"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIT1"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ACT11381.1"
FT                   /translation="MQNILLIDAGKSFAHSKGELNHTLTEVAASFLRDKGHDVRVTVVD
FT                   SGYDIEQEIQNYLWADTIIYQMPGWWMDTPWILKKYIDDVFTAGHGSLYASDGRSRSDA
FT                   SKKYGSGGLLQGRKYMLSLTWNAPLEAFDDPEQFFHGVGVDGVYLPFHKANQFIGLSPL
FT                   PTFICNDVIKAPDVPAYLVNYRQHLDELFA"
FT   gene            complement(374894..375757)
FT                   /locus_tag="PC1_0323"
FT   CDS_pept        complement(374894..375757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0323"
FT                   /product="ketose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.40"
FT                   /note="KEGG: eca:ECA0338 hypothetical protein; TIGRFAM:
FT                   ketose-bisphosphate aldolase; PFAM: ketose-bisphosphate
FT                   aldolase class-II"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11382"
FT                   /db_xref="GOA:C6DIT2"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIT2"
FT                   /inference="protein motif:TFAM:TIGR00167"
FT                   /protein_id="ACT11382.1"
FT                   /translation="MLISMTDILKPTREHRFAIGAFNVADSCFIRAVVEEAEATNTPAI
FT                   ISIHPSELEFVTDEFFAYVRERTLRSPVPFVIHLDHGASIAHVLRAIQCGFTSVMIDGS
FT                   LLPYEENVALTREVVKLAHAVGVSVEGELGTIGDTGTTIEGGVSKVIYTDPEQAEDFVN
FT                   RTGVDTLAVAIGTAHGIYPKDLKPELQMHILRDISQRVSIPLVLHGGSANPDAEIAEAV
FT                   TLGVGKINISSDMKFAYFQKAREILSRETWWDPNAIYPEPIKAAKEVIRYKMALFGSTG
FT                   KASLYR"
FT   gene            complement(375847..376698)
FT                   /locus_tag="PC1_0324"
FT   CDS_pept        complement(375847..376698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0324"
FT                   /product="Tagatose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.40"
FT                   /note="PFAM: ketose-bisphosphate aldolase class-II; KEGG:
FT                   eca:ECA0339 sugar-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11383"
FT                   /db_xref="GOA:C6DIT3"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIT3"
FT                   /inference="protein motif:PRIAM:4.1.2.40"
FT                   /protein_id="ACT11383.1"
FT                   /translation="MYAAMKALIDDAYQQQYAVLAINCFNLETARAAIAAAEQQRAPLI
FT                   LNVYQGHSAHFPPHLAVPLAKALAEQATVPVALSLDHGTAFSLIGQAFRAGFTGLMIDA
FT                   SSHPLAENILRTQQVVTIAATAGVCVEGELGHIADAPVYDQEDAAVKMTQVEDVVPFIR
FT                   QTGIDLLAVSVGTAHGMYPPGVTPRIDFERLEALHRESTVPLALHGGSGTKADDIRRVS
FT                   RHGVAKINVGAAVFEAGKTALQQALHQHPTTELSDLLATMESACRDVVVDYLGWSGSAN
FT                   KA"
FT   gene            complement(376710..377801)
FT                   /locus_tag="PC1_0325"
FT   CDS_pept        complement(376710..377801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0325"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="TIGRFAM: PTS system, fructose subfamily, IIC
FT                   subunit; PFAM: phosphotransferase system EIIC; KEGG:
FT                   eca:ECA0340 PTS system, IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11384"
FT                   /db_xref="GOA:C6DIT4"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIT4"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ACT11384.1"
FT                   /translation="MNTRKITVGQEIKRHLLTGISWMIPLIVAAGICIALGQVIGGPDV
FT                   GKQTGSIAWMLNQIGGWGMGLIVPLISAAIAYSIADRPGFAPGLIVGFICGQIQTGFIG
FT                   GILGGFLVGYTVLLLRRYIKLPTSMQGLMPVMILPLLSTIIAGLLMMTFIGQPIVWLQK
FT                   SLIHLLESMQGGSKFLMGAILGAMATFDFGGPVNKTMSLFADGMLVDGIYGPEAVKFVG
FT                   SMIPPFGITLSFLLTRYKYTRAEKEALKAAFPMGICMITEGVIPIAARDLFRVVASCVV
FT                   ASAIAGGLIMVWGVEAPVPHGGMFVVPLFTKPLMFCLALGIGTAICGVMLSLIKKRVTQ
FT                   ADEEFDDVDDSSVRDEDIKFTLE"
FT   gene            complement(377827..378141)
FT                   /locus_tag="PC1_0326"
FT   CDS_pept        complement(377827..378141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0326"
FT                   /product="PTS system, fructose-specific, IIB subunnit"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   subunnit; PFAM: phosphotransferase system PTS
FT                   fructose-specific IIB subunit; KEGG: eca:ECA0341 PTS
FT                   system, IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11385"
FT                   /db_xref="GOA:C6DIT5"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIT5"
FT                   /inference="protein motif:TFAM:TIGR00829"
FT                   /protein_id="ACT11385.1"
FT                   /translation="MNIVCVAACTAGIAHTYIAREKLIKGANALNYAIKVETQGTIGTE
FT                   NELTPDEIAAADVVILAIDIKITGEERFKGKPIVRVKTEVVIKSPIKFLEKVASSLAGA
FT                   "
FT   gene            complement(378155..378634)
FT                   /locus_tag="PC1_0327"
FT   CDS_pept        complement(378155..378634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0327"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="TIGRFAM: PTS system, fructose subfamily, IIA
FT                   subunit; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: eca:ECA0342 PTS
FT                   system, EIIA component"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11386"
FT                   /db_xref="GOA:C6DIT6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIT6"
FT                   /inference="protein motif:TFAM:TIGR00848"
FT                   /protein_id="ACT11386.1"
FT                   /translation="MDINKILNVNRVKLTMSATNKDEAINELTDLLYADGAITNKQDFI
FT                   HDVWLREAEGSTGFENHIAIPHGKSSAVKQTTLAIGRTRHDIPWETLDGSQVRCIILFA
FT                   VRLEDQNTTHIRLLSQVASALADDEVIAQLLDESDPHKIIRLFSQYAETAPVTPT"
FT   gene            complement(378682..380232)
FT                   /locus_tag="PC1_0328"
FT   CDS_pept        complement(378682..380232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0328"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /note="PFAM: PRD domain protein; Helix-turn-helix type 11
FT                   domain protein; M trans-acting positive regulator;
FT                   regulatory protein DeoR; KEGG: eca:ECA0343 PTS system
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11387"
FT                   /db_xref="GOA:C6DIT7"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIT7"
FT                   /inference="protein motif:PFAM:PF00874"
FT                   /protein_id="ACT11387.1"
FT                   /translation="MMQPLTSRQNRLLKYLLQHQGYVTVKDIAHYLDVSEKTVYRDMQF
FT                   VEAFLSVWNIYPDKKVGAGIMLTTDDDRHLTLLEQQIVVDDGETDALINNARRVKIASQ
FT                   LLSDTPHETSISKLSERYFISSASIVNDLKIIESWLHPLGLALVRSQSGTHIEGSENQV
FT                   RHAMASLINDVMHHKEPGPLNHSRLDPGSYKALINYFGEEDVSFVESLLQDMERQLSYP
FT                   LGEPYYINIFTHTLIMMHRIAQGKALMMAEESVHQQVDNRIFSIAQNMVSQIEQRVEST
FT                   LPSDEVWFIYQYIISSGIVMEERADNQLLRYQFSNGESRRITHALTQIFSDLINIDLRT
FT                   DKLLHEGLLIHIKPLLNRLKYQIHIRNPLLDDIKSEFIDIYDMTQQAMDEVCQRFQLKP
FT                   VAEDEIGYLTIHFQAALERQIAHKRILVVCSSGVGTSHLLKNRILRAFPDWIIVGVVSA
FT                   SNMQRFCQQEEIELIISTIHLEEQHIPVVYVSAFFNDDDIKRVTEKVIANQLHQAVPH"
FT   gene            complement(380668..383070)
FT                   /locus_tag="PC1_0329"
FT   CDS_pept        complement(380668..383070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0329"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: kpe:KPK_1035 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11388"
FT                   /db_xref="GOA:C6DIT8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIT8"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACT11388.1"
FT                   /translation="MLINKNLNKILLTGILTGVALNSMAADSTTGNNALNGKSQDNSAA
FT                   KAEQTDDVMTVKSPKIEKKAGSSTTLTAADMQKEGGNNFGTIMRYQPLVSATGASGGSN
FT                   TGKSGFDRGGYTGYNIRGIESNRVAIDTDGIALPNATGRSYASRAGFNTFGMGRDYIDP
FT                   YVYSSVDIESGVTSAENTINALGGSVSFRPKSADDYLKAGKQDYFGLQSDFDSANHGWH
FT                   NGITAAGGDDELRGVVVLSRRDGQQTRNNSDEIAAYPANWHSNAILASGIWQANDEHQL
FT                   TGTLDYYHKTNHTHYDYWGNLPSGNNTIYGTAQQSSETRRWTASLKDRWTPVNNTLVDL
FT                   VDSRIYFQNSESHDNTWLPATTGMAAADSHRVYSDYNVTTYGFDTHMVKSWDRHEFSWG
FT                   LNASQSKTERPFRQSPNQTGANNIMQPEADSNSYTVGGFVQDTVTWDLAGHAFSVVPAV
FT                   RAIHQRTKPTNTVRLSGDGSVISESDVNRLYGKANSDTQVLPALSFLYDITPTLTTYLQ
FT                   YRRGAQFPDASQLYGSTNLDANYAGPFQYAFIGNSDLKTETSNNVEWGLKGEATEGITF
FT                   RTALFYNTYKNFIANTRYRRSANPDKFTNVPSNISTIYQAENRDKAYIYGGEVSSKIQL
FT                   GTWFPAVDGLSTTLAFGYTKGQSQSRYLGDRYVDLDSVAPMKAVIGIAYDDPSQRYGAA
FT                   VTSTFQKGKQAKDTSRESYTNAGSAITTSSTEYMRIPGYGMVDLTAYYRVTKNVKINGG
FT                   VYNLTDRKYWDYLSSRQIETNDRQGQYDRALSVQPGRTFQLGVNVDF"
FT   sig_peptide     complement(382993..383070)
FT                   /locus_tag="PC1_0329"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            383321..383656
FT                   /locus_tag="PC1_0330"
FT   CDS_pept        383321..383656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11389"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIT9"
FT                   /inference="similar to AA sequence:KEGG:ECA0344"
FT                   /protein_id="ACT11389.1"
FT                   /translation="MKLPTYETDHYELDDGEALNREYPDSFWIPDKEVRESLVPDDFVK
FT                   LIFRMEKTAGADELSVERMWVRVTTKYRALYQGVLDNTPTGSDCVRCGQIVTFHACHVI
FT                   GIYEKDE"
FT   gene            383757..384260
FT                   /locus_tag="PC1_0331"
FT   CDS_pept        383757..384260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bch:Bcen2424_3695 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11390"
FT                   /db_xref="InterPro:IPR025850"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIU0"
FT                   /inference="similar to AA sequence:KEGG:Bcen2424_3695"
FT                   /protein_id="ACT11390.1"
FT                   /translation="MSIEIPESVLPLFQAAGWPCATTQSVPPFVPENHPAFIILHTFGG
FT                   LTVGQCGAGEACASGDIIFGSSEDLQEDETLLEWQGILNTTLILIGETHHSHGALLMDS
FT                   AGICYGMSFIHEAFWFEGADFGTAVERILLGRKGKPMLRPDQSSISVYGETITADHPNV
FT                   YRYR"
FT   gene            384435..386705
FT                   /locus_tag="PC1_0332"
FT   CDS_pept        384435..386705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0332"
FT                   /product="DNA topoisomerase IV, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: eca:ECA0345 DNA topoisomerase IV subunit A;
FT                   TIGRFAM: DNA topoisomerase IV, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller; SMART: DNA gyrase/topoisomerase IV subunit
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11391"
FT                   /db_xref="GOA:C6DIU1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIU1"
FT                   /inference="protein motif:TFAM:TIGR01062"
FT                   /protein_id="ACT11391.1"
FT                   /translation="MSEMTHDGAESLALRTFTENAYLNYSMYVIMDRALPFIGDGLKPV
FT                   QRRIVYAMSELGLNASAKFKKSARTVGDVLGKYHPHGDSACYEAMVLMAQPFSYRYPLV
FT                   DGQGNWGAPDDPKSFAAMRYTESRLSKYAEILLSELGQGTVDYTPNFDGTMQEPKMLPA
FT                   RLPNILLNGTTGIAVGMATDIPPHNVREVAAAAVMLLENPKASLDDLLQHVQGPDFPTE
FT                   AEIITPRDEVRKLYQNGRGSVRMRAVWKKEDGDVVITALPHQVSGAKVLEQIASQMRAK
FT                   KLPMVEDLRDESDHENPTRLVLVPRSNRIDMDQVMNHLFATTDLEKSYRVNMNMIGLDG
FT                   RPSVKGLVEILSEWLVFRRDTVCRRLNYRLEKVLKRLHILEGLLIAFLNIDEVIHIIRT
FT                   EDEPKPVLMRQFSLSETQAEAILELKLRHLAKLEEMKIRGEQDDLAKERDQLQALLASD
FT                   RKLSNLIKKEIQADAQTYGDDRRSPLYERSEAKAMSEHDFVPSEPVTIVLSEMGWVRSA
FT                   KGHDIDPAGLSYKAGDSFRAAAKGKSNQPVVFIDSTGRSYALDPITLPSARGQGEPLTG
FT                   KLTPPPGATIEQVLMAADDQPLLMASDAGYGFVCTFNDLVARNRAGKAIITLPDNAKAL
FT                   APMEIHGDDNLLMAITAAGRMLLFPVSDLPQLSKGKGNKIVSISSADFAEGKDRLTWLY
FT                   LLPPQASVTLYFGKRKLVLRPNELQKYQGERGRKGTLLRGLQRIDRIEVDAPQQISTGS
FT                   SEE"
FT   gene            386857..387594
FT                   /locus_tag="PC1_0333"
FT   CDS_pept        386857..387594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0333"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /note="KEGG: eca:ECA0346 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; TIGRFAM: 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11392"
FT                   /db_xref="GOA:C6DIU2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIU2"
FT                   /inference="protein motif:TFAM:TIGR00530"
FT                   /protein_id="ACT11392.1"
FT                   /translation="MLSILRFLVVVIFSILVCIFGLFYCLFSPRNPRHVATFGHLFGRL
FT                   STVFGLKVEMRIPEEAAHYGNCIYIANHQNNYDMVTVSKAVQPRTVTVGKKSLLWIPFF
FT                   GPLYWLTGNLLIDRENRAKAHGTIAQVVKHIKERNTSIWMFPEGTRSRGRGLLPFKTGA
FT                   FHAAISAEVPIVPICVSTTSNKVKLNRWNNGLVIVEMLPPIDTRAYTKDQVRELATHCH
FT                   DVMAAKIAELDAEVAAREAADKK"
FT   gene            387696..389111
FT                   /locus_tag="PC1_0334"
FT   CDS_pept        387696..389111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0334"
FT                   /product="multicopper oxidase type 3"
FT                   /note="PFAM: multicopper oxidase type 3; multicopper
FT                   oxidase type 2; KEGG: eca:ECA0347 repressor protein for
FT                   FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11393"
FT                   /db_xref="GOA:C6DIU3"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR026589"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIU3"
FT                   /inference="protein motif:PFAM:PF07732"
FT                   /protein_id="ACT11393.1"
FT                   /translation="MSLSRRQFIQASGLALCAGMTPLAAKASGNSAALPIPPLLESRRG
FT                   QPLFLTMQRAHWAFSGDRKTAIWGINGRYLGPTVRVYDGDDVKLIYSNRLNEPVAMTIG
FT                   GLQVPGPLMGGAARIISPGTDWSPVVPIRQPSATCWYHANTPNRMAPHIYNGLAGLWLV
FT                   EDRASKALPLPNHYGVDDFPLIIQDKRLDNFGVPIYSPPSNGGFVGDSLLVNGIQNPFV
FT                   EVSRGWVRLRLLNASNSRRYVMRLSDGRAMHVIASDQGLLPAPMAVNQLSLAPGERREI
FT                   LIDMSQGEDVTLTAGESAGIMDRLRGLFEPSSILISTQILTLKPTGLLPLVTDNLPMRL
FT                   LADNIIEGSISRTREFRLGDSLPGINGAMWDMTRADVQTQLGRCERWIIHADTPQAFHI
FT                   QGVKFLVRSANGGPPAVEDSGWKDTVWVDNDVELLVYFMQPSSMAFPFLYYSQTLELAD
FT                   RGSTGQLIVQSAM"
FT   sig_peptide     387696..387779
FT                   /locus_tag="PC1_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.638 at
FT                   residue 28"
FT   gene            389479..390216
FT                   /locus_tag="PC1_0335"
FT   CDS_pept        389479..390216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0335"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: UbiC transcription regulator-associated domain
FT                   protein; regulatory protein Crp; regulatory protein GntR
FT                   HTH; SMART: regulatory protein GntR HTH; KEGG: eca:ECA0348
FT                   GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11394"
FT                   /db_xref="GOA:C6DIU4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIU4"
FT                   /inference="protein motif:PFAM:PF07702"
FT                   /protein_id="ACT11394.1"
FT                   /translation="MRELLLWVRDQLAGASSAPRYMQLASLLESEIGRRKALAGQFLPA
FT                   ERLIAQQLGLSRVTVSRSLSLLEEKGLIVRQQGVGTRVTQRLNYALSAEDEGFTALVLK
FT                   QGGIAGSLWLDKVIQVPPAAIAAKMSLPEGEVVTYLRRVRLSNGEPVSLETTWIPQKFL
FT                   PDPEALEQSLYQYWVSRGIAPDKKRYRFKAIACAAEIAARLGTAVGTPLLYCQLHVYNE
FT                   QGELLEYSEAHCRSDVYEIQFAD"
FT   gene            complement(390259..391086)
FT                   /locus_tag="PC1_0336"
FT   CDS_pept        complement(390259..391086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0336"
FT                   /product="2,5-didehydrogluconate reductase"
FT                   /EC_number="1.1.1.274"
FT                   /note="PFAM: aldo/keto reductase; KEGG: eca:ECA0349
FT                   2,5-diketo-D-gluconate reductase A"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11395"
FT                   /db_xref="GOA:C6DIU5"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIU5"
FT                   /inference="protein motif:PRIAM:1.1.1.274"
FT                   /protein_id="ACT11395.1"
FT                   /translation="MTQPKVKLADGNIMPQLGLGVWRASSEDTVIAVTEALSIGYRAID
FT                   TAAIYKNEEAVGQALSSANLPREEVFITTKLWNGDHTDPQKALEESLRKLRLDYIDLYL
FT                   IHWPLPQQNTFVDAWRGLIKLQEQGLAKSIGVSNFHIHHLQRLKEETGVLPVIDQVELH
FT                   PLLQQRQLHAWNATHHIQTESWSPLAQGGEGIFDHPVIRKLATKYGKTPAQIVIRWHLD
FT                   SGLVVIPKSVTPSRIKENFEVFDFRLDKDELGEIAKLDSGKRLGSDPDEPRND"
FT   gene            complement(391361..392524)
FT                   /locus_tag="PC1_0337"
FT   CDS_pept        complement(391361..392524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0337"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   eca:ECA0350 putative iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11396"
FT                   /db_xref="GOA:C6DIU6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIU6"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACT11396.1"
FT                   /translation="MLNFTLHTPTKILFGEGQIAELGKEIPADARILITYGGGSVKHNG
FT                   VLDQVYRALEGRNVREFSGIEPNPTYETLMKAVEVVRAEKIDFLLAVGGGSVVDGTKFI
FT                   AAAADYQAAQDPWHILQTGGAEIDRGVAMAAVLTLPATGSESNNGAVITRKSTNDKLAF
FT                   RSRYTQPLFAVLDPVVTYTLPARQIANGVVDAFVHTVEQYLTYSVDAKVQDRFAEGLLL
FT                   TLVEEGPRALAEPENYKVRANVMWSATMALNGLIGAGVPQDWSTHMLGHELTALHGLDH
FT                   AQTLAVVLPAMLAARKAQKRDKLLQYAERVWNLRDGSEDQRIDGAIAATRDFFEKMGVP
FT                   TRMSDYQLDGSSIPTLVAKLNEHGLTALGEHRDITLEESQKIYEAAR"
FT   gene            complement(392528..393268)
FT                   /locus_tag="PC1_0338"
FT   CDS_pept        complement(392528..393268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0338"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: eca:ECA0351
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11397"
FT                   /db_xref="GOA:C6DIU7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIU7"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACT11397.1"
FT                   /translation="MNKTIELFTSHRSERSYLDKAIPDDVLDAIIQSAHLAPTSVNSQQ
FT                   VSLIVTRDPERKARIAELAGGQPWIAKAPVFITVVLDMHKTQVGIAMSGKQQHAHESLE
FT                   SLIAGTTDVGIALGTLMAAARSFGLGIVPIGGIRREPQAMIDFLELPELTFPVAGVAIG
FT                   YVDTPAHQKPRLPLNSFRHDETYHQDVLPAAIEQYNQTLVTHWQQTGRADGDNWGDNTA
FT                   SYYQHIYFPKVLPAILQQGFKLDK"
FT   gene            393500..394489
FT                   /locus_tag="PC1_0339"
FT   CDS_pept        393500..394489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0339"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AraC-type transcriptional regulator domain
FT                   protein; helix-turn-helix- domain containing protein AraC
FT                   type; SMART: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: eca:ECA0352 AraC family transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11398"
FT                   /db_xref="GOA:C6DIU8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009594"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIU8"
FT                   /inference="protein motif:PFAM:PF06719"
FT                   /protein_id="ACT11398.1"
FT                   /translation="MLTEGQCEGLVQNPADQKPIVQELTESQQTVRQRIVRQAIRCSTK
FT                   NWATPSLVPQVKILYTEQHHPRVPVMYEPTIVIIFQGQKIGYVGGKTFQYDPENYLLMT
FT                   VPLPFECETIASAEHPLVGMAIRIDIQMLQDLLIDIGDDDSAVRPCSCTCGVNSAPLTD
FT                   EILCAVERLLDAMDNPRDARVLGPTIVREIIYHMLCGERGAALQALVNRHTHFSQIAKS
FT                   LRRIENHYADNLNVEQLAAEVNMSISAFHHNFKAVTNTSPLQYLKSYRLHKARVMMINE
FT                   GLRAGVAAARVGYESVSQFSREFKRYFGATPSDEAARLKASNMVVEES"
FT   gene            complement(394519..395178)
FT                   /locus_tag="PC1_0340"
FT   CDS_pept        complement(394519..395178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0340"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   eca:ECA0353 DedA family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11399"
FT                   /db_xref="GOA:C6DIU9"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIU9"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ACT11399.1"
FT                   /translation="MSVVHDIIQALWQQDFSALADPHVIWVVYGILFTTLFLENGLLPA
FT                   SFLPGDSLLLLTGAMIAKGVMSFFPTMILLTIAASLGCWLSYLQGRWLSDTRLVKGWLL
FT                   QLPAHYHQRAHHLFHRHGLMALLVGRFLAFIRTLLPTMAGISGLNNTRFQIFNWLSGLL
FT                   WVGGIVTLGYALSHIPLVKRYEDQVMTALILLPIILLISGLIGMAVVVWRKKRAVA"
FT   gene            complement(395500..396690)
FT                   /locus_tag="PC1_0341"
FT   CDS_pept        complement(395500..396690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0341"
FT                   /product="cystathionine beta-lyase"
FT                   /note="TIGRFAM: cystathionine beta-lyase; PFAM: Cys/Met
FT                   metabolism pyridoxal-phosphate-dependent protein; KEGG:
FT                   eca:ECA0354 cystathionine beta-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11400"
FT                   /db_xref="GOA:C6DIV0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIV0"
FT                   /inference="protein motif:TFAM:TIGR01324"
FT                   /protein_id="ACT11400.1"
FT                   /translation="MTSKKTATALVAAGRSKKFTHGSVNPVIQRASSLVFDTVQDKKHA
FT                   TINRAKGALFYGRRGTLTHFAFQEAMVELEGGVGCALYPCGAAAISNAILSFVAAGDHI
FT                   LVTESAYEPTQDFCTKVLNKLNVSTTYFNPLIGADIAELIQPNTKVVFLESPGSITMEV
FT                   HDVPAIVQAVRRINPEIVIMIDNTWAAGILFKAFDFDIDISIQAGTKYIVGHSDAMLGT
FT                   AVANERCWAQLREHSYLMGQMVDADTAYVASRGLRTLGVRLKQHQESSIRIAKWLAERP
FT                   EVAVVNHPALPECKGHEFYVRDFNGCNGLFSFVLKEKLSKETLAHYLDHFEHFSMAYSW
FT                   GGFESLILANQPEELAAIRPASGVDFTGTLIRLHIGLEDSDDLIDDLAAGFSRLSA"
FT   gene            complement(396934..398226)
FT                   /locus_tag="PC1_0342"
FT   CDS_pept        complement(396934..398226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0342"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: eca:ECA0355 DedA family
FT                   membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11401"
FT                   /db_xref="GOA:C6DIV1"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIV1"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ACT11401.1"
FT                   /translation="MDAFILIASLAVLLAVGVPVAYAVGLSAIVGALWIDLPLEAVMIQ
FT                   VTNGVNKFSLLAIPFFILAGAIMAEGGIARRLVSFAYIFVGFIRGGLSLVNIVASTFFG
FT                   AISGSSVADTASIGSVMIPEMEKKGYPRDFSAAVTASGSVQAILTPPSHNSVIYSLATG
FT                   GTVSIASLFIAGILPGLLLSLTMMVMCVGFAHRRGYPKGERVPFRQALKIFVDTLWGLM
FT                   TVVIIMGGILSGIFTATESAAIACLWSFFVTMFIYKDYKWSELPKLMYRTVKTVTIVMI
FT                   LIGFAAAFGAIMTYMQLPARITEFFTSISDNKYVILMCINIMLLLLGTLMDMAPLILIL
FT                   TPVLLPVALSLGIDPVHFGMIMLVNLGIGLITPPVGSVLFVASAVSKQKIEQVVKAMLP
FT                   FYCGLFLVLMLVTYIPAISLWLPKLFGVHTG"
FT   sig_peptide     complement(398155..398226)
FT                   /locus_tag="PC1_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 24"
FT   gene            complement(398242..398748)
FT                   /locus_tag="PC1_0343"
FT   CDS_pept        complement(398242..398748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0343"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: eca:ECA0356 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11402"
FT                   /db_xref="GOA:C6DIV2"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIV2"
FT                   /inference="protein motif:PFAM:PF04290"
FT                   /protein_id="ACT11402.1"
FT                   /translation="MAQSYLSSMDVLYRIAMWVSGLALLIMTIVIPVGIFARYVLNAAL
FT                   SWPEPISIICMVTFTFVGAAVSYRSNSHIAVSMLTDRLPESGKKICVHLSNLLMLLISL
FT                   FILYYSTLLCLELWEQPVAEFPLLTAGESYLPLPIGSLITVLFIIEKMFFGPQDKRPVV
FT                   MLGSS"
FT   gene            complement(398863..399840)
FT                   /locus_tag="PC1_0344"
FT   CDS_pept        complement(398863..399840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0344"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: eca:ECA0357 substrate-binding periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11403"
FT                   /db_xref="GOA:C6DIV3"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIV3"
FT                   /inference="protein motif:TFAM:TIGR00787"
FT                   /protein_id="ACT11403.1"
FT                   /translation="MKLSKTLIGVCLGSTALLMSHAIQAQQIKASDVHPEGYPNVVAVQ
FT                   KMGEKLKAATGGRLEIKTFPGGVLGDEKQMIEQAQIGAIDIIRVSMTPVAAILPEIEVF
FT                   TLPYIFRDEDHMHKVLDGKIGQEIGDKITQSSKSKLVFLGWMDAGTRNLITKEPVVKPE
FT                   DLKGMKIRVQGSPVALATLKAMGANSIAMGVSEVFSGMQTGVIDGTENNPPTFVAHNYL
FT                   PVVKNYTWSRHFIIPELFLYSKTKWDKLSKEDQDLILKLAKEAQQEQRVLWNEYTQQSL
FT                   DKMKAGGVQFHDIDTEYYFKATQPVRDQFGAKYQDLIKAVADVK"
FT   sig_peptide     complement(399763..399840)
FT                   /locus_tag="PC1_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 26"
FT   gene            400541..401551
FT                   /locus_tag="PC1_0345"
FT   CDS_pept        400541..401551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0345"
FT                   /product="tonB-system energizer ExbB"
FT                   /note="TIGRFAM: tonB-system energizer ExbB; PFAM:
FT                   MotA/TolQ/ExbB proton channel; KEGG: eca:ECA0358 biopolymer
FT                   transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11404"
FT                   /db_xref="GOA:C6DIV4"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014164"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIV4"
FT                   /inference="protein motif:TFAM:TIGR02797"
FT                   /protein_id="ACT11404.1"
FT                   /translation="MKTAVSNTTQQVLSTWQKKRGAFSAFSRSVLVILLCTAGLSGNAF
FT                   AAPATAPLSTENAATASQPAVASPAAPVTADVQAPASALALPASAAPGTNNLMKTDLSV
FT                   WGMYQHADAVVKTVMIGLLLASVITWAIFFSKSVEMSGAKRRLRREYLALEQAKTLDDA
FT                   LETADAFKTGSVAQQLLVDAQNELELSARSDDNNGIKERTAFRLERRVAATGRHMGRGN
FT                   GYLATVGAVAPFVGLFGTVWGIMNSFIGIAQTQTTNLAVVAPGIAEALLATAIGLVAAI
FT                   PAVVIYNVFARSIASYKAMVGDVAAQVLLLQSRDLDVAASNDNRASSAAHKLRVG"
FT   sig_peptide     400541..400681
FT                   /locus_tag="PC1_0345"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 47"
FT   gene            401555..401980
FT                   /locus_tag="PC1_0346"
FT   CDS_pept        401555..401980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0346"
FT                   /product="TonB system transport protein ExbD"
FT                   /note="TIGRFAM: TonB system transport protein ExbD; PFAM:
FT                   Biopolymer transport protein ExbD/TolR; KEGG: eca:ECA0359
FT                   biopolymer transport protein ExbD"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11405"
FT                   /db_xref="GOA:C6DIV5"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014170"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIV5"
FT                   /inference="protein motif:TFAM:TIGR02803"
FT                   /protein_id="ACT11405.1"
FT                   /translation="MAMHLKEDVSDDGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDI
FT                   RVDLPASSAAPQPRPEKPLYLTVKADKQMFLGEEVVSEQSLAQVLDAKTSANKETTIFF
FT                   QADKSVDYETIMSVMDSLRKAGYLKVGLVGAETAAAK"
FT   gene            complement(402090..403109)
FT                   /locus_tag="PC1_0347"
FT   CDS_pept        complement(402090..403109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0347"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: eca:ECA0360 sucrose operon repressor; TIGRFAM:
FT                   D-fructose-responsive transcription factor; PFAM:
FT                   regulatory protein LacI; periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11406"
FT                   /db_xref="GOA:C6DIV6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR012781"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIV6"
FT                   /inference="protein motif:TFAM:TIGR02417"
FT                   /protein_id="ACT11406.1"
FT                   /translation="MKPTKRITISDIAALAGVSKSTASLVLNGRSKEFRVSDETRDRIL
FT                   AVAHEQRYQPSIHARSLRSSRSNTLGLVVPEMTNYGFAVISRELEMLCREAGLQLLIAC
FT                   TDENASQEMMAVNSLVQRQVDGLIVASSLLSDIEYQKINQQLPVIQFDRVIGDSTLPMV
FT                   ISEAVESTAEMVERIARQHRDEFYFLGGQPRISPTRHRLEGFQLGLARTGIDCKPEWII
FT                   HGSYHPSAGYEMFAQLCATLGRPPKALFVAACGLMEGVLRYMNQHNLMESGIRLCCFDD
FT                   HYLFDCLPLKIDTVAQDCENLARNSFEMVTSLIAQQPLEEDRRYIPTRIHWRHPDSRA"
FT   gene            complement(403140..404549)
FT                   /locus_tag="PC1_0348"
FT   CDS_pept        complement(403140..404549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0348"
FT                   /product="sucrose-6-phosphate hydrolase"
FT                   /note="KEGG: eca:ECA0361 sucrose-6-phosphate hydrolase;
FT                   TIGRFAM: sucrose-6-phosphate hydrolase; PFAM: Glycosyl
FT                   hydrolase family 32 domain protein; SMART: glycoside
FT                   hydrolase family 32"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11407"
FT                   /db_xref="GOA:C6DIV7"
FT                   /db_xref="InterPro:IPR001362"
FT                   /db_xref="InterPro:IPR006232"
FT                   /db_xref="InterPro:IPR013148"
FT                   /db_xref="InterPro:IPR013189"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR018053"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIV7"
FT                   /inference="protein motif:TFAM:TIGR01322"
FT                   /protein_id="ACT11407.1"
FT                   /translation="MKEVHLLKRMAHALMSGHSRKQEDPYRPEWHLSPCVGLLNDPNGF
FT                   IHHKGRYHLFYQWNPLSCAHGAKFWGHWSSADLVNWTHEPVALVPSESYESHGCYSGSA
FT                   VVDQGAIMLMYTGNVKYDDGSRTAFQCLARENPNGEYDKLGAVLTLPDGYTGHVRDPKV
FT                   WRHDDHWYMVLGAQDLDLQGKVLLYRSDDLLAWEKVGEIAGSRLGGLGDFGYMWECPDL
FT                   FPLDGKDVLICCPQGVPAEEERYLNTFQAGYVIGSLNYNNGAYPHQDFHELDLGFEFYA
FT                   PQTTLSEDGRRLLFGWMSIPDENEFFEPTIEYGWIHTMTCPRELTLRGDRVYQRPAREL
FT                   QQLRRQHYTWHGAADYASPLHTSSAEILIAVQGEFQLSLASQLVLCWDGERVTLSRRNR
FT                   RTGEPEHRYWRGELSQLQILCDRSSVEIFINDGEAVMSARYFPESEATMTFSGSGRLTL
FT                   QHWLLAPCVIE"
FT   gene            complement(404549..405919)
FT                   /locus_tag="PC1_0349"
FT   CDS_pept        complement(404549..405919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0349"
FT                   /product="PTS system, sucrose-specific IIBC subunit"
FT                   /note="TIGRFAM: PTS system, sucrose-specific IIBC subunit;
FT                   PTS system, glucose-like IIB subunint; PTS system, maltose
FT                   and glucose-specific subfamily, IIC subunit; PFAM:
FT                   phosphotransferase system EIIC; phosphotransferase system
FT                   PTS EIIB protein; KEGG: eca:ECA0362 PTS system,
FT                   sucrose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11408"
FT                   /db_xref="GOA:C6DIV8"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004719"
FT                   /db_xref="InterPro:IPR010973"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIV8"
FT                   /inference="protein motif:TFAM:TIGR01996"
FT                   /protein_id="ACT11408.1"
FT                   /translation="MDINKTAAALIPLLGGKENIASAAHCATRLRLVLNDDNLADKKAI
FT                   ENVDGVKGCFQNAGQMQIIFGTGLVNKVYAEFIKAAGISESSKSEAASIAAKKLNPLQR
FT                   LARLLSNIFVPIMPAIIASGLLMGLLGMIKTYGWVDASSAIFVMLDMFSSAAFIILPIL
FT                   IGFTAAREFGGNPYLGATLGGILTHPALTNAWGVAGGFQTMHFFGMDIAMIGYQGTVFP
FT                   VLLAVWFMSIVEKRLRKIVPDALDIIVTPFLTVIISGFVAMLIIGPAGRALGDGISFLL
FT                   STLITHAGWLAGLLFGGLYSAIVITGVHHSFHAIEAGLLGNPNIGVNFLLPIWAMANVA
FT                   QGGACLAVYFKTRDAKTRAIAVPAGLSCLLGITEAAIFGINLRFIKPFLAALAGGALGG
FT                   AWVVFNHVNMTAVGLTGFPGLAIVQGGSMLNYLIGMFIAFGAAFTLSLLLKYKTDSE"
FT   gene            complement(405999..407534)
FT                   /locus_tag="PC1_0350"
FT   CDS_pept        complement(405999..407534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0350"
FT                   /product="porin LamB type"
FT                   /note="PFAM: porin LamB type; KEGG: eca:ECA0363 putative
FT                   sucrose porin"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11409"
FT                   /db_xref="GOA:C6DIV9"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR021570"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIV9"
FT                   /inference="protein motif:PFAM:PF02264"
FT                   /protein_id="ACT11409.1"
FT                   /translation="MKPSHLAVTIGLLLSSPFYVSAANTDSIEARLNAMEQRLQQAEAR
FT                   AQAAEARADAAEKQTQQLATRTTQTEQKTQQVEQRTTALAKQKSFADGFEFHGYARSGL
FT                   SINDSATSSKTDIGPGMSPAGQTGGHIGRLGNEDDTYVEIKLEHKQKLDNGATTRFKVM
FT                   MADGQRSYNDWTATTSDLNIREAFVELGSLPTFTGAFKDTTLWAGKRFDRDNFDIHWLD
FT                   SDVVFLAGTGGGIYDVKWADSAKSNFSLYGRSLGEITSLDNDIKNYVFTANNYVGPFQF
FT                   MLSGLTAKNNDVKQNTGTSRDNTFVTNTNAGDKGYHAMVAYHGDSFYGLRDGTSKTAIL
FT                   YGHGLGGEVKNIGADGNLTNDANTWRFATYGTTALNKTWSFAPSILAQTSKDRYVNGDS
FT                   YEWVTFNARLIQEITENFALAYEGSYQYMDLDPRGYRSLNQVSGGFYKLTFAPTFKVGD
FT                   IGNFFSRPELRVFASYMDWDKRLDNYSSEDTFGSTGFKAGGEWNFGIQMETWF"
FT   sig_peptide     complement(407466..407534)
FT                   /locus_tag="PC1_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 23"
FT   gene            complement(407733..408656)
FT                   /locus_tag="PC1_0351"
FT   CDS_pept        complement(407733..408656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0351"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: eca:ECA0364
FT                   aminoimidazole riboside kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11410"
FT                   /db_xref="GOA:C6DIW0"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIW0"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACT11410.1"
FT                   /translation="MANRIWVMGDAVVDLIPEDAERYLKCPGGAPANVAVGIARLGGNS
FT                   AFIGRVGDDVFGHFLKTVLEQENVDTHHMAHDRFHRTSTVVVSLDEAGERAFTFMVRPS
FT                   ADLFLQPEDLPIFNRGEWLHLCSIALSQEPSRSTAFEAMRQIKAAQGRVSFDPNIRDDL
FT                   WQSEQELRDCLTQALMLADVVKLSREELAFLCSTPDVEAGIQQFMQRYPTQLLLVTLGS
FT                   EGVWLHDRHQLRHFAAPSVTPVDTTGAGDAFVAGLLHGLAQYDDLSQPLSWDPIIAQAQ
FT                   RCGALATTAKGAMTALPYAQQLHALP"
FT   gene            409126..409677
FT                   /locus_tag="PC1_0352"
FT   CDS_pept        409126..409677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0352"
FT                   /product="protein of unknown function DUF583"
FT                   /note="PFAM: protein of unknown function DUF583; KEGG:
FT                   eca:ECA0365 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11411"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIW1"
FT                   /inference="protein motif:PFAM:PF04519"
FT                   /protein_id="ACT11411.1"
FT                   /translation="MFSFDKNKKDAKEPQERSEINSSPAISPSNELINSVNPVRVKKDT
FT                   FISQGARMTGSLAVDGNITVEGRVEGDVQCDNTIKVEHTGQVNGEMKSQQIIINGRVEG
FT                   RIAASVVAILAQGKVFGDIFTDELSIEKGGVFTGQSHPLTPPTQNQEKLTYVDKEKEKA
FT                   AKAPAEQENVVALAGNVPTE"
FT   gene            409860..410318
FT                   /locus_tag="PC1_0353"
FT   CDS_pept        409860..410318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11412"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIW2"
FT                   /inference="similar to AA sequence:KEGG:ECA0368"
FT                   /protein_id="ACT11412.1"
FT                   /translation="MKVEAAESSVFASQQVMAKRSTEHAEKAALSEQLQSYQAGSGAVP
FT                   VGQTTRYDFTRISPAELYETVEGLVSSGRLGREEGSALLGFISSPRENVGSVPPSNVFQ
FT                   PINVFDTIQQGVAGASSRSEVQNTESLQRAAEALNRFQGQVSSISVYV"
FT   gene            complement(410394..411746)
FT                   /locus_tag="PC1_0354"
FT   CDS_pept        complement(410394..411746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0354"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   eca:ECA0369 putative pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11413"
FT                   /db_xref="GOA:C6DIW3"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIW3"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /protein_id="ACT11413.1"
FT                   /translation="MSELTLLADADERGRRYLAENAQRRVFPDAAALAALARFDEALPQ
FT                   QGFSPESTLTLLDEVGSPATTASNGPNYFGFVIGASLPVAAASERLMIAWDQCASTFDN
FT                   SPVSATLERLASRWVLDALNLPKDSAVGFGTSATACTLSCLAAARRALLAKQGWDFDND
FT                   GLNGAPEITVVISELTHITVKKALRVLGFGLRHLRIAPVNAYGQIDVAQLPPLDDRTIL
FT                   CLQAGEVNTGEFDDFAQIIPIAKAAGAWVHVDGAFGLWARASSHATLTEGIELADSWTT
FT                   DAHKWLNTPYDCAMAICRDADALAEAMNADAVYSSAARDAQKNLTLEFSRRPRGIPVWA
FT                   VLRTLGRDGVAEMVERHCRQAAFIADGLRHAGFEVLNRVVLNQVLLRGETDGQTTAIRD
FT                   ALQASGKAWFGGTVWQGRPALRISVSSWRTQDDNVQALITLLTEIKARTPR"
FT   gene            complement(411804..413072)
FT                   /locus_tag="PC1_0355"
FT   CDS_pept        complement(411804..413072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0355"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA0370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11414"
FT                   /db_xref="GOA:C6DIW4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIW4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACT11414.1"
FT                   /translation="MKANIMKTSPIHTTSSVTECDLYSTQTTLPRALVLLFACASALSV
FT                   ANVYYAQPLLDALSVDFHISIAAVGGVMSATQLGCALALILLVPLGDILNRRYLMLSQL
FT                   GALIVALIAVGLSTTSLALLIGMLAVGMLGTAMTQGLIAYAATAAAPQERGRVVGAAQG
FT                   GVVIGLLLARVLSGFIADVAGWRSVYFFSALLMLLLAVLLWRTLPHQLLARQRPHYSAL
FT                   LLSMLTLLRQERVLQIRGTIALLMFAALSIFWSALVLPLSREPYFFSHTVIGAFGLVGI
FT                   LGALAAVKAGSLADKGREQWVSGIALLLLLTSWLPLWLAPYSLLALVVGIIVLDLGGQA
FT                   IHVTNQSMIFKTHPDAHSRLVGCYMLFYSIGSGLGAMATTAAYDAAGWSGVCLLGAAVS
FT                   LTALLFWKVTLHASAPSPAASTP"
FT   sig_peptide     complement(412932..413072)
FT                   /locus_tag="PC1_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.457 at
FT                   residue 47"
FT   gene            413208..413654
FT                   /locus_tag="PC1_0356"
FT   CDS_pept        413208..413654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0356"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: eca:ECA0371
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11415"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DIW5"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACT11415.1"
FT                   /translation="MVKRKSLKEDACPVARALDVVGDRWALLIIRDAFDNRRRFSDFQR
FT                   SLGVAKNILTDRLRTLVDEGILSVQPVSDSSAYQEYVLTPKGEQLFPLVVALRQWGEQQ
FT                   LFAEGEPHSLLLDRHTGQPLQAMLPHSAQGQPVVGQDTFVQKVD"
FT   gene            413664..414125
FT                   /locus_tag="PC1_0357"
FT   CDS_pept        413664..414125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11416"
FT                   /db_xref="GOA:C6DJK3"
FT                   /db_xref="InterPro:IPR011194"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJK3"
FT                   /inference="similar to AA sequence:KEGG:ECA0372"
FT                   /protein_id="ACT11416.1"
FT                   /translation="MQKEPKETGSDLEAISRYLKKLHVLTLCVGENSELWCASCFYTYD
FT                   DQLIAFYLMTELQTRHGEMMVRLPQVAGTVSGQPKSVMLIKGVQFRGQAVLLEGDEAHQ
FT                   ARARYNTRFPIARASQAPIWRLDLTEIKMTDNALGFGKKRYWQRDEQVQ"
FT   gene            414220..414873
FT                   /locus_tag="PC1_0358"
FT   CDS_pept        414220..414873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0358"
FT                   /product="Semialdehyde dehydrogenase NAD-binding"
FT                   /note="PFAM: Semialdehyde dehydrogenase NAD - binding;
FT                   KEGG: eca:ECA0373 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11417"
FT                   /db_xref="GOA:C6DJK4"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJK4"
FT                   /inference="protein motif:PFAM:PF01118"
FT                   /protein_id="ACT11417.1"
FT                   /translation="MSRVLLLGATGLVGHELLQLLKANNRVETIYAPTRKPLASSEKVV
FT                   NPHGPDLSAALAQLTDPVDIAFCCLGSTLKTAGSKQAFRYVDYTLVVEGSKVALALGAT
FT                   HLLVVSSLSANATSPFFYSRVKGETERSLRQQGWQHLTLAQPSMLLGEREDSRPLESLA
FT                   APLFRLFPAKWRAIEGKTVAQALLNQAFSPEPKARVTVLESDQLRSLGKLPALQ"
FT   gene            complement(414885..415349)
FT                   /locus_tag="PC1_0359"
FT   CDS_pept        complement(414885..415349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0359"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein; KEGG: eca:ECA0374 anaerobic
FT                   ribonucleotide reductase-activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11418"
FT                   /db_xref="GOA:C6DJK5"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJK5"
FT                   /inference="protein motif:TFAM:TIGR02491"
FT                   /protein_id="ACT11418.1"
FT                   /translation="MNYHQYYPVDVVNGPGTRCTLFVAGCVHECVGCYNKSTWRLNSGQ
FT                   PFTQEQEDRIIADLQDTVIPRQGISLSGGDPLHPRNVPDILRLVERIRAECPGKDIWVW
FT                   TGYVLAELTPEQQRVVDLINVLVDGKFVQDLKDPALIWRGSSNQVVHRLR"
FT   gene            complement(415431..417569)
FT                   /locus_tag="PC1_0360"
FT   CDS_pept        complement(415431..417569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0360"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="KEGG: eca:ECA0375 anaerobic ribonucleoside
FT                   triphosphate reductase; TIGRFAM: anaerobic
FT                   ribonucleoside-triphosphate reductase; PFAM: formate
FT                   C-acetyltransferase glycine radical; ATP-cone domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11419"
FT                   /db_xref="GOA:C6DJK6"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJK6"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ACT11419.1"
FT                   /translation="MKPVVIKRDGCQVPFDEVRIKEAVERAAHAAGVNDADYCATVACA
FT                   VAQQMQDKSRVDIREIQDAVENLLMSGNYKKLARTYIEYRHDRDIARERHGRLNQEIRG
FT                   LVEQSNMALLNENANKDSKVIPTQRDLLAGIVAKHYAKQYILPRDVVLAHERGEIHYHD
FT                   LDYSPFFPMFNCMLIDLNGMLTNGFKMGNAEIEPPKSISTATAVTAQIIAQVASHIYGG
FT                   TTINRIDEILAPFVTASHAKHKAVAEEWQIPDADNYALTRTEKECYDAFQSLEYEVNTL
FT                   HTANGQTPFVTFGFGLGVSWESRLIQESILRNRIAGLGKNHKTAVFPKLVFAIRDGLNH
FT                   KAGDPNYDIKQLALECASKRMYPDILNYDQVVNVTGSFKTPMGCRSFLGVYEENGQQIH
FT                   DGRNNLGVISLNLPRIALEAEGNEDRFWTLLDQRLALAKKALMTRIARLESVKARVAPI
FT                   LYMEGACGVRLKADDSIADIFKNGRASISLGYIGLHETINALFGNQTHVFDDETLRAKA
FT                   IAIIACLKDATEQWKDETGYGFSLYSTPSENLCDRFCRLDTAEFGVVQGVTDKGYYTNS
FT                   FHLDVEKKVNPYQKIDFELPYPPLANGGFICYGEYPNLQHNLKALEDVWDYSYSRVPYY
FT                   GTNTPIDECYECGFTGEFECTSKGFTCPKCGNHDSARVSVTRRVCGYLGSPDARPFNAG
FT                   KQEEVKRRIKHLGNGQLG"
FT   gene            complement(417973..418710)
FT                   /locus_tag="PC1_0361"
FT   CDS_pept        complement(417973..418710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0361"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   eca:ECA0376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11420"
FT                   /db_xref="GOA:C6DJK7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016545"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJK7"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ACT11420.1"
FT                   /translation="MTYCVAMCLSDGLVFASDSRTNAGVDHIATFKKLYVFQHENERVL
FT                   VIQCAGNLATTQSIISLLNARIDAQHTPNLMQVNSMYDAAMLLGETVREVIHRDSSVQQ
FT                   NGSNTNFGCNLLLGGQIGGETHRLFHIYPEGNFIEATPDTPYFQIGESKYGKPIIDRVL
FT                   TMDTPLEQAMCCALISIDSTLRSNLSVGLPLDVMIYRTGSFASTEQQRITENNAYFTTI
FT                   RKAWSEGLLNTFRQLPPFPDIQP"
FT   gene            complement(418734..419555)
FT                   /locus_tag="PC1_0362"
FT   CDS_pept        complement(418734..419555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0362"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein;
FT                   transglutaminase domain protein; SMART: transglutaminase
FT                   domain protein; KEGG: eca:ECA0377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11421"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJK8"
FT                   /inference="protein motif:PFAM:PF08379"
FT                   /protein_id="ACT11421.1"
FT                   /translation="MKLTINHLTHYRYDEEVKFSTQYLRLTPQNSAHQKIREWKLTLPT
FT                   SAVQTTDAYGNVLHVLTLDHPHQDITIHAEGVVDILDSGAAENPEIQDGLSPLVFLRPT
FT                   PLTEADGEIRAFAQRYYRPDAAEESLNTLMAELRLKMPYTPGATQVQDTAAAAFAMQKG
FT                   VCQDHTHVFLACCRSLSIPARYVSGYVYSQDTHHVAMHAWAEVWLNGYWQGFDITNSTR
FT                   QLHQHLWLAVGMDYMDACPVRGTRLGGGCEEMFSEAEVRLFERQQQVQQQQ"
FT   gene            complement(419552..420481)
FT                   /locus_tag="PC1_0363"
FT   CDS_pept        complement(419552..420481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0363"
FT                   /product="protein of unknown function DUF403"
FT                   /note="PFAM: protein of unknown function DUF403; KEGG:
FT                   eca:ECA0378 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11422"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJK9"
FT                   /inference="protein motif:PFAM:PF04168"
FT                   /protein_id="ACT11422.1"
FT                   /translation="MLSRTASELYWMARYLERAESLARVLDVTYKLSMMPRHSQQQRDL
FT                   ALPLNLTATHELFQQRYTRFSMNNLLNFFALDSQNPSSIYNCIEMAWNNAHAVRGSLSS
FT                   EVWECINATRIDIRNLRHQGVDNVGIDAFFDWVKERSHLFRGAMFGTLLRNDAQCFIRV
FT                   GTLIERAYATAQLLKVKHQQLNNDPDPVREYYRLDTLLRAVSAREAYHSIYRQPISPET
FT                   VTELLVLREDVPRSLHACIGDLVLQLEAIGSQRAKVPHRLAHLLHVELRFSTLDDILAQ
FT                   DLSTYLNNFMIKINELADSIRHTYLEAL"
FT   gene            complement(420475..421914)
FT                   /locus_tag="PC1_0364"
FT   CDS_pept        complement(420475..421914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0364"
FT                   /product="protein of unknown function DUF404"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF407; KEGG: eca:ECA0379 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11423"
FT                   /db_xref="InterPro:IPR016450"
FT                   /db_xref="InterPro:IPR025841"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJL0"
FT                   /inference="protein motif:PFAM:PF04169"
FT                   /protein_id="ACT11423.1"
FT                   /translation="MIKMKLPSAPYYDEMLSSQGQQRQHYNSYWQWLQQTDQQAIKQKK
FT                   EQAELLFHRVGITFNVYGEEGGTERLIPFDSVPRIIPAHEWQLLDRGIRQRVQALNAFL
FT                   YDIYHHQHILKAGIIPSEQVLANEQYQPCMQGVNLHNNIYAHITGIDMVRNSDGHYYVL
FT                   EDNLRTPSGVSYMLENRKMMMRLYPDLFASQHIAPVERYPSYLLQTLRESTLVDDPTVV
FT                   VMTPGRFNSAYFEHSFLAQQMGVELVESADLFVKEGAVYMRTTEGPCQVDVIYRRVDDA
FT                   FLDPLAFRADSMLGVPGLLSVYRAGGVVLANAIGTGVADDKSIYPYVPEMIRFYLSEEP
FT                   ILHNIPTWQCRNPSDLSYVLDHLDSMVVKEVHGAGGYGMLVGPRATRGEIETFRQRLLA
FT                   HPNNYIGQETLALSTCPTFIDDGLAPRHIDLRPFALSGEEIRLVPGGLTRVALTEGSLV
FT                   VNSSQGGGTKDTWVMEEDESC"
FT   gene            complement(422136..422522)
FT                   /locus_tag="PC1_0365"
FT   CDS_pept        complement(422136..422522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0365"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="TIGRFAM: endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: eca:ECA0380 putative
FT                   endoribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11424"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJL1"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ACT11424.1"
FT                   /translation="MSRTISTEHAPAAIGPYVQGVDLGSMIITSGQIPVNPKSGLVADN
FT                   ITAQTRQSLENVQAIVEAAGLKVSDIVKTTVFVKDLHDFTLVNTAYEAFFNEHDAPFPA
FT                   RSCVEVARLPKDVKIEIEAIAVRR"
FT   gene            complement(422621..423085)
FT                   /locus_tag="PC1_0366"
FT   CDS_pept        complement(422621..423085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0366"
FT                   /product="aspartate carbamoyltransferase, regulatory
FT                   subunit"
FT                   /note="TIGRFAM: aspartate carbamoyltransferase, regulatory
FT                   subunit; PFAM: aspartate transcarbamylase regulatory
FT                   subunit; KEGG: eca:ECA0381 aspartate carbamoyltransferase
FT                   regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11425"
FT                   /db_xref="GOA:C6DJL2"
FT                   /db_xref="InterPro:IPR002801"
FT                   /db_xref="InterPro:IPR020542"
FT                   /db_xref="InterPro:IPR020545"
FT                   /db_xref="InterPro:IPR036792"
FT                   /db_xref="InterPro:IPR036793"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJL2"
FT                   /inference="protein motif:TFAM:TIGR00240"
FT                   /protein_id="ACT11425.1"
FT                   /translation="MTHDNKLQVEAIKRGTVIDHIPAQVGFKLLTLFKLTATDQRITIG
FT                   LNLPSNHLGRKDLIKIENIFLTEEQANQLAIYAPQATVNQIDDYDVVRKLVPTLPEHIT
FT                   GVLTCPNSNCISRSEPVSSSFSVKQRDGDVHLKCKYCEKEFERQAVLQDR"
FT   gene            complement(423101..424036)
FT                   /locus_tag="PC1_0367"
FT   CDS_pept        complement(423101..424036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0367"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /note="KEGG: eca:ECA0382 aspartate carbamoyltransferase
FT                   catalytic subunit; TIGRFAM: aspartate carbamoyltransferase;
FT                   PFAM: aspartate/ornithine carbamoyltransferase carbamoyl-P
FT                   binding domain; aspartate/ornithine carbamoyltransferase
FT                   Asp/Orn-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11426"
FT                   /db_xref="GOA:C6DJL3"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJL3"
FT                   /inference="protein motif:TFAM:TIGR00670"
FT                   /protein_id="ACT11426.1"
FT                   /translation="MVNPLYQKHIISINDLSREDLELTLRVAASLKAKPQPELLKHKVI
FT                   ASCFFEASTRTRLSFETAMHRLGASVVGFADSNNTSLGKKGETLADTISVISQYVDAIV
FT                   MRHPQEGASRLATEFSGGIPVLNAGDGANQHPTQTLLDLFTIQETQGRLNNINIAMVGD
FT                   LKYGRTVHSLTQALAKFEGNRFYFIAPDALAMPDYILSMLKEKNIAYSLHNSIDEVVGE
FT                   LDILYMTRVQKERLDPSEYINIKSQFVLRAADLHSARPNLKVLHPLPRVDEITIDVDAT
FT                   PYAYYFQQAGNGIYARQALLALVLNRELVL"
FT   gene            complement(424184..424306)
FT                   /locus_tag="PC1_0368"
FT   CDS_pept        complement(424184..424306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11427"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJL4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11427.1"
FT                   /translation="MHRYTKKSAAYVGSQPQLPSGSQPAFSFPLLNYFIKKAPQ"
FT   gene            424456..424587
FT                   /locus_tag="PC1_0369"
FT   CDS_pept        424456..424587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0369"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11428"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11428.1"
FT                   /translation="MGSSLFRINALAGVTFGEYKDYKTEFHFFYQRGFYDYWQCPPP"
FT   gene            424559..425023
FT                   /locus_tag="PC1_0370"
FT   CDS_pept        424559..425023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   eca:ECA0383 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11429"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJL6"
FT                   /inference="protein motif:PFAM:PF04074"
FT                   /protein_id="ACT11429.1"
FT                   /translation="MITGNVHHLELVPYLPAKLREAIEYVKKNITADTPLGKHDIEGNS
FT                   VFVLISNDSTDLLEKRRAEYHAKYLDIQIVLSGVEGMTFSNLPAGKPDTDWLADKDIAF
FT                   LPSGEQEKQFVMQEGDFVVFFPGEVHKPLCAVGEPAHVRKAVVKIDASLV"
FT   gene            425373..426056
FT                   /locus_tag="PC1_0371"
FT   CDS_pept        425373..426056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0371"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: plu:plu2006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11430"
FT                   /db_xref="GOA:C6DJL7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJL7"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACT11430.1"
FT                   /translation="MTQITLPDRLIAMFESDPLVGWAIKDTNSRFVYVNNTFKTWQTIS
FT                   TRYDYEGLNIRDIPVPVAEFSDIFNQQEREIERTGKAVRAITTHIQGTEKIMQPAYNIQ
FT                   EPIYDEHRNCIGTVISVRHVRIITPTSLLNGTIIQHSTFEPPSTIFTEKEWEVIYLLVC
FT                   GMMLKDISSILSITVDAVNSRLRSCYRKTGLNSVSGLKEYCRDNRFDNYIPLFFLKKGH
FT                   IIIRG"
FT   gene            426061..426726
FT                   /locus_tag="PC1_0372"
FT   CDS_pept        426061..426726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0372"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="PFAM: PAS fold-4 domain protein; KEGG: plu:plu0925
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11431"
FT                   /db_xref="GOA:C6DJL8"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJL8"
FT                   /inference="protein motif:PFAM:PF08448"
FT                   /protein_id="ACT11431.1"
FT                   /translation="MDPDLTPVEYYFDNSLFGWAIKDCNSQYVYGNKMACQYFGVTENK
FT                   LVGCLDTDLTPDISEHYGHILYDDQKILTTNEMSIVLKTFDYGRRNRLRSFLVEKRPWR
FT                   LNDGSDGIVCTYIEITNVYFSTFLMPCERKPIVFTRPANIFTDKEWEAVLLLQSGVKQN
FT                   RIPDILGISSSTLRNRITRCCDKAGVANSTALIQHCNQKGWDNYIPPFFLIKGHVSIT"
FT   gene            426849..427035
FT                   /pseudo
FT                   /locus_tag="PC1_0373"
FT   gene            complement(427088..428095)
FT                   /locus_tag="PC1_0374"
FT   CDS_pept        complement(427088..428095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0374"
FT                   /product="ornithine carbamoyltransferase"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: eca:ECA0384 ornithine
FT                   carbamoyltransferase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11432"
FT                   /db_xref="GOA:C6DJL9"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJL9"
FT                   /inference="protein motif:TFAM:TIGR00658"
FT                   /protein_id="ACT11432.1"
FT                   /translation="MQPFYKRHFLRLMDFTPAEIANLLALSTKLKADKKNGTEVRRLQG
FT                   KNIALIFEKDSTRTRCSFEVAAYDQGAQVTYLGPSGSQIGHKESIKDTARVLGRMYDGI
FT                   QYRGYGQQIVETLAQYAGVPVWNGLTNEFHPTQLLADLLTMQEHLPGKPLSEMALVYVG
FT                   DARNNMGNTMLEAAALTGLDLRLVAPKACWPDAGLVAECQAAAEQTGGSITLTEDIATG
FT                   VAGADFIYTDVWVSMGEPKETWQERIALLKPYQVNAAMIAATGNPQVKFLHCLPAFHDD
FT                   QTTMGQQMAEQYGLHGGMEVTDEVFESAHSIVFDQAENRMHTIKAVMVATLAQD"
FT   gene            428257..428682
FT                   /locus_tag="PC1_0375"
FT   CDS_pept        428257..428682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0375"
FT                   /product="protein of unknown function DUF1260"
FT                   /note="PFAM: protein of unknown function DUF1260; KEGG:
FT                   eca:ECA0385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11433"
FT                   /db_xref="GOA:C6DJM0"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016716"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJM0"
FT                   /inference="protein motif:PFAM:PF06877"
FT                   /protein_id="ACT11433.1"
FT                   /translation="MANRELLEEQREETRLIIEELLDDGSDPDALYTIEHHFSAEKFEV
FT                   LEKVAVEAFKLGYEVTDAEELEVEDGVLLMCCDAISEVALNAELIDAQVEQLLALAERH
FT                   GVNYDGWGTYFEDPDGEGEEDGDDEDFYDEDDDGKRH"
FT   gene            complement(428751..429254)
FT                   /locus_tag="PC1_0376"
FT   CDS_pept        complement(428751..429254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0376"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   eca:ECA0386 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11434"
FT                   /db_xref="GOA:C6DJM1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJM1"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACT11434.1"
FT                   /translation="MTTATSAKLQVRPITAHDDAAIARVIRQVSAEFGLTADKGYTVSD
FT                   PNLDALFALYSQPQSAYWVIEYEGCVVGGGGIAPLVAGDEDVCELQKMYFLPIARGKGL
FT                   ARQLAIQALDFARQHGFRRCYLETTGHLTSAIRLYESLGFEPIPHSMGNTGHTDCEVTM
FT                   LKVL"
FT   gene            429549..430730
FT                   /locus_tag="PC1_0377"
FT   CDS_pept        429549..430730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0377"
FT                   /product="protein of unknown function DUF898 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF898
FT                   transmembrane; KEGG: eca:ECA0387 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11435"
FT                   /db_xref="GOA:C6DJM2"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJM2"
FT                   /inference="protein motif:PFAM:PF05987"
FT                   /protein_id="ACT11435.1"
FT                   /translation="MTINTSENNTQHRVKFHGKAGEYFAIWLVNALLTVITLGIYSAWA
FT                   TVRRRRYFYGNTEINGDRFDYHADPIQILKGRLLVIAGIILFYIILAMSPTLGTIIALA
FT                   FAALIPIIVIRNWRYNAIMSSYRGVRFNYDCQTGRAYWVLLFCPILLMLAFYIALVVVV
FT                   MIGMQSNSPILIGFIALAIAIPGFAAVNGIMKMMQLDFYVNNLSFGKTAFKAELTKAAF
FT                   IKFALVSLLIFVPFLIAALSFMSSFIFTLFQTIMMGGGNEDLILMMLLSNAFNFIMMFI
FT                   VALLGVLVSSSYLVVAQRNYLFNQTSLNGDVKLHSSMQTLSYMGLLITNSLITIFSLGW
FT                   AAPVAEIRHARYIANATAVEGDLALLHVQAHQDTANSALAEEAVQALDLGVGL"
FT   gene            430747..431784
FT                   /locus_tag="PC1_0378"
FT   CDS_pept        430747..431784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0378"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: eca:ECA0388
FT                   putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11436"
FT                   /db_xref="GOA:C6DJM3"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJM3"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACT11436.1"
FT                   /translation="MNIEGHYQYPGLAARVAASLHLADNGSMMVLNTGSSNTTFSLEQV
FT                   TVSDALGSIPLTLTFPDGGRFVPADDPTFRAWYSARRRPGLVHRLERHKRGVILTLFAT
FT                   ILVIINYVYVVLPWASSALALRIPTAIEQQLGQHTLTLLRHSDFTPSKLPIERQQAMQA
FT                   LFQQVMPADMREDKTPLRLEIMSAPIGPNAFMLADGTLIISDDLVTLAKSDNELAAVML
FT                   HEMGHHAYRHPMRMVVRSSLVSLTFMWMTGDVSGVGDTVLQSAAFINEMQFSRDMEREA
FT                   DAWAIAEMQQQGRSLQSMQAMYQALVANDRSHDEVESLDLPDWLSTHPDMDERLKVIER
FT                   EMNKH"
FT   gene            432150..433229
FT                   /locus_tag="PC1_0379"
FT   CDS_pept        432150..433229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0379"
FT                   /product="Homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: eca:ECA0389
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11437"
FT                   /db_xref="GOA:C6DJM4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJM4"
FT                   /inference="protein motif:PRIAM:2.3.1.31"
FT                   /protein_id="ACT11437.1"
FT                   /translation="MINRILSGVVGAFLLMLSPLTHAQANFPEPKEGDWIAPEFTFNSG
FT                   EKLKDLRIHYYTIGDKTKPAVLLLHGTNQPIKALLANGFGGELFGPGQALDSSKYFIIM
FT                   PESIGSGKSSKPSDGLRMKFPQYDYNDMVQAQYRLVKEGMGINHLRLVMGYSMGGMQTW
FT                   LWGEKYPDMMDALVPMASLPNELSGRNWMMRRILIESIKNDPVWNNGDYTQQPPTLKTA
FT                   SIMFSIATTGGTLAYQSKAPTRAQADKLVEDRLAAPSNSDANDFIYIWGSSANYNAAPE
FT                   LNKIKASVLVINSADDERNPVETGILDNELKKIKQATLFLIPASKDTSGHGTMMSAKFY
FT                   KDELQRFLEKNQSQKNNKK"
FT   sig_peptide     432150..432221
FT                   /locus_tag="PC1_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 24"
FT   gene            433449..435068
FT                   /locus_tag="PC1_0380"
FT   CDS_pept        433449..435068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0380"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: eca:ECA0390 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11438"
FT                   /db_xref="GOA:C6DJM5"
FT                   /db_xref="InterPro:IPR003122"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR035440"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJM5"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACT11438.1"
FT                   /translation="MFRKIKIRTALSMMVFSLAALLLFVGVLGLVAVQSGNKSFARVDM
FT                   EVLPGLVALNDSSELLLRGRLDLRLYESLMGKGDVEAAKVALGRARTKVDGASEKWQEY
FT                   LKYPQSDEEKVISADMAEKRNTLMQDFIDPAFAALNAGNLDEYRQRAGKSTVLYAAFDK
FT                   SSKALVAFKLKSIDEAYADSNGRVNLMETILYTAIACALLLAALAWSVMTNMIVKPLNQ
FT                   AISVFDRIAEGDLRAQIDSSGKNEIAHLFAAVQRMRDGLENMVRVVRNGTDAISVGVEE
FT                   IASGNIDLSSRTEQQAASLDETASSMEQIMSTVKNNEDNTRKANDLALKASNSASRGGN
FT                   VVSEVVDTMRSIKQSSAKISDIVGVIDGIAFQTNLLALNAAVESARAGQYGKGFAVVAS
FT                   EVRMLAARSATAAKEIGTMIDDSLSRIEKGAGLVEVAGNTMDEVLMDVKKVVDIMDEIT
FT                   LASSEQSRGISQINIAINQMDGVTQQNASLVSEVATSANALQEQVVNLQQSVSRFQIAR
FT                   ENMEMDNVLPGLRQNIALADAR"
FT   sig_peptide     433449..433547
FT                   /locus_tag="PC1_0380"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.588 at
FT                   residue 33"
FT   gene            complement(435146..435706)
FT                   /locus_tag="PC1_0381"
FT   CDS_pept        complement(435146..435706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0381"
FT                   /product="phosphotransferase KptA/Tpt1"
FT                   /note="PFAM: phosphotransferase KptA/Tpt1; KEGG:
FT                   eca:ECA0395 RNA 2'-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11439"
FT                   /db_xref="GOA:C6DJM6"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR022928"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="InterPro:IPR042081"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJM6"
FT                   /inference="protein motif:PFAM:PF01885"
FT                   /protein_id="ACT11439.1"
FT                   /translation="MSNTKHADVSKFLSYVLRHKPEAIGLTLNSGGWANIAELISCAAK
FT                   DGRLLTREVIQSVVDNSDKKRFSISADGLSIRAAQGHSSAQVDMRYEPKVPPEFLYHGT
FT                   ATRFIDSINQQGLRPGSRQYVHLSADEATAITVGQRHGKPTVLKIKTLEMHQQGFIFYQ
FT                   ADNGVWLTLTVPVPFIDSTPFID"
FT   gene            complement(435844..435915)
FT                   /pseudo
FT                   /locus_tag="PC1_0382"
FT   gene            436273..437457
FT                   /locus_tag="PC1_0383"
FT   CDS_pept        436273..437457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0383"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11440"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11440.1"
FT                   /translation="MSSDTFADLQKVFFAAFIQGLGYNLNQPAQVVQPSPPIIGDDEDD
FT                   NDKILWSYFNTLPTSSLTRNTTLASGTQFLSTYSAIMSSLQSPPNKFKEEIGEYCFDAF
FT                   SNAVENGNAEATPRGYRDWAFLTNKCSSHANSGASAYAAMLLDPIFAGQNNVLPYKPVG
FT                   RKSVDFFPDYNTMMKQLKKAPSREFTTDLSIKDTSYTKTWNGGAQSAVFGLWSNSYSNT
FT                   EISQKFASSSVHLEASFKNLLPFSANPGDWYNSATLGIAYSEAGTPPWSPNGLKTWKNT
FT                   FSASGDMQRFTTLLLIANQMKLVYSTAATFSTTEQKEIIKNSRSGLWPFYHKSSENVSE
FT                   TSVNFDTSGRLMVTVTTEKNVPTIVGAIIEPVDKYLGHLRDASQLELRRLIPRG"
FT   gene            437532..438431
FT                   /locus_tag="PC1_0384"
FT   CDS_pept        437532..438431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0384"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11441"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11441.1"
FT                   /translation="MRNFDDVQQYFIARQIEAIGLPSNTVKIYQGAISPAPDDNALWEL
FT                   LDQLPSSGVIQYNNQGSFFEHYSILVNALVASPNILDPIAAAQRNLTNWGEQPPAWEKG
FT                   YRSMEKQLSSAPKISFEFELPVSASSSFWGIWHNSDPMAGLSSAIALSALSVKVSFGHL
FT                   LHFTPQPDDWYTGIALKTAYQNPNKTPPWQPDDLISWDSMFGITGSLHQIVTGLICVSD
FT                   IKVEYTISAHFTDQHLNEIKEYNGGGVWPYYLSNKNAVTKFQINTDGDLHVSIMSTKGM
FT                   PIIIGVIANPMASWIGGQ"
FT   gene            complement(438409..438549)
FT                   /locus_tag="PC1_0385"
FT   CDS_pept        complement(438409..438549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0385"
FT                   /product="RNA:NAD 2'-phosphotransferase-like protein"
FT                   /note="KEGG: pae:PA0054 RNA 2'-phosphotransferase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11442"
FT                   /db_xref="GOA:C6DJM9"
FT                   /db_xref="InterPro:IPR002745"
FT                   /db_xref="InterPro:IPR042080"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJM9"
FT                   /inference="protein motif:COG:COG1859"
FT                   /protein_id="ACT11442.1"
FT                   /translation="MSNTKHDDVSKFLSYVLRHKPEAIGLTLNSEGWANIAELITDHQS
FT                   N"
FT   gene            complement(438687..441542)
FT                   /locus_tag="PC1_0386"
FT   CDS_pept        complement(438687..441542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0386"
FT                   /product="valyl-tRNA synthetase"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: eca:ECA0402
FT                   valyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11443"
FT                   /db_xref="GOA:C6DJN0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJN0"
FT                   /inference="protein motif:TFAM:TIGR00422"
FT                   /protein_id="ACT11443.1"
FT                   /translation="METKYNPQDIEQPLYEHWEKQGYFKPHGDTSKESFSIMIPPPNVT
FT                   GSLHMGHAFQQTIMDTLIRYQRMQGKNTLWQAGTDHAGIATQMVVERKIAAEEGKTRHD
FT                   YGREAFIDKIWQWKGESGGNITRQMRRLGNSVDWERERFTMDEGLSNAVKEVFVRLYKE
FT                   DLIYRGKRLVNWDPKLRTAISDLEVENREVKGSMWHLRYPLADGVKTAEGKDYLVVATT
FT                   RPETMLGDTGIAVNPEDPRYKDLIGKEVILPLIGRRIPIVGDEHADMEKGTGCVKITPA
FT                   HDFNDYEVGKRHQLPMVNILTFDGDIRQSAEVFDTNGEASTVYSSDIPEAFQGLERFAA
FT                   RKALVAAFDELGLLEEIKAHDLTVPYGDRGGVVIEPMLTDQWYVRAAVLAKPAVEAVED
FT                   GRIQFVPKQYENMYFSWMRDIQDWCISRQLWWGHRIPAWYDANGNVYVGRTESEVRSEN
FT                   NLADDVVLNQDEDVLDTWFSSGLWTFSTLGWPEQTPDLKAFHPSSVMVSGFDIIFFWIA
FT                   RMIMLTMHFIKDEDGKPQVPFHTVYMTGLIRDEEGQKMSKSKGNVIDPLDMVDGISLEA
FT                   LLEKRTGNMMQPQLAEKIRKRTEKQFPNGIEPHGTDALRFTLAALASTGRDINWDMKRL
FT                   EGYRNFCNKLWNASRFVLMNTEDQDCGFGAGEKVLSLADRWILAEFNRTVKAYREALDG
FT                   YRFDIAAGILYEFTWNQFCDWYLELTKPVMNGGSEAELRGTRHTLVTVLEALLRLAHPI
FT                   IPFITETIWLRVKALKGISADTIMLQPFPEFDASQEDTLALNDLEWIKQAIIAVRNIRA
FT                   EMNIAPGKPLEVLLRDATAEAQRRVEENRSFIQTLARLENITVLPAGDKGPVSVTKLID
FT                   GAELLIPMAGLIDKAAELDRLAKEVAKIEAEIGRIESKLSNEGFVARAPEAVVAKEREK
FT                   MDGYAVAKAKLLEQQAVIAAL"
FT   gene            complement(441555..442004)
FT                   /locus_tag="PC1_0387"
FT   CDS_pept        complement(441555..442004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0387"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: DNA polymerase III chi subunit HolC; KEGG:
FT                   eca:ECA0403 DNA polymerase III subunit chi"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11444"
FT                   /db_xref="GOA:C6DJN1"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJN1"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ACT11444.1"
FT                   /translation="MKNATFYLLEHDSKSGELSAHEALACDLAAERWRAGKRVLIACED
FT                   EQQAIRLDEALWQRDPTAFVPHNLAGEGPRHGAPVELAWPQRRGNAPRDLLISLLPQFA
FT                   DFATAFHEVIDFVPYEESLKQLARDRYKTYRSVGFQLTTATPPTH"
FT   gene            complement(442109..443620)
FT                   /locus_tag="PC1_0388"
FT   CDS_pept        complement(442109..443620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0388"
FT                   /product="Leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="PFAM: peptidase M17 leucyl aminopeptidase domain
FT                   protein; KEGG: eca:ECA0404 leucyl aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11445"
FT                   /db_xref="GOA:C6DJN2"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJN2"
FT                   /inference="protein motif:PRIAM:3.4.11.1"
FT                   /protein_id="ACT11445.1"
FT                   /translation="MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYISA
FT                   LLRRGELEGKVGQSLLLHHVPNILSERILLIGCGKERELDERQYKQVIQKTINALNETG
FT                   SMEAVCFLTELHVKGRNTYWKVRQAVETAKETLYTFDQLKSNKVELRRPLRKMVFNVPT
FT                   RRELTSGERAIQHGLAIAAGIKAAKDLGNMPPNICNAAYLASQARQLADTYSQNIITRV
FT                   IGEQQMKELGMNAYLAVGQGSQNESLMSVIEYKGDPNPETRPIVLVGKGLTFDSGGISI
FT                   KPADSMDEMKYDMCGAATVYGVMRMAAELALPLNIIGVLAGCENMVDGRAYRPGDVLTT
FT                   MSGQTVEVLNTDAEGRLVLCDTLTYVERYEPDVVIDVATLTGACVIALGHHITGLMANH
FT                   NPLAHELLSASEQSGDRAWRLPLTDEFQEQLESNFADMANIGGRPGGAITAGCFLSRFT
FT                   RKYSWAHLDIAGTAWRSGKAKGATGRPVALLSQFLLNRAGQNDVE"
FT   gene            443904..445019
FT                   /locus_tag="PC1_0389"
FT   CDS_pept        443904..445019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0389"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   eca:ECA0405 putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11446"
FT                   /db_xref="GOA:C6DJN3"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJN3"
FT                   /inference="protein motif:PFAM:PF03739"
FT                   /protein_id="ACT11446.1"
FT                   /translation="MIIIRYLVRETFKSQLAILFILLLIFFCQKLVRILGAAVDGEIPT
FT                   NLVISLLGLGVPEMVQLILPLSLFLGVLMTFGRLYAESEITVMHACGLGKRVLLKAALA
FT                   LAVFTAVIATINVMWLSPWSSRHQEEVLAEAKANPGMATLVEGQFQSAQGGNAVLFVGN
FT                   VKGSEFQHVFLAQLRPSGNARPSVVVADRGHIKQNEDGAQVVTLDNGSRYEGTALLRDF
FT                   RITDFTNYQAVIGHQSVTLNNSDVQQMDMQTLWHSDAHDARAEFHWRLTLILSVLIMAL
FT                   MVVPLSVVNPRQGRVLSMLPAMLLYLIFFLLQSSLRSNASKGKIDPMVWVWLTNLMYFG
FT                   IAVMLNLWDTVPMRKVRARFKPRTLKTQGAA"
FT   gene            445019..446095
FT                   /locus_tag="PC1_0390"
FT   CDS_pept        445019..446095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0390"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   eca:ECA0406 putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11447"
FT                   /db_xref="GOA:C6DJN4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJN4"
FT                   /inference="protein motif:PFAM:PF03739"
FT                   /protein_id="ACT11447.1"
FT                   /translation="MFGVLDRYIGKTIFTTIMTTLFMLVSLSGIIKFVDQLRKVGQGEY
FT                   SALGAGLYTLLSVPKDIEIFFPMAALLGALLGLGQLATRSELVVMQASGFTRLQIATAV
FT                   MKTAIPLVLLTMAIGEWVSPQGEQMARNYRSQMISGGSMISTQGGLWAKDGNDFIYIER
FT                   VAGDKELSGVNIYHFDDSNKLLSVRYAASAEFEDDRNVWRLSQVDESDLSDGKQIGGSQ
FT                   TLSGEWKTNLTPDKLGVVALEPDALSIRGLHNYAKYLKQSGQESSRYQLNMWSKIFAPV
FT                   SVAVMMLMAVSFIFGPLRSVSAGSRIVIGISFGFLFYLLNEIFRPLSLVYGIPPILGAI
FT                   LPSSVFLCISVALLLKRR"
FT   gene            446324..446408
FT                   /locus_tag="PC1_R0015"
FT                   /note="tRNA-Leu1"
FT   tRNA            446324..446408
FT                   /locus_tag="PC1_R0015"
FT                   /product="tRNA-Leu"
FT   gene            446660..447088
FT                   /locus_tag="PC1_0391"
FT   CDS_pept        446660..447088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0391"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   eta:ETA_00490 putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11448"
FT                   /db_xref="GOA:C6DJN5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJN5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACT11448.1"
FT                   /translation="MELIVTHDIADNDREALFAGLRSYNHRFINPASFGQLGIFHRNSV
FT                   GVMTGGLIATRKGLWLCIDYLWVSEESRGLKLGSALVKEAEQEAMRLGCRHALVDTFSF
FT                   QALPFYEKQGYQLHMSLPDFPEEGMFRHYLIKQNIQSA"
FT   gene            447179..448300
FT                   /locus_tag="PC1_0392"
FT   CDS_pept        447179..448300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0392"
FT                   /product="Cupin 4 family protein"
FT                   /note="PFAM: Cupin 4 family protein; SMART: transcription
FT                   factor jumonji jmjC domain protein; KEGG: eca:ECA0420
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11449"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJN6"
FT                   /inference="protein motif:PFAM:PF08007"
FT                   /protein_id="ACT11449.1"
FT                   /translation="MAYQLNLNWPEFLEKYWQKQPVVLKNAFPNFVDPITPDELAGLAM
FT                   EAEVDSRLVSHKNGQWQASNGPFEHFDNLGETGWSLLAQAVNHWHAPSAELVRPFRVLP
FT                   DWRLDDLMISFSVPGGGVGPHIDQYDVFIIQGMGSRRWRVGDKLPMRQFCPHPALLHVD
FT                   PFPPIIDEDLEPGDILYIPPGFPHDGFTHETALNYSVGFRGPNGRDLISSFADYVLEND
FT                   LGGEHYSDPDLTCREHPGRVEDYEFDRLREMMIEVINQPEALKQWFGRFVTTPRHELDI
FT                   APAEPPYEQDEIVGALMDGDVLTRLSGLRVLEVGGSYFINSERLDTVDPKAADALCRYT
FT                   VLGKKELGDALENPAFVAELTGLVNQGYWFFDE"
FT   gene            448477..449637
FT                   /locus_tag="PC1_0393"
FT   CDS_pept        448477..449637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0393"
FT                   /product="secretory lipase"
FT                   /note="PFAM: secretory lipase; KEGG: eca:ECA0421 putative
FT                   exported lipase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11450"
FT                   /db_xref="GOA:C6DJN7"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJN7"
FT                   /inference="protein motif:PFAM:PF03583"
FT                   /protein_id="ACT11450.1"
FT                   /translation="MFHSPQIQRSVLTLFFVISVGMLPLRSSAEADTPGSLTEKTTLDA
FT                   KNGLQEAAEQYLIRYRSLSGVDGKSPREDTGAVFIPKGEAPKGGWPVVVWAHGTVGVQT
FT                   SCAPSLNPRSARDAQYLNTWLSLGFAVVAPDYAGLGSPGLHHYLNARGEAWSVLDGVKA
FT                   ALGAFPLRNQLTIVGQSQGAHAAFASVGYQPDYAPDLHIVSTVLTGVPYFDDKTSAAAL
FT                   FAGGGGVKEGGDPKIPYAMYIYLSAADTEKGLNIDDYFTPKAAADVSAAREMCIDALTK
FT                   KVMDDGLNAGNSLKPATQGLLESQTASLRYNTLKIAHPVFIGTGTQDIDVPAIMQRAFA
FT                   RDIAKAGTSVDVHEYKGMNHDETVNVSLRDSVPFVLKNLHADTKKH"
FT   sig_peptide     448477..448572
FT                   /locus_tag="PC1_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.603 at
FT                   residue 32"
FT   gene            complement(449715..450908)
FT                   /locus_tag="PC1_0394"
FT   CDS_pept        complement(449715..450908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0394"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: eca:ECA0422
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11451"
FT                   /db_xref="GOA:C6DJN8"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJN8"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACT11451.1"
FT                   /translation="MLTLATLIRFELRSLLRDPTLLLTLFGGILLYSFLYPRPYLAQTP
FT                   RELPVVLVDEDGTQLSRRLAFMADSTPEVRLVAQRNTLDEAKALLLHGEAKGILYIPRH
FT                   FYRDIMQGKSVTVSYSADASYFLIYGAIAQSLATVGGTAGAQVKVARLLAQGEGIPAAS
FT                   SQWQATTLNTVPVFNPTMGYVDYVVPGVFMLILHQILLMGCGLLGAGQNQRTQSGGVHY
FT                   WQYATPWRLLLARTAVVGGAYLLSLLYMLGFCLDAYGIAREASMSQLLLFTLPFLLSTL
FT                   WLGVVLGATFTRKDLPSQAVLLSSIPIVFLSGFIWPVEMIPAPLNWLAQWIPAVFTIQG
FT                   ILRLNQMGADFSQIDAFWWHLWMLAALYGLLAWGMLGYRQRQYRRENQAARRWLARD"
FT   sig_peptide     complement(450780..450908)
FT                   /locus_tag="PC1_0394"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.603) with cleavage site probability 0.598 at
FT                   residue 43"
FT   gene            complement(450902..452017)
FT                   /locus_tag="PC1_0395"
FT   CDS_pept        complement(450902..452017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0395"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11452"
FT                   /db_xref="GOA:C6DJN9"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJN9"
FT                   /inference="similar to AA sequence:KEGG:ECA0423"
FT                   /protein_id="ACT11452.1"
FT                   /translation="MMREWSALWRDRWGMALALWLPLVTMLMTWWTLSGAIVRELPIGL
FT                   VDLDNSTMSRQFARALHASPSFNLNHQFPAVAEGSSSLRGGEIYALVVIPRHFERDIRQ
FT                   GTLPTVTAWNNGQFVLVAKVINSSLALVAGTFNGQIAVVQALAQGAAVPEAKGLAVPIG
FT                   GQITALFNQNSNYAQFLLNAIIPSIWSILLALYGMNTLAREDRHGTLWVPENRAAIGSK
FT                   FLTHWLIGWAWGGLWSYGLYSLLDYPLNGSALLLVVSIGVTAGACVALGMAFYALIRDP
FT                   ARTVSIVGALMAPGLAFMGITFPAAAMETFATFWRQLLPVAHYGDIAIAITSYGAGIMQ
FT                   IAPALAALALFWLLLPFTLWRYRSSGKEIAC"
FT   gene            complement(452017..453009)
FT                   /locus_tag="PC1_0396"
FT   CDS_pept        complement(452017..453009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0396"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   eca:ECA0424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11453"
FT                   /db_xref="GOA:C6DJP0"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJP0"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACT11453.1"
FT                   /translation="MTQSLSRSKRKWFLQAILLIVVVWIAYRFWLAYQPEPIRLQGQIE
FT                   AQQYSVSSKVAGRIAEVPVQKGQQLDVGDLVFTLLTPELDAKLEQAKAGEAAAGAVALE
FT                   AQKGAREQQIAAAKDQWQKAKAGSELSHKTYLRVQNLYQEGVLPLQKRDEAKASWDAAR
FT                   YTEGMAWQEYQMAQEGTRKETQVAAEEKARMAAGSVAEVEAYLAEARVVSPHTGEVSNV
FT                   LLRSGEIAPQGFPVVTLLDMSDIWIQLAVREDLLERFAMGTEFEARIPALNNQTFRFKV
FT                   SYVSVMGDFATWRATDTRQGFDMRTFEVEARPIEPINGLRVGMSALVEM"
FT   gene            complement(453006..454427)
FT                   /locus_tag="PC1_0397"
FT   CDS_pept        complement(453006..454427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0397"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   eca:ECA0425 putative outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11454"
FT                   /db_xref="GOA:C6DJP1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJP1"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACT11454.1"
FT                   /translation="MPRITHKKIRPLTYFPIALLLLQCWSPTTWGQTISFNQAWARLLQ
FT                   SDDSIAAEHAGVDRAQSLKESAKGLYWPQVNVGASYTRLDKPVELDARDLNPLSNHRDI
FT                   FAALNQLINISGNPFVTRFTEQNVVTSSVQVVWPLFTGGRIDAAQSIRAAQVNEAEQML
FT                   IVRTLAQFEALAQTYYGVVMAHQVMKTRQDIEKGMAQHYDHARKLEAQGQIARVEVLSA
FT                   QSAYDMARIETQKARRSMETTEMVFAKLIKTEGATPSSPLFVNKALPELPALVKQTLNT
FT                   HPGLKVLSAKRDQAKDLIRIERAKYAPDVFLFGNYQLYEQDTLAARTTPDWMVGVGVSV
FT                   PLISREGRSDNIAAAKSAEMQVNYLEADMRQNLEIMVESTWREARLALEEFNSLSSTQK
FT                   LAEENVRLRNKAFMQGMSTSLDVVDALNQLAGAKTQRASAAYRYVVSIARLMAISGQIT
FT                   RFSDYQTQHAIQVMP"
FT   sig_peptide     complement(454332..454427)
FT                   /locus_tag="PC1_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.972 at
FT                   residue 32"
FT   gene            complement(454792..456231)
FT                   /locus_tag="PC1_0398"
FT   CDS_pept        complement(454792..456231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0398"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="TIGRFAM: aspartate ammonia-lyase; PFAM: fumarate
FT                   lyase; KEGG: eca:ECA0426 aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11455"
FT                   /db_xref="GOA:C6DJP2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJP2"
FT                   /inference="protein motif:TFAM:TIGR00839"
FT                   /protein_id="ACT11455.1"
FT                   /translation="MSTNIRIEEDLLGTREVPADAYYGIHTLRAIENFYISNSTISDIP
FT                   EFVRAMVMVKKAAALANKELQTIPRKIADTILQACDEVLNNGKCLDQFPVDVYQGGAGT
FT                   SVNMNTNEVLANIGLELMGHQKGEYQYLNPNDHLNKCQSTNDAYPTGFRIAVYTSILKL
FT                   VEAITQLSDGFERKAKEFENILKMGRTQLQDAVPMTLGQEFHAFNVLLKEENRNLLRTA
FT                   ELLLEVNLGATAIGTRLNTPDEYQKLAVQHLAKVSGLPCVPAEDLIEATSDCGAYVMMH
FT                   SALKRVAVKLSKICNDLRLLSSGPRTGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVC
FT                   FKVIGNDTCVTMAAEAGQLQLNVMEPVIGQAMFESIQILSSACYNLLEKCVDGITANKD
FT                   VCEAYVFNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTEEQLDDIFS
FT                   IQNLMHPAYKAKRYTDENEAV"
FT   gene            complement(456484..457479)
FT                   /locus_tag="PC1_0399"
FT   CDS_pept        complement(456484..457479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0399"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: eca:ECA0427 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11456"
FT                   /db_xref="GOA:C6DJP3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJP3"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACT11456.1"
FT                   /translation="MVKRTVSANKSIDMYAVYVFVTMAEAGSMTAAAARLGLTPSAISQ
FT                   TIRLLEEDFGVKLVNRARRPFVLTPYGIALKNRGEILTEEIANLKAQVLEAGKGIKPDL
FT                   RIGLVDSFAITCGSVFTKSLMKSSSQLLIRTGLSPQQGEALMRRELDLIVTSDPLIDSD
FT                   SVVRHQLFSEGYFIITPPDYRKRIKTVEDIRELSAALPLVRFNRNSQIGMQIERYLRRI
FT                   DVRVPNMLEFDNADTLTSMVAAGIGWAVTTPLSFLQSVAHSREVLTHMPEQLNIKRSLY
FT                   IVGHRDEYSAFFEEACDVTHDIIKTVFIPKLKTLNRGIEKLVEINPDNTE"
FT   gene            complement(458071..458406)
FT                   /locus_tag="PC1_0400"
FT   CDS_pept        complement(458071..458406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0400"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11457"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJP4"
FT                   /inference="similar to AA sequence:KEGG:ECA0128"
FT                   /protein_id="ACT11457.1"
FT                   /translation="MTDTHATPADSTITIFRDLIASLPFAQLDDIQLCDLGAIAAESVE
FT                   GLCHGLHYLGDTLQNDVELPQESLSQLGACLNATAHLIPALLEMCEQAERHVRTVTTVS
FT                   DAPFTTQ"
FT   gene            complement(458461..458537)
FT                   /pseudo
FT                   /locus_tag="PC1_0401"
FT   gene            458850..459269
FT                   /locus_tag="PC1_0402"
FT   CDS_pept        458850..459269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0402"
FT                   /product="Glutathione transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: kpn:KPN_04759 putative
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11458"
FT                   /db_xref="GOA:C6DJP5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJP5"
FT                   /inference="protein motif:PRIAM:2.5.1.18"
FT                   /protein_id="ACT11458.1"
FT                   /translation="MLKGLNHLTFAVTDLAASLDFYQNLLQMTLHARWESGAYLTCGDL
FT                   WLCLSLDPVRQCLSKEDSDYTHYAFSIEQANFLPFCTRLMAENIPVWKTNRSEGDSFYF
FT                   LDPDGHKLEVHVGDLQQRLAACRKNPYQGMVFELP"
FT   gene            complement(459277..460860)
FT                   /locus_tag="PC1_0403"
FT   CDS_pept        complement(459277..460860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0403"
FT                   /product="Sigma 54 interacting domain protein"
FT                   /note="PFAM: regulator of RNA terminal phosphate cyclase;
FT                   sigma-54 factor interaction domain-containing protein;
FT                   ATPase associated with various cellular activities AAA_5;
FT                   SMART: AAA ATPase; KEGG: esa:ESA_00062 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11459"
FT                   /db_xref="GOA:C6DJP6"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009715"
FT                   /db_xref="InterPro:IPR017183"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJP6"
FT                   /inference="protein motif:PFAM:PF06956"
FT                   /protein_id="ACT11459.1"
FT                   /translation="MKRRVIIGVLGTTLDKRGKRENRWTKWRPTVGLCQQPDFPVDRLE
FT                   LLHQSRNEGMAQQVAEDIAVVSPATQVTLQTVELRDPWNLEEVYSAFLDFASRYPFDTE
FT                   NEEYFVHITTGTHVVQICWFLLTEARYLPAKLLQTAPGEKADRPAPQGIYAVIDLDLSR
FT                   YATLTSRFQHEQERSVSFLKSGIETRNSTFNALIDQIERVALRSTAPMLLTGPTGAGKS
FT                   FLAQRIYQLRQSRHLVSGRFVAVNCATLRGDNAMSTLFGHVKGAFTGALQARTGLLREA
FT                   DGGMLFLDEIAELGLDEQAMLLKAIEEKHFLPFGSDKEVSSDFQLIAGTHRNLHEWIAQ
FT                   GKFREDLYARINMWTFPLPGLAERREDIEPNIDYELQRFTRDHQTQIRFDKDARQRYLT
FT                   FACSPQAAWRGNFRELGSSIARMATLAEQGRITVALVEEEVARLQASWRRDAPATALPP
FT                   ELANIDLFEQRQLETVLDVCRTANSLSEAGRQLFAVSRQQKQKPNDADRLRKYLARFGL
FT                   SWEELKRGEG"
FT   gene            461052..462287
FT                   /locus_tag="PC1_0404"
FT   CDS_pept        461052..462287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0404"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   esa:ESA_00065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11460"
FT                   /db_xref="GOA:C6DJP7"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJP7"
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /protein_id="ACT11460.1"
FT                   /translation="MEEMKMQDYDMMSPVNSAPVKMWTQGVPVEPEARDQLLNTAKMPF
FT                   IFKHLAVMPDVHLGKGSTIGSVIPTRGAIIPAAVGVDIGCGMIAVRTSLVASDLPDNLM
FT                   GLRSAIEQAVPHGRSVTRSKRDVGSWQNPPQTVDAHWSLLEPRFKRLTDKYPQLLKTNN
FT                   YQHLGTLGTGNHFIEICLDEVDRVWVMLHSGSRGVGNAIGSLFIKLAQEDMQQHIANLP
FT                   DRNLAYFEEGSLHFDDYIEAVEWAQDFARHNREVMMSHTLAALSRIVTKPFTTQQEGVN
FT                   CHHNYVQRETHFGESVLITRKGAVSAQKGQMGIIPGSMGAKSFIVRGLGNEESFCSCSH
FT                   GAGRTMSRTAAKKRFTVEDQIRATAHVECRKDSDVIDEIPMAYKDIDKVMAAQSSLVEI
FT                   VHTLRQVVCVKG"
FT   gene            462292..463083
FT                   /locus_tag="PC1_0405"
FT   CDS_pept        462292..463083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0405"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: esa:ESA_00066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11461"
FT                   /db_xref="InterPro:IPR018775"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJP8"
FT                   /inference="similar to AA sequence:KEGG:ESA_00066"
FT                   /protein_id="ACT11461.1"
FT                   /translation="MMEKDYRVDAAMRTRIKLVLQDVEERYQVKVLYACESGSRGWGFA
FT                   SPDSDYDVRFLYVHRPEWYLRVEAQRDVIELPIDDELDVCGWEWRKALGLLKRANPTLI
FT                   EWLDSPVVYQEDRDATSALRATVPTWFSPSKARWHYLSMARKNFRGYLQDETVRLKKYF
FT                   YVLRPLLAVRWIEAGKGMPPMRFSQLLAGTVDDPRLLAEIHQLLEIKQRSGEAEYGPRR
FT                   EVIHAFITQMLSDADSLAELPDSKSDDDTMLDALLYRTVMA"
FT   gene            463124..464467
FT                   /locus_tag="PC1_0406"
FT   CDS_pept        463124..464467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0431 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11462"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJP9"
FT                   /inference="similar to AA sequence:KEGG:ECA0431"
FT                   /protein_id="ACT11462.1"
FT                   /translation="MASYDLLLQQLEKLVASPDNYYRPAQADALGSASHLITLTRHYNG
FT                   HIRQRAVLCLGFMDEVSALPALIERVNDWAEPVRRAAKQSVRLLLTPNNTASFVANLPA
FT                   IFWLLQCQREDHQPLVDEIVSFLSEEAHAPSLFAGLCSEDKTVARLSLDILAERECFPL
FT                   KQIFGQAMLHHDPLVRANAVRYLLSADKDVDHDVLTILLKDSFAPIKQVALQYVIDNAF
FT                   PVSESQLIALLFDKNALVRQRASALLRERNDDPVAHYLAVLDRASTVTVRKTTLWGLDE
FT                   HRYDGIVALAERNLDERYPSLYYSALRILILRTGDDARERLLDSLRNPSIAITKVARKL
FT                   FYQQKIYLSLSELQCCLDSASSREHVEVYYFLAHKLNKWDWLVFLLDNAKSENTALTQT
FT                   GVAYWVQRFNRSGMLPDTRQQARLRTLLDENPHVISRDSPYIALFLYS"
FT   gene            464547..464831
FT                   /locus_tag="PC1_0407"
FT   CDS_pept        464547..464831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0407"
FT                   /product="putative DNA-damage-inducible protein J"
FT                   /note="KEGG: ppr:PBPRA1505 putative DNA-damage-inducible
FT                   protein J"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11463"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJQ0"
FT                   /inference="similar to AA sequence:KEGG:PBPRA1505"
FT                   /protein_id="ACT11463.1"
FT                   /translation="MSTIHFRIDEETKQLAMQAADRHQVSLTELMRQRAEELAEEERQY
FT                   QRNAGDEWLEAQIQDAFSRYDAGEGEFVSNEDVSQRMDALKAWAARGEL"
FT   gene            464828..465133
FT                   /locus_tag="PC1_0408"
FT   CDS_pept        464828..465133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0408"
FT                   /product="addiction module toxin, RelE/StbE family"
FT                   /note="TIGRFAM: addiction module toxin, RelE/StbE family;
FT                   PFAM: plasmid stabilization system; KEGG: rle:pRL110045
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11464"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJQ1"
FT                   /inference="protein motif:TFAM:TIGR02385"
FT                   /protein_id="ACT11464.1"
FT                   /translation="MIFKVRWEKQALADREGIYRYLYKEAGLDVANAADEKFISSVSLL
FT                   EATPEAGLDIGKSGERRKLVLTRFPFIIIYALKRKINEVHILRILHTSRKLSASYR"
FT   gene            complement(465139..465930)
FT                   /locus_tag="PC1_0409"
FT   CDS_pept        complement(465139..465930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0432 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11465"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJQ2"
FT                   /inference="similar to AA sequence:KEGG:ECA0432"
FT                   /protein_id="ACT11465.1"
FT                   /translation="MAATNHWTRDQLLIAFTLYSQLPFGRLHSRNPDIIRYAKLINRTP
FT                   SALAMKLVNLASLDPFIIDSGRTGLRGASNADRALWQEMDSNPELFEQQCQQAMVSLEA
FT                   GAAKATTAPSPFKANDSEIPDYHGGERLTQVKTRIGQQLFRKRVLSNYGERCCVTGLEE
FT                   PALLVASHIQPWKTAAEYRLDPSNGLCLSNLHDKAFDMGLISFNDSLEMLLSPRIKKLK
FT                   SAISDVNFAQYEGKQIHVPDTYPPNLSQMAFHREHIFLARG"
FT   gene            466085..467182
FT                   /locus_tag="PC1_0410"
FT   CDS_pept        466085..467182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0410"
FT                   /product="protein of unknown function DUF1615"
FT                   /note="PFAM: protein of unknown function DUF1615; KEGG:
FT                   eca:ECA0433 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11466"
FT                   /db_xref="InterPro:IPR011673"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJQ3"
FT                   /inference="protein motif:PFAM:PF07759"
FT                   /protein_id="ACT11466.1"
FT                   /translation="MPRSSIPLFRPLCALALLVLAGCASKTATTPESRPADVRAQVLKL
FT                   LPDNVKDRQGWATDIATAFTAQGLDPSNENLCSVLAVTEQESTFSADPQVPNLSKIAWQ
FT                   EIDRRAEKVHVPAFLVRTALLIKSPNGKSYSERLDKVRTEKELSAIFDDFIDMVPMGQT
FT                   LFGRLNPVHTGGPMQVSIAFAEANAKGYPYTVDGSLRREVFSRRGGMYFGIKHLLDYPA
FT                   NYPQSIYRFADFNAGRYASRNAAFQRAVSRLTGVKLALDGDLINYSSDKASATELAVRA
FT                   LGKHLDMSDSAIRRALEKGNSLDFEDTSLYERVFALADKSGTKAPRAILPGITLESPKI
FT                   TRKLTTAWFAQRVDERRQRCLARAK"
FT   sig_peptide     466085..466168
FT                   /locus_tag="PC1_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.617 at
FT                   residue 28"
FT   gene            complement(467232..468701)
FT                   /locus_tag="PC1_0411"
FT   CDS_pept        complement(467232..468701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0411"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: sulphate transporter; Xanthine/uracil/vitamin
FT                   C permease; KEGG: eta:ETA_28920 sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11467"
FT                   /db_xref="GOA:C6DJQ4"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJQ4"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ACT11467.1"
FT                   /translation="MNLSTLRHDIPAGLVVFLVALPLSLGIAQASGLPPFVGLLTGVVG
FT                   GIVVTLFSPSRYAVSGPAAGLVTIVSGSIASLGSFSALLLAIMLAGVLQCILGLLRAGR
FT                   FITLIPGTVIKGMLSAIGILLIIQQIPLAFGSDGEDDLTSLFDTSEPGFSASALTVCLI
FT                   GLAILWLWTTKPVQKISALSWLPGPLVAVLFGGLFTVYGERLSSDMVDNLPRIVLPEFG
FT                   NLEQFMGEMIRPDWQAWKNPAVYVVAVTLALVASLETLLSQEALKKIRPQHPVPSPDKE
FT                   MRAQGIGNMVSGFLGGLPITAVIVRSSVNVNAGARTKFSILLHGVLLLLCGLFMTDLLN
FT                   VIPLASLAAVLLYTGYKLASPQQFLLLWRQGLQQFVPFAATVIGIIVFGMLAGIGLGIV
FT                   TQLAFSIYKSHRNAMQLTRYGDHFVLSFQQNLTFVHNPRLQGLLNKIPANSVVIVEHDN
FT                   ADYIDPDVRTMLEDFRENAQERGIKLNQWPV"
FT   sig_peptide     complement(468609..468701)
FT                   /locus_tag="PC1_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.987 at
FT                   residue 31"
FT   gene            complement(468698..469360)
FT                   /locus_tag="PC1_0412"
FT   CDS_pept        complement(468698..469360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0412"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: carbonic anhydrase; KEGG: eta:ETA_28930
FT                   carbonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11468"
FT                   /db_xref="GOA:C6DJQ5"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR015892"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJQ5"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ACT11468.1"
FT                   /translation="MFSKKRVFNLTTLKPLLAKNRSWATLRRQRHPHYFRKHTQGQTPH
FT                   SLWIGCSDSRVPAEVLTGSAPGELFVHRNIANMVVTDDDNFMSVLQYALEYLHVSRIVL
FT                   CGHYGCGGVQAAVNLPDMGLAQENSALSRRITALRQALSPHIAASQEGDADDSTRQNQL
FT                   VEANVLAQFAHLIACEPVQKAWRHGVELDVFGCVYDLHSGHLKELIHRHAKEQEASP"
FT   gene            complement(469913..471874)
FT                   /locus_tag="PC1_0413"
FT   CDS_pept        complement(469913..471874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0413"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: Nitrate and nitrite sensing domain protein;
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein; SMART: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   eca:ECA0434 methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11469"
FT                   /db_xref="GOA:C6DJQ6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR010910"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJQ6"
FT                   /inference="protein motif:PFAM:PF08376"
FT                   /protein_id="ACT11469.1"
FT                   /translation="MKSLHHISIRSKFILALLPPILALLWFSFSGVMERRGTENEMIRM
FT                   AKLITLARDAGEFAHQLQRERGMSAGYFGSQGKKFGSELTTQRQDTDRAQQQFQQTAAN
FT                   LSDSELGNDVSGEIGKIAQRMQQIGEYRRNIDSLSISVTQALGYYSDSVNYLLNIVGDM
FT                   THLVSDGSIAQRLAAYYNLLNVKEQAGLERAVLSNTFSANSFAAGMFERLNQMVGKGEA
FT                   YTTAYNMFANTDLRKAFEQALNNPSAQNALQMRNKAIASPGGNFGIDASQWFNQQTAKI
FT                   DELKKVEQLAANDLATQVNTLAAEARQSWISYLAGALISLLMALGLASMIMRSINEQLQ
FT                   QTLTTIREMGGDLTRRLRVPGTDELSQLNQAYNASLENIADMVVSIKHSSQTIGRASSE
FT                   IANGNQDLAQRTEEQSASLVQTASSMEEITVTVKQTADFAGQARQLTTEVDDQAQRVGT
FT                   ITESASGAMERIQDASQRVNAVVTAIDAIAFQTNLLALNAAVEAARAGQHGRGFSVVAA
FT                   EVRQLSQRSADEAGKIRALIADSIASVSEGTKLVNQSNRGISDIVSGTRKVRDLVNEIA
FT                   VAADEQSLGIAQINEALSQLEMVTQQNATLVSQASVASQLLDEQAIEMESLVSRFKVDD
FT                   SAPQQTLQQSLPQARLPR"
FT   sig_peptide     complement(471782..471874)
FT                   /locus_tag="PC1_0413"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.945) with cleavage site probability 0.325 at
FT                   residue 31"
FT   gene            complement(472235..474889)
FT                   /locus_tag="PC1_0414"
FT   CDS_pept        complement(472235..474889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0414"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: geo:Geob_1512 fibronectin type III domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11470"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJQ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11470.1"
FT                   /translation="MIPARLRKALLLTLALASATTFNAVSTIANSASAANVEATGLVDS
FT                   ITFGDKTSESGHDLNANNSQTIAGALGESSRKLLPFQQPGVNGGSLTFTMQIDPLRRNY
FT                   VSVKLWGEDDGNINTGRLYLYMIKDGVEYQIGYRHEGDYSPLSVAHWNKPLPGRFFYST
FT                   TLLPYSMTKGSTSITLKIVSTGRLYPFGSGGPESTKPYQYAMNQPSRGIYRAYTHIDPF
FT                   LNVAGEKQGSEPAATTRPSPGDEILGTNGRFRTAMNNHIQTLISKPSTTDALSGGDLRY
FT                   LARAWSVPELVSYQNSGLVDKVVATLDAYAAQYYADTNIATKNWGGNFGSQGQAIYYLR
FT                   NALTASRLDESVNYGNAGVKKRRVAWADMLFASREFGRQKNRLVLSNQSLIANTNIYFT
FT                   NKGLLVLSDSRAFPETTAQRYIKEAVGLLPWTGDDRNGPGDGGWAPFGDRYYQVTDKGQ
FT                   TREWGYLGAGYGEVQSYLAEYYRVTGNEDFRKQMIKMAKARAPFRRPAIEISNGANYRA
FT                   MEAIGLLAWRGAHESDGNFAGFLTYVDAVNTNERAKGLRVAAASKDATLIGYAKQMLED
FT                   NQFFANLDGAESAFEALDVFADYQTIKTASDSGARLPMSADQPDFAWADEENAIVAVKK
FT                   GNERLWLSTYWQAKAGTGINGLARFHFSTPSYDQYGVLETTPIFRSTTSYTRPNRIDMP
FT                   EKTPYTPPNPPTNAYAGEVLPLGIKPEDASNDEPFRGKADFYATRFGHYLIGINANASN
FT                   RYVLKTPVGFKNAEDLVSQRTLSGNITVDPRSTAVLYLNDTRDTKAVPNAPLHLGSQNS
FT                   NGINTLFWTQSSGSEHYKVMRSTSENGTYQAIATVTENSYSDRTGTASGRYYYRIVATN
FT                   GNGESYPSMASQP"
FT   sig_peptide     complement(474785..474889)
FT                   /locus_tag="PC1_0414"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.792 at
FT                   residue 35"
FT   gene            complement(475093..477804)
FT                   /locus_tag="PC1_0415"
FT   CDS_pept        complement(475093..477804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0415"
FT                   /product="magnesium-translocating P-type ATPase"
FT                   /note="TIGRFAM: magnesium-translocating P-type ATPase;
FT                   ATPase, P-type (transporting), HAD superfamily, subfamily
FT                   IC; PFAM: E1-E2 ATPase-associated domain protein; cation
FT                   transporting ATPase domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase; KEGG: eca:ECA0435 magnesium
FT                   transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11471"
FT                   /db_xref="GOA:C6DJQ8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006415"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJQ8"
FT                   /inference="protein motif:TFAM:TIGR01524"
FT                   /protein_id="ACT11471.1"
FT                   /translation="MTDMITQTGYRRARKTPTATFAIAREAQNSLDQTLANLNTHLHGL
FT                   SHDDVIERQQTYGENRVAHEKAPHALVQLAAAFNNPFIYVLTALAAISFFTDYWLPLRH
FT                   NEETSLTGVIIILVMVSLSGLLRFWQEFRTNKAAEALKSMVRTTATVLRRPHASATAVM
FT                   QEIPLQQLVPGDMLFLSAGDMVPADVRLVESRDLFVSQAVLTGESLPIEKYDVFSDISA
FT                   KGSQPTGCVGESDLLALSNICLMGTNISSGTATAIVVATGSHTYFGSLAKSIVGTRSQT
FT                   AFDRGVNSVSWLLIRFMIVMVPIVLLINGFTKGDWMEASLFALAIAVGLTPEMLPMIVS
FT                   SNLAKGAIAMARRKVVVKRLNAIQNFGAMDVLCTDKTGTLTQDRIILEHHLNTQGQVDE
FT                   SVLQLAWLNSAHQSGMKNLMDQAIMQFGRHNPAIAALGRYRKIDELPFDFIRRRLSIIV
FT                   ADEHDQQRLICKGAVEEMLSVATHVNENGQRYELDDERRNTLKMLAENYNQQGFRVLMI
FT                   GTRELSPVGSTLPLSAEDERDLTICGLLTFLDPPKESASAAIRALHENGVTVKVLTGDN
FT                   AIITSKICRDVGLEPGEVLEGNAIDALSDEQLSVLVEQRTIFARLTPLQKSRVLKALQG
FT                   NDHTVGFLGDGINDAPALRDADIGISVDTGTDIAKESADIILLEKNLMVLEEGVIKGRE
FT                   TFGNIIKYLNMTASSNFGNVFSVLVASAFIPFLPMLAIHLLIQNLMYDISQLSLPWDKM
FT                   DKEFLRKPRKWDAKNIGRFMLCIGPTSSIFDITTYALMWFVFAANSVEHQALFQSGWFV
FT                   EGLLSQTLVVHMLRTQKIPFIQSTAALPVMLMTGLVMAMGIYLPFSPLGPLVGLQPLPW
FT                   EYFPWLAATLIGYCTVAQLVKRAYIRRFGQWF"
FT   gene            complement(478322..479899)
FT                   /locus_tag="PC1_0416"
FT   CDS_pept        complement(478322..479899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0416"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: eca:ECA0436
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11472"
FT                   /db_xref="GOA:C6DJQ9"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJQ9"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACT11472.1"
FT                   /translation="MKFSQLTVFSKLLLGFSVLIAMMLLLGVVSLLQLSVNNSRIDELS
FT                   SSSLPGVRYSLEMRGVLSETRLQQIQYIDSKTPEEREGHRKELLQNADAFLAAFKNYQT
FT                   VANSEDKKALIKVIGENFSGFNSVNATLIDTVNRGDLAEASRISGANSSKYRSQLMKDL
FT                   AKLVEMEVATAKNIVDGANSTYRTSQYYVWGLLLLALLTTAVIATIISRNISRQLGGDP
FT                   HYAQEIMTEIASGNLTTEIKLRQGDNSSLLASINHMNRQLVNTVHTIMNGSESITLASS
FT                   EIAQGNSDLSQRTEEQAASLIQASANMQQLTHTVRQNADNAKEASQLAQQTSETASQGG
FT                   LIVDDMLKRMHEISDSSQKIVDIIAVIEGIAFQTNILALNAAVEAARAGSEGKGFAVVA
FT                   GEVRTLAQKSANAAKEIKTLIEGTVEKITDGSARADKASQAMSEIVQSVKKVTDIVAEI
FT                   SQASNEQHIGIKEISVAVEQMDRVTQQNAALVEESATAAHAMTEQGEQLRDAVRFFKVN
FT                   QDHLLRIH"
FT   sig_peptide     complement(479792..479899)
FT                   /locus_tag="PC1_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.256 at
FT                   residue 36"
FT   gene            complement(480455..480769)
FT                   /locus_tag="PC1_0417"
FT   CDS_pept        complement(480455..480769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0417"
FT                   /product="L-rhamnose 1-epimerase"
FT                   /note="TIGRFAM: L-rhamnose 1-epimerase; PFAM: protein of
FT                   unknown function DUF718; KEGG: eca:ECA0437 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11473"
FT                   /db_xref="GOA:C6DJR0"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013448"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJR0"
FT                   /inference="protein motif:TFAM:TIGR02625"
FT                   /protein_id="ACT11473.1"
FT                   /translation="MLRKAFVMSVFPDCHDDYQRRHNPIWPELAEVLKNHGAHHYSIFL
FT                   DKQRNLLFGYVEVESEARWEAIAQTEVCQRWWKYMSDVMPSNPDNSPVSEALEPVFYLD
FT                   "
FT   gene            complement(480858..481682)
FT                   /locus_tag="PC1_0418"
FT   CDS_pept        complement(480858..481682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0418"
FT                   /product="rhamnulose-1-phosphate aldolase"
FT                   /EC_number="4.1.2.19"
FT                   /note="KEGG: eca:ECA0438 rhamnulose-1-phosphate aldolase;
FT                   TIGRFAM: rhamnulose-1-phosphate aldolase; PFAM: class II
FT                   aldolase/adducin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11474"
FT                   /db_xref="GOA:C6DJR1"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR013447"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJR1"
FT                   /inference="protein motif:TFAM:TIGR02624"
FT                   /protein_id="ACT11474.1"
FT                   /translation="MQAILSSWFVQGMIKATSDMWLKGWDERNGGNVSLRLTAEDVTPY
FT                   ESDFYPQPRHEALSQPMPALADCWFIVTGSGKFFRNVQLDPADSLVVLQVDSDGKGYRI
FT                   FWGLTNGGLPTSELASHFQSHIVRMGVTHGHDRVIMHCHATNLIALSYVLELDTAKFTR
FT                   ELWEGSTECLVVFPDGVGIVPWMVPGTDAIGDATSEQMQRHSLVLWPFHGIFGTGPTLD
FT                   DAFGLIDTAEKSAEVMVKVRSMGGKKQTISTEELIALGKRFGVTPMEVALRV"
FT   gene            complement(481687..482949)
FT                   /locus_tag="PC1_0419"
FT   CDS_pept        complement(481687..482949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0419"
FT                   /product="L-rhamnose isomerase"
FT                   /EC_number="5.3.1.14"
FT                   /note="KEGG: eca:ECA0439 L-rhamnose isomerase; TIGRFAM:
FT                   L-rhamnose isomerase; PFAM: L-rhamnose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11475"
FT                   /db_xref="GOA:C6DJR2"
FT                   /db_xref="InterPro:IPR009308"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJR2"
FT                   /inference="protein motif:TFAM:TIGR01748"
FT                   /protein_id="ACT11475.1"
FT                   /translation="MSTPIETAWQLAKARYASLNIDVEAALEQLDQIPVSMHCWQGDDV
FT                   AGFENTGGPLTGGIQATGNYPGKASTPDELRADLEQAFALIPGPKRLNLHAIYLESAQP
FT                   VARNEIAPEHFRTWVEWAKRHQLGLDFNPTCFSHPLSADGFTLSHPDEKVRRFWIEHCQ
FT                   ASRRISAYFGRELGTPSVMNIWVPDGMKDLTIDRLAFRQRLLSALDEIIAEPLDQAHHI
FT                   DAVESKLFGIGAESFTVGSNEFYLGYAASRGTALCLDAGHFHPTEVISDKISSAILYVP
FT                   RLLLHVSRPVRWDSDHVVLLDDETQAIAHEIVRHKLLNRVHIGLDFFDASINRIAAWVI
FT                   GTRNMKKALLRALLEPTETLRKLEQNGDYTARLALLEEQKSLPWQAVWEHYCQCHDVIP
FT                   GSEWLQQVRQYEETILTQRQG"
FT   gene            complement(482946..484436)
FT                   /locus_tag="PC1_0420"
FT   CDS_pept        complement(482946..484436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0420"
FT                   /product="rhamnulokinase"
FT                   /note="TIGRFAM: rhamnulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: eca:ECA0440 rhamnulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11476"
FT                   /db_xref="GOA:C6DJR3"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR013449"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJR3"
FT                   /inference="protein motif:TFAM:TIGR02627"
FT                   /protein_id="ACT11476.1"
FT                   /translation="MAVKNIVAVDLGASSGRVMLATLHTATQHLTLKEIHRFSNTLVFQ
FT                   DNHHQWDLAALERDILTGLHQIDAMGIVPDSIGIDSWGVDYVLLDQDGQRVGLPYSYRD
FT                   HRTDGVMATVTAELGREAIYQRTGIQFLPFNTLYQLKALCDAPSDDLHQVAHLLMIPDY
FT                   FHYRLTGSLVCEYTNASTTQLLSLEKKTWDSELLDYLGVPRRWLSDPVQPGHAVGKWAA
FT                   PSGRQISVTAVATHDTASAVVGAPLQSRDSAYLSSGTWSLMGIESDTPFNSPQALAANI
FT                   TNEGGVDGTYRVLKNIMGLWLLQRVCQERDIKDLGALIEAAAALPAFASLINPNDDRFI
FT                   NPPSMHQAIRDYCREHGQPVPHSDAELARCIFDSLALLYRQVVLELGELRHAPIRQLHI
FT                   VGGGSQNAFLNQLCADVCQIPVLAGPVEASTLGNIGCQLMALGAVADLAAFRHMLTHNF
FT                   PLHRYTPRAESDFAGHWRRFQALSQPETAPKGKKETTQ"
FT   gene            484772..485611
FT                   /locus_tag="PC1_0421"
FT   CDS_pept        484772..485611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0421"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: AraC protein arabinose-binding/dimerisation;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: helix-turn-helix- domain containing protein AraC
FT                   type; KEGG: eca:ECA0441 transcriptional activator RhaS"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11477"
FT                   /db_xref="GOA:C6DJR4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR023609"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJR4"
FT                   /inference="protein motif:PFAM:PF02311"
FT                   /protein_id="ACT11477.1"
FT                   /translation="MTLLRGDDFFTSRAVTVAVEPRTPQTAFPEHYHDFWEIVLVEQGA
FT                   GVHVFNDQPYALCSGSVFFVRDNDRHLFEDVEGLCLTNMLYRSPRGFRFLSDIAAFLPY
FT                   GPNGEWQGQWQVNAAGMQQLKQSLNSLAELAQSDAPEAIAASESLFLHILVQLRQQCFQ
FT                   TQSSGSERQGVQALLGWLQNNYSEEVNWGSLADRFSLPLRTLHRQLKQHTGMTPQRYLN
FT                   RLRLLEARRRLQQSDDSITTIAHACGFSDSNHFSTQFRKAFSQAPKSLRHQAFSREE"
FT   gene            485636..486490
FT                   /locus_tag="PC1_0422"
FT   CDS_pept        485636..486490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0422"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   Cupin 2 conserved barrel domain protein; SMART:
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   KEGG: eca:ECA0442 L-rhamnose operon transcriptional
FT                   activator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11478"
FT                   /db_xref="GOA:C6DJR5"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR023699"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJR5"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACT11478.1"
FT                   /translation="MATAVRGLKLQTEDYFLTDKNVVMVAERHPQPVFPLHHHDFDELV
FT                   IVWRGNGLHLWNDVPYRITRGDMFYVSANDRHSYESVHGLELDNILYIRNRLTLSADWQ
FT                   RLLPGGEHPQSQRHWCLGSEGMDTLREKVDALRQECMKSDALSLQLSEALLLQIALLAA
FT                   RYRHTPDNPQLADAHQLDMLMNALRASIAAPFRFEAFCEQHHFSARSLRSRFKEQTGMS
FT                   VPHYLRQLRLCKAMELLRYDLQTIGDIAALCGFEDSNYFSVVFHQAFGVSPSAYRQRFL
FT                   NVE"
FT   gene            486552..486842
FT                   /locus_tag="PC1_0423"
FT   CDS_pept        486552..486842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0423"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; KEGG: shn:Shewana3_1797 CopG family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11479"
FT                   /db_xref="GOA:C6DJR6"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJR6"
FT                   /inference="protein motif:PFAM:PF01402"
FT                   /protein_id="ACT11479.1"
FT                   /translation="MADTTRQTTTLRIDQDIKERLKTLADDRHSSAHALMLEAIAEYVE
FT                   REEKRSQYRKETLVAWEEYQNTGEHITADETVTCLESWGSGHEQDAPACHK"
FT   gene            486830..487057
FT                   /locus_tag="PC1_0424"
FT   CDS_pept        486830..487057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0424"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xfa:XF2074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11480"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJR7"
FT                   /inference="similar to AA sequence:KEGG:XF2074"
FT                   /protein_id="ACT11480.1"
FT                   /translation="MPQMIVSESARRGLQRLQDFLKNKNALAAKKAAEVLIRGIRQLAA
FT                   LPNIGRPVEHLPLEYQELVIEFGSSGYVML"
FT   gene            complement(487195..488904)
FT                   /locus_tag="PC1_0425"
FT   CDS_pept        complement(487195..488904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0425"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: eca:ECA0445 ABC transporter ATP
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11481"
FT                   /db_xref="GOA:C6DJR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJR8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACT11481.1"
FT                   /translation="MSLNPLPHPSHTASDASAKTPLLHVDGLSVTFPSPFGPIRSVKNL
FT                   SFQVNAGEILALVGESGSGKSVTARTLVGLAGENVDVQANAIELTRHDGSLCDLRYLTD
FT                   RDWRTIRGREIGFVLQDALVSLDPLRKIGQEVAEPILTHHLLPRQQVPARVAELLTKAG
FT                   IPDPEHRAVQYPHELSGGLRQRALIASALAAGPQLLIADEPTTALDATVQKQVLKVFTA
FT                   LAQAGHGVLLITHDLAVVAEVADRVIVMQQGSLVEGGEARQILSAPTHPYTRKLLAAIP
FT                   TASTRGKWLAGTDPLQNGMAPSSASLAADHASTDDTIALTADRIAVSFKRPDGSRMQAV
FT                   NQVSLQIKRGETLGIVGESGSGKTTLGKVILALQKPDSGEVRLADNAWSTLTERERRPL
FT                   RARIQTITQDPLSSFDPQFTVAQILNQPLRLRRDLSDDEKQRRILTLLEYVGLTPDLLS
FT                   RRPRALSGGQRQRVSIAQALASEPEILICDEPVSALDVTTQAQVLDLLVALQRQLGLTM
FT                   LFISHDLGVVQHMSHRIAVMKDGDIVETGPVEQIFNQPQHPYTRLLLSTVAE"
FT   gene            complement(488901..489767)
FT                   /locus_tag="PC1_0426"
FT   CDS_pept        complement(488901..489767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0426"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA0446 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11482"
FT                   /db_xref="GOA:C6DJR9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJR9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT11482.1"
FT                   /translation="MSSEPMPFTQTPSRKTYRSPWLSTATLLPAAIVFLLALAVFFPSL
FT                   FTSRTADEMDMGAVFQSPNSTYWFGTDQLGRDIFSRIVHGTSLSLGIGVGAMLIACFGG
FT                   VLFGTLSVLAPLRIRQVLVRLLDIMLAFPDLLLALLVIAVLGRGPENTMLAVGLAGIAG
FT                   YARLIRSQVLQVRLSGYVEHAIALGEHPLYIVFRHIIPNTLRPLLIVATIGVGHAVLSA
FT                   SALSFLGLGVVPPTAEWGALLADGRNFLDIAPWVSLLPASVVALSVISITLLGRRLQAI
FT                   LAKGEAR"
FT   sig_peptide     complement(489612..489767)
FT                   /locus_tag="PC1_0426"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.677 at
FT                   residue 52"
FT   gene            complement(489760..490719)
FT                   /locus_tag="PC1_0427"
FT   CDS_pept        complement(489760..490719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0427"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eca:ECA0447 ABC transporter
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11483"
FT                   /db_xref="GOA:C6DJS0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJS0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACT11483.1"
FT                   /translation="MMSGLNVNLYALGKRLFTILAVLWGAATLTFIAVKLIPGDPVAIL
FT                   SGGDNVVDEAYRAVLIKQFGLDQPLWVQYLRYCGQALQGDFGVSYLYRLPVGSVISDAM
FT                   HETLPLALGGLILALFLAITSALLTAGRYGALRTTVSWLELTLLSTPVYWIGIVLLSLF
FT                   SFRLQWFPVTGNDGVMSLVLPVITLSLPIAAILSQVLRDGLEEALSQPFSLTVRTRGVS
FT                   EIRLRFRHGLRHAALAASTLTGTLLASVLGGSVLTETVFGRAGIGQVTLSAIENRDMPL
FT                   VLGVVMLSAFLFVVINLLVDALYLIIDPRLRKKASAHE"
FT   gene            complement(490697..492310)
FT                   /locus_tag="PC1_0428"
FT   CDS_pept        complement(490697..492310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0428"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: eca:ECA0448 putative ABC transporter extracellular
FT                   solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11484"
FT                   /db_xref="GOA:C6DJS1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJS1"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACT11484.1"
FT                   /translation="MEKTHPQVTTLAAGLLSLLFALNPGAYAAQSNEKPVAGGILNVGL
FT                   GSDTPIIDPHITAYGVTALIARNVVDSLVGQAEDNRFTPWLAESWKINDDNTEYTFHLR
FT                   KDVTFSDGTKLDAEAVKYNIERILDPKTTSSYAKSLLGPIDKISTPDDYTIVLHYSSPF
FT                   AALLQGLSLPYLGIQSPTYLKNTPNTSNTVVGSGPFILDSFVKGSGSKLTKRPDYNWGP
FT                   GYAKHTGPAYLDGLVFKYLPEASVRLGALSSGQIQAIDAVPPANFPTVKRNPKLEVITY
FT                   ENPGVNRVLYLNTTKGPFQDVAVRKAFQSAVDTNAAVKVAFFGTLKAADNVLGPATLYY
FT                   DPSVASRWGFDVKKANELLDNAGWKQKDSEGFRTKDGNRLSVKFVYASTNVEAADVALF
FT                   QAVQYQVKQAGFDVQLTPVDAGEFTTRTNANEYDIASNFFVRAEPDILRTVFDSAYAPP
FT                   NGNNFTRISVLNDKLRKAIGAGEAERKQLYSEIQREVIDQAYVVPLYIPAYQLGLSKQV
FT                   QGISWATNAKPNFYDVWIKR"
FT   sig_peptide     complement(492224..492310)
FT                   /locus_tag="PC1_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 29"
FT   gene            493046..493660
FT                   /locus_tag="PC1_0429"
FT   CDS_pept        493046..493660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0429"
FT                   /product="protein of unknown function DUF1440"
FT                   /note="PFAM: protein of unknown function DUF1440; KEGG:
FT                   eca:ECA0449 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11485"
FT                   /db_xref="GOA:C6DJS2"
FT                   /db_xref="InterPro:IPR009898"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJS2"
FT                   /inference="protein motif:PFAM:PF07274"
FT                   /protein_id="ACT11485.1"
FT                   /translation="MNFFEQTSPSRRRYGLAAFIGLIAGIVSSFVKWGAENPLPPRSPT
FT                   DMFTGACAPESLIRAAENIDCSRNFLNPPYIFLRDWLGVVDPNAAVYTFAGHVFNWVGV
FT                   THIIFSIVFAVGYCVVAEVFPKIKLWQGLLAGALAQLFVHMISFPLMGLTPSLFVLPWY
FT                   EHVSEIVGHLIWFWSIEIIRRDLRNRMTHEPDPEIPLSASR"
FT   sig_peptide     493046..493141
FT                   /locus_tag="PC1_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.789) with cleavage site probability 0.583 at
FT                   residue 32"
FT   gene            complement(493909..494943)
FT                   /locus_tag="PC1_0430"
FT   CDS_pept        complement(493909..494943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0430"
FT                   /product="RhaT l-rhamnose-proton symport 2"
FT                   /note="PFAM: RhaT l-rhamnose-proton symport 2; KEGG:
FT                   eca:ECA0450 rhamnose-proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11486"
FT                   /db_xref="GOA:C6DJS3"
FT                   /db_xref="InterPro:IPR004673"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJS3"
FT                   /inference="protein motif:PFAM:PF06379"
FT                   /protein_id="ACT11486.1"
FT                   /translation="MSNPILLGIFWHFIGAASAACFYAPFKQVKNWSWETMWSLGGFFS
FT                   WIILPWCISWWLLPDFWRYYGSFDMATLLPIFLFGAMWGIGNINYGLTMRYLSMSMGIG
FT                   IAIGVTLIIGTLMTPVLQGKFSVLFGSAGGRMTLLGVLVAVIGVAIVSYAGLLKERVLG
FT                   IRAEEFNLKKGLILAVMCGIFSAGMSFAMDAAKPMHAAAQAQGINALYVALPSYVVIMG
FT                   GGAVVNLGFCFMRLATCKGISLKADLAQAKPLLIANALFAILGGVMWYLQFFFYAWGHA
FT                   NIPADYTYISWMLHMSFYVLCGGIVGLLFKEWKSVGQKPVRTLVLGCMVIILAANVVGL
FT                   GMAA"
FT   gene            495271..495777
FT                   /locus_tag="PC1_0431"
FT   CDS_pept        495271..495777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   eca:ECA0451 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11487"
FT                   /db_xref="GOA:C6DJS4"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJS4"
FT                   /inference="protein motif:PFAM:PF03350"
FT                   /protein_id="ACT11487.1"
FT                   /translation="MERFIENLMYTSRWLLAPVYLGLSLGLLALAIKFFQEVFHVLPNI
FT                   FDIAEADLVLVLLSLIDMTLVGGLLVMVMLSGYENFVSALDITDGREKLNWLGKMDSGS
FT                   LKNKVAASIVAISSIHLLRVFMDARNIPDNKLMWYVIIHLTFVLSALVMGYLDRMSRYE
FT                   KSKAA"
FT   gene            495872..496909
FT                   /locus_tag="PC1_0432"
FT   CDS_pept        495872..496909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0432"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; KEGG: eca:ECA0452 putative zinc-binding
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11488"
FT                   /db_xref="GOA:C6DJS5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041694"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJS5"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACT11488.1"
FT                   /translation="MPQTDRINRRVVLAQRPHGAPTQENFRLEQQAVPSVDAGQVLLRS
FT                   VFLSLDPYMRGRMSDAPSYAKPVELNDVMVGGTISRVVESKHPDYQTGDWVLSYSGWQD
FT                   YAVSDGKGLTNLGQSPTNPSYALGVLGMPGFTAYMGLTDIGQPKAGETLVVAAATGPVG
FT                   ATVGQIGKLKGCRVVGVAGGAEKCRYAVEVLGFDVCLDHRADDFAEQLKQACPQGIDIY
FT                   FENVGGKVFDAVLPLLNTSARIPVCGLVSGYNATGLPDGPDRLPLLAGTILKKRIRMQG
FT                   FIIFDDYGHRFEEFWKDVSPWVAEGKIKYREEIVDGLENAPDAFIGLLHGRNFGKLVVR
FT                   IGPDA"
FT   gene            496997..497821
FT                   /locus_tag="PC1_0433"
FT   CDS_pept        496997..497821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0433"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: mmw:Mmwyl1_0462 helix-turn-helix
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11489"
FT                   /db_xref="GOA:C6DJS6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJS6"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACT11489.1"
FT                   /translation="MHPDSASFRVRPLQPWFVINAAEDYLKKSVSQSPIAHFYSFTVDR
FT                   AEPMTLAVPDGSVDLLLHCCPEAPSGRVCGSTASAQITRLMPGERYFGVRFMPGIMPAF
FT                   LDLSPGELAGQEIPFDEVAPDTPRLLRRLVNTHDFNEQVSLFLHYFSYWTTRSAPPLLL
FT                   QIIDLIMAHDGKIRVDELERKTLYSARYIHRLFHDNCGMSPKTFCRTIRFQRALALLNQ
FT                   GNIDSLTMLAQHLEYADQSHFFREFKAFASCSPQHYLARLQAARYQYRIRQC"
FT   gene            498020..499399
FT                   /locus_tag="PC1_0434"
FT   CDS_pept        498020..499399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0434"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG:
FT                   4-aminobutyrate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11490"
FT                   /db_xref="GOA:C6DJS7"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJS7"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACT11490.1"
FT                   /translation="MAQAKDIVPGFYTIDDAIALDGETTRALQLTHLNRMRSLDGHAKY
FT                   FVRAEGSTFIDDKGEKHLDMIGAVGVVTVGNNNEFVWSCLQKCFDNRLFMMGAISYHNV
FT                   AAALAHNMALLSPQGKLTKMGTATGGAEAIEGMIKLVKLGTRHKTHKTHLLATLGAFHG
FT                   KTSGAVSLGGKDKWRAGQQPTLGNIDHVAYGSVTELENALATGKYKAFVVEPIQGEGGI
FT                   IVPPAGYLKAARELCDRYDTLLVLDEIQCGAARTGKFWCCEHDDVVPDCIVFAKGLSGG
FT                   LVPFGGYLCTESLYEAAYGTIETCYHHTATYQENTLSAAAALGSLQFIIEHDLCGMAER
FT                   KGALMMQRLYDIQARHPQVIKEVRGKGLMIGIEFGRLPETLHASMGEYYSAAIAGLLVE
FT                   KWRIQVNFTINNLAVFRFLPPLTISEEELDYALNAFESALNSVVEQVEQVEQANTSVMT
FT                   A"
FT   gene            499410..500564
FT                   /locus_tag="PC1_0435"
FT   CDS_pept        499410..500564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0435"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   kpn:KPN_03491 1,3-propanediol oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11491"
FT                   /db_xref="GOA:C6DJS8"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJS8"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACT11491.1"
FT                   /translation="MTFIYSQPVKLCIGRGEVARVGEEVAMLGSRVLLVTGKTSCRQTG
FT                   LLTRLTDLLTQSGVRWVLFDSIEANPLTTTVDDGAALAREQQCDVVLGVGGGSVMDAAK
FT                   GIAFMACHSGKLLDYLSQPPAPAATLPLVLVTTTAGTGSEGNCVAVFTNPETHDKPAFF
FT                   SPALYARTAIVDPTLMVTQSSRMVAATGFDALSHNIEARVGKFCNPMTEIMAERAIRLL
FT                   TTYLPRVCRDVTDLDAWDQVCWANTLGGIAIGMSACGLPHAMEHPLSGLYNITHGEGLA
FT                   ALYPTLMRFSCVENIAGFAAVTCAMSDSVTHLDESERASHSVYLVQRFLENIGLTFTLR
FT                   DLGVSEQDIPWLADNCVQTMGVSLEQNPRWASRQDIEALYRTCL"
FT   gene            500649..502052
FT                   /locus_tag="PC1_0436"
FT   CDS_pept        500649..502052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0436"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   eta:ETA_33160 amino acid permease-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11492"
FT                   /db_xref="GOA:C6DJS9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJS9"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACT11492.1"
FT                   /translation="MNTHQLKKNSLGLWSLVFFVVAAASPLTGVVGGLPVAISAGNGAG
FT                   IPAVYLMAGGILLIFSFGYIAMSRYVTNAGAFYSYITLGLGRRAGFSALSVALLAYFAI
FT                   QIAVVAMFGFFSSMYLQEHLGIELPWWGYSVAMLLLMCLLGIESVEVGGRVLGVLMLME
FT                   VGIMLVVDIAVLLSHDTPPLTLEAFSPSVINQGSIGIALIFSIAAFIGFESTAIYGEEC
FT                   RNPEKTIPRATLAAVILIMLFFAFTSWMMVQAYGVGQVQQQAINDPGRFILNVSTALVG
FT                   KWSEQMISLLLITSLFAAAQAFHNNISRYLFSIGRDGVLSTKLAQVSENKGTPYVASIV
FT                   QTIVVLTVLCAMVVADLDPMMQIFALGSAIATMAILLLQVGVSLAVIRFFQRETQHPVS
FT                   AWSRLWAPIISTVAMLSALIMVVRNVDVLSGSSSQIVSLLPWGVFGIAIMGYLSASRVR
FT                   IPSPQENMP"
FT   sig_peptide     500649..500723
FT                   /locus_tag="PC1_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.696 at
FT                   residue 25"
FT   gene            complement(502119..502316)
FT                   /locus_tag="PC1_0437"
FT   CDS_pept        complement(502119..502316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11493"
FT                   /db_xref="GOA:C6DJT0"
FT                   /db_xref="InterPro:IPR022553"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJT0"
FT                   /inference="similar to AA sequence:KEGG:ECA0454"
FT                   /protein_id="ACT11493.1"
FT                   /translation="MVDGVEIRNRCEIPEGDSDGFFAFIIIPLSIPFFFVKKSMDRIIT
FT                   YIIMLFYYLWSFYIRFNFCQ"
FT   gene            complement(502425..502727)
FT                   /locus_tag="PC1_0438"
FT   CDS_pept        complement(502425..502727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0438"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA0453 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11494"
FT                   /db_xref="GOA:C6DJT1"
FT                   /db_xref="InterPro:IPR022553"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11494.1"
FT                   /translation="MFQKNYIYNVYFYAYSALCLFLINAFSTIEYEWMLDDGSLDSFCE
FT                   VPRADADGFLIFIIVPLSIPFLLVKRTPPRIVTYLAILIYHSYRFYTRVSLCPHR"
FT   gene            complement(502806..503096)
FT                   /locus_tag="PC1_0439"
FT   CDS_pept        complement(502806..503096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0454 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11495"
FT                   /db_xref="GOA:C6DJT2"
FT                   /db_xref="InterPro:IPR022553"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJT2"
FT                   /inference="similar to AA sequence:KEGG:ECA0454"
FT                   /protein_id="ACT11495.1"
FT                   /translation="MSRAKESIYHVYFYAYSALCFFLINTFSTIGYDGSIARFCETPRG
FT                   EADGFLIFIIVPLSIPFLLVKRSIPKIITYLIILIYHSDSFYTRISMCPIM"
FT   gene            complement(503125..503871)
FT                   /locus_tag="PC1_0440"
FT   CDS_pept        complement(503125..503871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0440"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11496"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJT3"
FT                   /inference="similar to AA sequence:KEGG:ECA0455"
FT                   /protein_id="ACT11496.1"
FT                   /translation="MSKFNAIAAECDLSFSDWGKNYPRWSPIDFIWWKTFGGNDYLNKY
FT                   KDSYIVFHKEKIKEIASKHKIPATLLALIAYSEAGGMIDYLKYPVLFYRQSKHTYSDWA
FT                   NQETPTTPPEKTSIGIVAMQIRVVAEIFNKNPSELKNAEATYISICLNKDNFNLTMVAR
FT                   HLYELITYDYPGTDTLNLTDEQFILAGSRYNRGIERSHSDFIRSINAEKTAKTERDWTS
FT                   YGRSMLNHREKVTKLLYNSTTVIQRP"
FT   gene            complement(503878..504357)
FT                   /locus_tag="PC1_0441"
FT   CDS_pept        complement(503878..504357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0441"
FT                   /product="type VI secretion system effector, Hcp1 family"
FT                   /note="TIGRFAM: type VI secretion system effector, Hcp1
FT                   family; PFAM: protein of unknown function DUF796; KEGG:
FT                   eca:ECA0456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11497"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJT4"
FT                   /inference="protein motif:TFAM:TIGR03344"
FT                   /protein_id="ACT11497.1"
FT                   /translation="MANSIFMKITGKIQGLISEGCLSIDSVGNKHISGHEDEIFVYATN
FT                   YDLSRDRHVNHHPFSVTKVVDKSTPLLLTSIANNELLECELRYYRTSASGTQENYMTIT
FT                   LRDASIVNLSNQNPNSLTHNDMQPFETLSLRYESITCQHNIAGTSGYSILTENMY"
FT   gene            complement(504694..505905)
FT                   /locus_tag="PC1_0442"
FT   CDS_pept        complement(504694..505905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0442"
FT                   /product="Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family"
FT                   /note="TIGRFAM: Ubiquinone biosynthesis hydroxylase,
FT                   UbiH/UbiF/VisC/COQ6 family; PFAM: monooxygenase
FT                   FAD-binding; KEGG: eca:ECA0457 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11498"
FT                   /db_xref="GOA:C6DJT5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJT5"
FT                   /inference="protein motif:TFAM:TIGR01988"
FT                   /protein_id="ACT11498.1"
FT                   /translation="MQSFDVVIAGGGMVGLALACGLQGSGLRIAVLEKQAAEPQPLGKN
FT                   HALRVSAINAASECLLRHIGVWENLVAQRVSPYNDMQVWDKDSFGKISFSGEEFGFSHL
FT                   GHIIENPVIQQVLWQRASQLSDITLLSPTSLKQVAWGENEAFITLQDDSMLTARLVVGA
FT                   DGAHSWLRQHADIPLTFWDYGHHALVANIRTEQPHQSVARQAFHGDGILAFLPLDDPHL
FT                   CSIVWSLSPEQAQAMQKLPVEEFNRQVAMAFDMRLGLCELESERQTFPLTGRYARSFAA
FT                   HRLVLVGDAAHTIHPLAGQGVNLGFMDVAELIAELKRLQTQGKDIGQHLYLRRYERRRK
FT                   HSAAVMLASMQGFRELFDGDNPAKKLLRDVGLVLADKLPGIKPTLVRQAMGLHDLPDWL
FT                   SQEQ"
FT   gene            complement(505934..507112)
FT                   /locus_tag="PC1_0443"
FT   CDS_pept        complement(505934..507112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0443"
FT                   /product="2-polyprenyl-6-methoxyphenol 4-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenyl-6-methoxyphenol 4-hydroxylase;
FT                   Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6
FT                   family; PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: eca:ECA0458
FT                   2-octaprenyl-6-methoxyphenyl hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11499"
FT                   /db_xref="GOA:C6DJT6"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR011295"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJT6"
FT                   /inference="protein motif:TFAM:TIGR01984"
FT                   /protein_id="ACT11499.1"
FT                   /translation="MAVMIVGGGMAGATLALAISRLSQGTIPVDLIEAHSPLDKEHPGF
FT                   DARALALSDGTRQQLATLGIWQALSGNATAITDIHVSERGHASVVNLKASDYHVKALGH
FT                   VVELHDVGQRLFSLLQQAPGVRLHCPAKVVAVTRTQDNATLTLDDGTELTGQLLVAADG
FT                   SRSVLSQSCGIQWQQHDYDQVAVIANVTTAEPHRGRAFERFTPHGPLALLPMSNGRCSL
FT                   VWCHDKHRQHEVDGWSEAEFCRQLQQAFGWRLGRFTHIGERHSYPLRLLTASQHISHRL
FT                   ALVGNAAQTLHPIAGQGFNLGIRDVMSLAETLVEAAKNQQDIGQYRVLSRYQQRREPDQ
FT                   HTTVAITDGLVRLFANRYAALAVSRNLGLIAMNNLPLMRDAFARRTLGWVER"
FT   sig_peptide     complement(507035..507112)
FT                   /locus_tag="PC1_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.792) with cleavage site probability 0.495 at
FT                   residue 26"
FT   gene            complement(507158..508483)
FT                   /locus_tag="PC1_0444"
FT   CDS_pept        complement(507158..508483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0444"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; peptidase M24B X-Pro
FT                   dipeptidase/aminopeptidase domain protein; KEGG:
FT                   eca:ECA0459 proline aminopeptidase P II"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11500"
FT                   /db_xref="GOA:C6DJT7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJT7"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ACT11500.1"
FT                   /translation="MNPQEFLRRRQGLLEKMAPGSAAIIFAAPEAQRNADSDYPYRQNS
FT                   DFWYFTGFNEPEAVLLLVKSDAKHHHSVIFNRVRDLTAEIWFGRRLGQEAAPAKLGVDR
FT                   ALPFDEISTQLHLLLNGLDVVYHAQGQYDYADKLVFAALDTLRNGTRQGFAAPATLTDW
FT                   RPWVHEMRLFKSPEEISVMRRACEITALAHTRAMQKCRPGMYEYQLEGEIHHEFTRHGA
FT                   RYPSYNTIVGSGENACILHYTENETQMRDGDLVLIDAGCEYKSYAGDITRTFPVNGKFT
FT                   APQRAIYDIVLRSQLRALELFGPSRSIREVNEEVVRMMVSGLIKLGVMKGDVEELIAEQ
FT                   AHRQFFMHGLSHWLGLDVHDVGDYGTTERGRPLEPGMVLTIEPGLYIAPDAKVPQQYRG
FT                   IGVRIEDNIVITENGNENLTAGVVKDADDIEALMAQWHDKQH"
FT   gene            complement(508574..509161)
FT                   /locus_tag="PC1_0445"
FT   CDS_pept        complement(508574..509161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0445"
FT                   /product="yecA family protein"
FT                   /note="TIGRFAM: yecA family protein; PFAM: protein of
FT                   unknown function UPF0149; KEGG: eca:ECA0460 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11501"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJT8"
FT                   /inference="protein motif:TFAM:TIGR02292"
FT                   /protein_id="ACT11501.1"
FT                   /translation="MSIENTFPAYEGLDQLLHQQQVALTAAEMHGLISGMLCGGNHDDS
FT                   WRTLVFELTNEGMAFTQTLSQPLQDLYQATREALEDDGFLFQLFLPDDSQDEVSVFDRA
FT                   DALAGWVNHFLLGLGVVQPQLNKAKGELKEAIEDLRNIAQLGYDEDEDQEELEQSLEEV
FT                   IEYVRVSAILCHNEFTSQRVATAPEQQKPTLH"
FT   gene            509354..509683
FT                   /locus_tag="PC1_0446"
FT   CDS_pept        509354..509683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0446"
FT                   /product="protein of unknown function DUF710"
FT                   /note="PFAM: protein of unknown function DUF710; KEGG:
FT                   eca:ECA0461 Z-ring-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11502"
FT                   /db_xref="GOA:C6DJT9"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR023771"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJT9"
FT                   /inference="protein motif:PFAM:PF05164"
FT                   /protein_id="ACT11502.1"
FT                   /translation="MSAQPVDIQIFGRSLRVNCPPEQQDALNQAAEDLNQRLQDLKVRT
FT                   RVTNTEQLVFIAALNVCHELAQERGKTRDYASNMEQRIRMLQQTIEQALLEQGRITERQ
FT                   GAQFE"
FT   gene            509758..509941
FT                   /locus_tag="PC1_R0016"
FT   ncRNA           509758..509941
FT                   /locus_tag="PC1_R0016"
FT                   /product="6S RNA"
FT                   /note="6S / SsrS RNA as predicted by Rfam (RF00013), score1
FT                   16.92"
FT                   /ncRNA_class="other"
FT   gene            509981..510622
FT                   /locus_tag="PC1_0447"
FT   CDS_pept        509981..510622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0447"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /note="TIGRFAM: 5-formyltetrahydrofolate cyclo-ligase;
FT                   PFAM: 5-formyltetrahydrofolate cyclo-ligase; KEGG:
FT                   eca:ECA0462 putative 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11503"
FT                   /db_xref="GOA:C6DJU0"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJU0"
FT                   /inference="protein motif:TFAM:TIGR02727"
FT                   /protein_id="ACT11503.1"
FT                   /translation="MSSSDSSTSPDTSLSPTTASRQQIRQAVRQHRRLLTPEQQALFAQ
FT                   QACERVMAHPKIIRAESVAVFLSFDGELDTSPLIQQLWQQGKRVYLPVLHPFRAGHLLF
FT                   LRYAPDTELVRNRLKIMEPRLDVRQVLPLPQLDILLTPLVAFDHQGQRLGMGGGFYDRT
FT                   LQYRNQMSRGPYPIGLAHDCQQVDALPVESWDIPLPEIITPSRHWQWSTR"
FT   gene            complement(510619..511872)
FT                   /locus_tag="PC1_0448"
FT   CDS_pept        complement(510619..511872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0448"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="KEGG: eca:ECA0463 nicotinamide-nucleotide
FT                   adenylyltransferase; TIGRFAM: nicotinamide-nucleotide
FT                   adenylyltransferase; cytidyltransferase-related domain
FT                   protein; PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11504"
FT                   /db_xref="GOA:C6DJU1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006417"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016429"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038727"
FT                   /db_xref="InterPro:IPR041749"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJU1"
FT                   /inference="protein motif:TFAM:TIGR01526"
FT                   /protein_id="ACT11504.1"
FT                   /translation="MSSFDYLKSAIRQKGCTLQQVADATDMTKGYLSQLLNAKIKSPSA
FT                   QKLEALHRFLELEFPRYEKSIGVVFGKFYPLHTGHIYLIQRACSQVDELHVILGYDEPR
FT                   DRLLFENSSMSQQPTVSDRLRWLLQTFKYQKNIHIHAFNEQGMEPYPHGWDVWSKGIQA
FT                   FMQEKSITPNFVYTSEEQDAPQYREHLGIEAVLIDPQRSFMNISGSQIRHDPFRYWDYI
FT                   PTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQY
FT                   SDYDKIALGQAQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFD
FT                   LVILLENNTPWVADGLRSLGSTTARSEFQNLLKTMLADNNIQYVYIKESDYDSRFLHCV
FT                   ELVQQMLGHDRSPEQSKS"
FT   gene            complement(512004..513386)
FT                   /locus_tag="PC1_0449"
FT   CDS_pept        complement(512004..513386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0449"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase;
FT                   KEGG: eca:ECA0464 DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11505"
FT                   /db_xref="GOA:C6DJU2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJU2"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ACT11505.1"
FT                   /translation="MAKAVKRAFVCNECGADYPRWQGQCSACHAWNTITEVRLASASVS
FT                   RSDRLTGYAGESAGVSRVQKLSEISLEALPRFSTGFQEFDRVLGGGVVPGSAILIGGNP
FT                   GAGKSTLLLQTLCKLSENMKTLYVTGEESLQQVAMRAHRLNLPTQNLNMLSETSIEQIC
FT                   LIAEQEQPKLMVIDSIQVMHLADIQSSPGSVAQVRETAAYLTRFAKTRGVAIVMVGHVT
FT                   KDGSLAGPKVLEHCIDCSVLLDGDADSRFRTLRSHKNRFGAVNELGVFAMTEQGLREVS
FT                   NPSAIFLSRGDEVTSGSSVMVVWEGTRPLLVEIQALVDQSMMSNPRRVAVGLEQNRLAI
FT                   LLAVLHRHGGLQMSDQDVFVNVVGGVKVTETSADLALLLSLVSSFRDRPLPQDLVIFGE
FT                   VGLAGEIRPVPSGQERITEAAKHGFKRAIVPHANMPKKTPASMQVFGVKKLADALAILD
FT                   DL"
FT   gene            complement(513404..514381)
FT                   /locus_tag="PC1_0450"
FT   CDS_pept        complement(513404..514381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0450"
FT                   /product="phosphoserine phosphatase SerB"
FT                   /EC_number="3.1.3.3"
FT                   /note="KEGG: eca:ECA0465 phosphoserine phosphatase;
FT                   TIGRFAM: phosphoserine phosphatase SerB; HAD-superfamily
FT                   hydrolase, subfamily IB (PSPase-like); PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; Haloacid
FT                   dehalogenase domain protein hydrolase type 3"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11506"
FT                   /db_xref="GOA:C6DJU3"
FT                   /db_xref="InterPro:IPR023190"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041449"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJU3"
FT                   /inference="protein motif:TFAM:TIGR00338"
FT                   /protein_id="ACT11506.1"
FT                   /translation="MSNSLTYRDLPDEINCWPGLPLSLSGDEVMPLDYRAGDTGWLIYS
FT                   DVLDKNLISRYQRKLGSAMVIVSAWNVGDYQVVRLAGTLTPRATKLAHELGIDVAPMRN
FT                   APTLRSPGLLVMDMDSTAIQIECIDEIAKLAGTGELVAEVTERAMRGELDFAASLRQRV
FT                   GTLKGADATILKTVRKTLPLMPGLRNMVSQLQEAGWHVAIASGGFTYFADYLRDELGLV
FT                   AAVANELGMQDGKLTGEVIGQIVDAKYKATTLQQLAEKLEIPMHQTVAIGDGANDLPMI
FT                   KAASLGIAYHAKPKVNEQSAVTIRHADLTGVLCILSGSMRHEKR"
FT   gene            514538..515236
FT                   /locus_tag="PC1_0451"
FT   CDS_pept        514538..515236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0466 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11507"
FT                   /db_xref="GOA:C6DJU4"
FT                   /db_xref="InterPro:IPR019305"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJU4"
FT                   /inference="similar to AA sequence:KEGG:ECA0466"
FT                   /protein_id="ACT11507.1"
FT                   /translation="MVRARVKFRLHRTAIVLICLALLVVLMQGASYFSLSHQMARSEQV
FT                   EDLARTLSRQVAYSLSPLMGSVDDNSQKINTILKQLTDHSRILDAGVYQQDGSLVAHVG
FT                   EQVQLRDRLALDGNRVGSYFNHQLVQPIEGKEGPIGFLRITLDTHVLATEARQVDNTTN
FT                   ILRLMILLSLAIGIILTRTLLQNRRTRWQQSPYLLTASTPVKEEEDEAGSDTRTSDSAT
FT                   VKKDEEEKNL"
FT   sig_peptide     514538..514660
FT                   /locus_tag="PC1_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.974) with cleavage site probability 0.303 at
FT                   residue 41"
FT   gene            complement(515291..516208)
FT                   /locus_tag="PC1_0452"
FT   CDS_pept        complement(515291..516208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0467 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11508"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJU5"
FT                   /inference="similar to AA sequence:KEGG:ECA0467"
FT                   /protein_id="ACT11508.1"
FT                   /translation="MSLSVNNTGYSNSQAQSTATSSTTAQSTTTTSSDSIQITDPITGK
FT                   TVTFPNNIKISAEALARWKETVAKAPPSDPKKDEPSKIPRDIYADRDLLRQTDTSKPYV
FT                   SNEFMTVYIDEIGTNEMAIENWSGHLKADSGISKEAFLGLVKKALSSPPEVSLWSYTTD
FT                   SMEIAITANKLETLKNRYVDSDYQKRADLDIQDFIEYKSNALSNLEKNILQDEYQRSVD
FT                   AGDTDKANATFLELQKNAEGTSTTQLQRQQIFSRAASTDVSAWFGSFRDYIAASDFDRY
FT                   TKSEYNSIVSEFYNHWLGFQLALK"
FT   gene            516514..518103
FT                   /locus_tag="PC1_0453"
FT   CDS_pept        516514..518103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0453"
FT                   /product="peptide chain release factor 3"
FT                   /note="TIGRFAM: peptide chain release factor 3; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein; KEGG:
FT                   eca:ECA0468 peptide chain release factor 3"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11509"
FT                   /db_xref="GOA:C6DJU6"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJU6"
FT                   /inference="protein motif:TFAM:TIGR00503"
FT                   /protein_id="ACT11509.1"
FT                   /translation="MSPSEYAREVSKRRTFAIISHPDAGKTTITEKVLLFGQAIQTAGT
FT                   VKGRGSNQHAKSDWMEMEKQRGISITTSVMQFPYRECLVNLLDTPGHEDFSEDTYRTLT
FT                   AVDCCLMVIDAAKGVEDRTRKLMEVTRLRDTPILTFMNKLDRDIRDPMEVLDEVESELK
FT                   IACAPITWPIGCGKLFKGVYHLYKDETYLYQTGKGHTIQEVRIVKGLDNPELDTAVGEE
FT                   LAAQLREELELVKGASHEFELDAFLAGELTPVFFGTALGNFGVDHMLDGLVAWAPAPMP
FT                   RKTDTREVTAAEEKFTGFVFKIQANMDPKHRDRVAFMRVVSGRYEKSMKLRQVRTGKDV
FT                   VISDALTFMAGDRSHIEEAYPGDIIGLHNHGTIQIGDTFTQGEDMKFTGIPNFAPELFR
FT                   RIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPLTNNDLIVGAVGVLQFDVVVARLKTEYN
FT                   VEAIYESVNVSTARWVECSDVKKFEEFKRKNELHLALDGGDNLAYVAPTMVNLNLTRER
FT                   YPEVTFHQTREH"
FT   gene            518608..519216
FT                   /locus_tag="PC1_0454"
FT   CDS_pept        518608..519216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0454"
FT                   /product="transport-associated protein"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   eca:ECA0469 periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11510"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJU7"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ACT11510.1"
FT                   /translation="MKKTTLTKSLIVVALSSILAGGAMAEETLGQKVERIADTTGAKID
FT                   SSANKASGYMSDSAITAKVKSALLEDKSITSSDISVETSKGVVTLSGFVGSQALSTRAV
FT                   EIATQVEGVQSVSDKLQVKDNQSQSVGAYADDAVVTSTIKAKLLADDIVPSRKVKVETQ
FT                   EGVVLLSGEVDNKAQSDRAESIAKAVDGVKSVKNDLTVK"
FT   sig_peptide     518608..518685
FT                   /locus_tag="PC1_0454"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            519365..519526
FT                   /locus_tag="PC1_0455"
FT   CDS_pept        519365..519526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0455"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   eca:ECA0470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11511"
FT                   /db_xref="GOA:C6DJU8"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DJU8"
FT                   /inference="protein motif:PFAM:PF07043"
FT                   /protein_id="ACT11511.1"
FT                   /translation="MFRWGIIFLVIALIAAALGFGGLAGTAAGAAKIVFVVGIILFLLS
FT                   LFTGRKRP"
FT   sig_peptide     519365..519454
FT                   /locus_tag="PC1_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.473 at
FT                   residue 30"
FT   gene            519652..519840
FT                   /locus_tag="PC1_0456"
FT   CDS_pept        519652..519840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0456"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11512"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJU9"
FT                   /inference="similar to AA sequence:KEGG:ECA0471"
FT                   /protein_id="ACT11512.1"
FT                   /translation="MNSDIVVGKWKQWKGNFLALWADWFDSDCAWLEGSNDYLSGVLQE
FT                   GYGKAHEEVSSEKTTLH"
FT   gene            519955..520752
FT                   /locus_tag="PC1_0457"
FT   CDS_pept        519955..520752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0457"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; amidohydrolase
FT                   2; KEGG: eca:ECA0472 TatD family deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11513"
FT                   /db_xref="GOA:C6DJV0"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJV0"
FT                   /inference="protein motif:PFAM:PF01026"
FT                   /protein_id="ACT11513.1"
FT                   /translation="MPSERYRFIDTHCHFDFPLFYDDAPESLRLAQDAGVERIIIPAVA
FT                   SQHFERVLMLARTYPSLYAALGLHPLYIAEHQEDDLIRLEDELRQQPARLVAVGEIGLD
FT                   LYMPEPQFERQLTFLEAQLRLAKKYDLPTILHSRRSHDRLAQLLRRIDVPRTGVVHGFA
FT                   GSLAQAQAFIRLGYYIGVGGTITYDRANKTRQAIAQLPLDRLLLETDAPDMPMSGYQGQ
FT                   PNRPERISCAFQTLCELRAESPEEIAEALWQNSFRLFGRLIPT"
FT   gene            521057..522334
FT                   /locus_tag="PC1_0458"
FT   CDS_pept        521057..522334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0458"
FT                   /product="nucleoside transporter"
FT                   /note="TIGRFAM: nucleoside transporter; PFAM: Na+ dependent
FT                   nucleoside transporter domain protein; nucleoside
FT                   recognition domain protein; Na+ dependent nucleoside
FT                   transporter; KEGG: eca:ECA0473 putative Na+ dependent
FT                   nucleoside transporter-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11514"
FT                   /db_xref="GOA:C6DJV1"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="InterPro:IPR018270"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJV1"
FT                   /inference="protein motif:TFAM:TIGR00804"
FT                   /protein_id="ACT11514.1"
FT                   /translation="MQLVMSLIGMLVLIFFAVILSSNRKAIRLRTVVGAFVIQIGIGAL
FT                   VLYVPVGRKILEGLTGGVANVIAYGNQGVSFIFGGLVSDKMFEIFGGGGFVFAFRVLPI
FT                   IVFFSSLVAVLYYMGVMQWVIRLLGGGLQKLLGTSRTESLSATANIFVGQTEAPLVVRP
FT                   YIANMTRSELFAVMCGGLASIAGSVMAGYAQMGVPLDYLIAASFMAAPGGLLFAKLMVP
FT                   ETEKTHDHDEMVGFVDEDDRPANVIDAAASGAASGMQLALNVGAMLLAFVALIALLNGI
FT                   LGGIGGWFDYPQLSMELMLGWIFSPVAFLIGVPWHEATVAGSFIGQKLIVNEFVAYMNF
FT                   SEYLKADDVVAAAGLQVLSDHTKAVISFALCGFANLSSIAILIGGLGSMAPSRRQDIAR
FT                   LGLKAVAAGTLSNLMSACIAGFFLSL"
FT   gene            522517..523233
FT                   /locus_tag="PC1_0459"
FT   CDS_pept        522517..523233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0459"
FT                   /product="4'-phosphopantetheinyl transferase"
FT                   /note="PFAM: 4'-phosphopantetheinyl transferase; KEGG:
FT                   eca:ECA0474 enterobactin synthetase component D
FT                   (4'-phosphopantetheinyl transferase)"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11515"
FT                   /db_xref="GOA:C6DJV2"
FT                   /db_xref="InterPro:IPR003542"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="InterPro:IPR041354"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJV2"
FT                   /inference="protein motif:PFAM:PF01648"
FT                   /protein_id="ACT11515.1"
FT                   /translation="MLSAFIDDVEWITFPRATDGATYPGITARCHFHVSAYDDALFAAL
FT                   NIPFPDALARAVPKRRAEFLAGRYLARHVLNKLDHPDFVLCSAEDRSPQWPENVAGSLS
FT                   HNKDSVLCAAHLRIEALSCVGVDIEGFISDERAQSLWPGIIGDEEFQWFQEREESFCCL
FT                   LTVSFSAKESLFKALYPQVRHYFDFLDARLVALDITKREFELELLTDLTPTFYAGRRFK
FT                   GAYLLREYDVTTFICC"
FT   gene            complement(523283..525229)
FT                   /locus_tag="PC1_0460"
FT   CDS_pept        complement(523283..525229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0460"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: eca:ECA0475 TonB-dependent siderophore
FT                   receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11516"
FT                   /db_xref="GOA:C6DJV3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJV3"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACT11516.1"
FT                   /translation="MQLKSENRFSHHHFPHSKMYRALLVTGLLALPALAQAENAADEKI
FT                   VVTATQTKHTTLSAPASVSVITRAELEKMSVNNVSDAVKKLPGININPSTTYGRNEIKI
FT                   RGMRADYTLLLVNGRRINTQESLATDMGNDFDLSSIPMSAIERIEVIRGPMSSLYGADA
FT                   LGGVVNVILRQPGENVAGEVGYNFQAPTEGSGGDHNRLNGYVSGPLIENTLLGSLIVDG
FT                   GKRDAWRTEQSKNRNSDALEKRDNYSVLGNLTWLIDSQQSLDFDATYTKDDRFVDWNNS
FT                   GATAHNTQKLDRLGLGLTHNGSWDNFDTRLRYYYENIDLMDNSELNKGIADITQNNQTV
FT                   DGQISGYLGDHLLTGGGEYRITSLEHSMNLKGGKVDVNQSALFLQDEFKIADLALTFGG
FT                   RVDHHEVYGTEFSPRAYATYSLTDNWVIKGGVNKAFKAPTLAQFTKGYTKAACRGQCYI
FT                   VGNPDLKAETSISYELGTAYEAEHFGTGITLFNNDIKDMIQTNSLTRTYENVSKARVQG
FT                   IETSFWVDLTDDLNWTTNWTVVDAEDRATRMRLKQTPKNTVNTQLNWQALDNLSTYVSY
FT                   QYTSNQYLRDKETYRTRGFNTVDIGATYTPVKNVDLKLGVTNLTNEKRDYVATDIDYFV
FT                   SGRTVYGGVSYKF"
FT   sig_peptide     complement(525116..525229)
FT                   /locus_tag="PC1_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.814 at
FT                   residue 38"
FT   gene            complement(525327..526589)
FT                   /locus_tag="PC1_0461"
FT   CDS_pept        complement(525327..526589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0461"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   eca:ECA0476 putative iron transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11517"
FT                   /db_xref="GOA:C6DJV4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJV4"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACT11517.1"
FT                   /translation="MDESMYSQHTRPVVHLALLINMLSLGSLMMVMPLGPDFISALSMD
FT                   AKNIGYISGGATFASAIVGFLAAPYLDRFNRKHALLVLLTLRFGLTAACMFATSQTHLL
FT                   VLFILAGCVAGPASGVLMAAVVDIVPANERGKQLAYVGMSFSLAAIIIMPLSLELAHRI
FT                   NWQAPFYIFGLGGLLLALLVLWLFPSMPPTHRAQQSASPSTSPTSVLHDLLASPLFLLG
FT                   LTVVSLQMFGHFLLIPHFSNYFQFNLAFPRDDISLLYLCGGLGSMVTMQLCGNLLDRGY
FT                   ASRTIVVTTLLLAVVILCGFVLPFSLSLYLVFTLFMALSAARSSSTLAITAGIPLPHQR
FT                   AAFMSYQGTAANVASGLASVASAAYLSTSVEGRIDGFSQLAVASTIFALAAMLLTLRLI
FT                   PLLAERSRKMAARQPVQATGQ"
FT   gene            526921..528117
FT                   /locus_tag="PC1_0462"
FT   CDS_pept        526921..528117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0462"
FT                   /product="isochorismate synthase"
FT                   /note="TIGRFAM: isochorismate synthase; PFAM: Chorismate
FT                   binding-like; KEGG: eca:ECA0477 isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11518"
FT                   /db_xref="GOA:C6DJV5"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJV5"
FT                   /inference="protein motif:TFAM:TIGR00543"
FT                   /protein_id="ACT11518.1"
FT                   /translation="MDTLITEAETFSGLTYSEQTAFLYASEHRSLSTSGLFERISSPVC
FT                   ASDSHDDRLSSAIAQAFQRARQAGQSLPIVVGAIPFDTTQPSCLYIPDSYTVTTKSELV
FT                   SRARKHTAAAPAALTLNSVPDECQFKSIVAEAVERFRRGELSKAVLSRILDIELAWPVK
FT                   AQTILNNLMVQNAGGYHFSLPLPDGSILLGASPELMLRKQGNVIVSNPLAGSARRMNDE
FT                   HLDYLNSQRLLNSSKDKHEHKLVVDDIRQRLMPLCSSLTIPSAPSLMSTASMWHLSTAI
FT                   SGELVHPEMTALQVACQLHPTPALCGFPTQEARQLIAELEPHDRGVFSGIVGWCDANGD
FT                   GEWAIAIRCGTIKNNNVRLFAGAGIVEASVPEDEWAETAAKLNTMLNAFGLKSGVDGL"
FT   gene            528114..529757
FT                   /locus_tag="PC1_0463"
FT   CDS_pept        528114..529757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0463"
FT                   /product="2,3-dihydroxybenzoate-AMP ligase"
FT                   /note="TIGRFAM: 2,3-dihydroxybenzoate-AMP ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG: eca:ECA0478
FT                   enterobactin synthase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11519"
FT                   /db_xref="GOA:C6DJV6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011963"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJV6"
FT                   /inference="protein motif:TFAM:TIGR02275"
FT                   /protein_id="ACT11519.1"
FT                   /translation="MSIEFTPWPEELAQRYRDKGYWVGLPLTDAWERHLTTQPDAVAVV
FT                   CGERQWSYRELDRQSSALASRLTESGLRCGDTALVQLPNVAEFYLTFFALLKMGVAPVN
FT                   ALFSHNKLELLSYATQIEPRLLIASAEHPLFGDGAFLDRLQTQVPRLQTVVMLGDSSLG
FT                   HSLSDWLQPRASTSQYQPSASGQVAFFQLSGGSTGTPKLIPRTHDDYYYSVRRSVEICE
FT                   LTPQTRYLCALPAPHNFPLSSPGSLGVFYAGGRVVLAPDPGAMTCFPLIERHQIDITSL
FT                   VPPAAALWIQAAEQFGGALRSLKILQVGGAKLSETVARRIPAVLGCQLQQVLGMAEGLV
FT                   NYTRLDDSDEHIFTTQGCPMSPDDEVKVLDIDGNPLPRGEAGLLATRGPYTFRGYYRSP
FT                   EHNARAFDSEGFYHSGDVVQMTEDGYLCVVGREKDQINRGGEKIAAEEIENLLLKHDGI
FT                   LHAALVSMPDPVMGEKSCAFLVVSDPALKAITLRKYLRNQGIAEFKLPDRFEMIDTLPV
FT                   TPVGKIDKKSLRQRIQTQLSTQNPTELQNK"
FT   gene            529768..530643
FT                   /locus_tag="PC1_0464"
FT   CDS_pept        529768..530643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0464"
FT                   /product="Isochorismatase"
FT                   /EC_number="3.3.2.1"
FT                   /note="PFAM: isochorismatase hydrolase;
FT                   phosphopantetheine-binding; KEGG: eca:ECA0479 enterobactin
FT                   synthetase component B (isochorismatase)"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11520"
FT                   /db_xref="GOA:C6DJV7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR016291"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJV7"
FT                   /inference="protein motif:PRIAM:3.3.2.1"
FT                   /protein_id="ACT11520.1"
FT                   /translation="MAIPSIASYPLPRAQDFPENKVSWAFEPERAVLLIHDMQDYFVNF
FT                   YGADSPLAQQLIENIAALRTYCKARGIPVVYTAQPNAQSAADRALLNDMWGAGLNNHPD
FT                   KQRVVSALAPDEHDTVLVKWRYSAFHRSPLEPMMKEMGKDQLIICGVYGHIGCMITATD
FT                   AFMRDIKPFMVGDAVADFSLQEHQMALKYVATRAGRVVSTAELTGAKMAQTLTKQGLRA
FT                   HLLTLIDEEEDQFDEDENLIDYGLDSVRMMALLTEWRNQGVTLSFVDLARNPSLNAWWA
FT                   LIEKQQGAAS"
FT   gene            530640..533783
FT                   /locus_tag="PC1_0465"
FT   CDS_pept        530640..533783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0465"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase;
FT                   phosphopantetheine-binding; condensation domain protein;
FT                   KEGG: eca:ECA0480 enterobactin synthetase component F"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11521"
FT                   /db_xref="GOA:C6DJV8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJV8"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ACT11521.1"
FT                   /translation="MKPLSVAQRGLWLGHALNDDKATFNTAECIAFDGKVDIEAMLSAI
FT                   RQAVMECECLYCQFVEVAAEQADQPEIGFVASQLPVPIGVLPIVELLPAPRTDEAQTIR
FT                   QWAREEISQPLDLLNGLPCRFALLCGEKRDFLYSCVHHIALDGFGTTMLFQRIAQIYTA
FT                   LTAGQSVPMAEFGPFSDVLEEEQQRDASGQTAQARDFWLETLNAMPEPASFSEKKAPIA
FT                   ARFLRQSCDMPEDLWQPLTALCEGNKISWPDLFLAMLATHLKLVSGSDRLTFGMMVMNR
FT                   IGSASLTVPSMQMNIVPLCIQVDEQADFVALAQQVARTKRTLRRHQHYRYEHLRRDLNR
FT                   VGGEQRLFGPLINIMPFDHPLSYGSLSSSTLNLSAGPVEDLTIEIHFKPDGTPVLDFDA
FT                   NPACYSAEALANLQETLFTLLQRWLAQPRQTSGELLGRWLREERELALITSREPEPFVE
FT                   PVLTAIAKQARKNPNHTALTQRDRQYSYQQLLDLSDQAAAALHERGVQPGERIGIMLNR
FT                   SPETIICLLAVMQCGAVYVPLDPEQPHERQQHIIQIAGLRTIVTQADYQHRLASVFSGE
FT                   IVLAGHLLSPNAQHAALPPAEVRDGQIAYVMFTSGSTGLPKGVEIGVSALDHFIAAARQ
FT                   RYGLRAADRVLQFAPFNFDASIEEIFATLTSGATLVLRTDEMLESIPTFVEQVEELAIT
FT                   LLDLPTAFWNEWVVGLKTGALTMPSALRAIIIGGEAVYPEQLVQWQRHAPDTLRLINTY
FT                   GPTETTVVATSCDLQTQPADVAQLPIGLPLAGVNALILAAGDRPAAEGELVLLGPTLAS
FT                   GYIGTEHTAFTQLAVGDRELPAYRTGDRVRLEKGQLLYLGRMDNEFKISGYRIQPGEVE
FT                   AHLLAQPDVDEACVQGIVYPNGVRRLVAFVATKAGEIDARALKQRLGSVLPPAMIPTDY
FT                   RAFRQLPKTGSNKVDRKRLLAEYHDEAPAQALASETENRVSAIWQQILGVSGIQSRDNF
FT                   FELGGQSLQTIQIVNRLAAEFSVSIKVSDVFDHPQLSDFCRYLDDRLSQDENSVEMVW"
FT   gene            533792..534559
FT                   /locus_tag="PC1_0466"
FT   CDS_pept        533792..534559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0466"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; NAD-dependent epimerase/dehydratase; KEGG:
FT                   eca:ECA0481 2,3-dihydroxybenzoate-2,3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11522"
FT                   /db_xref="GOA:C6DJV9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR003560"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJV9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACT11522.1"
FT                   /translation="MNKAQPLQFDFSGQTVWVTGAASGIGESIARQFVGLGANVIGFDR
FT                   AFRHQDRPFTCVTLDISEPDSVAAVCRQQLAETGLDVLVNAAGILRLGDIDALSVDDWH
FT                   QCINVNASGAFYLLNALVPHFKQQRRGAIVCVGSNAAHVPRLQMAAYCASKAALTSLSH
FT                   CAGLELAPYGVRCNLVSPGSTDTPMQRGMWHSADAEQRTIAGFPDQYKLGIPLGKIAQP
FT                   EEIANTVVFLASDLASHITMQDVVVDGGATLTA"
FT   gene            534582..540899
FT                   /locus_tag="PC1_0467"
FT   CDS_pept        534582..540899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0467"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   non-ribosomal peptide synthase; PFAM: AMP-dependent
FT                   synthetase and ligase; phosphopantetheine-binding;
FT                   condensation domain protein; KEGG: eca:ECA0482 putative
FT                   non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11523"
FT                   /db_xref="GOA:C6DJW0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR041464"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJW0"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ACT11523.1"
FT                   /translation="MKDIVTLLKQLERQGVRLALNAQGQLISQSSKDAITADIGRTIKE
FT                   NKDAIVRCLTAQQAFERPITPQNATSGPLSSSQSGLWFIEQYEEQSHLYNMPVYFRLTG
FT                   TLDVAALEFAFDALAQRHASLRTRFVVNEQGKGEQRIDAYQPFVIQHDDFSSLPEAERE
FT                   ACLQQQVKAEISRPFDLTAGDLTRVRLVKMSERVHILMITQHHIISDGWSVKNMFADFK
FT                   PAFLACQNRQPYPVEPTQLNYIDYAHWFNSNAFLDYHNEFKPFWVERLTGIPEVHSLPL
FT                   DKSRPAHQNSGGEVIFSAINNELWDKFKRLCQRYNTSNFIGLHAVFSLMLARISGEKDI
FT                   VIGSPLAYRERPDIEDVVGFFVNTIVLRTQLQDQQSFVDYLQYCREQDLSAFDHQLYRF
FT                   EALSEAIGSDRTTAINPIFQVMLVYQAKVDFNDLIPGCDAEEETSPVLPAKTDISVKVT
FT                   ELMGEVRLDWLFATALFERQTIQYYADRFIRLIEAVVEAPETDVWHLPLMEADRFAAVL
FT                   AESQQLPRSYPQPLLTVTDVIEAVAQRDPQQLAIAFDGEQRTDTLTYGELNRQANQLAH
FT                   WLHRQGLGEQSLVGVLAKRDRYFVIALLAVWKAGAAYVPLDPDYPPERLRHIITDANLA
FT                   VILGGDGEQLAQWSAEQRIDLADPAVVAQWHDLPGDESPAIPRHAQQLAQVIYTSGSTG
FT                   LPKGVMIEHGSLINLLGDHRDRIDFTPQSTMFNCMSLSFDAGNMTTLLPLSCGGTLAFG
FT                   EPNDRAIVQAEQACATHLILPTALMSILDPKQVNGIQAIGMGGEACPNAVVENWADKVA
FT                   LYNMYGPTECTVTALSTRLRKGQPVTIGKPIAHIQALILDAAGQLCPAGVPGELCLAGL
FT                   GLARGYLNQPQMTASRFEHITLNDVNRVGQGTATLRIYRTGDKARLLNNGDYEYCGRID
FT                   EQIKLRGYRIEPGEIEAQLAAVCPSLKQVKVIVAQVGSRPALVAYATVKAGGGTPEPAA
FT                   VLIDVAKHLPEYMVPFRLILLEDMPLTPNGKLNTKQLPPVLEASDGDGEADNPLEADVL
FT                   AIWRSVLNTPLGVEDDFFRLGGDSILSIQLTTRLRSAGYACTVKDVFEAKSVRRLCRVL
FT                   AQNNRDTGIVAEQGTLEGEFALLPIQRWFMEQPLARPEHWNQAAMIQLPEVDAGRLTTM
FT                   LQALMAQHDALRLACDAEGQRYLTDVPCPAVSTLDYRQLGDDGLQQAFTALQSEFAPAQ
FT                   GRTMACALVRHHPQADTAVFLAFHHLVIDAVSWRILVDDLERLYLGEPLPPKTSSYRQW
FT                   GTALHHYATQHAEQLTYWQAQENGVDQTALLAAKDPQGQASAAMLTLDAETTSQLVSEA
FT                   NRAFNTDVSDLLLAALTRTLNDLGWGDKARIMLEGHGREAIDPTLDVSRTVGWFTSTYP
FT                   VCLQDRSDWASLIQSCKEQLRQVPDKGVGFNPLRYHHPQGNSLTLSPIVFNYLGLSVHT
FT                   AGTWRPVDVAPGVCVALENKPAEIISLHGGIAGGQLTLRQVGCLNQRDSERLMVRLTEN
FT                   LRALTAACLAQLHHGTVFTPSDFPAVTLSQTQLDSLSQRYDIDTLLPLSSLQQSMLYHR
FT                   LRCPQDDAYHLQTPVRYAQALDVEGYRQAWQRQIQRFPALRAALESEQTSVQVIVKQAD
FT                   LPFYYQDVTQEADPQAVIERYRQQDLRTGFDLSQPPLLRIACFRLGEQDYRVLLSCHHS
FT                   VIDGWSGPQLLGAVHRDYLLLMRGETPTIQVDSAYVDYALHAVAQQPAVEAFWQQRQPL
FT                   LVQTNDVAVLFAAAGKRADLSQHLTQIEPQVTSVSLNEQDQATLTAFAREVGVTHSIIA
FT                   QYAWHRLLARSTGDAVSIVGNVLSGRESPVDDVASSVGLYINSLPLALSWQQPMSLQQH
FT                   LVQLQNELMAMNQHATQSLIALTAGRPRLFNSLFIYENYPGAKAEPGQRADDPHRLSPE
FT                   FSAAYEKVEMPLNLVVREQAGCMLLRFEFDADVLDSTQARRVLMRWHDEVVALINSAPQ
FT                   QPAEIIGHEKATGSVVAQKTAADSGISQPDTPSAQLLLRVWAQVLHLAESGLWSQTLCE
FT                   CGIDSLRRIALAQALSRALAQPVSVALLQRYPSPQALNGYLAQSRVTANEETLS"
FT   gene            540896..543010
FT                   /locus_tag="PC1_0468"
FT   CDS_pept        540896..543010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0468"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   eca:ECA0483 putative non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11524"
FT                   /db_xref="GOA:C6DJW1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJW1"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ACT11524.1"
FT                   /translation="MTGSNEAVVNPLAEIQQPTAFGQRVGAAYGEQRHSSELSQEYPTP
FT                   LVSAAWSWLLYKYSGEEQVCAAFVTSDLPDHVRPLIAHFHQRDRLISDWIAAVGSACDP
FT                   LPVSEVSVAAPLHALFSSLLIVGDMASLSVVVQKVAQTVALIVQVQKDLLILTAPDGQF
FT                   DNRQLQGISRHLTQLLDGLLAQRWERLTQIRLSPLVAPLPHRAATPALHDELLARLAQD
FT                   ARQDRVAIRFQEREISYRELLQRVALIQQMFAAQGITAGQRVGLHLSRQPDTVAALLAC
FT                   VFSQVAFVPLEPDFPGERLQAIQQEAMLAAVLQDSYTGGSLAFDCPILNLCDLPYSASD
FT                   STASVQLAQAGGPETAAYMMFTSGSTGKPKGVVIGQRALQTFIHASVERLVLTDKANWL
FT                   LITTLAFDISMLEVFGPLWAGGVLHLTTHEEYKDPQAVAAYLQARPEINVLQATPAFWR
FT                   MMFKAGWQGKPDLVALCGGEALDLRLAQRLVSRCRTLWNCYGPTEATIWSQMAQIDGAT
FT                   LENQHTVALGNTLVGYQHLVIDDDRHPLAEGMVGELCILGEALSSGYWQRDDLTQDRFI
FT                   QQVESGQRMYRTGDKVRLLADDRYQYLGRFDDQVKLRGFRIELGEIEAQMKRIEQVQDA
FT                   AVKLQGEGDEAVLVGYVEYKPGSEMTKLALRKQLHQFLPAYMVPGRIVVLDKLPKTGSG
FT                   KVDRKRLTDV"
FT   gene            complement(543096..544604)
FT                   /locus_tag="PC1_0469"
FT   CDS_pept        complement(543096..544604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0469"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   pen:PSEEN0747 efflux outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11525"
FT                   /db_xref="GOA:C6DJW2"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJW2"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACT11525.1"
FT                   /translation="MLKGRKLFSLSAIVLAASGCAVTTQPISKVESGQRSQQDRVAMFS
FT                   QQEPVTAPITLYDAMARALKYNLESRLKVMEYALSQQQLELARYDMLPKIAASAGYVGR
FT                   NNMSASSSRSVETGRTSLEPSTSQDRDRDVADLTMVWNVLDFGVSYVTAQQKSDQRWIA
FT                   EERKRKVVHTILQDVRSAYWRAVAAERLLGQIDGLIARVNTARDASEHMSSQQIGDPIE
FT                   ALSYQRALIDATRQLEEQRRALSLAKTELATLMNLPLDTAYKLALPQSGDETVPQLNVD
FT                   VKVLEEAALVSRPELREQDYQVRIHAAETRKALLRMLPGVEISAGGHYDSNSFLVNNSW
FT                   ADVGVKATWNLFNLLSGPAARKAAQANESVSEMQRQAMSLAIMAQLYIARANFNEAQRQ
FT                   YKTSSELRNLDTKIVEQLRNRYKANSIGELQLIQGELNALNASLRQDLAYAELRNSYGQ
FT                   IFSTIGLDLLPKSLPSNSLADISQSLRQSDINWQQGKISTLQSF"
FT   sig_peptide     complement(544539..544604)
FT                   /locus_tag="PC1_0469"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.516 at
FT                   residue 22"
FT   gene            complement(544713..553274)
FT                   /locus_tag="PC1_0470"
FT   CDS_pept        complement(544713..553274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0470"
FT                   /product="Ig family protein"
FT                   /note="PFAM: Ig family protein; SMART: Dystroglycan-type
FT                   cadherin domain protein; KEGG: lch:Lcho_3739 outer membrane
FT                   adhesin like proteiin"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11526"
FT                   /db_xref="GOA:C6DJW3"
FT                   /db_xref="InterPro:IPR006644"
FT                   /db_xref="InterPro:IPR008009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015919"
FT                   /db_xref="InterPro:IPR025592"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJW3"
FT                   /inference="protein motif:PFAM:PF05345"
FT                   /protein_id="ACT11526.1"
FT                   /translation="MLWRQLFSKKSDHPTDHIEQAYSAPLGFVLESRVLFDGAIAATAT
FT                   QAETSNSSDATASSNPAQTANHSAEATSENNTSSDQNSATHDITTDVVVQAVAGETIRK
FT                   EAVFIDTALTDYQTLVNSVPAGVDVFLLDSSKDGLTQMAVWAETHTGYDAIHILSHGNE
FT                   GQVRLGNLTLDSATAEARSADLAKLGTALTQDGDLLLYGCDIAQDTGKSFVSLLSQLTQ
FT                   ADIAASDDLTGAIAKGGNWQLETTVGSIETNNAALGEITTNYNNLLASPTLGTNTFSQF
FT                   SGTNTFVSSQSGVQSYDDINNGFTYVAYSTDRVTLQTVAISGNQVLNTIVAPGGNLNYF
FT                   AIKSTDGSEFNLSNIDLRGLGNYASTFTITGYKDGSAVAGATQTITLTTAFQTATLSNA
FT                   FQNIDEVRLTTATLGNGTVQWDNIVTAPVVASTDNVPSIAGSATNPTYTENGTDVGLFT
FT                   NVIANTNDSGQTFTSATFTVTNVADSTEYLNINGVKVSLINGNSVTLGSGYGSASVFLS
FT                   AGTATISLSGETLSNADMGTLLSGMTYGNSSENPHTTARVVTLTQVTDSGASNNSYSPG
FT                   NIASTVTVVAVNDAPTDLALSNTTFGQSLGSNGIVGTLSATDVDSTTFTYSLVSGAGST
FT                   DNALFILSGSTLRAVNAATMAAGTYSVRLQVSDGQATYDKVITLTVADDIAPTFDATPT
FT                   ITAPTPDGFTLNTDLNERGTIYYVVLPDGASAPSVSQVINGQNASGSLPLNFGSQLAGS
FT                   APYSQSLTLTGLAAATAYDVYVVARDSAGNATLSVVKLDVTTAASSTAPTLSATGSNPV
FT                   FIGGMAGAVDLFSGVSADTRDSGQTFNSLTLTVSNVSDSGEFISVAGNTISLASNGSGT
FT                   LTGIGSYTVTRVGNTVTLQLSGMSASNTQFAGLVDGLRYGNSNSSVTAATRDVSLTAVR
FT                   DSGTSNNTTSLSLTSSVNVLASNSALYVTSGDDTGDDASFGNSLQDDLNDGGGLSLREA
FT                   LHWANLTPGIDRIVFQTNVTLAEGLLVPTSSMLIDGQSFTLNGGGYSGFQINTSSITLA
FT                   IQNLTLTNFTTSTNQVTGGVLGIHYGATDINFRLYNVDISGNTDDTWGTGMIDLFNIAP
FT                   GRYIVDLDRVNIHNNVLFGGLNEEGVVRLFVAGTQHTVSLSITNSAIYNNGSFNPASGN
FT                   IGVAGIYVTASLSNATSTHISLMNTTITGQDAGMVFGFTGGSTNWVANIRNSIISGNTV
FT                   DVTTFYSGGTGGTYTLLGNNNLIGGTVNLISTADPRLAATATNAINQGDRFSVTGDADA
FT                   RGLDRVRQGAVDIGAYESQFASGVSPQVDLNGASSGNDYSATVSSGLSTGVPITDMLAT
FT                   LSQTDGDTRLWTLTLSLAGNANGSSEYLTLSQQALLAAHAAGINVSGDGSQTVTLTGGA
FT                   SLDAFQTALRAIVYVNVATTPTAGNRTISVTANDDASSSATSTLTVVVGNPPVVATPIP
FT                   AQSVAQDGSLSFTVPAGTFTDPDVGDTLTLSATLANGSSLPSWLTFNPATGTFTGTPGN
FT                   ADVGILSIKVTATDTTNASVSTTFSLTVTNVNDAPIVATPIPAQSVAQDGSLSFTVPAG
FT                   TFTDPDGDTLSLSATLANGSALPGWLTFNSVTGTFSGTPGNADVGTLSIKVIANDGNAS
FT                   VSTTFSLTITNVNDAPMVSATIPAQSVAQDGSLNFTVPAGTFTDPDGDTLTLSATLANG
FT                   STLPSWLTFNPATGTFSGTPGNADVGTLSIKVTAHDGSASVSTTFNLTITNVNDAPVVA
FT                   TPIPAQSVAQNGSLSFTVPAGTFTDPDVGDTLTLSATLADGSPLPGWITFNSATGTFSG
FT                   TPGNADVGSLSIRVTATDGSNASVHTDFSLTITNVNDAPVVATPIPAQSVAQGDSLNFT
FT                   VPAGTFTDPDAGDTLTLSATLANGSPLPGWITFNSATGTFSGTPGNADIGSLSIRVTAT
FT                   DGSNASVHTDFSLTITNVNDAPVVATPIPAQSVAQDGSLNFTVPAGTFTDPDGDTLTLS
FT                   ATLANGSPLPGWLTFNPATGTFSGTPGNADVGSLSIRVTATDGSNASVHTDFSLTVTNV
FT                   NDAPVVATPIPAQSVVQDGSLNFTIPAGTFTDPDGDTLTLSATLANGSPLPSWITFNPA
FT                   TGTFSGTPGNGDIGNLSIKVTANDGDASISTTFSLTVTPSNQAPVVSTPIPPQSVAQDG
FT                   GFNFTVPAGTFSDPDGDTLTLSATLTDGSPLPSWLHFDPTIGTFSGTPGNGDVGTLVIR
FT                   VTATDGSNTSISTSFGLTVTNVNDAPVVATPIPPQSVAQDGGFNFTVPAGTFSDPDGDA
FT                   LTLSATLADGSPLPSWLHFDPTIGTFSGTPGNGDVGTVVIRVTATDGSNTSVSTSFGLT
FT                   VTNVNDAPVVATPIPPQSVAQDGGFNFTVPAGTFSDPDGDTLTLSATLSDGSPLPGWLR
FT                   FDPAIGTFSGTPGNGDVGTVVIRVTATDGSNTSISTSFGLTVTNVNDAPVVATPIPPQT
FT                   VAQDGGFNFTVPAGTFSDPDGDTLTLSATLADGSPLPGWLRFDPAIGTFSGTPGNGDVG
FT                   TVVIRVTATDGSNTSVSTSFGLTVTNVNDAPVVATPIPAQSVAQDGSFNFTVPAGTFVD
FT                   PDGDTLTLSATLADGSPLPGWLRFDPAIGTFSGTPSNGDVGTVVIRVTATDGSNTSIST
FT                   SFGLTVTRSIVGGDPQFKANDGLGRTPSFSDTRQQSTQDIAAAEQTLGGLIANPSLGSL
FT                   TLGNDGAPRSVMSAIFATGRQNTETGTLPVSQVAGAFGHGVASGIGVNFDSTLGSFPSF
FT                   SKDSALGGTSSLASTFSGIYLPSLTPMEVFSGGSWKDIPLDGASNAMNSTDDNTGRSVA
FT                   FTPSLHRQLQQIGDSELQRLAAIEQALQESGQQQG"
FT   gene            complement(553485..554225)
FT                   /locus_tag="PC1_0471"
FT   CDS_pept        complement(553485..554225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0471"
FT                   /product="Tail Collar domain protein"
FT                   /note="PFAM: Tail Collar domain protein; KEGG:
FT                   ppw:PputW619_0674 tail collar domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11527"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJW4"
FT                   /inference="protein motif:PFAM:PF07484"
FT                   /protein_id="ACT11527.1"
FT                   /translation="MKCIQRLFAKSAIATVLAVGLSQPATASACSTEPYIGSICYMVTS
FT                   YCPQGYLPANGQTVTINQYQALYALIGNIWGGSPQQGNFVLPDMRGRVPVGAGQGTGLA
FT                   NVTRGQVFGVENVALTTSNVAPHIHPATVASSGGVSGTASIAIPVVNGAATTNVPDNTT
FT                   SLATTSPSFDLSSVGGVDSPAKIYSNAAPTTTLKPFSAPFSVTSLTGITISPNIGGTPF
FT                   SVRNPSVGLTACIAAIGIYPTNPN"
FT   sig_peptide     complement(554136..554225)
FT                   /locus_tag="PC1_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.642 at
FT                   residue 30"
FT   gene            complement(554719..556827)
FT                   /locus_tag="PC1_0472"
FT   CDS_pept        complement(554719..556827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0472"
FT                   /product="peptidase M50"
FT                   /note="PFAM: peptidase M50; KEGG: pfo:Pfl01_0147 peptidase
FT                   M50"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11528"
FT                   /db_xref="GOA:C6DJW5"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJW5"
FT                   /inference="protein motif:PFAM:PF02163"
FT                   /protein_id="ACT11528.1"
FT                   /translation="MNPHLPPLRADLQLVESAPGINGAPQWVLSDPITGRYFTLTPSAI
FT                   RLLRHWPLRQPQQILAAANSEPGLPLRVKELEQLLQFLRQHDLIAASDVEQRQRYLGKA
FT                   QAMRTSLWKSVLHQYLFFRIPLWRPDPVLNRCWPWLQHYGAPFLMWVFPCILLLGLFLV
FT                   SRDWVRYTHSFPHLFSLSGMAVFGISLVFAKFIHELGHAFMAKRAGCRVQSMGVAFIVL
FT                   FPLFYTDTTDAWKLKDRQARLLIGAGGILAELMLAVIALLAWALLPDGAARTAAFMLSS
FT                   ATWLTTLVVNLNPLMRFDGYFLLSDFWRVENLQERAYALCRWRLRESLFGHGHPAPENL
FT                   SPSLQRKLLVWGYASWIWRFFLFFGIALVVYHFFIKVIGIGLMLVEIVWFIALPIAKEA
FT                   YAWWSMRKSIHPIAFLRSALLCSALLFILLYPWGGSIHIPAVLEAEKVSTLYSPVPAQV
FT                   NQLHVTDGQRVDAGDILLELTSVDLDYRLDIERQRITQLQQQRQRGAARQETASEIQVM
FT                   DRQLAEALARYRGLAAQRQRLTIRAPQAGVVRDLARDMTAGRWLTADTPLLRVVEPTQG
FT                   RVVGYIPEESLMRTQEGMQGVFLADDPAFPRLDVTLHDIAPTGSAYLQQEMLASDRHGP
FT                   IAVRRDRDHNPQPVQAQYRVHFMVQEEPFLPLQQPLRGSVILEGEKESILGTVWRRVAA
FT                   LGIRESGF"
FT   gene            complement(556824..558152)
FT                   /locus_tag="PC1_0473"
FT   CDS_pept        complement(556824..558152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfo:Pfl01_0146 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11529"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJW6"
FT                   /inference="similar to AA sequence:KEGG:Pfl01_0146"
FT                   /protein_id="ACT11529.1"
FT                   /translation="MSTTPTSASTAAFARFLDVERQARAAKSTEELAYCIVNDSQPLFG
FT                   FRHAALIINGRVRAVTGVTQPAPHAPFVAFIERACTQLSSIDEKALAKCAVIEASQLDE
FT                   QSRKDWQALSAPEVLWSPLNDRQGKPFGAIWYAREQLWQSTDQVLAEQLSGAFSHAWLA
FT                   LEPQTTRWRRRQTRWKIAVPALLLLACLFIPVRQSVLAPAEVIPHQGRVVAAPLDGVIQ
FT                   SFTVLPNQSVRKGEVLVRFDSTTLKAQADVAERALNVAEAEHRASSQRAFQDADSKARL
FT                   DFLAAQVAQKRAERDYANALLSRAEIRAERDGIAVFADATRWMGKPVRTGERLMELADP
FT                   ALTALRIELDVGDAIRLPQEAPITLFLDSDPLTPHAALLERIAYESEQTPAGNLAYRLD
FT                   ARFTDTPPRIGLRGTAKISGDYVPLAVYLFRRPLAVIRQAIGI"
FT   gene            complement(558149..558952)
FT                   /locus_tag="PC1_0474"
FT   CDS_pept        complement(558149..558952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppw:PputW619_0668 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11530"
FT                   /db_xref="GOA:C6DJW7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJW7"
FT                   /inference="similar to AA sequence:KEGG:PputW619_0668"
FT                   /protein_id="ACT11530.1"
FT                   /translation="MDSFSNVISRRTFQLLALCLFAFTAHAQTSDPLLAIPSHDTPSLT
FT                   PTDNQARGILIAVEQATLSSELAGRIVEIPFREGESFKKGDLLVRFDCSIYQAQLAAAS
FT                   AATRAAEAELSQNQQLAQMKSVGRHAVSLSAAHFAQAQAESQVYQIQVNRCRITAPFDG
FT                   QVVKRRAQAFESVAQGAPLLDVVNNRNLEINLLVPSRLLSVLKPGLAFTFTPDETGKPL
FT                   QAKVTRLGARIDESSQTLGLTGTLAHADNTLMAGMSGTAQFSEAQ"
FT   sig_peptide     complement(558869..558952)
FT                   /locus_tag="PC1_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 28"
FT   gene            complement(559251..561332)
FT                   /locus_tag="PC1_0475"
FT   CDS_pept        complement(559251..561332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0485 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11531"
FT                   /db_xref="InterPro:IPR025115"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJW8"
FT                   /inference="similar to AA sequence:KEGG:ECA0485"
FT                   /protein_id="ACT11531.1"
FT                   /translation="MTSISESLTALVKRRAQLREMFTTHQFDALDTLLEQEHQIWLDGP
FT                   NLPYTYIWLINSLFDPALSDADILSRLQAWVAARPESYHAHHLTGQYWENAAARIRTAN
FT                   GGQYVEDDRWMGAELARDLGVAAYLRASALHQRPALTFSRLFRLTCYLGEPQWLGVLLQ
FT                   GGEPLTYAQRQAQVDPSLWEAGLERLRNEGAQTLVELPVALPASLPAREDHEWEEPMNY
FT                   WLRITLAVRPQDLAIRKECVYFLYPRWGGSHEAITQFIDGPLCEVLTEPERNSLRVTQC
FT                   WDYVGYAALIPDANDAESITYCRETFDWLLGLELFPDTRALVLRQYAWFLGNYARLEDE
FT                   NGIRWNKSDMRLAYNLMVEAWQVDLPESDPESDAFATLISCLDFVRIEDSFDLMPKWLE
FT                   RCQYWRDAHYETTIAALASKFGFYGIAKGQFDSDALLARCRVLKSETNFGQAGTNLFEY
FT                   VSEEAGVFLLHEAANWGEASSMAALSDLYSGHLSRRNERDPSPYEDQEKSDYWQERAAD
FT                   AGNEICQYNIAYCLIRDNETLSPVQYQRARELMFGVMHRPNVGRTVWTRAARELSTLLL
FT                   FSNIPEDQARCVDVVLPELWSDEDDDNRDYAAGYYAYAFRNGAGVTQNSYLAKVWIDRA
FT                   LEISPDSQYNHDRANEIYQRGGMLSGVRAKMGFNRDKAKIDARGRAITFGDDAHQEHQ"
FT   gene            562021..562953
FT                   /locus_tag="PC1_0476"
FT   CDS_pept        562021..562953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0476"
FT                   /product="phosphoenolpyruvate phosphomutase"
FT                   /note="TIGRFAM: phosphoenolpyruvate phosphomutase; KEGG:
FT                   eca:ECA0487 phosphoenolpyruvate phosphomutase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11532"
FT                   /db_xref="GOA:C6DJW9"
FT                   /db_xref="InterPro:IPR012698"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJW9"
FT                   /inference="protein motif:TFAM:TIGR02320"
FT                   /protein_id="ACT11532.1"
FT                   /translation="MSVILSNHTPTDSYKGCTPGSRRSALRELLRQQKGIRVMEAHSPL
FT                   SALLIEQAAYEDGDIHYQFDAFWSSSLTDSTLRGKPDTELVDISHRFHAITEIFDVTTR
FT                   PLIFDGDTGGQTEHLAHRIRAAENLGISAMIIEDKTGLKKNSLFGNDVKQTQASVEDFC
FT                   EKITTAKKAQLTPEFMLIARIESLILDVGMEDAINRALRYADAGADGIMIHSRHKNPSE
FT                   ILAFARQFREHYPHLPLVCVPTSFNDITFDQLIDGGFNIVIYANHMLRAAYPAMKSILP
FT                   EILKHGRTLEVEDKCMSIKDILDLIPGTR"
FT   gene            563186..564340
FT                   /locus_tag="PC1_0477"
FT   CDS_pept        563186..564340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0477"
FT                   /product="phosphonopyruvate decarboxylase"
FT                   /note="TIGRFAM: phosphonopyruvate decarboxylase; PFAM:
FT                   thiamine pyrophosphate protein domain protein TPP-binding;
FT                   KEGG: eca:ECA0488 phosphonopyruvate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11533"
FT                   /db_xref="GOA:C6DJX0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR017684"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJX0"
FT                   /inference="protein motif:TFAM:TIGR03297"
FT                   /protein_id="ACT11533.1"
FT                   /translation="MIDPNKLIEFLAQRGVHFFSGVPDSLLKAFCLAVESNHSGLAHRI
FT                   ASNEGCAIGMAIGHYLSTRTLPVVYMQNSGLGNAINPLCSLATPDVYGIPLLLIIGWRG
FT                   EVDDGGKQQHDEPQHVMQGRVTLAQLDVLDIPHIVLDSHSAPRWDDIQALLQRSHDEHR
FT                   PVALVVRKNTFSSSAAPANSTVEPVLMQREAIVAACLNVLPSHLPIVSTTGMLSRELYE
FT                   LREQRSEGHQRDFLTVGGMGLASQIALGLCDAQPQRKVVCLDGDGALLMHMGGLTNTAQ
FT                   ANNLIHIVINNGAHDSVGGQPTAASRLPLAPIAAASGYGDTYYVETEDALQAALQQALR
FT                   AHSSQFIEVKCRVGHRSDLGRPATSPAQNRDAFMQFLNTPPQAS"
FT   gene            564395..565288
FT                   /locus_tag="PC1_0478"
FT   CDS_pept        564395..565288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0478"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: eca:ECA0489 putative 2-hydroxy-3-oxopropionate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11534"
FT                   /db_xref="GOA:C6DJX1"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJX1"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ACT11534.1"
FT                   /translation="MTHSVSLVGVGVLGKAISLRLLQRQFSLSVFNRTHSKASEIAAEG
FT                   AQSVPELHQLFTQEKQVVLICLKDAEAIRDVFQSKEVTQKLTRYRPLFLNISTIGPEES
FT                   RWMASFFHQHGAHYVECPVSGGPEGARQGKLAAWVGPCVDDFARTVNDIVTSLSDRYVL
FT                   MANNHSAQTMKVINNYCEAVHLLVAAEALLVAEGHGIAPDMLANALTLGRGRSTYMEVM
FT                   LDRYLNPRETVSVPLSIRLKDLDLAHTLFQRAEIQSEFFDTARQCYQNTADLSAVPQDQ
FT                   TACFAYLSRTLPAGRE"
FT   gene            565289..565732
FT                   /locus_tag="PC1_0479"
FT   CDS_pept        565289..565732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0479"
FT                   /product="phosphonate C-P lyase system protein PhnG"
FT                   /note="TIGRFAM: phosphonate C-P lyase system protein PhnG;
FT                   PFAM: phosphonate metabolism PhnG; KEGG: eca:ECA0490
FT                   putative phosphonate metabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11535"
FT                   /db_xref="GOA:C6DJX2"
FT                   /db_xref="InterPro:IPR009609"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJX2"
FT                   /inference="protein motif:TFAM:TIGR03293"
FT                   /protein_id="ACT11535.1"
FT                   /translation="MSELTQRQRWMSILAHSDPVELEEHWGTLNFPTGYQLLRPTQIGL
FT                   IQLQGRMEVDGPRFIVGDMTVTRAAVQLEDGTCGYSYIAGRNKPHAELCAWIDALLQTR
FT                   SYFHEIWERIITPLADQQRAYREQQQHEVAASRVNFFTLVRGE"
FT   gene            565739..566320
FT                   /locus_tag="PC1_0480"
FT   CDS_pept        565739..566320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0480"
FT                   /product="phosphonate C-P lyase system protein PhnH"
FT                   /note="TIGRFAM: phosphonate C-P lyase system protein PhnH;
FT                   PFAM: phosphonate metabolism; KEGG: eca:ECA0491
FT                   carbon-phosphorus lyase complex subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11536"
FT                   /db_xref="GOA:C6DJX3"
FT                   /db_xref="InterPro:IPR008772"
FT                   /db_xref="InterPro:IPR038058"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJX3"
FT                   /inference="protein motif:TFAM:TIGR03292"
FT                   /protein_id="ACT11536.1"
FT                   /translation="MTTMTGFAHPVFGTQLCFRKIVKAMSEPGSLVTVPNVSGLESISS
FT                   ATAATLLTLTSHTTPLFIDPRIGNPLLLRTLCLHTNVPIATTLEEAYFVLLSGNPFSYD
FT                   LMALSCGSEAEPEKSTTVIVEVDGMHDGPCLKLTGPGIKTHRIISPRLPGSVRNYLCNR
FT                   PHAFPTGLDFLFTSGKKLFAIPRSTHVEEC"
FT   gene            566320..567423
FT                   /locus_tag="PC1_0481"
FT   CDS_pept        566320..567423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0481"
FT                   /product="phosphonate metabolism"
FT                   /note="PFAM: phosphonate metabolism; KEGG: eca:ECA0492
FT                   putative phosphonate metabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11537"
FT                   /db_xref="GOA:C6DJX4"
FT                   /db_xref="InterPro:IPR008773"
FT                   /db_xref="UniProtKB/TrEMBL:C6DJX4"
FT                   /inference="protein motif:PFAM:PF05861"
FT                   /protein_id="ACT11537.1"
FT                   /translation="MYVAVKGGEKAIEAAHQLQSCRRRGCTDIPELDCSQIEQQLNLAV
FT                   DRVMTEGNIYDRQLAALAIKQASGDLVESIFLLRAYRSTLPRWGISQPLNTSDMRLERR
FT                   VSAIFKDLPGGQLLGPTYDYTHRLLDFSLLAAGEDPVAPQPDAADANEEADEHVAHAFQ
FT                   FLAQQHFVPERDIRDDSDPPDITMVPPSYPGTRAARLQQLFRGDEGFLLSLGYSTQRGY
FT                   GRNHPFVGEIRTGYITVSIVAEEVGFAIDIGEILLTECETVNGFVKPTNDAPHFTRGYG
FT                   LAFGRSERKAITVALADRALQAADYQEEIRGPAQDEEFVLSHADNVEAAGFVSHLKLPH
FT                   YVDFQSELELLKRLREEYLASVPRSNA"
FT   gene            567423..568328
FT                   /locus_tag="PC1_0482"
FT   CDS_pept        567423..568328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0482"
FT                   /product="phosphonate metabolism PhnJ"
FT                   /note="PFAM: phosphonate metabolism PhnJ; KEGG: eca:ECA0493
FT                   putative phosphonate metabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11538"
FT                   /db_xref="GOA:C6DKA1"
FT                   /db_xref="InterPro:IPR010306"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKA1"
FT                   /inference="protein motif:PFAM:PF06007"
FT                   /protein_id="ACT11538.1"
FT                   /translation="MGQTTISRQTGSRPETAYDDSDTEYNYAYLDESTKGMIRRAILKA
FT                   IAIPGHQVPFGSREMPMPYGWGTGGIQITASIIGPDDTLKVIDQGSDDTTNAVSIRTFF
FT                   RKVANVPTTEKTSDATLIQTRHRIPETPLKEDQILVFQVPIPEPLRFIEPRETETCKMH
FT                   ALEEYGVMQVKLYEDIARFGHIATTYAYPVKVNHRYVMDPSPIPKFDNPKMDMMPALQL
FT                   FGAGREKRVYAVPPYTVVESLDFDDHPFTIQQWDKPCELCGARDSFLDEVVMDDDGTRM
FT                   FVCSDTDYCQQRQSQGGETS"
FT   gene            568325..569113
FT                   /locus_tag="PC1_0483"
FT   CDS_pept        568325..569113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0483"
FT                   /product="phosphonate C-P lyase system protein PhnK"
FT                   /note="KEGG: eca:ECA0494 phosphonates transport ATP-binding
FT                   protein; TIGRFAM: phosphonate C-P lyase system protein
FT                   PhnK; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11539"
FT                   /db_xref="GOA:C6DKA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012700"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKA2"
FT                   /inference="protein motif:TFAM:TIGR02323"
FT                   /protein_id="ACT11539.1"
FT                   /translation="MTTEHHVPDTPLLDVRHLTHLYAPEKGFRDVSFQLWPGEVLGIVG
FT                   ESGSGKTTLLNAISARLAPQDGEVIYRNAEQQVLSIYDISERQRRALVRTEWGIVWQHP
FT                   LAGLRPTVSAGGNIGERLMAIGNRHYGDIRSKAAQWMANVELPENRLDDLPTTFSGGMQ
FT                   QRLQIARNLVTAPRLIFMDEPTGGLDVSVQARLLDLLRTLVVEMQLSVVIVTHDLGVAR
FT                   LLSHRLLVMQRGRVVEQGLTDRVLDDPSHPYTQLLVSSIL"
FT   gene            569135..569866
FT                   /locus_tag="PC1_0484"
FT   CDS_pept        569135..569866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0484"
FT                   /product="phosphonate C-P lyase system protein PhnL"
FT                   /note="KEGG: eca:ECA0495 putative phosphonate ABC
FT                   transporter ATP-binding protein; TIGRFAM: phosphonate C-P
FT                   lyase system protein PhnL; PFAM: ABC transporter related;
FT                   protein of unknown function UPF0040; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11540"
FT                   /db_xref="GOA:C6DKA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012701"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKA3"
FT                   /inference="protein motif:TFAM:TIGR02324"
FT                   /protein_id="ACT11540.1"
FT                   /translation="MDTQLRIENVDKTFVLYNQQGARLPVFHDVSLSVKGGECVALHGH
FT                   SGSGKSTLLRSLYGNYQPDGGHIWVRHRERWVDIVNADARHVLEIRRETVGWVSQFLRV
FT                   IPRISTLNVVIQPLLERGMSRQESEILAGELLTHLNVPERLWSLAPATFSGGEQQRINI
FT                   ARGFIGDYPILLLDEPTASLDAKNRLAVTQLINNAKDKGCAIVGIFHDDEVRQEVADRL
FT                   YTMSLHTMPVISNAQETANDH"
FT   gene            569856..570992
FT                   /locus_tag="PC1_0485"
FT   CDS_pept        569856..570992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0485"
FT                   /product="phosphonate metabolism protein PhnM"
FT                   /note="TIGRFAM: phosphonate metabolism protein PhnM; PFAM:
FT                   Amidohydrolase 3; amidohydrolase; KEGG: eca:ECA0496
FT                   putative phosphonate metabolism protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11541"
FT                   /db_xref="GOA:C6DKA4"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR012696"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKA4"
FT                   /inference="protein motif:TFAM:TIGR02318"
FT                   /protein_id="ACT11541.1"
FT                   /translation="MIINNVNMVLAQEIIHGSLEVRNGVIHHISDRPSRHPGALDGEQA
FT                   WLLPGLVELHTDNLDKCFTPRPGVNWPSEAAMRNHDALIISCGITTVLDAVAVGDVRDG
FT                   GHRLENLRRMTDAILYSQQHGANRADHHLHLRCELPHQNTFPLFEQLADIPLVALASLM
FT                   DHSPGQRQFSSQEKYHQYYKGKYHLNDEQMAAFEEEQLAGSRRWSQPNREAIVRLCHDR
FT                   GITLASHDDATPEHISEAHQHRVSIAEFPTTTIAAQQAHGVGMNVLMGAPNVICGGSHS
FT                   GNVSAHHLATLGVLHILSSDYYPASLLEAAFMIAEDERNDYDLPRAIALVSNNPAQALQ
FT                   FDDRGCIEEGRRADLLLVKRQAPQMKLMRVWRQGVRVF"
FT   gene            570995..571564
FT                   /locus_tag="PC1_0486"
FT   CDS_pept        570995..571564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0486"
FT                   /product="phosphonate metabolism
FT                   protein/1,5-bisphosphokinase (PRPP-forming) PhnN"
FT                   /note="TIGRFAM: phosphonate metabolism
FT                   protein/1,5-bisphosphokinase (PRPP-forming) PhnN; SMART:
FT                   guanylate kinase/L-type calcium channel region; KEGG:
FT                   eca:ECA0497 ribose 1,5-bisphosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11542"
FT                   /db_xref="GOA:C6DKA5"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR012699"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKA5"
FT                   /inference="protein motif:TFAM:TIGR02322"
FT                   /protein_id="ACT11542.1"
FT                   /translation="MPKLIYLIGPSGAGKDSLLRAIRQLALPRLLVAHRYITRPAEIQG
FT                   ENHIALTPEEFAIRQRLGLFALNWQAHQCDYGVGIEIDGWLQRGSYVIVNGSRAYLSQA
FT                   RERYGNTLFPICLTVSTSTLRERLCARGRESEQQIATRLQRAEEEQSRLQSDCVLLNND
FT                   GDLQRTLSTFQSLLPFDSVSAARSER"
FT   gene            571603..572400
FT                   /locus_tag="PC1_0487"
FT   CDS_pept        571603..572400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0487"
FT                   /product="phosphonate metabolism protein PhnP"
FT                   /note="TIGRFAM: phosphonate metabolism protein PhnP; PFAM:
FT                   beta-lactamase domain protein; KEGG: eca:ECA0498
FT                   carbon-phosphorus lyase complex accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11543"
FT                   /db_xref="GOA:C6DKA6"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017693"
FT                   /db_xref="InterPro:IPR035682"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKA6"
FT                   /inference="protein motif:TFAM:TIGR03307"
FT                   /protein_id="ACT11543.1"
FT                   /translation="MAANRAANSDQIVFHFLGTGSAQQVPAFGCECEVCQQAQQDERKR
FT                   RRACCAAITTQDRVILIDAGLPELAPYLLPYSRRHILLTHYHMDHVQGLFPLRWGYGDP
FT                   IPVFGPPDDAGCDDLFKHPGILHFQPPLTPFQSFELDGISITPVPLIHSKLTYGYLIQT
FT                   PTHTLAYLTDTIGLPPETAQFLSAHTLDYAVVDCSHPPQTTPPRNHNDVPRALEIFTQL
FT                   NPKQLYLTHIGHELDRWLQTQTLLPENVQAAYDGLELELGLGL"
FT   gene            572709..575033
FT                   /locus_tag="PC1_0488"
FT   CDS_pept        572709..575033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0488"
FT                   /product="outer membrane autotransporter barrel domain
FT                   protein"
FT                   /note="TIGRFAM: outer membrane autotransporter barrel
FT                   domain protein; PFAM: Autotransporter beta- domain protein;
FT                   KEGG: mms:mma_0520 autotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11544"
FT                   /db_xref="GOA:C6DKA7"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKA7"
FT                   /inference="protein motif:TFAM:TIGR01414"
FT                   /protein_id="ACT11544.1"
FT                   /translation="MTFSSFKAKPLALAVGAVVGLMASYPALSASNDIVVSTSTTGLTL
FT                   TTGSHTSLDSVEVTSTGALSGSFYGINNSTTIGSIINAGTISGSEGLFSTGTIGSIINS
FT                   GLIESSWDAALWAEGAASTINAIDNRGTINGAVAVVVQGGAHLGTLTNSGTISGSYGIA
FT                   NFGSGGTIDSIINTGLISSNSAIYNASATLGSIANSGVIAGDIYSASGLIFNGGEGVTF
FT                   GTLTGYDQATQGSININNGDLVFASGNLLLNDNVTVSSGVMSNQAAALQINNTVTLNGN
FT                   YVQGSDATLLIGVADDAVATGDITTDSGYGRLVVSGTANIASGSTVSLVSLNNYAFANG
FT                   QRYVVAQAAAEGTEYNASSLNYLASGYNGVITGSAQADSVNSGLSDLVVTLGTSGPSRN
FT                   ATTGNAISSFNGLFNYGGTDTSLLNVFNASATLGSSEEANRAGARLSPAAVASASAQAS
FT                   SAPTNAILNVVSQRADAIRVSGGNSGVATGEGDSDVVMWGQGFGGKANQGQRSDVSGYD
FT                   ARFGGLLIGADRAVSDSWRLGGLGSYAATNVDSTGDNDGSTVRIKSYGLFGYANYEGRP
FT                   WFLNLSTGVVRHQYDTQRLIDFSGFSGNATGSFNGMQYVVSGQTGYPFKLGATETTLTP
FT                   IAGLTYSILKQQGYTESGGNGAGLTVGDATSTSLKSDVALKLDRRIALSGGEVQPFIQL
FT                   GWRHEFHDDAMQSAANFAADSTGATDFVTTGSRPVADSGVLSVGTTIVSQRNLSLTLKY
FT                   TGEAARSYESHSGNLQVRWQF"
FT   sig_peptide     572709..572798
FT                   /locus_tag="PC1_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.868 at
FT                   residue 30"
FT   gene            575169..575996
FT                   /locus_tag="PC1_0489"
FT   CDS_pept        575169..575996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0489"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rso:RSc3165 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11545"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKA8"
FT                   /inference="similar to AA sequence:KEGG:RSc3165"
FT                   /protein_id="ACT11545.1"
FT                   /translation="MKITRLLVLFSTLAIGCTSDPQRHADEIAQVAGLQRETLPVSPFV
FT                   LTTYTRITRTDRPLNIYIEGDGRAWRTRNLPADDPTPRRALGLSLAAADRAANVVYIAR
FT                   PCQFTPSSVNPACQPDYWTGKRFAPEVITAMDRAITHYAAKVPTQSIVLTGYSGGGAVA
FT                   VLVAAQRHDIALLRTVAGNLDHDAVNRFHGVSLMLGSLNPRDVAKQVAAIPQWHFSGED
FT                   DRIVPPFVAEHFARAVGECAQVRRIPGVGHEGDWVSLWPSLINLRAPCRHSNP"
FT   sig_peptide     575169..575246
FT                   /locus_tag="PC1_0489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.851 at
FT                   residue 26"
FT   gene            complement(576167..576376)
FT                   /pseudo
FT                   /locus_tag="PC1_0490"
FT   gene            complement(576506..576769)
FT                   /locus_tag="PC1_0491"
FT   CDS_pept        complement(576506..576769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0491"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ppf:Pput_4032 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11546"
FT                   /db_xref="GOA:C6DKA9"
FT                   /db_xref="InterPro:IPR021529"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKA9"
FT                   /inference="similar to AA sequence:KEGG:Pput_4032"
FT                   /protein_id="ACT11546.1"
FT                   /translation="MTNAVAKNTPRFRLPKHTLPYVFALYMATIMAFLMCLVIILAEFG
FT                   MGPHYMENVMNAYQVAMPAAFVCILIVRPIVTRLVGLTVHGH"
FT   gene            576898..577800
FT                   /locus_tag="PC1_0492"
FT   CDS_pept        576898..577800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0492"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: pen:PSEEN1395 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11547"
FT                   /db_xref="GOA:C6DKB0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKB0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACT11547.1"
FT                   /translation="MDVLGLISNFIRVVENGSIAAAARAKGMSPAAVSQSLSRLETHLG
FT                   VRLLSRTTRSMTLTENGKRYFEKVRHIPHDIELASQAAASETKLQGPLCIATTAAFGRY
FT                   VIAPLMPAFKESFPDIDIELISTDRNVNHRLEGVDVSIRIEAQLNDQLIARKIASLPFI
FT                   FCAAQAYLDRAGTPQTPEELSQHACLVFRYPTDGRFLPWTFMVNGQPVNVKLNPKFISD
FT                   DIDIIAKIAANGGGVTRLASFVAQPLIDSGQLTPLFCSDRSSGNHVESLPMNIYACVNE
FT                   RSALNSKVRAFIAFLEAEI"
FT   gene            578523..579746
FT                   /locus_tag="PC1_0493"
FT   CDS_pept        578523..579746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0493"
FT                   /product="abortive infection protein"
FT                   /note="KEGG: mmw:Mmwyl1_3852 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11548"
FT                   /db_xref="GOA:C6DKB1"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKB1"
FT                   /inference="similar to AA sequence:KEGG:Mmwyl1_3852"
FT                   /protein_id="ACT11548.1"
FT                   /translation="MIKWYRFKNFYSFKDEQLVDLTLKANSSTSSLDEPWLDTRITKVL
FT                   AVMGANGSGKSNMLKPLAFLSWFCSESFKSMDNSDYLPIYPHICNKKDPSEIEIYFVDS
FT                   RTVEDEIHNFEFKYLLKFNKKRVLHEELKYKTSRLFSSIFYRKYDELTNSYKVKSAGDD
FT                   FNISELKTVPQNASAISYFRRKGDNIIADAMHHIFYSIENNLNAFGKANFDYGKVLKAT
FT                   EYYSEEPDIFEKAKKYLTRMDFGLDDIIIKSEDIIDKKTGESEKKFLPYGIHTHEGERF
FT                   EIPFIMESTGTQACYYFIYKLISALHYGGVAVIDELDSDLHPYMIRELIDMFANNGINK
FT                   LSSQLIFSCHTAEILKSLNKHNVYLVEKSNSVSEAWRLDDIQGLRSQDNLYSKYITGAL
FT                   GGVPDINI"
FT   gene            579758..580282
FT                   /locus_tag="PC1_0494"
FT   CDS_pept        579758..580282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0494"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mmw:Mmwyl1_3851 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11549"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKB2"
FT                   /inference="similar to AA sequence:KEGG:Mmwyl1_3851"
FT                   /protein_id="ACT11549.1"
FT                   /translation="MTKKKIVRRSVRKTLLLVGEGHAEKAFLSHLKSLFSNGTFKVSTV
FT                   TAGGKGPEHVITHAISCKKCDGYDFVIVLLDTDLPWPKSHIRSALSAGINLIGSEPCLE
FT                   GLLLDILGLRKVNSNKGCKDLLHPLLSGICTERDSYAELFTLETLNKSKNEKIQFIIEA
FT                   LRGKERKSLKI"
FT   gene            complement(580457..580762)
FT                   /locus_tag="PC1_0495"
FT   CDS_pept        complement(580457..580762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0495"
FT                   /product="CcdB protein"
FT                   /note="PFAM: CcdB protein; KEGG: ecs:pO157p29 plasmid
FT                   maintenance protein CcdB"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11550"
FT                   /db_xref="GOA:C6DKB3"
FT                   /db_xref="InterPro:IPR002712"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKB3"
FT                   /inference="protein motif:PFAM:PF01845"
FT                   /protein_id="ACT11550.1"
FT                   /translation="MQFIVYQYKRASHYTMFIDVQSDIVDTPKRRMVIPLIESHHLSEK
FT                   VNKTLFPLIRIDGEDYRLMTTELSSVPVEVIGKVIADLGDCADEIKDALNLMFWGI"
FT   gene            complement(580765..580983)
FT                   /locus_tag="PC1_0496"
FT   CDS_pept        complement(580765..580983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0496"
FT                   /product="Post-segregation antitoxin CcdA"
FT                   /note="PFAM: Post-segregation antitoxin CcdA; KEGG:
FT                   eca:ECA0511 plasmid maintenance protein CcdA"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11551"
FT                   /db_xref="InterPro:IPR009956"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKB4"
FT                   /inference="protein motif:PFAM:PF07362"
FT                   /protein_id="ACT11551.1"
FT                   /translation="MKHRVSVTVDKDNYQVLSAAGVNISGLVNDAIGKEARRIKAEEWK
FT                   KENREGMEEVARFIAQHGSFADENRNW"
FT   gene            complement(581042..581785)
FT                   /locus_tag="PC1_0497"
FT   CDS_pept        complement(581042..581785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0497"
FT                   /product="mobilization protein"
FT                   /note="KEGG: eca:ECA1608 mobilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11552"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKB5"
FT                   /inference="similar to AA sequence:KEGG:ECA1608"
FT                   /protein_id="ACT11552.1"
FT                   /translation="MLISDYRERRAHSHEKMRRLLTFLKEETYSDFKTLMLLFDYKNHK
FT                   PLYLLLAKAIDMGFIQKQTFCTRMEKISLWGITNDGLSVVVTPHEDGFPARFEPSKVTG
FT                   WTLMQRLDRQLARLLLEKKGAYGWISGADSTFRSRYKVYHRPAGVITLLDGTVIAVETE
FT                   RHLKTKARYQAIITQHLITRTQKLWMYVFYIVPDPQIKRAIERMFNSVKYAIVDHQQIP
FT                   LETKHRNVFRVYTVEELKGLDLNLG"
FT   gene            complement(581837..582520)
FT                   /locus_tag="PC1_0498"
FT   CDS_pept        complement(581837..582520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypm:YP_pCRY21 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11553"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKB6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11553.1"
FT                   /translation="MSERFIFATFTALNMPFRHDAGRDGFRRMNACASRAFIRGVRQVN
FT                   SISQKLLICVARTHPRAFPPRETEQAGGSRINFAAPASKKTRPRVGLFGGLKPRTPSWL
FT                   SLRPQAGSEARLPTLKAFSHFFADRNGQKKKWAKNGVSKGVVARSGRRCAAVDVGSFGV
FT                   ASSRDITPMRQAIRASSPHELAHAVLCRERYFPAHDRIAVTSLSPQDRLMTSTHASGRR
FT                   YSPML"
FT   gene            complement(582689..583030)
FT                   /locus_tag="PC1_0499"
FT   CDS_pept        complement(582689..583030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0499"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: yen:YE1926 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11554"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11554.1"
FT                   /translation="MADTDSNTGASYQSLPDYENRYSAMSAALARLDFSHMDTDELSQV
FT                   TEYCAETQAGLCHCLNFIGDALITFADNDVCESTPESLCQLGHGLTAISLLIPALTTMH
FT                   KRAHSLTAR"
FT   gene            583171..583341
FT                   /locus_tag="PC1_0500"
FT   CDS_pept        583171..583341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0500"
FT                   /product="conserved hypothetical protein; putative
FT                   repressor (interpro)"
FT                   /note="KEGG: ecq:ECED1_1795 conserved hypothetical protein;
FT                   possible repressor (interpro)"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11555"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKB8"
FT                   /inference="similar to AA sequence:KEGG:ECED1_1795"
FT                   /protein_id="ACT11555.1"
FT                   /translation="MSSEKAKTDQYQIRLSHEFRAQLEEQAHKDGDKTLATWIKRVLRK
FT                   ELQTRGIEPKG"
FT   gene            complement(583483..584742)
FT                   /locus_tag="PC1_0501"
FT   CDS_pept        complement(583483..584742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0501"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sty:STY4680
FT                   bacteriophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11556"
FT                   /db_xref="GOA:C6DKB9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKB9"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACT11556.1"
FT                   /translation="MLTDSKVRSAKHLAKSYKLTDSQGLYLTVSPSGAKLWYFRYRFGG
FT                   KENRLAFGPYPQITLAEAREKRDAARKLLASGLSPSQLRKSNNPAVEESRTFQYVAMTW
FT                   HTSSLKLWSEAHADKILTCLKRYVFPAIGSMDIAQVETRHLAQLVKAIDDKGVHDVAGR
FT                   VRQHLTKIMRHAVQQGVIKYNPAYDLDGVVTPVVTQHHPALPLKRLPELLEKIENYKGR
FT                   MLTRLALELNLHVFLRSSELRFARWDEFNLKAHIWSVPAQREAVNGVRFSERGAKMKDE
FT                   HLVPLSRQAVALLKQIQAYSGESVFVFPGAHTLNKPMSENTINKALRVIGYDTKTEICG
FT                   HGFRTMACSALNESGRWSKDAIERQMSHKERNGVRAAYVHKAEHLEARIEMMQWWSDYL
FT                   DVNREGYVAPYIYARNYTVG"
FT   gene            complement(584904..584979)
FT                   /locus_tag="PC1_R0017"
FT                   /note="tRNA-Phe2"
FT   tRNA            complement(584904..584979)
FT                   /locus_tag="PC1_R0017"
FT                   /product="tRNA-Phe"
FT   gene            complement(585106..585681)
FT                   /locus_tag="PC1_0502"
FT   CDS_pept        complement(585106..585681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0502"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: eca:ECA0617 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11557"
FT                   /db_xref="GOA:C6DKC0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKC0"
FT                   /inference="similar to AA sequence:KEGG:ECA0617"
FT                   /protein_id="ACT11557.1"
FT                   /translation="MQREDVLEHALTLLEQHGFAMTTLDMLAERLGVPVEELTPFWPDR
FT                   EALLYDGLRHHSQQVDTWRRQLLLDDEKTIEQKLLARYQVLHESVNKQRYPGCLFIAAC
FT                   SFFPDINHPIHQIAEQQKLASYQYTRDLLEELETDDPEMVAQQMELILEGCLSNLLVKH
FT                   QASSIATAQRLAEDVLRFALCRKNGALT"
FT   gene            complement(585725..587476)
FT                   /locus_tag="PC1_0503"
FT   CDS_pept        complement(585725..587476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0503"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; Thioredoxin domain; KEGG: eca:ECA0618
FT                   thiol:disulfide interchange protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11558"
FT                   /db_xref="GOA:C6DKC1"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKC1"
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /protein_id="ACT11558.1"
FT                   /translation="MAQRIFTLIFLLWTAFGTPNVAASSFGQKLFGNSTTSRFLPVDSA
FT                   FAFEFQQQNNQLNLRWDIHPDYYLYRAQIKIEGNGATLGKIELPPGESHNDEFFGQVFI
FT                   LRDRLALAVPIEQAESGATVKVTYQGCADAGFCYPPETRVVPLSQVLASTGTDAAPNTP
FT                   SGKATPSDQTAPPQTTPMPFSPWWALLIGIGVAFTPCVLPMYPLIASLVLGRKEQLTPR
FT                   RTLLLSMTYVQGMALTYTLLGLVVAAAGLRFQAALQHPYILIGLSVMFVALALSMFGLY
FT                   TLQLPSSVQTRLTEWSNRQQGGSVTGVFCMGALAGLICSPCTTAPLSAILLYIAQSGNM
FT                   LAGGGTLYLYALGMGLPLILVTLFGNKLLPRSGPWMQYVKEAFGFIILALPVFLLERIL
FT                   GEVWGMRLWSALGIAFFGWALMLTLRSGKGWMRGVQLLLLAGVVISAKPLQDWVFPPAG
FT                   VAQSHTSALNFAPVANIADLNSALAKSAQPVMLDLYADWCVACKEFEKYTFSDPAVQDH
FT                   LSRITLLQADVTANREEQNALLKKLQVLGLPTIVFFDAQGKEIPGSRVTGFMNAEQFQA
FT                   HLQKFSP"
FT   sig_peptide     complement(587405..587476)
FT                   /locus_tag="PC1_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.762 at
FT                   residue 24"
FT   gene            complement(587452..587784)
FT                   /locus_tag="PC1_0504"
FT   CDS_pept        complement(587452..587784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0504"
FT                   /product="CutA1 divalent ion tolerance protein"
FT                   /note="PFAM: CutA1 divalent ion tolerance protein; KEGG:
FT                   eca:ECA0619 divalent-cation tolerance protein CutA"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11559"
FT                   /db_xref="GOA:C6DKC2"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR023700"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKC2"
FT                   /inference="protein motif:PFAM:PF03091"
FT                   /protein_id="ACT11559.1"
FT                   /translation="MSDRPLCDAVVILCTAPDEVCAQQLAHSLLETRLAACVTLLPGAR
FT                   SLYYWEGKLEQQSEVQMLIKSDTSHQQALLTHLKQQHPYDTPELLVLPVSGGDSDYLTW
FT                   LNASLR"
FT   gene            complement(587916..589217)
FT                   /locus_tag="PC1_0505"
FT   CDS_pept        complement(587916..589217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0505"
FT                   /product="anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family"
FT                   /note="TIGRFAM: anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family; PFAM: anaerobic c4-dicarboxylate membrane
FT                   transporter; KEGG: eca:ECA0620 anaerobic C4-dicarboxylate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11560"
FT                   /db_xref="GOA:C6DKC3"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKC3"
FT                   /inference="protein motif:TFAM:TIGR00770"
FT                   /protein_id="ACT11560.1"
FT                   /translation="MLGLELFIVLLAIYLGARLGGIGIGFAGGLGVLVLTLGFQIKPGV
FT                   IPFDVIEIIMAVIAAIAAMQVAGGMDYLVSLAEKLLRKHPKYVTFLAPLVTYFMTILAG
FT                   TGHTAFSTLPVIAEVAKEQGIRPSRPLSIAVVASQIAITASPISAAVVFVAGILEPHGV
FT                   SYLLLLGICIPTTLAAILLTAIVTNFLGKELKDDPIYQERLKKGETTLRGNSQHEIKPG
FT                   AKLSVVLFLIGIVAVVLYATAISGTVGLIQNPVLPRNEAIVVFMLTIATLICITCKIDT
FT                   ARILSASTFKSGMSACICVMGVAWLGDTFVKAHISDIQDTAGALLQSYPWMLAVVLFFA
FT                   ATLLYSQAATAKALMPAALLLGVSPVTAVASFAAVSALFVLPTYPTLLAAVEMDDTGST
FT                   RIGKFVFNHSFLIPGVIAITLSVIFGFILGSILI"
FT   gene            complement(589339..590778)
FT                   /locus_tag="PC1_0506"
FT   CDS_pept        complement(589339..590778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0506"
FT                   /product="aspartate ammonia-lyase"
FT                   /note="TIGRFAM: aspartate ammonia-lyase; PFAM: fumarate
FT                   lyase; KEGG: eca:ECA0621 aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11561"
FT                   /db_xref="GOA:C6DKC4"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004708"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKC4"
FT                   /inference="protein motif:TFAM:TIGR00839"
FT                   /protein_id="ACT11561.1"
FT                   /translation="MSENIRIEEDLLGTREVPADAYYGVHTLRAIENFYISNNKISDIP
FT                   EFVRGMVMVKKAAALANRELQTIPKKIADVIIRACDEVLNNGKCMDQFPVDVYQGGAGT
FT                   SVNMNTNEVLANIGLELMGHQKGEYQYLNPNDHLNKCQSTNDAYPTGFRISVYASVLKL
FT                   TEAIAKLSDGFERKAKEFEDVLKMGRTQLQDAVPMTLGQEFHAFNVLLQEEIKNLLRTA
FT                   ELLLEVNLGATAIGTRLNTPDGYQQLAVQRLAEVSGLACVPAEDLIEATSDCGAYVMVH
FT                   SSLKRLAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPEVVNQVC
FT                   FKVIGNDTCVTMASEAGQLQLNVMEPVIGQAMFESTHILTNACYNLLEKCVNGITANKS
FT                   VCEAYVFNSIGIVTYLNPFIGHHNGDIVGRICAETGKSVREVVLERGLLTEAELDDIFS
FT                   IQNLMHPAYKAKRYTDENELP"
FT   gene            591303..591776
FT                   /locus_tag="PC1_0507"
FT   CDS_pept        591303..591776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0507"
FT                   /product="FxsA cytoplasmic membrane protein"
FT                   /note="PFAM: FxsA cytoplasmic membrane protein; KEGG:
FT                   eca:ECA0623 suppressor of F plamsid exlusion of phage T7"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11562"
FT                   /db_xref="GOA:C6DKC5"
FT                   /db_xref="InterPro:IPR007313"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKC5"
FT                   /inference="protein motif:PFAM:PF04186"
FT                   /protein_id="ACT11562.1"
FT                   /translation="MRWLPLLLIFLLAYIEISLFIQVAEVLGVAMTLLLVVFTSCVGVS
FT                   LVRNQGMKTLVQMQQKMAAGESPAAEMVKSVSLVLAGFLLLIPGFLTDFLGLLLLLPPV
FT                   QKSLTLKLMPHLHIWRSGSGASSSSGGNTFEGEYQRKDGGSANIEHRDDRDDR"
FT   gene            592008..592301
FT                   /locus_tag="PC1_0508"
FT   CDS_pept        592008..592301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0508"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: eca:ECA0624
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11563"
FT                   /db_xref="GOA:C6DKC6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKC6"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ACT11563.1"
FT                   /translation="MNIRPLHDRVIVKRKEVESKSAGGIVLTGSAAGKSTRGEVLAVGH
FT                   GRILENGEVKPLDVKVGDIVIFNDGYGVKAEKIDNEEVLIMSESDILAIVEA"
FT   gene            592347..593993
FT                   /locus_tag="PC1_0509"
FT   CDS_pept        592347..593993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0509"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: kpe:KPK_5137 chaperonin GroL"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11564"
FT                   /db_xref="GOA:C6DKC7"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKC7"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ACT11564.1"
FT                   /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSFG
FT                   APTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITEGL
FT                   KAVAAGMNPMDLKRGIDKAVIAAVEELKALSVPCSDSKAIAQVGTISANSDETVGKMIA
FT                   EAMDKVGKEGVITVEEGTGLQDELDVVEGMQFDRGYLSPYFINKPETGAVELESPFILL
FT                   ADKKISNIREMLPVLEAVAKAGKPLVIVAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIATLTGGTVISEEIGLELEKATLEDLGQAKRVVINKDTTTIIDGTGEEA
FT                   AIQGRVAQIRQQVEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEKKARVEDA
FT                   LAATRAAVEEGVVAGGGVALVRVAAKLASLTAQNEDQNVGIKVALRAMEAPLRQIVSNA
FT                   GEEPSVVANTVKAGEGNYGYNAATEEYGNMIDFGILDPTKVTRSALQYAASVAGLMITT
FT                   ECMVTDLPKSDAPDLGAAGGMGGMGGMGGMM"
FT   gene            594273..594806
FT                   /locus_tag="PC1_0510"
FT   CDS_pept        594273..594806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0510"
FT                   /product="Chorismate lyase"
FT                   /note="PFAM: Chorismate lyase; KEGG: eca:ECA0626 chorismate
FT                   pyruvate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11565"
FT                   /db_xref="GOA:C6DKC8"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKC8"
FT                   /inference="protein motif:PRIAM:4.1.3.40"
FT                   /protein_id="ACT11565.1"
FT                   /translation="MSDDVSTLLRTISWFAEPPSVLPEHIGDWLMETSSMTQRLEKYCA
FT                   QLTVTLCREGFVSPQSLGEESEQLPPDERYWLREVVLYGDERPWLFGRTIVPQQTLDGT
FT                   DSALTKIGNQPLGRYLFEQKSLTRDYIHTGCCEGLWARRSRLCLSGFPLLLTELFLPES
FT                   PVYYTPSDEGWQVI"
FT   gene            594819..595682
FT                   /locus_tag="PC1_0511"
FT   CDS_pept        594819..595682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0511"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: eca:ECA0627
FT                   4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11566"
FT                   /db_xref="GOA:C6DKC9"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKC9"
FT                   /inference="protein motif:TFAM:TIGR01474"
FT                   /protein_id="ACT11566.1"
FT                   /translation="MERSVTAGKWLAYCRLMRIDKPIGSLLLLWPTLWALWLAGGGAPA
FT                   PWTLFVFVAGVFLMRAAGCVINDYADRHFDGHVKRTASRPLPSGEVSEQSAKVLFVVLV
FT                   LLAFGLVLTLNTMTIWLSVAGLGLAWVYPFMKRVSHLPQFVLGAAFGWSIPMAYAAVSE
FT                   SLPATCWMMFLAYICWTVAYDTQYAMVDRDDDLKIGVKSTAILFGRFDNLIIGLLQFSM
FT                   LALLLILGTMTGLGMPYYISLLVAGGMFIYQQILTAGRERDACFKAFHNNKYAGMAIFI
FT                   GVLFGL"
FT   gene            complement(595815..598283)
FT                   /locus_tag="PC1_0512"
FT   CDS_pept        complement(595815..598283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0512"
FT                   /product="Glycerol-3-phosphate O-acyltransferase"
FT                   /EC_number="2.3.1.15"
FT                   /note="KEGG: eca:ECA0628 glycerol-3-phosphate
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11567"
FT                   /db_xref="GOA:C6DKD0"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKD0"
FT                   /inference="protein motif:PRIAM:2.3.1.15"
FT                   /protein_id="ACT11567.1"
FT                   /translation="MSGWRKIYYKLLNLPLKLLVKSKVIPADPVVELGLDPSRPILYVL
FT                   PYNSQADLLTLRAKCLALGLPDPSQSFEFNGVELPSHVFINDGPRVFRYYVPKQKSVKL
FT                   FHDYLDLHRANPDLDVQMVPVSVMFGRSPGREGHSQATPHLRLLNGIEKFFAVLWLGRD
FT                   SFVRFSSPVSLRYMATEHGTDKTIAHKLARVARMHFSRQRLAAVGPRLPVRQELFNKLL
FT                   DSKAIKKAVDDEARSKKISHEKAQQNAIALMEEIAADFSYEAVRLSDRVLSWTWNRLYQ
FT                   GINVHNAERVRQLAQDGHGIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGINLNFWP
FT                   AGPIFRRLGAFFIRRTFKGNKLYSTIFREYLGELFARGYSVEYFMEGGRSRTGRLLEPK
FT                   TGTLAMTIQAMLRGGTRPITLVPIYVGYEHVMEVGTYAKELRGAVKEKEGFMQMVRGLR
FT                   KLRNLGQGYVNFGEPLPLTTYLNQHVPQWRDAIDPIEAQRPSWLTPTVQDISMDIMVRI
FT                   NNSAAANAMNLCSTALLASRQRSLTREQMQEQLDCYLQLLRQVPYHKDITVPKKTADEL
FT                   LEHALSMNKFEVEKDSIGDIIILPREQAVLMTYYRNNIQHLLVLPSLIASIVIHHRRIT
FT                   LAEVVRQIALIYPLLQSELFLHYSKEQLPGVLETLANELVQQQLLCSRDGELAINPPRI
FT                   RTLQLLSAGVRETLQRYAITLSLLCANPEINRGTLEKESRNMAQRLSVLHGINAPEFFD
FT                   KAVFSTLVATLRTEGYITDSAEAAQGDIVAIYNILGDLITPEVRLTIESASSSAEMEAE
FT                   SQAVEETTQE"
FT   gene            598536..598901
FT                   /locus_tag="PC1_0513"
FT   CDS_pept        598536..598901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0513"
FT                   /product="diacylglycerol kinase"
FT                   /note="PFAM: diacylglycerol kinase; KEGG: eca:ECA0629
FT                   diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11568"
FT                   /db_xref="GOA:C6DKD1"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKD1"
FT                   /inference="protein motif:PFAM:PF01219"
FT                   /protein_id="ACT11568.1"
FT                   /translation="MNKATGMTRIIKATGYSLKGLKQAWQHEAAFRQETILTIVGVIIA
FT                   CLLPVTLVEKLLLIGSVVLIMLFELANSAIEAVVDRIGLEHHELSGRAKDIGSAAVFVA
FT                   IVLAAVVWGSILWQHFA"
FT   gene            599012..599620
FT                   /locus_tag="PC1_0514"
FT   CDS_pept        599012..599620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0514"
FT                   /product="SOS-response transcriptional repressor, LexA"
FT                   /EC_number="3.4.21.88"
FT                   /note="KEGG: eca:ECA0630 LexA repressor; TIGRFAM: LexA
FT                   repressor; PFAM: LexA DNA-binding domain protein; peptidase
FT                   S24 and S26 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11569"
FT                   /db_xref="GOA:C6DKD2"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKD2"
FT                   /inference="protein motif:TFAM:TIGR00498"
FT                   /protein_id="ACT11569.1"
FT                   /translation="MKVLTARQQQVYDLIRDHIAQTGMPPTRAEIAQQLGFRSPNAAEE
FT                   HLKALARKGVIEIVSGASRGIRLLMEEETGIPLVGRVAAGEPLLAQEHIECHYQVDPAM
FT                   FKPSADFLLRVSGMSMKDIGIMDGDLLAVHKTEDVRNGQIVVARIDDEVTVKRLKKQGN
FT                   MVHLLAENEEFAPIVVDLRQQSFSIEGLAVGVIRNSDWS"
FT   gene            600117..600326
FT                   /locus_tag="PC1_0515"
FT   CDS_pept        600117..600326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0515"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: eca:ECA0631
FT                   putative stress-response protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11570"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR026042"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKD3"
FT                   /inference="protein motif:PFAM:PF05532"
FT                   /protein_id="ACT11570.1"
FT                   /translation="MNKDQASGNWKQFKGKAKEQWGKLTDDDLTVIEGKRDQLVGRIQE
FT                   RYGYAKEAAEKEVKHWEEHHKYHW"
FT   gene            complement(600423..600938)
FT                   /locus_tag="PC1_0516"
FT   CDS_pept        complement(600423..600938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0516"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: eca:ECA0632
FT                   zinc uptake transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11571"
FT                   /db_xref="GOA:C6DKD4"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKD4"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACT11571.1"
FT                   /translation="MTMDSTKQDKLLAQAEQICQQRAVRLTPQRLEVLRLMAQQSGAIS
FT                   AYDLLDLLRVSEPQAKPPTVYRALDFLLEQGFIHRVESNNSYVLCHHIEDHSHTSALFI
FT                   CDRCGQVTERQTEGVEETLRSLAQQSGFTLRHSVVEAHGLCGVCQEVASCKQPDHCDHD
FT                   HTVPIKKR"
FT   gene            complement(601039..601737)
FT                   /locus_tag="PC1_0517"
FT   CDS_pept        complement(601039..601737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0517"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: eca:ECA0633
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11572"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR041602"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKD5"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ACT11572.1"
FT                   /translation="MITRRAAGQCGQADYGWLQARYTFSFGHYFDPQLLGYASLRVLNQ
FT                   EVLAPGASFQPRTYPRVDILNIILQGEAEYRDSNGCHIQAKAGDVLLLATQPNVSYSEH
FT                   NTSASKPLTRLQLWLNACQTRENSPLQRMELDSSSHTLLASPEGEHTSLQLRQQVWIHH
FT                   VDLQQNEQSTIALQGNQAYLQLIHGSMVVKGNQNSEALHCGDGAFIKEETTLTLRAESP
FT                   LRALLIDLVV"
FT   gene            601850..602746
FT                   /locus_tag="PC1_0518"
FT   CDS_pept        601850..602746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0518"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: eca:ECA0634 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11573"
FT                   /db_xref="GOA:C6DKD6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKD6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACT11573.1"
FT                   /translation="MAKERALTLEALRVMDAIDRRGSFAAAADELGRVPSALSYTMQKL
FT                   EEELDVVLFDRSGHRTKFTNVGRMLLERGRILLEAADKLTTDAEALARGWETHLTIVTE
FT                   ALIPTQRLFPLIDKLALKANTQVSILTEVLAGAWERLEQGRADIVIAPDMHFRASSEMN
FT                   TRKLYTMNNVYVASPEHPIHQEPEPLSDATRVKYRGIAVADTARERPVLTVQLLDKQQR
FT                   LTVSSLDDKRRALLAGLGVATMPYPMVAQDIAEGRLLVVGPEHQMESQIIMAWRRDSMG
FT                   EAKSWFLREIPKLLNQP"
FT   gene            complement(602817..603812)
FT                   /locus_tag="PC1_0519"
FT   CDS_pept        complement(602817..603812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0519"
FT                   /product="Glutathione transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="KEGG: eca:ECA0635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11574"
FT                   /db_xref="GOA:C6DKD7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKD7"
FT                   /inference="protein motif:PRIAM:2.5.1.18"
FT                   /protein_id="ACT11574.1"
FT                   /translation="MGQLVDGVWHDTWYETKSTGGHFKRSESVFRNWVTPDGTPGLTGK
FT                   GGFPAQSGRYHLYVSLACPWAHRTLLMRQLKGLEDHIAVSVVHPLMLDHGWTFGTDFEG
FT                   ATGDSLYQHEFLYQLYLHAKPDYSGRVTVPVLWDTEQHTIVSNESADIIRMLNSAFDGV
FT                   GATAGDYYPEALRAQIDELNGWIYDKVNNGVYKAGFATSQSAYDESAMTVFAALSDLEA
FT                   ILAKQRYLTGEQLTEADLRLWTTLIRFDPVYHTHFKCDKYRLSDYPNLFGFLRDIYQMP
FT                   GIADTVDMAHIRHHYYRSHGTINPHGVISLGPEQDLNQPHQRDKTVISLY"
FT   gene            complement(603921..604316)
FT                   /locus_tag="PC1_0520"
FT   CDS_pept        complement(603921..604316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0520"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: eca:ECA0636
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11575"
FT                   /db_xref="GOA:C6DKD8"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKD8"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACT11575.1"
FT                   /translation="MKNLESTALLIARILMPILFIVAGYGKLGDAYAGTQQYMQAMGVP
FT                   TFLLPLTILLELGGGLAVLFGLLTRTVALFTAGFTLLTALIFHSNFAEGMNQLMFMKNL
FT                   TIAGGYLLLAVTGPGAFSIDRLLGKKW"
FT   gene            complement(604590..604880)
FT                   /locus_tag="PC1_0521"
FT   CDS_pept        complement(604590..604880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11576"
FT                   /db_xref="InterPro:IPR025612"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKD9"
FT                   /inference="similar to AA sequence:KEGG:ECA0637"
FT                   /protein_id="ACT11576.1"
FT                   /translation="MSQRQQRDREKAQLLRRIQQQRLDLSAGKKHWLNTTARYDRGWQS
FT                   LMQWRKYWIVGSSLVALYGVRHPSRMIRWGRRLVGLWGTFRLVRKTFDSRS"
FT   gene            complement(604877..605272)
FT                   /locus_tag="PC1_0522"
FT   CDS_pept        complement(604877..605272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11577"
FT                   /db_xref="GOA:C6DKE0"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKE0"
FT                   /inference="similar to AA sequence:KEGG:ECA0638"
FT                   /protein_id="ACT11577.1"
FT                   /translation="MTDKSQQGPASGVMASAQRIISIIVSMVESRVRLAVIELEEEKTN
FT                   LIQLLMMVGLTLIFATFGIMSLIALIIWGIDPQYRLFALGCITATLLGLALIGGVWTLL
FT                   KVRRSTLLKATRKELATDRSLLEEDPK"
FT   gene            complement(605286..605591)
FT                   /locus_tag="PC1_0523"
FT   CDS_pept        complement(605286..605591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0523"
FT                   /product="protein of unknown function DUF883 ElaB"
FT                   /note="PFAM: protein of unknown function DUF883 ElaB; KEGG:
FT                   eca:ECA0639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11578"
FT                   /db_xref="GOA:C6DKE1"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKE1"
FT                   /inference="protein motif:PFAM:PF05957"
FT                   /protein_id="ACT11578.1"
FT                   /translation="MAKDQNSEYLRAELKSLADTLEEVLSTSSDKSKAELDKLRNKAES
FT                   ALKETRNRLSDTGERIASHTKEAVESADDYVRQNPWTGVGIGAAVGVVLGVLLSRR"
FT   gene            complement(605768..606157)
FT                   /locus_tag="PC1_0524"
FT   CDS_pept        complement(605768..606157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0524"
FT                   /product="protein of unknown function DUF1090"
FT                   /note="PFAM: protein of unknown function DUF1090; KEGG:
FT                   eca:ECA0640 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11579"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKE2"
FT                   /inference="protein motif:PFAM:PF06476"
FT                   /protein_id="ACT11579.1"
FT                   /translation="MKLSSSVLALSVLLSGHVLANTANQVETCQQKAQDIQRQIDEARK
FT                   HGNQNRINGLEKALDGVKTHCTDAGLAEKRQEAIAEKRKDVAERQQELNESRQKGDDAE
FT                   KILKRERKLAEAEQELRAAERAASQ"
FT   sig_peptide     complement(606095..606157)
FT                   /locus_tag="PC1_0524"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.972 at
FT                   residue 21"
FT   gene            complement(606163..606558)
FT                   /locus_tag="PC1_0525"
FT   CDS_pept        complement(606163..606558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0641 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11580"
FT                   /db_xref="GOA:C6DKE3"
FT                   /db_xref="InterPro:IPR026574"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKE3"
FT                   /inference="similar to AA sequence:KEGG:ECA0641"
FT                   /protein_id="ACT11580.1"
FT                   /translation="MSIRWLFPKLTPRKVARILILLALPIIALTQSQSLRHSQDDAMLH
FT                   IKPYDGAALPDGFYVYQRLNEKGIAIKSITPEQDSLIVRLASPEQSIAARDVLRLSLPK
FT                   VTITAQQATTPTPFWQQKLTQKQSKLG"
FT   sig_peptide     complement(606466..606558)
FT                   /locus_tag="PC1_0525"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.519 at
FT                   residue 31"
FT   gene            complement(606561..607244)
FT                   /locus_tag="PC1_0526"
FT   CDS_pept        complement(606561..607244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0526"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   eca:ECA0642 DedA family membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11581"
FT                   /db_xref="GOA:C6DKE4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKE4"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ACT11581.1"
FT                   /translation="MELIKELLNALWHQDFDILADPKLVWTIYILLFLIIFLENGLLPA
FT                   AFLPGDSLLILVGVLVAKGTMNYPFTLFLLTTAASLGCWASYIQGRWLGNTSVVQGWLS
FT                   HLPAHYHQRAHQLFHRHGLSALLVGRFLAFVRTLLPTIAGLSGLNNARFQFFNWMSGFL
FT                   WVFILVTLGFALGKTTVFLKYEDELMLCLMLLPLALLFIGLFGSLFVLWRKKRDTKASN
FT                   AEKGS"
FT   gene            complement(607698..608474)
FT                   /locus_tag="PC1_0527"
FT   CDS_pept        complement(607698..608474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0527"
FT                   /product="regulatory protein GntR HTH"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; SMART: regulatory protein GntR HTH; KEGG:
FT                   eca:ECA0643 DNA-binding transcriptional repressor ExuR"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11582"
FT                   /db_xref="GOA:C6DKE5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKE5"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACT11582.1"
FT                   /translation="MALTEPRRLYQQLAAELKQRIESGMYQVGEKLPAERYISEEMNVS
FT                   RTVVREAIIMLEVEGYVEVRKGSGIHVISNQQKNPFINSGDIEFVAAGPFELLQARQLI
FT                   ESNIAEFAATQVTRQDIIQLMEIQEYARQEDRFRDSQWDLKFHVQVALATQNSAMATIV
FT                   EKMWSQRIHNPYWRKLHEHIDDKSIESWCEEHDRILKALIRKDPYAAKLAMWQHLENTK
FT                   QMLFRATTDDFEFNVDRYMFAENPVVHLDQIHAGKS"
FT   gene            complement(608682..609983)
FT                   /locus_tag="PC1_0528"
FT   CDS_pept        complement(608682..609983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0528"
FT                   /product="d-galactonate transporter"
FT                   /note="TIGRFAM: d-galactonate transporter; PFAM: major
FT                   facilitator superfamily MFS_1; KEGG: eca:ECA0644
FT                   galacturonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11583"
FT                   /db_xref="GOA:C6DKE6"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKE6"
FT                   /inference="protein motif:TFAM:TIGR00893"
FT                   /protein_id="ACT11583.1"
FT                   /translation="MRKIKGLRWYMIGLVTIGTVLGYLTRNAISVAAPTLQDQLHITTQ
FT                   QYSYIVAAYSACYTIMQPIAGYVLDLLGTKIGYAMFAILWAVFCMGTALAHSWGGLAIA
FT                   RGAVGMAEAAMIPAGLKASSEWFPAKERSVAVGYFNVGSSIGAMVAPPLVVWAIVAHSW
FT                   EMAFIITGVLSLIWAICWLVFYKHPKDQKKLSDEERDYILSGQEAQHQTNNAKKMSAWQ
FT                   ILRNRQFWGIALPRFLAEPAWGTFNAWIPLFMFKAYGFNLKEIAMFAWMPMLFADIGCI
FT                   LGGYLPMLFQKYFKVNLIVSRKMVVTMGAVLMIGPGMIGLFTSPYVAIALLCVGGFAHQ
FT                   SLSGALITLSSDVFGRNEVATANGLTGMAAWMASTMFALVVGALADTMGFSPLFAALAV
FT                   FDLLGAVVIWTVLKNQPASEVAAAAETLKEANQH"
FT   sig_peptide     complement(609885..609983)
FT                   /locus_tag="PC1_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.606) with cleavage site probability 0.295 at
FT                   residue 33"
FT   gene            610400..611809
FT                   /locus_tag="PC1_0529"
FT   CDS_pept        610400..611809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0529"
FT                   /product="Glucuronate isomerase"
FT                   /EC_number="5.3.1.12"
FT                   /note="PFAM: Glucuronate isomerase; KEGG: eca:ECA0645
FT                   glucuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11584"
FT                   /db_xref="GOA:C6DKE7"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKE7"
FT                   /inference="protein motif:PRIAM:5.3.1.12"
FT                   /protein_id="ACT11584.1"
FT                   /translation="MPQFLSEDFLLDSEFARRLYHEYAVDQPIFDYHCHLPPEQIAENY
FT                   RFKNLYDIWLKGDHYKWRAMRTNGVPERLCTGDASDWEKFEAWAATVPHTIGNPLYHWT
FT                   HLELRRPFGVTGTLLSPSTAKDIWDRCNAMLERDDFTARGIMQQMNVKMVGTTDDPIDD
FT                   LRHHKTVAQDSSFSIKVLPSWRPDKAFNIELATFNDYMAKLGEVSDTDIRRFSDLQAAL
FT                   TKRLDHFAAHGCKVSDHALDVVMFAEADDATLDSILARRLSGETLSEHEVAQFKTGVLV
FT                   WLGAEYARRGWVQQYHIGALRNNNLRQFKLLGPDVGFDSINDRPLAQELSRLLSKQNEE
FT                   NLLPKTILYCLNPRDNEVLGTMIGNFQGEGMPGKMQFGSGWWFNDQKDGMQRQMTQLAQ
FT                   LGLLSRFVGMLTDSRSFLSYTRHEYFRRILCQMIGRWVEDGEAPADLPLLGEMVKNISF
FT                   DNAKNYFAIEL"
FT   gene            612016..613482
FT                   /locus_tag="PC1_0530"
FT   CDS_pept        612016..613482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0530"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: eca:ECA0646 altronate
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11585"
FT                   /db_xref="GOA:C6DKE8"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023668"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKE8"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ACT11585.1"
FT                   /translation="MQTLNRRNFPGRQHPDRVIQFGEGNFLRAFVDWQLDLLNEHTDLD
FT                   AGIVIVRPIDSDFPPALDTQDGLYTTIIRGLNEQGEAVREPRLIRSVNREINVYRQFDE
FT                   YLALAHDPNIRFVFSNTTEAGISYHADDSLSDAPPVSFPAKLTRLLYERFCHFDGAADK
FT                   GWVLLPCELIDYNGVALKELVLRYAAQWKLTPTFTAWLNDHNTFCSTLVDRIVTGYPRA
FT                   EVEALQQEMGYQDTFWDTAEHFYLFVIQGPQWLAEELRLNKLDLNVRIVDDIKPYKERK
FT                   VAILNGAHTALVPVAFLAGLDTVGESMDDALIGKFVEKTIAEEIVPVLDLPHDELTSFA
FT                   QAVLSRFRNPFIQHQLLSISLNGMTKFRTRILPQLLTYRERHGELPARLTFALAALIAF
FT                   YRGERSGEGDTLQTYPLQDDAHWLERYSTLWAGVKENTVSLAELVNVVLRDADHWEQDL
FT                   TQVPGLAAQVTEQLQTIVERGMRAAVEGYC"
FT   gene            613502..614992
FT                   /locus_tag="PC1_0531"
FT   CDS_pept        613502..614992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0531"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein; SAF domain protein; KEGG: eca:ECA0647
FT                   altronate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11586"
FT                   /db_xref="GOA:C6DKE9"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKE9"
FT                   /inference="protein motif:PRIAM:4.2.1.7"
FT                   /protein_id="ACT11586.1"
FT                   /translation="MQSIIKIHSLDNVAVALRDVEQGETVSVDSHTVTLQQPVVRGHKF
FT                   ALETIAPGEMITKYGLPIGHALVSIAPGEHIHSQNAKTNLSDLDEYQYQPEFIDLPPQM
FT                   GDRDVQLYRRKNGDVGIRNELWILPTVGCVNGIARQIQQRFLKETNDAEGIDGVYLFSH
FT                   TFGCSQLGQDHENTRTMLQNMVRHPNAGAVLVIGLGCENNQVDAFRTTLGGFDSDRVTF
FT                   MVCQQQDDEVEAGLERLHTLYEAMRHDKREPGKLSELKFGLECGGSDGLSGITANPLLG
FT                   RFSDYLIANGGTTVLTEVPEMFGAERILMSRCRDEATFEKTVHMVNDFKQYFIAHDQPI
FT                   YENPSPGNKAGGITTLEEKSLGCTQKAGQSKVVDVLKYGERLHTPGLNLLSAPGNDAVA
FT                   TSALAGAGCHMVLFSTGRGTPYGGFVPTVKLATNSELAKKKPHWIDFDAGRLIHDMPMD
FT                   ELLSQFVELIVEIADGKRTKNEVNDFRELAIFKSGVTL"
FT   gene            615081..615611
FT                   /locus_tag="PC1_0532"
FT   CDS_pept        615081..615611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0648 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11587"
FT                   /db_xref="GOA:C6DKF0"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="InterPro:IPR026267"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKF0"
FT                   /inference="similar to AA sequence:KEGG:ECA0648"
FT                   /protein_id="ACT11587.1"
FT                   /translation="MTQYWIAQSVGVLAFLVGITMFFNRNDQKFKIQLSAYSAVIGLHF
FT                   FLMGANAAGASALLNSARTLISLKTHNILVMFVFISLTLLFGLSGMHHAMELLPIAGTV
FT                   ASTWALFRTSGLTTRCVMWCSTACWVVHNIWLGSIGGSLIEGSFLVMNGFNIIRFWRMQ
FT                   QRGIDPFSVEKKA"
FT   gene            complement(615696..616943)
FT                   /locus_tag="PC1_0533"
FT   CDS_pept        complement(615696..616943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0533"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   eca:ECA0651 serine/threonine transporter SstT"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11588"
FT                   /db_xref="GOA:C6DKF1"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKF1"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACT11588.1"
FT                   /translation="METQHSRFLQYITHGSLVKQILLGLAAGIILASLSTQAALAAGLL
FT                   GTLFVGALKAVAPILVLMLVMASVANHQQGQKTNIRPILFLYLIGTFSAALIAVVLSVL
FT                   FPSTLALNAQAADITPPSGIVEVLKGLLMSVVANPIHALLNANYIGILVWAVGLGLAFR
FT                   HGSASTKNLISDASHAVTAIVRVVIRFAPLGIFGLVASTLAETGFGALWGYAHLLMVLI
FT                   GGMLLVALVINPLIVYWKIRSNPYPLVLRCLRESGVTAFFTRSSAANIPVNMELCRKLN
FT                   LNEDSYSVAIPLGATINMAGAAITITVLALAAVHTLGIEVDIATALLLSVVASICACGA
FT                   SGVAGGSLLLIPLACSMFGISNDIAMQVVAVGFIIGVLQDSAETALNSSTDVIFTAAVC
FT                   QAEDAKLAEKERLNLL"
FT   sig_peptide     complement(616818..616943)
FT                   /locus_tag="PC1_0533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.770 at
FT                   residue 42"
FT   gene            complement(617230..618183)
FT                   /locus_tag="PC1_0534"
FT   CDS_pept        complement(617230..618183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0534"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   eca:ECA0652 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11589"
FT                   /db_xref="GOA:C6DKF2"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKF2"
FT                   /inference="protein motif:PFAM:PF03741"
FT                   /protein_id="ACT11589.1"
FT                   /translation="MHSIGTPWLWGSFAAIVIVMLAIDLLYQGRKGSTVMTFKQAAVWS
FT                   IIWVTLSLLFNAGFWWYLDGTMGREVANAQSLAFLTGYLIEKALAVDNVFVWLMLFGYF
FT                   AVPPQYQRRVLIYGVLGAIVLRTLMVFGGSWLVTQFQWLLYVFGAFLLFTGLKMALAKE
FT                   DDGAIGDKPLVRWLRSRLRMTDTIENEKFFVRRNGILYATPLFLVLIMVEISDVIFAVD
FT                   SIPAIFAVTTDPFIVLTSNLFAILGLRAMYFLLAGVAERFSLLKYGLAVILIFIGTKMM
FT                   LIDIFHIPVAISLGVVASILIITMLINVWVNKRAER"
FT   gene            complement(618456..619454)
FT                   /locus_tag="PC1_0535"
FT   CDS_pept        complement(618456..619454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0535"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Semialdehyde
FT                   dehydrogenase NAD - binding; KEGG: eca:ECA0653 putative
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11590"
FT                   /db_xref="GOA:C6DKF3"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKF3"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACT11590.1"
FT                   /translation="MIRFAIVGTSWITRQFVDAAHETGKLKLTAIYSRTAEKAQPFQAD
FT                   YMVDTRFDSLDAMAKSDLIDAVYLASPNSLHCEQALLFLSHGKHVICEKPLASNRYEVE
FT                   QMIACARENQVVLFEAFKTASLPNFSVIQQALPKVGRLRKVVLNYCQYSSRYPRYLAGE
FT                   NPNTFNPAFSNGSIMDIGYYCLAFAVALWGEPCTTQASATLLESGVDAHGSVILNYGDF
FT                   DVTINHSKVSHSTIPSEIQGEDGSLVIEKVSECHNVKFIPREGKQLDLSQPQHINSMLY
FT                   EAEVFAALVSDGAINHAELARSRTVAGLLTEIRRQTGVVFPADAATPGNAE"
FT   gene            619616..620755
FT                   /locus_tag="PC1_0536"
FT   CDS_pept        619616..620755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0536"
FT                   /product="rRNA (guanine-N(2)-)-methyltransferase"
FT                   /EC_number="2.1.1.171"
FT                   /note="PFAM: methyltransferase small; ribosomal L11
FT                   methyltransferase; KEGG: eca:ECA0654 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11591"
FT                   /db_xref="GOA:C6DKF4"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKF4"
FT                   /inference="protein motif:PRIAM:2.1.1.52"
FT                   /protein_id="ACT11591.1"
FT                   /translation="MSQLELETCNLTLVRYPQVAENSALQAWDAADEYLLRELSTMEIA
FT                   PGPRLIFNDTFGALACGLQAQSPVSISDSYLSQLATRHNLELNGYDANAVTLLDSMADL
FT                   PEAPALVVIKIPKTIALLEHQLRMLRKVVTPQTRIIAGAKARDIHTSTLQLFERVMGPT
FT                   KTSLAWKKARLVHCEWAELKVSEQSLTTEWELDGYGYRIQNHANVYSRNGLDIGARFFM
FT                   QHLPEQIDGKIIDLGCGNGVIGLAALKANPEATVGFFDESYMAVASSQVNVEVNCPQDV
FT                   ERCSFVVNHGLARVKRDTLQAVLCNPPFHQQQAVTDEIAWQMFMDARRCLQVGGELRIV
FT                   GNRHLDYFHKLKRLFGNCETVASNTKFVILRAVKTGSSR"
FT   gene            complement(620772..622826)
FT                   /locus_tag="PC1_0537"
FT   CDS_pept        complement(620772..622826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0537"
FT                   /product="2,4-dienoyl-CoA reductase (NADPH)"
FT                   /EC_number="1.3.1.34"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: eca:ECA0655 putative 2,4-dienoyl-CoA
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11592"
FT                   /db_xref="GOA:C6DKF5"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKF5"
FT                   /inference="protein motif:PRIAM:1.3.1.34"
FT                   /protein_id="ACT11592.1"
FT                   /translation="MTAYPTLLSPLDLGFTTLKNRVVMGSMHTGLEEHPNGTERLAAFY
FT                   RERAQGGVGLIVTGGIAPNAKGAVAKGGATLHDEAQLAHHQVLTQAVHDAGGKIALQIL
FT                   HAGRYSYQPDPVAPSAIQAPINRFAPREMSTQDIVQTIDDFARCAALAQQAGYDGVEIM
FT                   GSEGYLINQFLVTHTNHRDDEWGGDFQRRCRFALEIVRAVRKRTGSDFILIYRLSMLDL
FT                   IEEGSSWQEIVQLAQAIEQAGATLINTGIGWHEARIPTIATLVPRGAFGWVTQKLMGKV
FT                   RIPLITTNRINDPDVAEKLLAEGCADMVSMARPFLADAELVAKAQSGRSDEINTCIGCN
FT                   QACLDQIFAGKVTSCLVNPRACHETELPIHPARVGKRFAVVGAGPAGMAFAVNAAARGH
FT                   QVTLFESSSYIGGQFNIAKQIPGKAEFYETLRYYRRQLELLGVTLRLSTQATPTDLLGF
FT                   DDVILACGIVPRTPEIAGIDHPSVLSYLDVLRDKKPVGKRVAIIGAGGIGFDTAHYLLN
FT                   KKSVPDGNHRLNPHPSQAGYGDFYAEWGIDTQLQHRGGLLPHQSDELPHPRDITLLQRK
FT                   TGKPGENLGKTTGWIHRTTLLRHGVTLLGGVEYHHIDDEGLHIIHDQQMRCLPVDNIII
FT                   CAGQEPNRTLYDPLLAAGCHVHLIGGADVAQELDARRAIDQATRLALTL"
FT   gene            623042..623338
FT                   /locus_tag="PC1_0538"
FT   CDS_pept        623042..623338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eca:ECA0656 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11593"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKF6"
FT                   /inference="similar to AA sequence:KEGG:ECA0656"
FT                   /protein_id="ACT11593.1"
FT                   /translation="MRVEELEYRLDSALRALEQSVQRQQQTWRQEHQSLQQQLLQAKER
FT                   DAYLCTQIERLSAQLSSMDSSPERNPLIQKMKVIHAHLDALAQEASAFRRSLR"
FT   gene            623590..624078
FT                   /locus_tag="PC1_0539"
FT   CDS_pept        623590..624078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0539"
FT                   /product="protein of unknown function Spy-related"
FT                   /note="PFAM: protein of unknown function Spy-related; KEGG:
FT                   eca:ECA0658 periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11594"
FT                   /db_xref="GOA:C6DKF7"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKF7"
FT                   /inference="protein motif:PFAM:PF07813"
FT                   /protein_id="ACT11594.1"
FT                   /translation="MRKLTAMLVASSLALGAAGIAHANEASKGPGPEHKMMMKEGREHR
FT                   GMMGPDAMFKELNLTEAQKQQVKDIMKESREKMHKAMQDDRREMHSLIASDTFDTAKAQ
FT                   AQLDKADAEHKARMLNGLETKNKIYNVLTPEQKKQYNDNFEKRLTQPPRPDGKPVPAE"
FT   sig_peptide     623590..623661
FT                   /locus_tag="PC1_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            624281..625750
FT                   /locus_tag="PC1_0540"
FT   CDS_pept        624281..625750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0540"
FT                   /product="diguanylate cyclase"
FT                   /note="KEGG: eca:ECA0659 putative signaling membrane
FT                   protein; TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; SMART: GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11595"
FT                   /db_xref="GOA:C6DKF8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKF8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACT11595.1"
FT                   /translation="MNNDLTLKTIKFMPFLFLTTFIVSCLGFRFRVLDELSLFWPANIL
FT                   VFCLMISFRARNGTIKGKTLSIGIGFLVSYVAMLSAALWMDNNSPLKTKVLLCLCNMVF
FT                   VVTAWCAFCLMCRFAGKWSTFEKFSKYYVYIIFASTFVGAFSSGVAYGVYAYVYDTGNR
FT                   YAEFMDWFSEQLGTGIILAFFFLRGKDILRALRNIPLCPKHIRENIFPFLVFIIFLLVS
FT                   LFFQDASLITLSVIPLTLCAFNYSFPIMSLLCAITGVILNYLYINQVGILINSNSEAYI
FT                   NSFLTTARLNIAMLIMAMLSVSHFVSMNRRLIKIIESNSLKDALTNTFNRRAFLSMLNG
FT                   RQGLLMNKRKRQLTLLFLDIDYFKQVNDTYGHASGDELIASFARMLSANIRPSDILCRW
FT                   GGEEFVIAAYDLTAEQSAAMAETLRHLTESTPLVLSDGREIRFTISIGVVTFPQYEGGN
FT                   TYDLIGLADEQLYKAKAQGRNRVCLRLVEDI"
FT   gene            625822..626184
FT                   /locus_tag="PC1_0541"
FT   CDS_pept        625822..626184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0541"
FT                   /product="protein of unknown function DUF305"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   eca:ECA0660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11596"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKF9"
FT                   /inference="protein motif:PFAM:PF03713"
FT                   /protein_id="ACT11596.1"
FT                   /translation="MKKVHLLLTAALLVPFLSFAADSAHSGHGSASESSSSQQAYMKGM
FT                   DAMHTEMMEGLKSSDPDIAFAKGMIAHHRGAIDMAKTELQYGKDPELRKLAEEIIKAQQ
FT                   PEIDQMEAWLKKQGKQ"
FT   sig_peptide     625822..625884
FT                   /locus_tag="PC1_0541"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 21"
FT   gene            626503..628431
FT                   /locus_tag="PC1_0542"
FT   CDS_pept        626503..628431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0542"
FT                   /product="PTS system, beta-glucoside-specific IIABC
FT                   subunit"
FT                   /note="TIGRFAM: PTS system, beta-glucoside-specific IIABC
FT                   subunit; PTS system, glucose subfamily, IIA subunit; PFAM:
FT                   sugar-specific permease EIIA 1 domain; phosphotransferase
FT                   system EIIC; phosphotransferase system PTS EIIB protein;
FT                   KEGG: eca:ECA0661 PTS system, beta-glucoside-specific IIABC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11597"
FT                   /db_xref="GOA:C6DKG0"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011297"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKG0"
FT                   /inference="protein motif:TFAM:TIGR01995"
FT                   /protein_id="ACT11597.1"
FT                   /translation="MNSKVLAENILRLVGGETNVSTLVHCATRLRFKIVDHGKVDVAAL
FT                   EALEGVITVINASGQLQVVIGNRVPEVYRAFGSISKLLEDGDGKRQTAESEQSTSAMGR
FT                   LIDLVAGIFTPLLGAMAAAGVLKGALAIVLALGWLNTKESTYVILHAASDSLFYFLPML
FT                   LAITAARKFETNIFVAVSIAGALVYPTIQGLFDAGQPVTFFGLPVVMMKYTASVIPIIF
FT                   SVWLMSYIERFLNRHIHESVRNILTPFFLLLLMVPLTLMTIGPIGISASKLIASVFVSI
FT                   YEFNPIIAGALMAASWQVLVIFGVHWGFVTVFINDLSVMGHSYLKAASSPSVFAQSGAL
FT                   LGVMVRTKDKKLKALAGSTFIASLFGITEPGVYGVTLKLKKPFICAVIAAAIGGAIVGY
FT                   AKSSAVSMGMPGLLTLPIFYGEGFVGFLIGCAIAFAASFVLTVIVGFDDPTPPIENTSA
FT                   PTRSSSTSATPAAPVSRQPANAVPPAQPLKDAPATAEQLGSPVKGELILLEDVDDKVFS
FT                   SGVVGQGVAILPEEGRIYSPVDGVIASTFSSGHAVGILAQNGAEILIHVGINTVQLEGQ
FT                   HYQMHVAEGDKVQKGQLLLEFDLEAIKQAGYDTVTPMVVTNADEYHLFSPGSARQLRVG
FT                   DTIIALA"
FT   gene            complement(628501..629889)
FT                   /locus_tag="PC1_0543"
FT   CDS_pept        complement(628501..629889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0543"
FT                   /product="glycoside hydrolase family 1"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   eca:ECA0662 6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11598"
FT                   /db_xref="GOA:C6DKG1"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKG1"
FT                   /inference="protein motif:PFAM:PF00232"
FT                   /protein_id="ACT11598.1"
FT                   /translation="MKAFPDGFLWGGSVAANQVEGAWNEDGKGVSTSDLQLKGVHGPVT
FT                   ERDENISCIKDRAIDFYHQYPQDIQLFAEMGFKVLRTSIAWTRIYPEGDEAEPCEAGLA
FT                   FYDRLFDEMAKHQIQPLITLSHYEMPYGLVKKLGGWGNRAVIDHFEKYARTVFSRYKDK
FT                   VKYWLTFNEINMALHSPFTGIGLSGEPSKQEIYQAIHHQLVASARAVKACHDLIPDAKI
FT                   GNMLLGAVRYPMTCHPKDVLEAQNKNREWLFFGDVQVRGTYPAWIQRYFRENGVELTIT
FT                   AQDKDDLSHTVDFVSFSYYMSGCATFEPEKYQSSRGNIIRLIPNPHLEASEWGWQIDPE
FT                   GLRFLLNELYDRYQKPLFIVENGLGARDVVEEDGSIHDSYRIDYLRRHLLQVREAIDDG
FT                   VELLGYTSWGPIDLVSAGTAQMSKRYGFIHVDRDDDGKGTLERRRKDSFYWYQDVINSN
FT                   GKSL"
FT   gene            629961..630218
FT                   /locus_tag="PC1_0544"
FT   CDS_pept        629961..630218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0544"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eca:ECA0663 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11599"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKG2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACT11599.1"
FT                   /translation="MTGKKKLGQKRVSLLTSAQVSPAIGGNVLSDHYTILNFCGNAPVW
FT                   LCDSGHDISVGATSALHGRMGGPQGKARALSGFIAMYKKI"
FT   sig_peptide     629961..630038
FT                   /locus_tag="PC1_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.620) with cleavage site probability 0.335 at
FT                   residue 26"
FT   gene            630271..630774
FT                   /locus_tag="PC1_0545"
FT   CDS_pept        630271..630774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0545"
FT                   /product="protein of unknown function DUF1543"
FT                   /note="PFAM: protein of unknown function DUF1543; KEGG:
FT                   sgl:SG0708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11600"
FT                   /db_xref="InterPro:IPR011440"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKG3"
FT                   /inference="protein motif:PFAM:PF07566"
FT                   /protein_id="ACT11600.1"
FT                   /translation="MHLYMFYLGGNAGKSNIEVHDIQFVAAEKPEDAWPALRDAWFGDP
FT                   DKVHIDGYARVVWADGYTVTLSDTRPADDNRLFFVNAGAYHPSTLAELHAFDLFVAKSA
FT                   PEAKSKGLASLLNGALHQHKDNLKDVDDCLLLEKIGDLYIHLTPCATGTPFTPEWQGYQ
FT                   PIGR"
FT   gene            631189..635418
FT                   /locus_tag="PC1_0546"
FT   CDS_pept        631189..635418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0546"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase;
FT                   flavodoxin/nitric oxide synthase; molybdopterin
FT                   oxidoreductase Fe4S4 region; FAD-binding domain protein;
FT                   oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   molydopterin dinucleotide-binding region; KEGG:
FT                   mfa:Mfla_0317 sulfite reductase (NADPH) alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11601"
FT                   /db_xref="GOA:C6DKG4"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKG4"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ACT11601.1"
FT                   /translation="MNAKSSTCVKSVCPYCGVGCGVVMEVKDNRVIKVSGDKTHPTNFG
FT                   RLCTKGNTSGQALAESGRLEHAYLRADRQHESVRVDVNKAIKETARRLRTIIDTHGPDA
FT                   VSLYVSGQMSLESQYLANKLAKGFIGTNNIESNSRLCMASAGSGYKLSLGSDGPPGSYQ
FT                   DFDHADVFFVIGANMADCHPILFLRMMDRVKAGAKLIVVDPRRNATADKANLFLHIKPG
FT                   TDLALLNSLLYLLVQNGHTDPAFIAEFTEGWEAMPAFLDDYHPETVAEITGLPEADIRK
FT                   AAEWIGTASAWMSCWTMGLNQSTHGTWNTNAICNLHLATGAICRPGSGPFSLTGQPNAM
FT                   GGREMGYMGMGLPGQRSVLVEKDRAAIEALWNVPAGTLRTKLGGGTVAMFEDMMAGKIK
FT                   ACWIICTNPVATVPNRKNVIAGLQAAELVITQDAFLDTETNRYADILLPGALWAEAEGV
FT                   MINSERNLTLMQKAVDPPGEAMADWQIIAKVACEMGYAQGFSYGSAAEVFEEIKQAWNP
FT                   KTGYDIRGASYERLRQAPLQWPCPPDDDNHRHPVRYLNDGVSQTLKALPDGTRPRLVFA
FT                   TESGKGIFLPRPHMSPAEMPDNDFQFVLNTGRLQHQWHTMTKTGKIPTLNKLNPGPFIE
FT                   VHPEDASALGIQDKDRVEVRSRRGHAALPAVVTDRVRPGNCFAPFHWNDVFGDDLAINA
FT                   VTSDAIDPISQQPEFKFCAVALTRIAEPASRISPERESHPAALPVSKQAEVGTPNNDIK
FT                   ELDMKHIDALATLLGLDAPPTLTLSAYEQHYLQGFIAALRTDASRLAGGVPVLPVTAPL
FT                   EPSRRLMLDGMLAGLFARTWLPDGGITALPTTAPAVPAVAASSPSPILVLWASSTGNAE
FT                   SFAAQCAERLKAEEHTVTLSEMGSVTIADLPAIPRVLFIASTFGDGDPPDNGMNFWMAL
FT                   QAETAPSLTEMAFSVLALGDSNYDQFCGFGRRLDARLEALGAQRLLARIDCEPDYQEAA
FT                   TAWLDSIVNALAGVPAPAANRAVTAAMVTVADEGDADAPVLTAASAPIFSRNAPLPARL
FT                   VINQRLNAPGAEKETRQFAFDIADSNVSYEAGDALGIWPTNSPELVAEILSALKLSPAT
FT                   VVTVKDKGDMTLAEALSQHVEIARITPEFLQFVSQRSGTSALADLLQEERKEELKQWLW
FT                   GRQIVDVLQAFPIQVQADELLSVLKRMQPRLYSISSSPKVTPHQIHLTVSTVRYGVEGQ
FT                   SRGGVCSTFLADRAAESGMVPIFIQKSAHFRTPQHPDTPIIMVGAGTGIAPFRAFLQER
FT                   QATKAQGKNWLFFGEQYAATDFYYREELEKLQRDGYLHRLDTAFSRDQHEKIYVQHRMC
FT                   EQGAELWRWLEEGAHFYVCGDASRMAKDVDLALRQVAQAHGGMNSEQAAAYVAKMAQDK
FT                   RYVRDVY"
FT   gene            complement(635550..635625)
FT                   /locus_tag="PC1_R0018"
FT                   /note="tRNA-Met7"
FT   tRNA            complement(635550..635625)
FT                   /locus_tag="PC1_R0018"
FT                   /product="tRNA-Met"
FT   gene            635766..636269
FT                   /locus_tag="PC1_0547"
FT   CDS_pept        635766..636269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0547"
FT                   /product="Uracil-DNA glycosylase superfamily"
FT                   /note="PFAM: Uracil-DNA glycosylase superfamily; KEGG:
FT                   eca:ECA0679 G/U mismatch-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11602"
FT                   /db_xref="GOA:C6DKG5"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR015637"
FT                   /db_xref="InterPro:IPR023502"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKG5"
FT                   /inference="protein motif:PFAM:PF03167"
FT                   /protein_id="ACT11602.1"
FT                   /translation="MITDILAMNLQVVFCGINPGLSTAHHGYHFANPSNRFWKVIHHVG
FT                   FTERLLTPAEEQHLLDTGCGITMLVERPTVEATELGRDELLQGGNAIVEKMERYQPRAL
FT                   AVLGKQAFSQAFGIKKVSWGRQSLNIGETQVWVLPNPSGLNRATLESLVASYQELHQAL
FT                   QDKA"
FT   gene            complement(636366..638204)
FT                   /locus_tag="PC1_0548"
FT   CDS_pept        complement(636366..638204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0548"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM: sigma-70
FT                   non-essential domain protein; sigma-70 region 3 domain
FT                   protein; sigma-70 region 2 domain protein; sigma-70 region
FT                   1.2; sigma-70 1.1 domain protein; sigma-70 region 4 domain
FT                   protein; KEGG: eca:ECA0680 RNA polymerase sigma factor
FT                   RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11603"
FT                   /db_xref="GOA:C6DKG6"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKG6"
FT                   /inference="protein motif:TFAM:TIGR02393"
FT                   /protein_id="ACT11603.1"
FT                   /translation="MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIIDSDQIEDII
FT                   QMINDMGIQVMEEAPDADDLLLAENTNDADEDAAEAAAQVLSSVESEIGRTTDPVRMYM
FT                   REMGTVELLTREGEIDIAKRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAGESRLSDL
FT                   ITGFVDPNAEEDIAPTATHVGSELSSEEMDDDDEESEDDDDSEDDNSIDPELAREKFTE
FT                   LRDQYETTRKVIKEHGRSHALAVQEILNLSEVFKQFRLVPKQFDFLVNSMRSMMDRVRT
FT                   QERLIIKLCVEQCKMPKKNFVTMFTGNETNSTWFAAAVAMGKPWSEKLNDVEEDVTRSL
FT                   QKLQQIEEETGLTIEQVKDINRRMSIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQ
FT                   FLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIET
FT                   INKLNRISRQMLQEMGREPTPEELAERMLMPEDKIRKVLKIAKEPISMETPIGDDEDSH
FT                   LGDFIEDTTLELPLDSATSESLRSATHDVLAGLTAREAKVLRMRFGIDMNTDHTLEEVG
FT                   KQFDVTRERIRQIEAKALRKLRHPSRSEVLRSFLDD"
FT   gene            complement(638359..640113)
FT                   /locus_tag="PC1_0549"
FT   CDS_pept        complement(638359..640113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0549"
FT                   /product="DNA primase"
FT                   /note="KEGG: eca:ECA0681 DNA primase; TIGRFAM: DNA primase;
FT                   PFAM: zinc finger CHC2-family protein; DNA primase
FT                   catalytic core domain; TOPRIM domain protein; DNA primase
FT                   DnaG DnaB-binding; SMART: DNA primase DnaG DnaB-binding;
FT                   Toprim sub domain protein; zinc finger CHC2-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11604"
FT                   /db_xref="GOA:C6DKG7"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:C6DKG7"
FT                   /inference="protein motif:TFAM:TIGR01391"
FT                   /protein_id="ACT11604.1"
FT                   /translation="MAGRIPRVFINDLLARTDIVDLIDARVKLKKQGKNYHACCPFHHE
FT                   KTPSFTVNGDKQFYHCFGCGAHGNAIDFLMNYDRLEFVETIEELATQYGLEVPYESGTG
FT                   PTQLERHQRQSLYELMGQLSGFYQQALSQSVGTPALQYLQQRGLSAEVISHFAIGFAPP
FT                   GWDNVLKRFGRNNDDRSTLNDAGMLVTNDQGRTYDRFRERVMFPIRDKRGRVIAFGGRV
FT                   LGDGTPKYLNSPETEIFHKGRQLYGLYEAQQSHAELKRLLVVEGYMDVVALAQFGIDYA
FT                   VASLGTSTTADHIQLLFRATDLVVCCYDGDRAGREAAWRALETALPYLNDGRQLRFMFL
FT                   PDGEDPDTLVRKEGKAVFEQRMEQALPLSQFLFETLQQQVDMSSPDGRTKLSTLALPLI
FT                   GQVPGETLRLYLRQQLGNKLGILDDSQLDRLLPKVAEQAQPYQPPQLKVTTMRILIGLL
FT                   VQNPRLAAEVPDLALEGIEEDKVAGLSLFQDLVKTCNASPGMNMGLLLEKYRDSKYRKQ
FT                   LETMASWNHMIVEEELDEKFRISLAELYDQLLKQRQETLIARDRTHGLSAKEKKELWSL
FT                   QLALTRKH"
FT   gene            complement(640267..640482)
FT                   /locus_tag="PC1_0550"
FT   CDS_pept        complement(640267..640482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0550"
FT                   /product="ribosomal protein S21"
FT                   /note="TIGRFAM: ribosomal protein S21; PFAM: ribosomal
FT                   protein S21; KEGG: yps:YPTB3416 30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11605"
FT                   /db_xref="GOA:C6DKG8"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKG8"
FT                   /inference="protein motif:TFAM:TIGR00030"
FT                   /protein_id="ACT11605.1"
FT                   /translation="MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTER
FT                   KRAKASAVKRHAKKLARENARRTRLY"
FT   gene            640710..641723
FT                   /locus_tag="PC1_0551"
FT   CDS_pept        640710..641723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0551"
FT                   /product="metalloendopeptidase, glycoprotease family"
FT                   /EC_number="3.4.24.57"
FT                   /note="KEGG: eca:ECA0683 O-sialoglycoprotein endopeptidase;
FT                   TIGRFAM: metalloendopeptidase, glycoprotease family; PFAM:
FT                   peptidase M22 glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11606"
FT                   /db_xref="GOA:C6DKG9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017860"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKG9"
FT                   /inference="protein motif:TFAM:TIGR00329"
FT                   /protein_id="ACT11606.1"
FT                   /translation="MRVLGIETSCDETGVAIYDTETGLLANQLYSQVKLHADYGGVVPE
FT                   LASRDHVRKTVPLIQAALREAGLQAGDIDGVAYTAGPGLVGALLVGATVGRSLAFAWDV
FT                   PAIPVHHMEGHLLAPMLEDNPPAFPFVALLVSGGHTQLISVTGIGEYRLLGESIDDAAG
FT                   EAFDKTAKLLGLDYPGGPMLSKMAQAGDSQRFTFPRPMTDRPGLDFSFSGLKTFAANTI
FT                   RSNGDDDQTRADIARAFEDAVVDTLAIKCRRALDETGFKRLVMAGGVSANRTLRQCLGD
FT                   VMAKRGGEVFYARPEFCTDNGAMIAYAGSVRLAHGASQTLGVSVRPRWPLAELPAV"
FT   gene            complement(641821..642291)
FT                   /locus_tag="PC1_0552"
FT   CDS_pept        complement(641821..642291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0552"
FT                   /product="arginine repressor, ArgR"
FT                   /note="TIGRFAM: arginine repressor; PFAM: arginine
FT                   repressor; KEGG: eca:ECA0684 arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11607"
FT                   /db_xref="GOA:C6DKH0"
FT                   /db_xref="InterPro:IPR001669"
FT                   /db_xref="InterPro:IPR020899"
FT                   /db_xref="InterPro:IPR020900"
FT                   /db_xref="InterPro:IPR036251"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKH0"
FT                   /inference="protein motif:TFAM:TIGR01529"
FT                   /protein_id="ACT11607.1"
FT                   /translation="MRNSTKQEDLVKAFKALLKEEKFSSQSEIVQALQDEGFENINQSK
FT                   VSRMLTKFGAVRTRNAKMEMVYCLPAELGVPTTSSPLKNLVLDVDYNDAVIVIHTSPGA
FT                   AQLIARLLDSLGKSEGILGTIAGDDTIFTTPARGFSVKQLYEAILVLFEQEL"
FT   gene            642762..643700
FT                   /locus_tag="PC1_0553"
FT   CDS_pept        642762..643700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0553"
FT                   /product="malate dehydrogenase, NAD-dependent"
FT                   /note="TIGRFAM: malate dehydrogenase, NAD-dependent; PFAM:
FT                   Lactate/malate dehydrogenase; KEGG: eca:ECA0685 malate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11608"
FT                   /db_xref="GOA:C6DKH1"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR023958"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DKH1"
FT                   /inference="protein motif:TFAM:TIGR01772"
FT                   /protein_id="ACT11608.1"
FT                   /translation="MKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVD
FT                   LSHIPTAVKIKGYSGEDAKPALAGADIVLISAGVARKPGMDRSDLFNVNAGIVRNLVEQ
FT                   IAVTCPKACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLFGVTTLDIIRSNTFVAELKG
FT                   KQPQDINVPVIGGHSGVTILPLLSQVPGISFSEQEVADLTKRIQNAGTEVVEAKAGGGS
FT                   ATLSMGQAAARFGLSLVRALQGESGVVECAYVESDGKHARFFAQPVLLGKDGVVERKDI
FT                   GTLSAFEQNALSSMLDTLKQDIELGETFIKN"
FT   gene            complement(643770..644033)
FT                   /locus_tag="PC1_0554"
FT   CDS_pept        complement(643770..644033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PC1_0554"
FT                   /product="putative transcriptional regulator, Nlp"
FT                   /note="KEGG: eca:ECA0686 sugar fermentation stimulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PC1_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACT11609"
FT                   /db_xref="GOA:C6DKH2"
FT