(data stored in ACNUC1104 zone)

EMBL: CP001658

ID   CP001658; SV 1; circular; genomic DNA; STD; PRO; 4398250 BP.
AC   CP001658; ABGM02000000-ABGM02000021; DS999538;
PR   Project:PRJNA21055;
DT   10-JUL-2009 (Rel. 101, Created)
DT   02-SEP-2014 (Rel. 122, Last updated, Version 2)
DE   Mycobacterium tuberculosis KZN 1435, complete genome.
KW   .
OS   Mycobacterium tuberculosis KZN 1435
OC   Bacteria; Actinobacteria; Corynebacteriales; Mycobacteriaceae;
OC   Mycobacterium; Mycobacterium tuberculosis complex.
RN   [1]
RP   1-4398250
RG   The Broad Institute Genome Sequencing Platform, Broad Institute Microbial
RG   Sequencing Center.
RA   Murray M., Pillay M., Borowsky M.L., Young S.K., Zeng Q., Koehrsen M.,
RA   Alvarado L., Berlin A.M., Borenstein D., Chen Z., Engels R., Freedman E.,
RA   Gellesch M., Goldberg J., Griggs A., Gujja S., Heiman D.I., Hepburn T.A.,
RA   Howarth C., Jen D., Larson L., Lewis B., Mehta T., Park D., Pearson M.,
RA   Roberts A., Saif S., Shea T.D., Shenoy N., Sisk P., Stolte C., Sykes S.N.,
RA   Walk T., White J., Yandava C., Haas B., Nusbaum C., Galagan J., Birren B.;
RT   "The Genome Sequence of Mycobacterium tuberculosis strain KZN 1435";
RL   Unpublished.
RN   [2]
RP   1-4398250
RG   The Broad Institute Genome Sequencing Platform, Broad Institute Microbial
RG   Sequencing Center.
RA   Murray M., Pillay M., Borowsky M.L., Young S.K., Zeng Q., Koehrsen M.,
RA   Alvarado L., Berlin A.M., Borenstein D., Chen Z., Engels R., Freedman E.,
RA   Gellesch M., Goldberg J., Griggs A., Gujja S., Heiman D.I., Hepburn T.A.,
RA   Howarth C., Jen D., Larson L., Lewis B., Mehta T., Park D., Pearson M.,
RA   Roberts A., Saif S., Shea T.D., Shenoy N., Sisk P., Stolte C., Sykes S.N.,
RA   Walk T., White J., Yandava C., Haas B., Nusbaum C., Galagan J., Birren B.;
RT   ;
RL   Submitted (01-JUL-2009) to the INSDC.
RL   Broad Institute of MIT and Harvard, 7 Cambridge Center, Cambridge, MA
RL   02142, USA
DR   MD5; 1029c6208114fc4d4da762110fb161a3.
DR   BioSample; SAMN00763683.
DR   EnsemblGenomes-Gn; EBG00001207913.
DR   EnsemblGenomes-Gn; EBG00001207914.
DR   EnsemblGenomes-Gn; EBG00001207915.
DR   EnsemblGenomes-Gn; EBG00001207916.
DR   EnsemblGenomes-Gn; EBG00001207917.
DR   EnsemblGenomes-Gn; EBG00001207918.
DR   EnsemblGenomes-Gn; EBG00001207919.
DR   EnsemblGenomes-Gn; EBG00001207920.
DR   EnsemblGenomes-Gn; EBG00001207921.
DR   EnsemblGenomes-Gn; EBG00001207922.
DR   EnsemblGenomes-Gn; EBG00001207923.
DR   EnsemblGenomes-Gn; EBG00001207924.
DR   EnsemblGenomes-Gn; EBG00001207925.
DR   EnsemblGenomes-Gn; EBG00001207926.
DR   EnsemblGenomes-Gn; EBG00001207927.
DR   EnsemblGenomes-Gn; EBG00001207928.
DR   EnsemblGenomes-Gn; EBG00001207929.
DR   EnsemblGenomes-Gn; EBG00001207930.
DR   EnsemblGenomes-Gn; EBG00001207931.
DR   EnsemblGenomes-Gn; EBG00001207932.
DR   EnsemblGenomes-Gn; EBG00001207933.
DR   EnsemblGenomes-Gn; EBG00001207934.
DR   EnsemblGenomes-Gn; EBG00001207935.
DR   EnsemblGenomes-Gn; EBG00001207936.
DR   EnsemblGenomes-Gn; EBG00001207937.
DR   EnsemblGenomes-Gn; EBG00001207938.
DR   EnsemblGenomes-Gn; EBG00001207939.
DR   EnsemblGenomes-Gn; EBG00001207940.
DR   EnsemblGenomes-Gn; EBG00001207941.
DR   EnsemblGenomes-Gn; EBG00001207942.
DR   EnsemblGenomes-Gn; EBG00001207943.
DR   EnsemblGenomes-Gn; EBG00001207944.
DR   EnsemblGenomes-Gn; EBG00001207945.
DR   EnsemblGenomes-Gn; EBG00001207946.
DR   EnsemblGenomes-Gn; EBG00001207947.
DR   EnsemblGenomes-Gn; EBG00001207948.
DR   EnsemblGenomes-Gn; EBG00001207949.
DR   EnsemblGenomes-Gn; EBG00001207950.
DR   EnsemblGenomes-Gn; EBG00001207951.
DR   EnsemblGenomes-Gn; EBG00001207952.
DR   EnsemblGenomes-Gn; EBG00001207953.
DR   EnsemblGenomes-Gn; EBG00001207954.
DR   EnsemblGenomes-Gn; EBG00001207955.
DR   EnsemblGenomes-Gn; EBG00001207956.
DR   EnsemblGenomes-Gn; EBG00001207957.
DR   EnsemblGenomes-Gn; EBG00001207958.
DR   EnsemblGenomes-Gn; EBG00001207959.
DR   EnsemblGenomes-Gn; EBG00001207960.
DR   EnsemblGenomes-Gn; EBG00001207961.
DR   EnsemblGenomes-Gn; EBG00001207962.
DR   EnsemblGenomes-Gn; EBG00001207963.
DR   EnsemblGenomes-Gn; EBG00001207964.
DR   EnsemblGenomes-Gn; EBG00001207965.
DR   EnsemblGenomes-Gn; EBG00001207966.
DR   EnsemblGenomes-Gn; EBG00001207967.
DR   EnsemblGenomes-Gn; EBG00001207968.
DR   EnsemblGenomes-Gn; EBG00001207969.
DR   EnsemblGenomes-Gn; EBG00001207970.
DR   EnsemblGenomes-Gn; EBG00001207971.
DR   EnsemblGenomes-Gn; EBG00001207972.
DR   EnsemblGenomes-Gn; EBG00001207973.
DR   EnsemblGenomes-Gn; EBG00001207974.
DR   EnsemblGenomes-Gn; EBG00001207975.
DR   EnsemblGenomes-Gn; EBG00001207976.
DR   EnsemblGenomes-Gn; EBG00001207977.
DR   EnsemblGenomes-Gn; EBG00001207978.
DR   EnsemblGenomes-Gn; EBG00001207979.
DR   EnsemblGenomes-Gn; EBG00001207980.
DR   EnsemblGenomes-Gn; EBG00001207981.
DR   EnsemblGenomes-Gn; TBMG_05001.
DR   EnsemblGenomes-Gn; TBMG_05002.
DR   EnsemblGenomes-Gn; TBMG_05003.
DR   EnsemblGenomes-Gn; TBMG_05004.
DR   EnsemblGenomes-Gn; TBMG_05005.
DR   EnsemblGenomes-Gn; TBMG_05006.
DR   EnsemblGenomes-Gn; TBMG_05007.
DR   EnsemblGenomes-Gn; TBMG_05008.
DR   EnsemblGenomes-Gn; TBMG_05009.
DR   EnsemblGenomes-Gn; TBMG_05010.
DR   EnsemblGenomes-Gn; TBMG_05011.
DR   EnsemblGenomes-Gn; TBMG_05012.
DR   EnsemblGenomes-Gn; TBMG_05013.
DR   EnsemblGenomes-Gn; TBMG_05014.
DR   EnsemblGenomes-Gn; TBMG_05015.
DR   EnsemblGenomes-Gn; TBMG_05016.
DR   EnsemblGenomes-Gn; TBMG_05017.
DR   EnsemblGenomes-Gn; TBMG_05018.
DR   EnsemblGenomes-Gn; TBMG_05019.
DR   EnsemblGenomes-Gn; TBMG_05020.
DR   EnsemblGenomes-Gn; TBMG_05021.
DR   EnsemblGenomes-Gn; TBMG_05022.
DR   EnsemblGenomes-Gn; TBMG_05023.
DR   EnsemblGenomes-Gn; TBMG_05024.
DR   EnsemblGenomes-Gn; TBMG_05025.
DR   EnsemblGenomes-Gn; TBMG_05026.
DR   EnsemblGenomes-Gn; TBMG_05027.
DR   EnsemblGenomes-Gn; TBMG_05028.
DR   EnsemblGenomes-Gn; TBMG_05029.
DR   EnsemblGenomes-Gn; TBMG_05030.
DR   EnsemblGenomes-Gn; TBMG_05031.
DR   EnsemblGenomes-Gn; TBMG_05032.
DR   EnsemblGenomes-Gn; TBMG_05033.
DR   EnsemblGenomes-Gn; TBMG_05034.
DR   EnsemblGenomes-Gn; TBMG_05035.
DR   EnsemblGenomes-Gn; TBMG_05036.
DR   EnsemblGenomes-Gn; TBMG_05037.
DR   EnsemblGenomes-Gn; TBMG_05038.
DR   EnsemblGenomes-Gn; TBMG_05039.
DR   EnsemblGenomes-Gn; TBMG_05040.
DR   EnsemblGenomes-Gn; TBMG_05041.
DR   EnsemblGenomes-Gn; TBMG_05042.
DR   EnsemblGenomes-Gn; TBMG_05043.
DR   EnsemblGenomes-Gn; TBMG_05044.
DR   EnsemblGenomes-Gn; TBMG_05045.
DR   EnsemblGenomes-Gn; TBMG_05101.
DR   EnsemblGenomes-Gn; TBMG_05102.
DR   EnsemblGenomes-Gn; TBMG_05103.
DR   EnsemblGenomes-Tr; EBT00001777056.
DR   EnsemblGenomes-Tr; EBT00001777057.
DR   EnsemblGenomes-Tr; EBT00001777058.
DR   EnsemblGenomes-Tr; EBT00001777059.
DR   EnsemblGenomes-Tr; EBT00001777060.
DR   EnsemblGenomes-Tr; EBT00001777061.
DR   EnsemblGenomes-Tr; EBT00001777062.
DR   EnsemblGenomes-Tr; EBT00001777063.
DR   EnsemblGenomes-Tr; EBT00001777064.
DR   EnsemblGenomes-Tr; EBT00001777065.
DR   EnsemblGenomes-Tr; EBT00001777066.
DR   EnsemblGenomes-Tr; EBT00001777067.
DR   EnsemblGenomes-Tr; EBT00001777068.
DR   EnsemblGenomes-Tr; EBT00001777069.
DR   EnsemblGenomes-Tr; EBT00001777070.
DR   EnsemblGenomes-Tr; EBT00001777071.
DR   EnsemblGenomes-Tr; EBT00001777072.
DR   EnsemblGenomes-Tr; EBT00001777073.
DR   EnsemblGenomes-Tr; EBT00001777074.
DR   EnsemblGenomes-Tr; EBT00001777075.
DR   EnsemblGenomes-Tr; EBT00001777076.
DR   EnsemblGenomes-Tr; EBT00001777077.
DR   EnsemblGenomes-Tr; EBT00001777078.
DR   EnsemblGenomes-Tr; EBT00001777079.
DR   EnsemblGenomes-Tr; EBT00001777080.
DR   EnsemblGenomes-Tr; EBT00001777081.
DR   EnsemblGenomes-Tr; EBT00001777082.
DR   EnsemblGenomes-Tr; EBT00001777083.
DR   EnsemblGenomes-Tr; EBT00001777084.
DR   EnsemblGenomes-Tr; EBT00001777085.
DR   EnsemblGenomes-Tr; EBT00001777086.
DR   EnsemblGenomes-Tr; EBT00001777087.
DR   EnsemblGenomes-Tr; EBT00001777088.
DR   EnsemblGenomes-Tr; EBT00001777089.
DR   EnsemblGenomes-Tr; EBT00001777090.
DR   EnsemblGenomes-Tr; EBT00001777091.
DR   EnsemblGenomes-Tr; EBT00001777092.
DR   EnsemblGenomes-Tr; EBT00001777093.
DR   EnsemblGenomes-Tr; EBT00001777094.
DR   EnsemblGenomes-Tr; EBT00001777095.
DR   EnsemblGenomes-Tr; EBT00001777096.
DR   EnsemblGenomes-Tr; EBT00001777097.
DR   EnsemblGenomes-Tr; EBT00001777098.
DR   EnsemblGenomes-Tr; EBT00001777099.
DR   EnsemblGenomes-Tr; EBT00001777100.
DR   EnsemblGenomes-Tr; EBT00001777101.
DR   EnsemblGenomes-Tr; EBT00001777102.
DR   EnsemblGenomes-Tr; EBT00001777103.
DR   EnsemblGenomes-Tr; EBT00001777104.
DR   EnsemblGenomes-Tr; EBT00001777105.
DR   EnsemblGenomes-Tr; EBT00001777106.
DR   EnsemblGenomes-Tr; EBT00001777107.
DR   EnsemblGenomes-Tr; EBT00001777108.
DR   EnsemblGenomes-Tr; EBT00001777109.
DR   EnsemblGenomes-Tr; EBT00001777110.
DR   EnsemblGenomes-Tr; EBT00001777111.
DR   EnsemblGenomes-Tr; EBT00001777112.
DR   EnsemblGenomes-Tr; EBT00001777113.
DR   EnsemblGenomes-Tr; EBT00001777114.
DR   EnsemblGenomes-Tr; EBT00001777115.
DR   EnsemblGenomes-Tr; EBT00001777116.
DR   EnsemblGenomes-Tr; EBT00001777117.
DR   EnsemblGenomes-Tr; EBT00001777118.
DR   EnsemblGenomes-Tr; EBT00001777119.
DR   EnsemblGenomes-Tr; EBT00001777120.
DR   EnsemblGenomes-Tr; EBT00001777121.
DR   EnsemblGenomes-Tr; EBT00001777122.
DR   EnsemblGenomes-Tr; EBT00001777123.
DR   EnsemblGenomes-Tr; EBT00001777124.
DR   EnsemblGenomes-Tr; TBMG_05001-1.
DR   EnsemblGenomes-Tr; TBMG_05002-1.
DR   EnsemblGenomes-Tr; TBMG_05003-1.
DR   EnsemblGenomes-Tr; TBMG_05004-1.
DR   EnsemblGenomes-Tr; TBMG_05005-1.
DR   EnsemblGenomes-Tr; TBMG_05006-1.
DR   EnsemblGenomes-Tr; TBMG_05007-1.
DR   EnsemblGenomes-Tr; TBMG_05008-1.
DR   EnsemblGenomes-Tr; TBMG_05009-1.
DR   EnsemblGenomes-Tr; TBMG_05010-1.
DR   EnsemblGenomes-Tr; TBMG_05011-1.
DR   EnsemblGenomes-Tr; TBMG_05012-1.
DR   EnsemblGenomes-Tr; TBMG_05013-1.
DR   EnsemblGenomes-Tr; TBMG_05014-1.
DR   EnsemblGenomes-Tr; TBMG_05015-1.
DR   EnsemblGenomes-Tr; TBMG_05016-1.
DR   EnsemblGenomes-Tr; TBMG_05017-1.
DR   EnsemblGenomes-Tr; TBMG_05018-1.
DR   EnsemblGenomes-Tr; TBMG_05019-1.
DR   EnsemblGenomes-Tr; TBMG_05020-1.
DR   EnsemblGenomes-Tr; TBMG_05021-1.
DR   EnsemblGenomes-Tr; TBMG_05022-1.
DR   EnsemblGenomes-Tr; TBMG_05023-1.
DR   EnsemblGenomes-Tr; TBMG_05024-1.
DR   EnsemblGenomes-Tr; TBMG_05025-1.
DR   EnsemblGenomes-Tr; TBMG_05026-1.
DR   EnsemblGenomes-Tr; TBMG_05027-1.
DR   EnsemblGenomes-Tr; TBMG_05028-1.
DR   EnsemblGenomes-Tr; TBMG_05029-1.
DR   EnsemblGenomes-Tr; TBMG_05030-1.
DR   EnsemblGenomes-Tr; TBMG_05031-1.
DR   EnsemblGenomes-Tr; TBMG_05032-1.
DR   EnsemblGenomes-Tr; TBMG_05033-1.
DR   EnsemblGenomes-Tr; TBMG_05034-1.
DR   EnsemblGenomes-Tr; TBMG_05035-1.
DR   EnsemblGenomes-Tr; TBMG_05036-1.
DR   EnsemblGenomes-Tr; TBMG_05037-1.
DR   EnsemblGenomes-Tr; TBMG_05038-1.
DR   EnsemblGenomes-Tr; TBMG_05039-1.
DR   EnsemblGenomes-Tr; TBMG_05040-1.
DR   EnsemblGenomes-Tr; TBMG_05041-1.
DR   EnsemblGenomes-Tr; TBMG_05042-1.
DR   EnsemblGenomes-Tr; TBMG_05043-1.
DR   EnsemblGenomes-Tr; TBMG_05044-1.
DR   EnsemblGenomes-Tr; TBMG_05045-1.
DR   EnsemblGenomes-Tr; TBMG_05101-1.
DR   EnsemblGenomes-Tr; TBMG_05102-1.
DR   EnsemblGenomes-Tr; TBMG_05103-1.
DR   EuropePMC; PMC2976163; 20805400.
DR   EuropePMC; PMC3089889; 21584191.
DR   EuropePMC; PMC4219376; 24299240.
DR   EuropePMC; PMC4722049; 26839757.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01066; 6C.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01779; AS1726.
DR   RFAM; RF01780; AS1890.
DR   RFAM; RF01781; ASdes.
DR   RFAM; RF01782; ASpks.
DR   RFAM; RF01783; b55.
DR   RFAM; RF01791; F6.
DR   RFAM; RF01798; g2.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   SILVA-LSU; CP001658.
DR   SILVA-SSU; CP001658.
FH   Key             Location/Qualifiers
FT   source          1..4398250
FT                   /organism="Mycobacterium tuberculosis KZN 1435"
FT                   /strain="KZN 1435"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:478434"
FT   gene            103..1626
FT                   /locus_tag="TBMG_00001"
FT                   /note="TBMG_00001.1"
FT   CDS_pept        103..1626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00001"
FT                   /product="chromosomal replication initiator protein dnaA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23022"
FT                   /protein_id="ACT23022.1"
FT   gene            2154..3362
FT                   /locus_tag="TBMG_00002"
FT                   /note="TBMG_00002.1"
FT   CDS_pept        2154..3362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00002"
FT                   /product="DNA polymerase subunit III beta dnaN"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23023"
FT                   /protein_id="ACT23023.1"
FT                   LPG"
FT   gene            3382..4539
FT                   /locus_tag="TBMG_00003"
FT                   /note="TBMG_00003.1"
FT   CDS_pept        3382..4539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00003"
FT                   /product="DNA replication and repair protein recF"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23024"
FT                   /protein_id="ACT23024.1"
FT   gene            4536..5099
FT                   /locus_tag="TBMG_00004"
FT                   /note="TBMG_00004.1"
FT   CDS_pept        4536..5099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00004"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23025"
FT                   /protein_id="ACT23025.1"
FT   gene            5225..7369
FT                   /locus_tag="TBMG_00005"
FT                   /note="TBMG_00005.1"
FT   CDS_pept        5225..7369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00005"
FT                   /product="DNA gyrase subunit B gyrB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23026"
FT                   /protein_id="ACT23026.1"
FT   gene            7404..9920
FT                   /locus_tag="TBMG_00006"
FT                   /note="TBMG_00006.1"
FT   CDS_pept        7404..9920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00006"
FT                   /product="DNA gyrase subunit A gyrA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23027"
FT                   /protein_id="ACT23027.1"
FT   gene            10016..10930
FT                   /locus_tag="TBMG_00007"
FT                   /note="TBMG_00007.1"
FT   CDS_pept        10016..10930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00007"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23028"
FT                   /protein_id="ACT23028.1"
FT   gene            10989..11065
FT                   /locus_tag="TBMG_05001"
FT   tRNA            10989..11065
FT                   /locus_tag="TBMG_05001"
FT                   /product="tRNA-Ile"
FT   gene            11214..11289
FT                   /locus_tag="TBMG_05002"
FT   tRNA            11214..11289
FT                   /locus_tag="TBMG_05002"
FT                   /product="tRNA-Ala"
FT   gene            complement(11976..12413)
FT                   /locus_tag="TBMG_00008"
FT                   /note="TBMG_00008.1"
FT   CDS_pept        complement(11976..12413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00008"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23029"
FT                   /protein_id="ACT23029.1"
FT   gene            12570..13118
FT                   /locus_tag="TBMG_00009"
FT                   /note="TBMG_00009.1"
FT   CDS_pept        12570..13118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00009"
FT                   /product="iron-regulated
FT                   peptidyl-prolyl-cis-trans-isomerase A ppiA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23030"
FT                   /protein_id="ACT23030.1"
FT   gene            complement(13235..13660)
FT                   /locus_tag="TBMG_00010"
FT                   /note="TBMG_00010.1"
FT   CDS_pept        complement(13235..13660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00010"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23031"
FT                   /protein_id="ACT23031.1"
FT   gene            complement(13816..14097)
FT                   /locus_tag="TBMG_00011"
FT                   /note="TBMG_00011.1"
FT   CDS_pept        complement(13816..14097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00011"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23032"
FT                   /protein_id="ACT23032.1"
FT   gene            14191..14979
FT                   /locus_tag="TBMG_00012"
FT                   /note="TBMG_00012.1"
FT   CDS_pept        14191..14979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00012"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23033"
FT                   /protein_id="ACT23033.1"
FT   gene            15016..15714
FT                   /locus_tag="TBMG_00013"
FT                   /note="TBMG_00013.1"
FT   CDS_pept        15016..15714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00013"
FT                   /product="anthranilate synthase component II trpG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23034"
FT                   /protein_id="ACT23034.1"
FT                   AGEATGRTSA"
FT   gene            complement(15692..17572)
FT                   /locus_tag="TBMG_00014"
FT                   /note="TBMG_00014.1"
FT   CDS_pept        complement(15692..17572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00014"
FT                   /product="transmembrane serine/threonine-protein kinase B
FT                   pknB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00014"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23035"
FT                   /protein_id="ACT23035.1"
FT   gene            complement(17569..18846)
FT                   /locus_tag="TBMG_00015"
FT                   /note="TBMG_00015.1"
FT   CDS_pept        complement(17569..18846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00015"
FT                   /product="transmembrane serine/threonine-protein kinase A
FT                   pknA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23036"
FT                   /protein_id="ACT23036.1"
FT   gene            complement(18861..20336)
FT                   /locus_tag="TBMG_00016"
FT                   /note="TBMG_00016.1"
FT   CDS_pept        complement(18861..20336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00016"
FT                   /product="penicillin-binding protein pbpA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00016"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23037"
FT                   /protein_id="ACT23037.1"
FT   gene            complement(20333..21742)
FT                   /locus_tag="TBMG_00017"
FT                   /note="TBMG_00017.1"
FT   CDS_pept        complement(20333..21742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00017"
FT                   /product="cell division protein rodA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00017"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23038"
FT                   /protein_id="ACT23038.1"
FT                   TAAGTEVIERV"
FT   gene            complement(21739..23283)
FT                   /locus_tag="TBMG_00018"
FT                   /note="TBMG_00018.1"
FT   CDS_pept        complement(21739..23283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00018"
FT                   /product="serine/threonine phosphatase ppp"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00018"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23039"
FT                   /protein_id="ACT23039.1"
FT   gene            complement(23372..23839)
FT                   /locus_tag="TBMG_00019"
FT                   /note="TBMG_00019.1"
FT   CDS_pept        complement(23372..23839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00019"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00019"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23040"
FT                   /protein_id="ACT23040.1"
FT   gene            complement(23963..25546)
FT                   /locus_tag="TBMG_00020"
FT                   /note="TBMG_00020.1"
FT   CDS_pept        complement(23963..25546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23041"
FT                   /protein_id="ACT23041.1"
FT                   GHSEIIVRMH"
FT   gene            25746..25831
FT                   /locus_tag="TBMG_05003"
FT   tRNA            25746..25831
FT                   /locus_tag="TBMG_05003"
FT                   /product="tRNA-Leu"
FT   gene            complement(26015..26980)
FT                   /locus_tag="TBMG_00021"
FT                   /note="TBMG_00021.1"
FT   CDS_pept        complement(26015..26980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23042"
FT                   /protein_id="ACT23042.1"
FT   gene            complement(27125..27544)
FT                   /locus_tag="TBMG_00022"
FT                   /note="TBMG_00022.1"
FT   CDS_pept        complement(27125..27544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00022"
FT                   /product="transcriptional regulator whib-like whiB5"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23043"
FT                   /protein_id="ACT23043.1"
FT   gene            27697..28467
FT                   /locus_tag="TBMG_00023"
FT                   /note="TBMG_00023.1"
FT   CDS_pept        27697..28467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00023"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00023"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23044"
FT                   /protein_id="ACT23044.1"
FT   gene            28464..29309
FT                   /locus_tag="TBMG_00024"
FT                   /note="TBMG_00024.1"
FT   CDS_pept        28464..29309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00024"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00024"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23045"
FT                   /protein_id="ACT23045.1"
FT                   "
FT   gene            29347..29709
FT                   /locus_tag="TBMG_00025"
FT                   /note="TBMG_00025.1"
FT   CDS_pept        29347..29709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23046"
FT                   /protein_id="ACT23046.1"
FT                   SAVLKRLRAQYTEPAR"
FT   gene            29824..31170
FT                   /locus_tag="TBMG_00026"
FT                   /note="TBMG_00026.1"
FT   CDS_pept        29824..31170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00026"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23047"
FT                   /protein_id="ACT23047.1"
FT   gene            31291..31608
FT                   /locus_tag="TBMG_00027"
FT                   /note="TBMG_00027.1"
FT   CDS_pept        31291..31608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00027"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23048"
FT                   /protein_id="ACT23048.1"
FT                   R"
FT   gene            31616..31921
FT                   /locus_tag="TBMG_00028"
FT                   /note="TBMG_00028.1"
FT   CDS_pept        31616..31921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00028"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23049"
FT                   /protein_id="ACT23049.1"
FT   gene            complement(31926..32069)
FT                   /locus_tag="TBMG_03973"
FT   CDS_pept        complement(31926..32069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03973"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03973"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23050"
FT                   /protein_id="ACT23050.1"
FT                   LI"
FT   gene            32159..33256
FT                   /locus_tag="TBMG_00029"
FT                   /note="TBMG_00029.1"
FT   CDS_pept        32159..33256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00029"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23051"
FT                   /protein_id="ACT23051.1"
FT   gene            33326..33901
FT                   /locus_tag="TBMG_00030"
FT                   /note="TBMG_00030.1"
FT   CDS_pept        33326..33901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00030"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23052"
FT                   /protein_id="ACT23052.1"
FT   gene            34409..36643
FT                   /locus_tag="TBMG_00031"
FT                   /note="TBMG_00031.1"
FT   CDS_pept        34409..36643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00031"
FT                   /product="8-amino-7-oxononanoate synthase bioF2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23053"
FT                   /protein_id="ACT23053.1"
FT   gene            36710..36973
FT                   /locus_tag="TBMG_00032"
FT                   /note="TBMG_00032.1"
FT   CDS_pept        36710..36973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00032"
FT                   /product="acyl carrier protein acpA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00032"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23054"
FT                   /protein_id="ACT23054.1"
FT   gene            36970..37365
FT                   /locus_tag="TBMG_00033"
FT                   /note="TBMG_00033.1"
FT   CDS_pept        36970..37365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00033"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00033"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23055"
FT                   /protein_id="ACT23055.1"
FT   gene            37362..39050
FT                   /locus_tag="TBMG_00034"
FT                   /note="TBMG_00034.1"
FT   CDS_pept        37362..39050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00034"
FT                   /product="fatty-acid-CoA ligase fadD34"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23056"
FT                   /protein_id="ACT23056.1"
FT   gene            complement(39159..39932)
FT                   /locus_tag="TBMG_00035"
FT                   /note="TBMG_00035.1"
FT   CDS_pept        complement(39159..39932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00035"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23057"
FT                   /protein_id="ACT23057.1"
FT   gene            complement(39980..41305)
FT                   /locus_tag="TBMG_00036"
FT                   /note="TBMG_00036.1"
FT   CDS_pept        complement(39980..41305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00036"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00036"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23058"
FT                   /protein_id="ACT23058.1"
FT   gene            41407..42015
FT                   /locus_tag="TBMG_00037"
FT                   /note="TBMG_00037.1"
FT   CDS_pept        41407..42015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23059"
FT                   /protein_id="ACT23059.1"
FT   gene            complement(42107..42454)
FT                   /locus_tag="TBMG_00038"
FT                   /note="TBMG_00038.1"
FT   CDS_pept        complement(42107..42454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00038"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00038"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23060"
FT                   /protein_id="ACT23060.1"
FT                   GSCAVCTQACH"
FT   gene            complement(42536..43468)
FT                   /locus_tag="TBMG_00039"
FT                   /note="TBMG_00039.1"
FT   CDS_pept        complement(42536..43468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00039"
FT                   /product="secreted proline rich protein mtc28"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23061"
FT                   /protein_id="ACT23061.1"
FT   gene            43665..46574
FT                   /locus_tag="TBMG_00040"
FT                   /note="TBMG_00040.1"
FT   CDS_pept        43665..46574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00040"
FT                   /product="leucyl-tRNA synthetase leuS"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23062"
FT                   /protein_id="ACT23062.1"
FT   gene            complement(46684..47310)
FT                   /locus_tag="TBMG_00041"
FT                   /note="TBMG_00041.1"
FT   CDS_pept        complement(46684..47310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00041"
FT                   /product="transcriptional regulator, marR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23063"
FT                   /protein_id="ACT23063.1"
FT   gene            complement(47469..48203)
FT                   /locus_tag="TBMG_00042"
FT                   /note="TBMG_00042.1"
FT   CDS_pept        complement(47469..48203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00042"
FT                   /product="transcriptional regulator, gntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00042"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23064"
FT                   /protein_id="ACT23064.1"
FT   gene            complement(48336..49130)
FT                   /locus_tag="TBMG_00043"
FT                   /note="TBMG_00043.1"
FT   CDS_pept        complement(48336..49130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00043"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00043"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23065"
FT                   /protein_id="ACT23065.1"
FT   gene            complement(49146..50042)
FT                   /locus_tag="TBMG_00044"
FT                   /note="TBMG_00044.1"
FT   CDS_pept        complement(49146..50042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00044"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00044"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23066"
FT                   /protein_id="ACT23066.1"
FT                   DQPRALIEIVRGVLDTR"
FT   gene            complement(50124..51227)
FT                   /locus_tag="TBMG_00045"
FT                   /note="TBMG_00045.1"
FT   CDS_pept        complement(50124..51227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00045"
FT                   /product="myo-inositol-1-phosphate synthase ino1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23067"
FT                   /protein_id="ACT23067.1"
FT   gene            complement(51288..51830)
FT                   /locus_tag="TBMG_00046"
FT                   /note="TBMG_00046.1"
FT   CDS_pept        complement(51288..51830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00046"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23068"
FT                   /protein_id="ACT23068.1"
FT                   NELIAAERAAPNPAEQT"
FT   gene            complement(51931..52800)
FT                   /locus_tag="TBMG_00047"
FT                   /note="TBMG_00047.1"
FT   CDS_pept        complement(51931..52800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00047"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00047"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23069"
FT                   /protein_id="ACT23069.1"
FT                   IKHVSYPS"
FT   gene            52913..53347
FT                   /locus_tag="TBMG_00048"
FT                   /note="TBMG_00048.1"
FT   CDS_pept        52913..53347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00048"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23070"
FT                   /protein_id="ACT23070.1"
FT   gene            53340..55802
FT                   /locus_tag="TBMG_00049"
FT                   /note="TBMG_00049.1"
FT   CDS_pept        53340..55802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00049"
FT                   /product="bifunctional penicillin-binding protein ponA1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23071"
FT                   /protein_id="ACT23071.1"
FT                   AATPTPPP"
FT   gene            55799..57481
FT                   /locus_tag="TBMG_00050"
FT                   /note="TBMG_00050.1"
FT   CDS_pept        55799..57481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00050"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23072"
FT                   /protein_id="ACT23072.1"
FT   gene            57438..58076
FT                   /locus_tag="TBMG_00051"
FT                   /note="TBMG_00051.1"
FT   CDS_pept        57438..58076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00051"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23073"
FT                   /protein_id="ACT23073.1"
FT   gene            58295..58585
FT                   /locus_tag="TBMG_00052"
FT                   /note="TBMG_00052.1"
FT   CDS_pept        58295..58585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00052"
FT                   /product="30S ribosomal protein S6 rpsF"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00052"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23074"
FT                   /protein_id="ACT23074.1"
FT   gene            58689..59183
FT                   /locus_tag="TBMG_00053"
FT                   /note="TBMG_00053.1"
FT   CDS_pept        58689..59183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00053"
FT                   /product="single-strand binding protein ssb"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00053"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23075"
FT                   /protein_id="ACT23075.1"
FT                   F"
FT   gene            59225..59479
FT                   /locus_tag="TBMG_00054"
FT                   /note="TBMG_00054.1"
FT   CDS_pept        59225..59479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00054"
FT                   /product="30S ribosomal protein S18 rpsR1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23076"
FT                   /protein_id="ACT23076.1"
FT   gene            59512..59970
FT                   /locus_tag="TBMG_00055"
FT                   /note="TBMG_00055.1"
FT   CDS_pept        59512..59970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00055"
FT                   /product="50S ribosomal protein L9 rplI"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23077"
FT                   /protein_id="ACT23077.1"
FT   gene            59999..60520
FT                   /locus_tag="TBMG_00056"
FT                   /note="TBMG_00056.1"
FT   CDS_pept        59999..60520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00056"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23078"
FT                   /protein_id="ACT23078.1"
FT                   GESPWRSLMT"
FT   gene            60499..63123
FT                   /locus_tag="TBMG_00057"
FT                   /note="TBMG_00057.1"
FT   CDS_pept        60499..63123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00057"
FT                   /product="replicative DNA helicase dnaB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23079"
FT                   /protein_id="ACT23079.1"
FT                   MAR"
FT   gene            63303..63995
FT                   /locus_tag="TBMG_00058"
FT                   /note="TBMG_00058.1"
FT   CDS_pept        63303..63995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23080"
FT                   /protein_id="ACT23080.1"
FT                   VIKPGMYY"
FT   gene            64012..65070
FT                   /locus_tag="TBMG_00059"
FT                   /note="TBMG_00059.1"
FT   CDS_pept        64012..65070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23081"
FT                   /protein_id="ACT23081.1"
FT                   IGVALDRILMTA"
FT   gene            complement(65115..65495)
FT                   /locus_tag="TBMG_00060"
FT                   /note="TBMG_00060.1"
FT   CDS_pept        complement(65115..65495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23082"
FT                   /protein_id="ACT23082.1"
FT   gene            65655..66797
FT                   /locus_tag="TBMG_00061"
FT                   /note="TBMG_00061.1"
FT   CDS_pept        65655..66797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00061"
FT                   /product="cellulase celA1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23083"
FT                   /protein_id="ACT23083.1"
FT   gene            67026..68465
FT                   /locus_tag="TBMG_00062"
FT                   /note="TBMG_00062.1"
FT   CDS_pept        67026..68465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00062"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00062"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23084"
FT                   /protein_id="ACT23084.1"
FT   gene            68521..68682
FT                   /locus_tag="TBMG_03974"
FT   CDS_pept        68521..68682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03974"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03974"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23085"
FT                   /protein_id="ACT23085.1"
FT                   PATSPLRR"
FT   gene            68723..71662
FT                   /locus_tag="TBMG_00063"
FT                   /note="TBMG_00063.1"
FT   CDS_pept        68723..71662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00063"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00063"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23086"
FT                   /protein_id="ACT23086.1"
FT   gene            71729..71968
FT                   /locus_tag="TBMG_00064"
FT                   /note="TBMG_00064.1"
FT   CDS_pept        71729..71968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00064"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23087"
FT                   /protein_id="ACT23087.1"
FT   gene            71961..72362
FT                   /locus_tag="TBMG_00065"
FT                   /note="TBMG_00065.1"
FT   CDS_pept        71961..72362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00065"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23088"
FT                   /protein_id="ACT23088.1"
FT   gene            complement(72414..74651)
FT                   /locus_tag="TBMG_00066"
FT                   /note="TBMG_00066.1"
FT   CDS_pept        complement(72414..74651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00066"
FT                   /product="isocitrate dehydrogenase [NADP] icd2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00066"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23089"
FT                   /protein_id="ACT23089.1"
FT   gene            complement(74769..75338)
FT                   /locus_tag="TBMG_00067"
FT                   /note="TBMG_00067.1"
FT   CDS_pept        complement(74769..75338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00067"
FT                   /product="transcriptional regulator, tetR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23090"
FT                   /protein_id="ACT23090.1"
FT   gene            75441..76352
FT                   /locus_tag="TBMG_00068"
FT                   /note="TBMG_00068.1"
FT   CDS_pept        75441..76352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00068"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23091"
FT                   /protein_id="ACT23091.1"
FT   gene            complement(76377..77762)
FT                   /locus_tag="TBMG_00069"
FT                   /note="TBMG_00069.1"
FT   CDS_pept        complement(76377..77762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00069"
FT                   /product="L-serine dehydratase sdaA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23092"
FT                   /protein_id="ACT23092.1"
FT                   VEC"
FT   gene            complement(77759..79036)
FT                   /locus_tag="TBMG_00070"
FT                   /note="TBMG_00070.1"
FT   CDS_pept        complement(77759..79036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00070"
FT                   /product="serine hydroxymethyltransferase 2 glyA2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23093"
FT                   /protein_id="ACT23093.1"
FT   gene            79626..80324
FT                   /locus_tag="TBMG_00071"
FT                   /note="TBMG_00071.1"
FT   CDS_pept        79626..80324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00071"
FT                   /product="maturase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23094"
FT                   /protein_id="ACT23094.1"
FT                   TIPTPWTQAV"
FT   gene            80755..81804
FT                   /locus_tag="TBMG_00072"
FT                   /note="TBMG_00072.1"
FT   CDS_pept        80755..81804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00072"
FT                   /product="glutamine-transport transmembrane protein ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00072"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23095"
FT                   /protein_id="ACT23095.1"
FT                   DPAQAFGGP"
FT   gene            81807..82799
FT                   /locus_tag="TBMG_00073"
FT                   /note="TBMG_00073.1"
FT   CDS_pept        81807..82799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00073"
FT                   /product="glutamine-transport ATP-binding protein ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23096"
FT                   /protein_id="ACT23096.1"
FT   gene            82879..84114
FT                   /locus_tag="TBMG_00074"
FT                   /note="TBMG_00074.1"
FT   CDS_pept        82879..84114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23097"
FT                   /protein_id="ACT23097.1"
FT                   LQASAVGYNTPS"
FT   gene            84127..85299
FT                   /locus_tag="TBMG_00075"
FT                   /note="TBMG_00075.1"
FT   CDS_pept        84127..85299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00075"
FT                   /product="aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23098"
FT                   /protein_id="ACT23098.1"
FT   gene            complement(85314..85703)
FT                   /locus_tag="TBMG_00076"
FT                   /note="TBMG_00076.1"
FT   CDS_pept        complement(85314..85703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00076"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00076"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23099"
FT                   /protein_id="ACT23099.1"
FT   gene            complement(85767..86621)
FT                   /locus_tag="TBMG_00077"
FT                   /note="TBMG_00077.1"
FT   CDS_pept        complement(85767..86621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00077"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00077"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23100"
FT                   /protein_id="ACT23100.1"
FT                   VRT"
FT   gene            86659..87264
FT                   /locus_tag="TBMG_00078"
FT                   /note="TBMG_00078.1"
FT   CDS_pept        86659..87264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00078"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00078"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23101"
FT                   /protein_id="ACT23101.1"
FT   gene            complement(87339..87932)
FT                   /locus_tag="TBMG_00079"
FT                   /note="TBMG_00079.1"
FT   CDS_pept        complement(87339..87932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00079"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23102"
FT                   /protein_id="ACT23102.1"
FT   gene            88335..89156
FT                   /locus_tag="TBMG_00080"
FT                   /note="TBMG_00080.1"
FT   CDS_pept        88335..89156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00080"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23103"
FT                   /protein_id="ACT23103.1"
FT   gene            89153..89611
FT                   /locus_tag="TBMG_00081"
FT                   /note="TBMG_00081.1"
FT   CDS_pept        89153..89611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00081"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23104"
FT                   /protein_id="ACT23104.1"
FT   gene            89706..90050
FT                   /locus_tag="TBMG_00082"
FT                   /note="TBMG_00082.1"
FT   CDS_pept        89706..90050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00082"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00082"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23105"
FT                   /protein_id="ACT23105.1"
FT                   EDLRAGGSAT"
FT   gene            90055..90534
FT                   /locus_tag="TBMG_00083"
FT                   /note="TBMG_00083.1"
FT   CDS_pept        90055..90534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00083"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00083"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23106"
FT                   /protein_id="ACT23106.1"
FT   gene            90531..92453
FT                   /locus_tag="TBMG_00084"
FT                   /note="TBMG_00084.1"
FT   CDS_pept        90531..92453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00084"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00084"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23107"
FT                   /protein_id="ACT23107.1"
FT                   LVVAR"
FT   gene            92459..93409
FT                   /locus_tag="TBMG_00085"
FT                   /note="TBMG_00085.1"
FT   CDS_pept        92459..93409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00085"
FT                   /product="formate hydrogenlyase hycD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23108"
FT                   /protein_id="ACT23108.1"
FT   gene            93420..94082
FT                   /locus_tag="TBMG_00086"
FT                   /note="TBMG_00086.1"
FT   CDS_pept        93420..94082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00086"
FT                   /product="hydrogenase hycP"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23109"
FT                   /protein_id="ACT23109.1"
FT   gene            94082..95548
FT                   /locus_tag="TBMG_00087"
FT                   /note="TBMG_00087.1"
FT   CDS_pept        94082..95548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00087"
FT                   /product="hydrogenase hycQ"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00087"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23110"
FT                   /protein_id="ACT23110.1"
FT   gene            95545..97023
FT                   /locus_tag="TBMG_00088"
FT                   /note="TBMG_00088.1"
FT   CDS_pept        95545..97023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00088"
FT                   /product="formate hydrogenase hycE"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23111"
FT                   /protein_id="ACT23111.1"
FT   gene            97058..97732
FT                   /locus_tag="TBMG_00089"
FT                   /note="TBMG_00089.1"
FT   CDS_pept        97058..97732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23112"
FT                   /protein_id="ACT23112.1"
FT                   RA"
FT   gene            97889..98482
FT                   /locus_tag="TBMG_00090"
FT                   /note="TBMG_00090.1"
FT   CDS_pept        97889..98482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00090"
FT                   /product="methyltransferase/methylase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23113"
FT                   /protein_id="ACT23113.1"
FT   gene            98611..99381
FT                   /locus_tag="TBMG_00091"
FT                   /note="TBMG_00091.1"
FT   CDS_pept        98611..99381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00091"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23114"
FT                   /protein_id="ACT23114.1"
FT   gene            99815..100582
FT                   /locus_tag="TBMG_00092"
FT                   /note="TBMG_00092.1"
FT   CDS_pept        99815..100582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00092"
FT                   /product="bifunctional nucleosidase mtn"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00092"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23115"
FT                   /protein_id="ACT23115.1"
FT   gene            100714..102999
FT                   /locus_tag="TBMG_00093"
FT                   /note="TBMG_00093.1"
FT   CDS_pept        100714..102999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00093"
FT                   /product="cation transporter P-type ATPase A ctpA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23116"
FT                   /protein_id="ACT23116.1"
FT                   QMTAPSSA"
FT   gene            complement(102946..103794)
FT                   /locus_tag="TBMG_00094"
FT                   /note="TBMG_00094.1"
FT   CDS_pept        complement(102946..103794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00094"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23117"
FT                   /protein_id="ACT23117.1"
FT                   A"
FT   gene            complement(103841..104800)
FT                   /locus_tag="TBMG_00095"
FT                   /note="TBMG_00095.1"
FT   CDS_pept        complement(103841..104800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23118"
FT                   /protein_id="ACT23118.1"
FT   gene            complement(104936..105346)
FT                   /locus_tag="TBMG_00096"
FT                   /note="TBMG_00096.1"
FT   CDS_pept        complement(104936..105346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00096"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00096"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23119"
FT                   /protein_id="ACT23119.1"
FT   gene            105455..106846
FT                   /locus_tag="TBMG_00097"
FT                   /note="TBMG_00097.1"
FT   CDS_pept        105455..106846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00097"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23120"
FT                   /protein_id="ACT23120.1"
FT                   TDAEQ"
FT   gene            106865..107734
FT                   /locus_tag="TBMG_00098"
FT                   /note="TBMG_00098.1"
FT   CDS_pept        106865..107734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00098"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00098"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23121"
FT                   /protein_id="ACT23121.1"
FT                   LKTPGYAA"
FT   gene            107731..108282
FT                   /locus_tag="TBMG_00099"
FT                   /note="TBMG_00099.1"
FT   CDS_pept        107731..108282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00099"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23122"
FT                   /protein_id="ACT23122.1"
FT   gene            108287..109909
FT                   /locus_tag="TBMG_00100"
FT                   /note="TBMG_00100.1"
FT   CDS_pept        108287..109909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00100"
FT                   /product="fatty-acid-CoA ligase fadD10"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23123"
FT                   /protein_id="ACT23123.1"
FT   gene            109914..110150
FT                   /locus_tag="TBMG_00101"
FT                   /note="TBMG_00101.1"
FT   CDS_pept        109914..110150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00101"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23124"
FT                   /protein_id="ACT23124.1"
FT   gene            110132..117670
FT                   /locus_tag="TBMG_00102"
FT                   /note="TBMG_00102.1"
FT   CDS_pept        110132..117670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00102"
FT                   /product="peptide synthetase nrp"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23125"
FT                   /protein_id="ACT23125.1"
FT   gene            117845..119830
FT                   /locus_tag="TBMG_00103"
FT                   /note="TBMG_00103.1"
FT   CDS_pept        117845..119830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00103"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00103"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23126"
FT                   /protein_id="ACT23126.1"
FT   gene            complement(120046..122304)
FT                   /locus_tag="TBMG_00104"
FT                   /note="TBMG_00104.1"
FT   CDS_pept        complement(120046..122304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00104"
FT                   /product="cation-transporter P-type ATPase B ctpB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23127"
FT                   /protein_id="ACT23127.1"
FT   gene            122448..123962
FT                   /locus_tag="TBMG_00105"
FT                   /note="TBMG_00105.1"
FT   CDS_pept        122448..123962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23128"
FT                   /protein_id="ACT23128.1"
FT   gene            complement(124111..124395)
FT                   /locus_tag="TBMG_00106"
FT                   /note="TBMG_00106.1"
FT   CDS_pept        complement(124111..124395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00106"
FT                   /product="50S ribosomal protein rpmB1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23129"
FT                   /protein_id="ACT23129.1"
FT   gene            124505..125701
FT                   /locus_tag="TBMG_00107"
FT                   /note="TBMG_00107.1"
FT   CDS_pept        124505..125701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00107"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23130"
FT                   /protein_id="ACT23130.1"
FT   gene            complement(125796..130673)
FT                   /locus_tag="TBMG_00108"
FT                   /note="TBMG_00108.1"
FT   CDS_pept        complement(125796..130673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00108"
FT                   /product="cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23131"
FT                   /protein_id="ACT23131.1"
FT   gene            complement(131027..131260)
FT                   /locus_tag="TBMG_00109"
FT                   /note="TBMG_00109.1"
FT   CDS_pept        complement(131027..131260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23132"
FT                   /protein_id="ACT23132.1"
FT   gene            131404..133005
FT                   /locus_tag="TBMG_00110"
FT                   /note="TBMG_00110.1"
FT   CDS_pept        131404..133005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00110"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23133"
FT                   /protein_id="ACT23133.1"
FT                   GSGGTIFGFAGTPGPS"
FT   gene            133048..133902
FT                   /locus_tag="TBMG_00111"
FT                   /note="TBMG_00111.1"
FT   CDS_pept        133048..133902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00111"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23134"
FT                   /protein_id="ACT23134.1"
FT                   NLS"
FT   gene            134083..136140
FT                   /locus_tag="TBMG_00112"
FT                   /note="TBMG_00112.1"
FT   CDS_pept        134083..136140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00112"
FT                   /product="transmembrane acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23135"
FT                   /protein_id="ACT23135.1"
FT   gene            136422..137378
FT                   /locus_tag="TBMG_00113"
FT                   /note="TBMG_00113.1"
FT   CDS_pept        136422..137378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00113"
FT                   /product="GDP-mannose 4,6-dehydratase gca"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23136"
FT                   /protein_id="ACT23136.1"
FT   gene            137452..138042
FT                   /locus_tag="TBMG_00114"
FT                   /note="TBMG_00114.1"
FT   CDS_pept        137452..138042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00114"
FT                   /product="sedoheptulose-7-phosphate isomerase gmhA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00114"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23137"
FT                   /protein_id="ACT23137.1"
FT   gene            138074..138646
FT                   /locus_tag="TBMG_00115"
FT                   /note="TBMG_00115.1"
FT   CDS_pept        138074..138646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00115"
FT                   /product="D-alpha,beta-D-heptose-1,7-biphosphate
FT                   phosphatase gmhB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23138"
FT                   /protein_id="ACT23138.1"
FT   gene            138646..139806
FT                   /locus_tag="TBMG_00116"
FT                   /note="TBMG_00116.1"
FT   CDS_pept        138646..139806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00116"
FT                   /product="D-alpha-D-heptose-7-phosphate kinase hddA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23139"
FT                   /protein_id="ACT23139.1"
FT   gene            complement(140400..141155)
FT                   /locus_tag="TBMG_00117"
FT                   /note="TBMG_00117.1"
FT   CDS_pept        complement(140400..141155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00117"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00117"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23140"
FT                   /protein_id="ACT23140.1"
FT   gene            141327..142277
FT                   /locus_tag="TBMG_00118"
FT                   /note="TBMG_00118.1"
FT   CDS_pept        141327..142277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00118"
FT                   /product="oxidative stress response regulatory protein
FT                   oxyS"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23141"
FT                   /protein_id="ACT23141.1"
FT   gene            complement(142261..144018)
FT                   /locus_tag="TBMG_00119"
FT                   /note="TBMG_00119.1"
FT   CDS_pept        complement(142261..144018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00119"
FT                   /product="oxalyl-CoA decarboxylase oxcA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23142"
FT                   /protein_id="ACT23142.1"
FT                   ATPAISGDG"
FT   gene            144131..145759
FT                   /locus_tag="TBMG_00120"
FT                   /note="TBMG_00120.1"
FT   CDS_pept        144131..145759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00120"
FT                   /product="fatty-acid-CoA ligase fadD7"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23143"
FT                   /protein_id="ACT23143.1"
FT   gene            complement(145760..147904)
FT                   /locus_tag="TBMG_00121"
FT                   /note="TBMG_00121.1"
FT   CDS_pept        complement(145760..147904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00121"
FT                   /product="elongation factor G fusA2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23144"
FT                   /protein_id="ACT23144.1"
FT   gene            complement(148041..148475)
FT                   /locus_tag="TBMG_00122"
FT                   /note="TBMG_00122.1"
FT   CDS_pept        complement(148041..148475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00122"
FT                   /product="F420-dependent enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00122"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23145"
FT                   /protein_id="ACT23145.1"
FT   gene            148624..148992
FT                   /locus_tag="TBMG_00123"
FT                   /note="TBMG_00123.1"
FT   CDS_pept        148624..148992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00123"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23146"
FT                   /protein_id="ACT23146.1"
FT                   ADDGDLIITHAMPKEWKR"
FT   gene            148989..149357
FT                   /locus_tag="TBMG_00124"
FT                   /note="TBMG_00124.1"
FT   CDS_pept        148989..149357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00124"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23147"
FT                   /protein_id="ACT23147.1"
FT                   PVLDEFVQRETGRILPRR"
FT   gene            149624..150769
FT                   /locus_tag="TBMG_03975"
FT                   /note="TBMG_00125.1"
FT   CDS_pept        149624..150769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03975"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03975"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23148"
FT                   /protein_id="ACT23148.1"
FT   gene            150714..151310
FT                   /locus_tag="TBMG_03976"
FT                   /note="TBMG_00125.1"
FT   CDS_pept        150714..151310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03976"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03976"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23149"
FT                   /protein_id="ACT23149.1"
FT   gene            151501..152529
FT                   /locus_tag="TBMG_00126"
FT                   /note="TBMG_00126.1"
FT   CDS_pept        151501..152529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00126"
FT                   /product="serine protease pepA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00126"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23150"
FT                   /protein_id="ACT23150.1"
FT                   PA"
FT   gene            152638..154443
FT                   /locus_tag="TBMG_00127"
FT                   /note="TBMG_00127.1"
FT   CDS_pept        152638..154443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00127"
FT                   /product="trehalose synthase treS"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23151"
FT                   /protein_id="ACT23151.1"
FT   gene            154493..155860
FT                   /locus_tag="TBMG_00128"
FT                   /note="TBMG_00128.1"
FT   CDS_pept        154493..155860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23152"
FT                   /db_xref="GOA:C6DQZ2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR040999"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DQZ2"
FT                   /protein_id="ACT23152.1"
FT   gene            155928..156707
FT                   /locus_tag="TBMG_00129"
FT                   /note="TBMG_00129.1"
FT   CDS_pept        155928..156707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00129"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23153"
FT                   /protein_id="ACT23153.1"
FT   gene            complement(156839..157861)
FT                   /locus_tag="TBMG_00130"
FT                   /note="TBMG_00130.1"
FT   CDS_pept        complement(156839..157861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00130"
FT                   /product="secreted fibronectin-binding protein C antigen
FT                   85-C fbpC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23154"
FT                   /protein_id="ACT23154.1"
FT                   "
FT   gene            158108..158563
FT                   /locus_tag="TBMG_00131"
FT                   /note="TBMG_00131.1"
FT   CDS_pept        158108..158563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00131"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23155"
FT                   /protein_id="ACT23155.1"
FT   gene            complement(158576..159919)
FT                   /locus_tag="TBMG_00132"
FT                   /note="TBMG_00132.1"
FT   CDS_pept        complement(158576..159919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00132"
FT                   /product="acyl-CoA dehydrogenase fadE1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00132"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23156"
FT                   /protein_id="ACT23156.1"
FT   gene            complement(159961..161043)
FT                   /locus_tag="TBMG_00133"
FT                   /note="TBMG_00133.1"
FT   CDS_pept        complement(159961..161043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00133"
FT                   /product="F420-dependent glucose-6-phosphate dehydrogenase
FT                   fgd2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23157"
FT                   /protein_id="ACT23157.1"
FT   gene            161130..161735
FT                   /locus_tag="TBMG_00134"
FT                   /note="TBMG_00134.1"
FT   CDS_pept        161130..161735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00134"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23158"
FT                   /protein_id="ACT23158.1"
FT   gene            162032..162934
FT                   /locus_tag="TBMG_00135"
FT                   /note="TBMG_00135.1"
FT   CDS_pept        162032..162934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00135"
FT                   /product="epoxide hydrolase ephF"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23159"
FT                   /protein_id="ACT23159.1"
FT   gene            complement(162905..163510)
FT                   /locus_tag="TBMG_00136"
FT                   /note="TBMG_00136.1"
FT   CDS_pept        complement(162905..163510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00136"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23160"
FT                   /protein_id="ACT23160.1"
FT   gene            163627..164952
FT                   /locus_tag="TBMG_00137"
FT                   /note="TBMG_00137.1"
FT   CDS_pept        163627..164952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00137"
FT                   /product="cytochrome P450 138 cyp138"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00137"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23161"
FT                   /protein_id="ACT23161.1"
FT   gene            complement(164973..165521)
FT                   /locus_tag="TBMG_00138"
FT                   /note="TBMG_00138.1"
FT   CDS_pept        complement(164973..165521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00138"
FT                   /product="peptide methionine sulfoxide reductase msrA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00138"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23162"
FT                   /protein_id="ACT23162.1"
FT   gene            165584..166087
FT                   /locus_tag="TBMG_00139"
FT                   /note="TBMG_00139.1"
FT   CDS_pept        165584..166087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00139"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00139"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23163"
FT                   /protein_id="ACT23163.1"
FT                   HGGP"
FT   gene            166088..167110
FT                   /locus_tag="TBMG_00140"
FT                   /note="TBMG_00140.1"
FT   CDS_pept        166088..167110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00140"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23164"
FT                   /protein_id="ACT23164.1"
FT                   "
FT   gene            167171..167551
FT                   /locus_tag="TBMG_00141"
FT                   /note="TBMG_00141.1"
FT   CDS_pept        167171..167551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00141"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23165"
FT                   /protein_id="ACT23165.1"
FT   gene            complement(167532..167942)
FT                   /locus_tag="TBMG_00142"
FT                   /note="TBMG_00142.1"
FT   CDS_pept        complement(167532..167942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23166"
FT                   /protein_id="ACT23166.1"
FT   gene            167972..168898
FT                   /locus_tag="TBMG_00143"
FT                   /note="TBMG_00143.1"
FT   CDS_pept        167972..168898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00143"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23167"
FT                   /protein_id="ACT23167.1"
FT   gene            complement(168965..170443)
FT                   /locus_tag="TBMG_00144"
FT                   /note="TBMG_00144.1"
FT   CDS_pept        complement(168965..170443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00144"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23168"
FT                   /protein_id="ACT23168.1"
FT   gene            170545..171387
FT                   /locus_tag="TBMG_00145"
FT                   /note="TBMG_00145.1"
FT   CDS_pept        170545..171387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00145"
FT                   /product="transcriptional regulator, tetR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23169"
FT                   /protein_id="ACT23169.1"
FT   gene            171476..171733
FT                   /locus_tag="TBMG_00146"
FT                   /note="TBMG_00146.1"
FT   CDS_pept        171476..171733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00146"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23170"
FT                   /protein_id="ACT23170.1"
FT   gene            171742..172107
FT                   /locus_tag="TBMG_03977"
FT   CDS_pept        171742..172107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03977"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03977"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23171"
FT                   /protein_id="ACT23171.1"
FT                   VRTTLLRGRLVTPAQPA"
FT   gene            172141..173082
FT                   /locus_tag="TBMG_00147"
FT                   /note="TBMG_00147.1"
FT   CDS_pept        172141..173082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23172"
FT                   /protein_id="ACT23172.1"
FT   gene            173177..174697
FT                   /locus_tag="TBMG_00148"
FT                   /note="TBMG_00148.1"
FT   CDS_pept        173177..174697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00148"
FT                   /product="aldehyde dehydrogenase NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00148"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23173"
FT                   /protein_id="ACT23173.1"
FT   gene            174772..175632
FT                   /locus_tag="TBMG_00149"
FT                   /note="TBMG_00149.1"
FT   CDS_pept        174772..175632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00149"
FT                   /product="short-chain type dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00149"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23174"
FT                   /protein_id="ACT23174.1"
FT                   AGFKL"
FT   gene            175639..176607
FT                   /locus_tag="TBMG_00150"
FT                   /note="TBMG_00150.1"
FT   CDS_pept        175639..176607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00150"
FT                   /product="quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23175"
FT                   /protein_id="ACT23175.1"
FT   gene            complement(176604..176891)
FT                   /locus_tag="TBMG_00151"
FT                   /note="TBMG_00151.1"
FT   CDS_pept        complement(176604..176891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23176"
FT                   /protein_id="ACT23176.1"
FT   gene            complement(177482..179248)
FT                   /locus_tag="TBMG_00152"
FT                   /note="TBMG_00152.1"
FT   CDS_pept        complement(177482..179248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00152"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00152"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23177"
FT                   /protein_id="ACT23177.1"
FT                   ADITQQLQSFSI"
FT   gene            complement(179258..180859)
FT                   /locus_tag="TBMG_00153"
FT                   /note="TBMG_00153.1"
FT   CDS_pept        complement(179258..180859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00153"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00153"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23178"
FT                   /protein_id="ACT23178.1"
FT                   SRRHRRPPTTVYRPRQ"
FT   gene            complement(181094..181924)
FT                   /locus_tag="TBMG_00154"
FT                   /note="TBMG_00154.1"
FT   CDS_pept        complement(181094..181924)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00154"
FT                   /product="phosphotyrosine protein phosphatase ptpb"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00154"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23179"
FT                   /protein_id="ACT23179.1"
FT   gene            complement(181926..183149)
FT                   /locus_tag="TBMG_00155"
FT                   /note="TBMG_00155.1"
FT   CDS_pept        complement(181926..183149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00155"
FT                   /product="acyl-CoA dehydrogenase fadE2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23180"
FT                   /protein_id="ACT23180.1"
FT                   STFAAAVT"
FT   gene            183354..183500
FT                   /locus_tag="TBMG_03978"
FT   CDS_pept        183354..183500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03978"
FT                   /product="response regulator receiver domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03978"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23181"
FT                   /protein_id="ACT23181.1"
FT                   PLW"
FT   gene            183561..184661
FT                   /locus_tag="TBMG_00156"
FT                   /note="TBMG_00156.1"
FT   CDS_pept        183561..184661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00156"
FT                   /product="NAD(P) transhydrogenase alpha subunit pntAa"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23182"
FT                   /protein_id="ACT23182.1"
FT   gene            184662..184994
FT                   /locus_tag="TBMG_00157"
FT                   /note="TBMG_00157.1"
FT   CDS_pept        184662..184994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00157"
FT                   /product="NAD(P) transhydrogenase alpha subunit pntAb"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00157"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23183"
FT                   /protein_id="ACT23183.1"
FT                   RDEALR"
FT   gene            184991..186418
FT                   /locus_tag="TBMG_00158"
FT                   /note="TBMG_00158.1"
FT   CDS_pept        184991..186418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00158"
FT                   /product="NAD(P) transhydrogenase beta subunit pntB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23184"
FT                   /protein_id="ACT23184.1"
FT                   GDAKKSVTEVSEELKAL"
FT   gene            complement(186434..186559)
FT                   /locus_tag="TBMG_03979"
FT   CDS_pept        complement(186434..186559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03979"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03979"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23185"
FT                   /protein_id="ACT23185.1"
FT   gene            186724..187368
FT                   /locus_tag="TBMG_00159"
FT                   /note="TBMG_00159.1"
FT   CDS_pept        186724..187368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00159"
FT                   /product="transcriptional regulator, tetR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00159"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23186"
FT                   /protein_id="ACT23186.1"
FT   gene            complement(187372..188778)
FT                   /locus_tag="TBMG_00160"
FT                   /note="TBMG_00160.1"
FT   CDS_pept        complement(187372..188778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00160"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23187"
FT                   /protein_id="ACT23187.1"
FT                   SVARLIPPIA"
FT   gene            complement(188870..190378)
FT                   /locus_tag="TBMG_00161"
FT                   /note="TBMG_00161.1"
FT   CDS_pept        complement(188870..190378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00161"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23188"
FT                   /protein_id="ACT23188.1"
FT   gene            190546..191895
FT                   /locus_tag="TBMG_00162"
FT                   /note="TBMG_00162.1"
FT   CDS_pept        190546..191895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00162"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23189"
FT                   /protein_id="ACT23189.1"
FT   gene            complement(191923..193074)
FT                   /locus_tag="TBMG_00163"
FT                   /note="TBMG_00163.1"
FT   CDS_pept        complement(191923..193074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00163"
FT                   /product="zinc-type alcohol dehydrogenase E subunit adhE"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23191"
FT                   /protein_id="ACT23191.1"
FT   gene            193056..193511
FT                   /locus_tag="TBMG_00164"
FT                   /note="TBMG_00164.1"
FT   CDS_pept        193056..193511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00164"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00164"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23190"
FT                   /protein_id="ACT23190.1"
FT   gene            193565..194050
FT                   /locus_tag="TBMG_00165"
FT                   /note="TBMG_00165.1"
FT   CDS_pept        193565..194050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00165"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23192"
FT                   /protein_id="ACT23192.1"
FT   gene            complement(194083..194877)
FT                   /locus_tag="TBMG_00166"
FT                   /note="TBMG_00166.1"
FT   CDS_pept        complement(194083..194877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00166"
FT                   /product="transcriptional regulator, gntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00166"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23193"
FT                   /protein_id="ACT23193.1"
FT   gene            194932..196596
FT                   /locus_tag="TBMG_00167"
FT                   /note="TBMG_00167.1"
FT   CDS_pept        194932..196596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00167"
FT                   /product="fatty-acid-CoA ligase fadD5"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00167"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23194"
FT                   /protein_id="ACT23194.1"
FT   gene            196800..197597
FT                   /locus_tag="TBMG_00168"
FT                   /note="TBMG_00168.1"
FT   CDS_pept        196800..197597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00168"
FT                   /product="hypothetical membrane protein yrbE1A"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23195"
FT                   /protein_id="ACT23195.1"
FT   gene            197599..198468
FT                   /locus_tag="TBMG_00169"
FT                   /note="TBMG_00169.1"
FT   CDS_pept        197599..198468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00169"
FT                   /product="hypothetical membrane protein yrbE1B"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23196"
FT                   /protein_id="ACT23196.1"
FT                   DPNFNLTV"
FT   gene            198473..199837
FT                   /locus_tag="TBMG_00170"
FT                   /note="TBMG_00170.1"
FT   CDS_pept        198473..199837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00170"
FT                   /product="MCE-family protein mce1A"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23197"
FT                   /protein_id="ACT23197.1"
FT   gene            199834..200874
FT                   /locus_tag="TBMG_00171"
FT                   /note="TBMG_00171.1"
FT   CDS_pept        199834..200874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00171"
FT                   /product="MCE-family protein mce1B"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23198"
FT                   /protein_id="ACT23198.1"
FT                   GRCTPQ"
FT   gene            200913..202418
FT                   /locus_tag="TBMG_00172"
FT                   /note="TBMG_00172.1"
FT   CDS_pept        200913..202418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00172"
FT                   /product="MCE-family protein mce1C"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23199"
FT                   /protein_id="ACT23199.1"
FT   gene            202415..204007
FT                   /locus_tag="TBMG_00173"
FT                   /note="TBMG_00173.1"
FT   CDS_pept        202415..204007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00173"
FT                   /product="MCE-family protein mce1D"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23200"
FT                   /protein_id="ACT23200.1"
FT                   VGAPLPAEAGGGQ"
FT   gene            204007..205176
FT                   /locus_tag="TBMG_00174"
FT                   /note="TBMG_00174.1"
FT   CDS_pept        204007..205176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00174"
FT                   /product="MCE-family lipoprotein mce1E"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23201"
FT                   /protein_id="ACT23201.1"
FT   gene            205170..206717
FT                   /locus_tag="TBMG_00175"
FT                   /note="TBMG_00175.1"
FT   CDS_pept        205170..206717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00175"
FT                   /product="MCE-family protein mce1F"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23202"
FT                   /protein_id="ACT23202.1"
FT   gene            206753..207394
FT                   /locus_tag="TBMG_00176"
FT                   /note="TBMG_00176.1"
FT   CDS_pept        206753..207394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00176"
FT                   /product="MCE-associated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00176"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23203"
FT                   /protein_id="ACT23203.1"
FT   gene            207397..208359
FT                   /locus_tag="TBMG_00177"
FT                   /note="TBMG_00177.1"
FT   CDS_pept        207397..208359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00177"
FT                   /product="MCE-associated transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23204"
FT                   /protein_id="ACT23204.1"
FT   gene            208356..208910
FT                   /locus_tag="TBMG_00178"
FT                   /note="TBMG_00178.1"
FT   CDS_pept        208356..208910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00178"
FT                   /product="MCE-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23205"
FT                   /protein_id="ACT23205.1"
FT   gene            208877..209611
FT                   /locus_tag="TBMG_00179"
FT                   /note="TBMG_00179.1"
FT   CDS_pept        208877..209611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00179"
FT                   /product="MCE-associated membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00179"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23206"
FT                   /protein_id="ACT23206.1"
FT   gene            complement(209642..210751)
FT                   /locus_tag="TBMG_00180"
FT                   /note="TBMG_00180.1"
FT   CDS_pept        complement(209642..210751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00180"
FT                   /product="lipoprotein lprO"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23207"
FT                   /protein_id="ACT23207.1"
FT   gene            complement(210831..212189)
FT                   /locus_tag="TBMG_00181"
FT                   /note="TBMG_00181.1"
FT   CDS_pept        complement(210831..212189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00181"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23208"
FT                   /protein_id="ACT23208.1"
FT   gene            complement(212216..212950)
FT                   /locus_tag="TBMG_00182"
FT                   /note="TBMG_00182.1"
FT   CDS_pept        complement(212216..212950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00182"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23209"
FT                   /protein_id="ACT23209.1"
FT   gene            complement(212967..214079)
FT                   /locus_tag="TBMG_00183"
FT                   /note="TBMG_00183.1"
FT   CDS_pept        complement(212967..214079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00183"
FT                   /product="alternative RNA polymerase sigma factor sigG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23211"
FT                   /protein_id="ACT23211.1"
FT   gene            214027..214866
FT                   /locus_tag="TBMG_00184"
FT                   /note="TBMG_00184.1"
FT   CDS_pept        214027..214866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00184"
FT                   /product="lysophospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23210"
FT                   /protein_id="ACT23210.1"
FT   gene            214908..215657
FT                   /locus_tag="TBMG_00185"
FT                   /note="TBMG_00185.1"
FT   CDS_pept        214908..215657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23212"
FT                   /protein_id="ACT23212.1"
FT   gene            215654..216163
FT                   /locus_tag="TBMG_00186"
FT                   /note="TBMG_00186.1"
FT   CDS_pept        215654..216163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23213"
FT                   /protein_id="ACT23213.1"
FT                   AQEGVR"
FT   gene            216208..218283
FT                   /locus_tag="TBMG_00187"
FT                   /note="TBMG_00187.1"
FT   CDS_pept        216208..218283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00187"
FT                   /product="beta-glucosidase bglS"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00187"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23214"
FT                   /protein_id="ACT23214.1"
FT   gene            218644..219306
FT                   /locus_tag="TBMG_00188"
FT                   /note="TBMG_00188.1"
FT   CDS_pept        218644..219306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00188"
FT                   /product="O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00188"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23215"
FT                   /protein_id="ACT23215.1"
FT   gene            219425..219856
FT                   /locus_tag="TBMG_00189"
FT                   /note="TBMG_00189.1"
FT   CDS_pept        219425..219856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00189"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23216"
FT                   /protein_id="ACT23216.1"
FT   gene            complement(219935..221662)
FT                   /locus_tag="TBMG_00190"
FT                   /note="TBMG_00190.1"
FT   CDS_pept        complement(219935..221662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00190"
FT                   /product="dihydroxy-acid dehydratase ilvD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23217"
FT                   /protein_id="ACT23217.1"
FT   gene            221810..222100
FT                   /locus_tag="TBMG_00191"
FT                   /note="TBMG_00191.1"
FT   CDS_pept        221810..222100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00191"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23218"
FT                   /protein_id="ACT23218.1"
FT   gene            222228..223469
FT                   /locus_tag="TBMG_00192"
FT                   /note="TBMG_00192.1"
FT   CDS_pept        222228..223469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00192"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23219"
FT                   /protein_id="ACT23219.1"
FT                   QHLFENPTLSPGDG"
FT   gene            223503..224603
FT                   /locus_tag="TBMG_00193"
FT                   /note="TBMG_00193.1"
FT   CDS_pept        223503..224603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00193"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00193"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23220"
FT                   /protein_id="ACT23220.1"
FT   gene            complement(224663..226510)
FT                   /locus_tag="TBMG_00194"
FT                   /note="TBMG_00194.1"
FT   CDS_pept        complement(224663..226510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00194"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23221"
FT                   /protein_id="ACT23221.1"
FT   gene            226817..230401
FT                   /locus_tag="TBMG_00195"
FT                   /note="TBMG_00195.1"
FT   CDS_pept        226817..230401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00195"
FT                   /product="drugs-transport transmembrane ATP-binding protein
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23222"
FT                   /protein_id="ACT23222.1"
FT   gene            230775..231473
FT                   /locus_tag="TBMG_00196"
FT                   /note="TBMG_00196.1"
FT   CDS_pept        230775..231473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00196"
FT                   /product="two component system transcriptional regulator,
FT                   luxR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00196"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23223"
FT                   /protein_id="ACT23223.1"
FT                   VAHALRAGLI"
FT   gene            231586..232170
FT                   /locus_tag="TBMG_00197"
FT                   /note="TBMG_00197.1"
FT   CDS_pept        231586..232170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00197"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23224"
FT                   /protein_id="ACT23224.1"
FT   gene            232167..234416
FT                   /locus_tag="TBMG_00198"
FT                   /note="TBMG_00198.1"
FT   CDS_pept        232167..234416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00198"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23225"
FT                   /protein_id="ACT23225.1"
FT   gene            complement(234457..236448)
FT                   /locus_tag="TBMG_00199"
FT                   /note="TBMG_00199.1"
FT   CDS_pept        complement(234457..236448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00199"
FT                   /product="zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00199"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23226"
FT                   /protein_id="ACT23226.1"
FT   gene            236491..237150
FT                   /locus_tag="TBMG_00200"
FT                   /note="TBMG_00200.1"
FT   CDS_pept        236491..237150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00200"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23227"
FT                   /protein_id="ACT23227.1"
FT   gene            237147..237836
FT                   /locus_tag="TBMG_00201"
FT                   /note="TBMG_00201.1"
FT   CDS_pept        237147..237836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00201"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23228"
FT                   /protein_id="ACT23228.1"
FT                   VTPINAR"
FT   gene            complement(237833..238330)
FT                   /locus_tag="TBMG_00202"
FT                   /note="TBMG_00202.1"
FT   CDS_pept        complement(237833..238330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00202"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00202"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23229"
FT                   /protein_id="ACT23229.1"
FT                   DS"
FT   gene            complement(238333..241233)
FT                   /locus_tag="TBMG_00203"
FT                   /note="TBMG_00203.1"
FT   CDS_pept        complement(238333..241233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00203"
FT                   /product="transmembrane transporter mmpL11"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00203"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23230"
FT                   /protein_id="ACT23230.1"
FT   gene            241455..241865
FT                   /locus_tag="TBMG_00204"
FT                   /note="TBMG_00204.1"
FT   CDS_pept        241455..241865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00204"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23231"
FT                   /protein_id="ACT23231.1"
FT   gene            complement(241917..243200)
FT                   /locus_tag="TBMG_00205"
FT                   /note="TBMG_00205.1"
FT   CDS_pept        complement(241917..243200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00205"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23232"
FT                   /protein_id="ACT23232.1"
FT   gene            243325..244428
FT                   /locus_tag="TBMG_00206"
FT                   /note="TBMG_00206.1"
FT   CDS_pept        243325..244428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00206"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00206"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23233"
FT                   /protein_id="ACT23233.1"
FT   gene            complement(244425..247259)
FT                   /locus_tag="TBMG_00207"
FT                   /note="TBMG_00207.1"
FT   CDS_pept        complement(244425..247259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00207"
FT                   /product="transmembrane transporter mmpL3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23234"
FT                   /protein_id="ACT23234.1"
FT                   ALSAQDLLRREGRL"
FT   gene            complement(247325..248059)
FT                   /locus_tag="TBMG_00208"
FT                   /note="TBMG_00208.1"
FT   CDS_pept        complement(247325..248059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00208"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23235"
FT                   /protein_id="ACT23235.1"
FT   gene            complement(248056..248847)
FT                   /locus_tag="TBMG_00209"
FT                   /note="TBMG_00209.1"
FT   CDS_pept        complement(248056..248847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00209"
FT                   /product="methlytransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00209"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23236"
FT                   /protein_id="ACT23236.1"
FT   gene            248979..250064
FT                   /locus_tag="TBMG_00210"
FT                   /note="TBMG_00210.1"
FT   CDS_pept        248979..250064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23237"
FT                   /protein_id="ACT23237.1"
FT   gene            250061..251539
FT                   /locus_tag="TBMG_00211"
FT                   /note="TBMG_00211.1"
FT   CDS_pept        250061..251539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23238"
FT                   /protein_id="ACT23238.1"
FT   gene            251723..253543
FT                   /locus_tag="TBMG_00212"
FT                   /note="TBMG_00212.1"
FT   CDS_pept        251723..253543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00212"
FT                   /product="iron-regulated phosphoenolpyruvate carboxykinase
FT                   pckA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23239"
FT                   /protein_id="ACT23239.1"
FT   gene            complement(253610..254581)
FT                   /locus_tag="TBMG_00213"
FT                   /note="TBMG_00213.1"
FT   CDS_pept        complement(253610..254581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00213"
FT                   /product="asnC-family transcriptional regulator nadR"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00213"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23240"
FT                   /protein_id="ACT23240.1"
FT   gene            complement(254578..255909)
FT                   /locus_tag="TBMG_00214"
FT                   /note="TBMG_00214.1"
FT   CDS_pept        complement(254578..255909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00214"
FT                   /product="methyltransferase/methylase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23241"
FT                   /protein_id="ACT23241.1"
FT   gene            256005..257618
FT                   /locus_tag="TBMG_00215"
FT                   /note="TBMG_00215.1"
FT   CDS_pept        256005..257618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00215"
FT                   /product="fatty-acid-CoA ligase fadD4"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23242"
FT                   /protein_id="ACT23242.1"
FT   gene            complement(257724..258845)
FT                   /locus_tag="TBMG_00216"
FT                   /note="TBMG_00216.1"
FT   CDS_pept        complement(257724..258845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00216"
FT                   /product="acyl-CoA dehydrogenase fadE3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00216"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23243"
FT                   /protein_id="ACT23243.1"
FT   gene            258854..259867
FT                   /locus_tag="TBMG_00217"
FT                   /note="TBMG_00217.1"
FT   CDS_pept        258854..259867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00217"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00217"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23244"
FT                   /protein_id="ACT23244.1"
FT   gene            complement(259864..260772)
FT                   /locus_tag="TBMG_00218"
FT                   /note="TBMG_00218.1"
FT   CDS_pept        complement(259864..260772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00218"
FT                   /product="esterase lipW"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00218"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23245"
FT                   /protein_id="ACT23245.1"
FT   gene            260865..262193
FT                   /locus_tag="TBMG_00219"
FT                   /note="TBMG_00219.1"
FT   CDS_pept        260865..262193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00219"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00219"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23246"
FT                   /protein_id="ACT23246.1"
FT   gene            262195..262743
FT                   /locus_tag="TBMG_00220"
FT                   /note="TBMG_00220.1"
FT   CDS_pept        262195..262743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00220"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23247"
FT                   /protein_id="ACT23247.1"
FT   gene            262753..263964
FT                   /locus_tag="TBMG_00221"
FT                   /note="TBMG_00221.1"
FT   CDS_pept        262753..263964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00221"
FT                   /product="esterase lipC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23248"
FT                   /protein_id="ACT23248.1"
FT                   KEVI"
FT   gene            264008..265417
FT                   /locus_tag="TBMG_00222"
FT                   /note="TBMG_00222.1"
FT   CDS_pept        264008..265417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00222"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00222"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23249"
FT                   /protein_id="ACT23249.1"
FT                   LTVVESAMAQA"
FT   gene            265448..266236
FT                   /locus_tag="TBMG_00223"
FT                   /note="TBMG_00223.1"
FT   CDS_pept        265448..266236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00223"
FT                   /product="enoyl-CoA hydratase echA1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23250"
FT                   /protein_id="ACT23250.1"
FT   gene            complement(266242..267705)
FT                   /locus_tag="TBMG_00224"
FT                   /note="TBMG_00224.1"
FT   CDS_pept        complement(266242..267705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00224"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23251"
FT                   /protein_id="ACT23251.1"
FT   gene            complement(267804..268568)
FT                   /locus_tag="TBMG_00225"
FT                   /note="TBMG_00225.1"
FT   CDS_pept        complement(267804..268568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00225"
FT                   /product="methyltransferase/methylase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23252"
FT                   /protein_id="ACT23252.1"
FT   gene            268604..269758
FT                   /locus_tag="TBMG_00226"
FT                   /note="TBMG_00226.1"
FT   CDS_pept        268604..269758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00226"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23253"
FT                   /protein_id="ACT23253.1"
FT   gene            complement(269775..271505)
FT                   /locus_tag="TBMG_00227"
FT                   /note="TBMG_00227.1"
FT   CDS_pept        complement(269775..271505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00227"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23254"
FT                   /protein_id="ACT23254.1"
FT                   "
FT   gene            complement(271515..272780)
FT                   /locus_tag="TBMG_00228"
FT                   /note="TBMG_00228.1"
FT   CDS_pept        complement(271515..272780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00228"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23255"
FT                   /protein_id="ACT23255.1"
FT   gene            272996..274219
FT                   /locus_tag="TBMG_00229"
FT                   /note="TBMG_00229.1"
FT   CDS_pept        272996..274219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00229"
FT                   /product="membrane acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00229"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23256"
FT                   /protein_id="ACT23256.1"
FT                   LQADAIAP"
FT   gene            complement(274247..274660)
FT                   /locus_tag="TBMG_03980"
FT                   /note="TBMG_00230.1"
FT   CDS_pept        complement(274247..274660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03980"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03980"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23257"
FT                   /protein_id="ACT23257.1"
FT   gene            complement(274651..274845)
FT                   /locus_tag="TBMG_03981"
FT                   /note="TBMG_00230.1"
FT   CDS_pept        complement(274651..274845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03981"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03981"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23258"
FT                   /protein_id="ACT23258.1"
FT   gene            complement(274924..275904)
FT                   /locus_tag="TBMG_00231"
FT                   /note="TBMG_00231.1"
FT   CDS_pept        complement(274924..275904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00231"
FT                   /product="phosphotriesterase php"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23259"
FT                   /protein_id="ACT23259.1"
FT   gene            275999..277705
FT                   /locus_tag="TBMG_00232"
FT                   /note="TBMG_00232.1"
FT   CDS_pept        275999..277705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00232"
FT                   /product="acyl-CoA dehydrogenase fadE4"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00232"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23260"
FT                   /protein_id="ACT23260.1"
FT   gene            277840..278529
FT                   /locus_tag="TBMG_00233"
FT                   /note="TBMG_00233.1"
FT   CDS_pept        277840..278529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00233"
FT                   /product="transcriptional regulator, tetR/acrR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00233"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23261"
FT                   /protein_id="ACT23261.1"
FT                   TRSEEIT"
FT   gene            278526..279470
FT                   /locus_tag="TBMG_00234"
FT                   /note="TBMG_00234.1"
FT   CDS_pept        278526..279470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00234"
FT                   /product="ribonucleoside-diphosphate reductase subunit beta
FT                   nrdB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00234"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23262"
FT                   /protein_id="ACT23262.1"
FT   gene            complement(279546..281081)
FT                   /locus_tag="TBMG_00235"
FT                   /note="TBMG_00235.1"
FT   CDS_pept        complement(279546..281081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00235"
FT                   /product="succinate-semialdehyde dehydrogenase [NADP+]
FT                   dependent gabD1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23263"
FT                   /protein_id="ACT23263.1"
FT   gene            complement(281107..282555)
FT                   /locus_tag="TBMG_00236"
FT                   /note="TBMG_00236.1"
FT   CDS_pept        complement(281107..282555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00236"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00236"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23264"
FT                   /protein_id="ACT23264.1"
FT   gene            complement(282590..286792)
FT                   /locus_tag="TBMG_00237"
FT                   /note="TBMG_00237.1"
FT   CDS_pept        complement(282590..286792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00237"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23265"
FT                   /protein_id="ACT23265.1"
FT   gene            complement(286839..287012)
FT                   /locus_tag="TBMG_00238"
FT                   /note="TBMG_00238.1"
FT   CDS_pept        complement(286839..287012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00238"
FT                   /product="conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23266"
FT                   /protein_id="ACT23266.1"
FT                   SVLNRVEYGNRS"
FT   gene            287127..288293
FT                   /locus_tag="TBMG_00239"
FT                   /note="TBMG_00239.1"
FT   CDS_pept        287127..288293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00239"
FT                   /product="lipoprotein lpqI"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23267"
FT                   /protein_id="ACT23267.1"
FT   gene            288369..288983
FT                   /locus_tag="TBMG_00240"
FT                   /note="TBMG_00240.1"
FT   CDS_pept        288369..288983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00240"
FT                   /product="transcriptional regulator, tetR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23268"
FT                   /protein_id="ACT23268.1"
FT   gene            289045..289278
FT                   /locus_tag="TBMG_00241"
FT                   /note="TBMG_00241.1"
FT   CDS_pept        289045..289278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00241"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23269"
FT                   /protein_id="ACT23269.1"
FT   gene            289286..289723
FT                   /locus_tag="TBMG_00242"
FT                   /note="TBMG_00242.1"
FT   CDS_pept        289286..289723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00242"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00242"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23270"
FT                   /protein_id="ACT23270.1"
FT   gene            complement(289753..290595)
FT                   /locus_tag="TBMG_00243"
FT                   /note="TBMG_00243.1"
FT   CDS_pept        complement(289753..290595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00243"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23271"
FT                   /protein_id="ACT23271.1"
FT   gene            complement(290606..291970)
FT                   /locus_tag="TBMG_00244"
FT                   /note="TBMG_00244.1"
FT   CDS_pept        complement(290606..291970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00244"
FT                   /product="3-oxoacyl-[acyl-carrier protein] reductase fabG4"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23272"
FT                   /protein_id="ACT23272.1"
FT   gene            292112..293434
FT                   /locus_tag="TBMG_00245"
FT                   /note="TBMG_00245.1"
FT   CDS_pept        292112..293434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00245"
FT                   /product="acetyl-CoA acyltransferase fadA2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23273"
FT                   /protein_id="ACT23273.1"
FT   gene            complement(293738..295573)
FT                   /locus_tag="TBMG_00246"
FT                   /note="TBMG_00246.1"
FT   CDS_pept        complement(293738..295573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00246"
FT                   /product="acyl-CoA dehydrogenase fadE5"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00246"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23274"
FT                   /protein_id="ACT23274.1"
FT   gene            295945..296433
FT                   /locus_tag="TBMG_00247"
FT                   /note="TBMG_00247.1"
FT   CDS_pept        295945..296433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00247"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23275"
FT                   /protein_id="ACT23275.1"
FT   gene            296749..298059
FT                   /locus_tag="TBMG_00248"
FT                   /note="TBMG_00248.1"
FT   CDS_pept        296749..298059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00248"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23276"
FT                   /protein_id="ACT23276.1"
FT   gene            complement(298056..298802)
FT                   /locus_tag="TBMG_00249"
FT                   /note="TBMG_00249.1"
FT   CDS_pept        complement(298056..298802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00249"
FT                   /product="succinate dehydrogenase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23277"
FT                   /protein_id="ACT23277.1"
FT   gene            complement(298803..300743)
FT                   /locus_tag="TBMG_00250"
FT                   /note="TBMG_00250.1"
FT   CDS_pept        complement(298803..300743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00250"
FT                   /product="succinate dehydrogenase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23278"
FT                   /protein_id="ACT23278.1"
FT                   EELAEHPGRRG"
FT   gene            complement(300774..301595)
FT                   /locus_tag="TBMG_00251"
FT                   /note="TBMG_00251.1"
FT   CDS_pept        complement(300774..301595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00251"
FT                   /product="succinate dehydrogenase membrane anchor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23279"
FT                   /protein_id="ACT23279.1"
FT   gene            complement(301675..301968)
FT                   /locus_tag="TBMG_00252"
FT                   /note="TBMG_00252.1"
FT   CDS_pept        complement(301675..301968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00252"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23280"
FT                   /protein_id="ACT23280.1"
FT   gene            complement(302113..302592)
FT                   /locus_tag="TBMG_00253"
FT                   /note="TBMG_00253.1"
FT   CDS_pept        complement(302113..302592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00253"
FT                   /product="heat shock protein hsp"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23281"
FT                   /protein_id="ACT23281.1"
FT   gene            302806..305367
FT                   /locus_tag="TBMG_00254"
FT                   /note="TBMG_00254.1"
FT   CDS_pept        302806..305367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00254"
FT                   /product="nitrite reductase [NAD(P)H] large subunit nirB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00254"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23282"
FT                   /protein_id="ACT23282.1"
FT   gene            305393..305749
FT                   /locus_tag="TBMG_00255"
FT                   /note="TBMG_00255.1"
FT   CDS_pept        305393..305749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00255"
FT                   /product="nitrite reductase [NAD(P)H] small subunit nirD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23283"
FT                   /protein_id="ACT23283.1"
FT                   VTPEGRIQVARVAV"
FT   gene            complement(305765..306289)
FT                   /locus_tag="TBMG_00256"
FT                   /note="TBMG_00256.1"
FT   CDS_pept        complement(305765..306289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00256"
FT                   /product="bifunctional cobalamin biosynthesis protein cobU"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23284"
FT                   /protein_id="ACT23284.1"
FT                   HLVIAGRVLKL"
FT   gene            complement(306314..307798)
FT                   /locus_tag="TBMG_00257"
FT                   /note="TBMG_00257.1"
FT   CDS_pept        complement(306314..307798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00257"
FT                   /product="cobyric acid synthase cobQ1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23285"
FT                   /protein_id="ACT23285.1"
FT   gene            complement(307817..309487)
FT                   /locus_tag="TBMG_00258"
FT                   /note="TBMG_00258.1"
FT   CDS_pept        complement(307817..309487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00258"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00258"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23286"
FT                   /protein_id="ACT23286.1"
FT   gene            309639..310013
FT                   /locus_tag="TBMG_03982"
FT   CDS_pept        309639..310013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03982"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03982"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23287"
FT                   /protein_id="ACT23287.1"
FT   gene            complement(309877..310209)
FT                   /locus_tag="TBMG_00259"
FT                   /note="TBMG_00259.1"
FT   CDS_pept        complement(309877..310209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00259"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00259"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23288"
FT                   /protein_id="ACT23288.1"
FT                   GCRLVQ"
FT   gene            complement(310234..310689)
FT                   /locus_tag="TBMG_00260"
FT                   /note="TBMG_00260.1"
FT   CDS_pept        complement(310234..310689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23289"
FT                   /protein_id="ACT23289.1"
FT   gene            complement(310714..311457)
FT                   /locus_tag="TBMG_00261"
FT                   /note="TBMG_00261.1"
FT   CDS_pept        complement(310714..311457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23290"
FT                   /protein_id="ACT23290.1"
FT   gene            complement(311454..312599)
FT                   /locus_tag="TBMG_00262"
FT                   /note="TBMG_00262.1"
FT   CDS_pept        complement(311454..312599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00262"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23291"
FT                   /protein_id="ACT23291.1"
FT   gene            complement(312699..314108)
FT                   /locus_tag="TBMG_00263"
FT                   /note="TBMG_00263.1"
FT   CDS_pept        complement(312699..314108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00263"
FT                   /product="membrane nitrite extrusion protein narK3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23292"
FT                   /protein_id="ACT23292.1"
FT                   ATTAPAGLAYV"
FT   gene            complement(314249..314794)
FT                   /locus_tag="TBMG_00264"
FT                   /note="TBMG_00264.1"
FT   CDS_pept        complement(314249..314794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00264"
FT                   /product="aminoglycoside 2-N-acetyltransferase aac"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23293"
FT                   /protein_id="ACT23293.1"
FT                   SLDTSAELMCDWRAGDVW"
FT   gene            complement(314804..315706)
FT                   /locus_tag="TBMG_00265"
FT                   /note="TBMG_00265.1"
FT   CDS_pept        complement(314804..315706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23294"
FT                   /protein_id="ACT23294.1"
FT   gene            complement(315723..316376)
FT                   /locus_tag="TBMG_00266"
FT                   /note="TBMG_00266.1"
FT   CDS_pept        complement(315723..316376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23295"
FT                   /protein_id="ACT23295.1"
FT   gene            complement(316451..317443)
FT                   /locus_tag="TBMG_00267"
FT                   /note="TBMG_00267.1"
FT   CDS_pept        complement(316451..317443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00267"
FT                   /product="periplasmic iron-transport lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00267"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23296"
FT                   /protein_id="ACT23296.1"
FT   gene            complement(317465..321094)
FT                   /locus_tag="TBMG_00268"
FT                   /note="TBMG_00268.1"
FT   CDS_pept        complement(317465..321094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00268"
FT                   /product="5-oxoprolinase oplA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00268"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23297"
FT                   /protein_id="ACT23297.1"
FT   gene            321271..322662
FT                   /locus_tag="TBMG_00269"
FT                   /note="TBMG_00269.1"
FT   CDS_pept        321271..322662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00269"
FT                   /product="membrane nitrite extrusion protein narU"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00269"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23298"
FT                   /protein_id="ACT23298.1"
FT                   GQVGV"
FT   gene            complement(322704..323213)
FT                   /locus_tag="TBMG_00270"
FT                   /note="TBMG_00270.1"
FT   CDS_pept        complement(322704..323213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23299"
FT                   /protein_id="ACT23299.1"
FT                   VDIGRV"
FT   gene            complement(323278..324471)
FT                   /locus_tag="TBMG_00271"
FT                   /note="TBMG_00271.1"
FT   CDS_pept        complement(323278..324471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00271"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23300"
FT                   /protein_id="ACT23300.1"
FT   gene            324507..326189
FT                   /locus_tag="TBMG_00272"
FT                   /note="TBMG_00272.1"
FT   CDS_pept        324507..326189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00272"
FT                   /product="fatty-acid-CoA ligase fadD2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23301"
FT                   /protein_id="ACT23301.1"
FT   gene            complement(326206..328401)
FT                   /locus_tag="TBMG_00273"
FT                   /note="TBMG_00273.1"
FT   CDS_pept        complement(326206..328401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00273"
FT                   /product="acyl-CoA dehydrogenase fadE6"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00273"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23302"
FT                   /protein_id="ACT23302.1"
FT   gene            complement(328515..329648)
FT                   /locus_tag="TBMG_00274"
FT                   /note="TBMG_00274.1"
FT   CDS_pept        complement(328515..329648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23303"
FT                   /protein_id="ACT23303.1"
FT   gene            complement(329645..330265)
FT                   /locus_tag="TBMG_00275"
FT                   /note="TBMG_00275.1"
FT   CDS_pept        complement(329645..330265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00275"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23304"
FT                   /protein_id="ACT23304.1"
FT   gene            330320..330943
FT                   /locus_tag="TBMG_00276"
FT                   /note="TBMG_00276.1"
FT   CDS_pept        330320..330943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00276"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00276"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23305"
FT                   /protein_id="ACT23305.1"
FT   gene            complement(330873..331598)
FT                   /locus_tag="TBMG_00277"
FT                   /note="TBMG_00277.1"
FT   CDS_pept        complement(330873..331598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00277"
FT                   /product="transcriptional regulator, tetR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23306"
FT                   /protein_id="ACT23306.1"
FT   gene            331688..332608
FT                   /locus_tag="TBMG_00278"
FT                   /note="TBMG_00278.1"
FT   CDS_pept        331688..332608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00278"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23307"
FT                   /protein_id="ACT23307.1"
FT   gene            complement(332648..333076)
FT                   /locus_tag="TBMG_00279"
FT                   /note="TBMG_00279.1"
FT   CDS_pept        complement(332648..333076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00279"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23308"
FT                   /protein_id="ACT23308.1"
FT   gene            complement(333100..333273)
FT                   /locus_tag="TBMG_00280"
FT                   /note="TBMG_00280.1"
FT   CDS_pept        complement(333100..333273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00280"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23309"
FT                   /protein_id="ACT23309.1"
FT                   VLDEGLELNSRK"
FT   gene            complement(333377..336280)
FT                   /locus_tag="TBMG_03983"
FT                   /note="TBMG_00282.1"
FT   CDS_pept        complement(333377..336280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03983"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03983"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23310"
FT                   /protein_id="ACT23310.1"
FT   gene            complement(336439..339198)
FT                   /locus_tag="TBMG_00283"
FT                   /note="TBMG_00283.1"
FT   CDS_pept        complement(336439..339198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00283"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23311"
FT                   /protein_id="ACT23311.1"
FT   gene            complement(339427..341961)
FT                   /locus_tag="TBMG_00284"
FT                   /note="TBMG_00284.1"
FT   CDS_pept        complement(339427..341961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00284"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00284"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23312"
FT                   /protein_id="ACT23312.1"
FT   gene            342231..343841
FT                   /locus_tag="TBMG_00285"
FT                   /note="TBMG_00285.1"
FT   CDS_pept        342231..343841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00285"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23313"
FT                   /protein_id="ACT23313.1"
FT   gene            343865..344773
FT                   /locus_tag="TBMG_00286"
FT                   /note="TBMG_00286.1"
FT   CDS_pept        343865..344773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00286"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23314"
FT                   /protein_id="ACT23314.1"
FT   gene            344997..346892
FT                   /locus_tag="TBMG_00287"
FT                   /note="TBMG_00287.1"
FT   CDS_pept        344997..346892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23315"
FT                   /protein_id="ACT23315.1"
FT   gene            346889..348505
FT                   /locus_tag="TBMG_00288"
FT                   /note="TBMG_00288.1"
FT   CDS_pept        346889..348505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00288"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23316"
FT                   /protein_id="ACT23316.1"
FT   gene            348502..352494
FT                   /locus_tag="TBMG_00289"
FT                   /note="TBMG_00289.1"
FT   CDS_pept        348502..352494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00289"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00289"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23317"
FT                   /protein_id="ACT23317.1"
FT   gene            352491..352799
FT                   /locus_tag="TBMG_00290"
FT                   /note="TBMG_00290.1"
FT   CDS_pept        352491..352799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00290"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23318"
FT                   /protein_id="ACT23318.1"
FT   gene            352802..354343
FT                   /locus_tag="TBMG_00291"
FT                   /note="TBMG_00291.1"
FT   CDS_pept        352802..354343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00291"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23319"
FT                   /protein_id="ACT23319.1"
FT   gene            354392..354685
FT                   /locus_tag="TBMG_00292"
FT                   /note="TBMG_00292.1"
FT   CDS_pept        354392..354685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00292"
FT                   /product="esat-6 like protein esxG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23320"
FT                   /protein_id="ACT23320.1"
FT   gene            354715..355005
FT                   /locus_tag="TBMG_00293"
FT                   /note="TBMG_00293.1"
FT   CDS_pept        354715..355005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00293"
FT                   /product="low molecular weight protein antigen 7 esxH"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23321"
FT                   /protein_id="ACT23321.1"
FT   gene            355016..355903
FT                   /locus_tag="TBMG_00294"
FT                   /note="TBMG_00294.1"
FT   CDS_pept        355016..355903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00294"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23322"
FT                   /protein_id="ACT23322.1"
FT                   PGQRVSRDFSTQSS"
FT   gene            355950..357368
FT                   /locus_tag="TBMG_00295"
FT                   /note="TBMG_00295.1"
FT   CDS_pept        355950..357368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00295"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23323"
FT                   /protein_id="ACT23323.1"
FT                   MAYLVGLFAWVLNR"
FT   gene            357365..358750
FT                   /locus_tag="TBMG_00296"
FT                   /note="TBMG_00296.1"
FT   CDS_pept        357365..358750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00296"
FT                   /product="membrane-anchored mycosin mycP3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23324"
FT                   /protein_id="ACT23324.1"
FT                   PTE"
FT   gene            358747..359742
FT                   /locus_tag="TBMG_00297"
FT                   /note="TBMG_00297.1"
FT   CDS_pept        358747..359742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00297"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23325"
FT                   /protein_id="ACT23325.1"
FT   gene            complement(359729..360931)
FT                   /locus_tag="TBMG_00298"
FT                   /note="TBMG_00298.1"
FT   CDS_pept        complement(359729..360931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00298"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23326"
FT                   /protein_id="ACT23326.1"
FT                   D"
FT   gene            361038..361823
FT                   /locus_tag="TBMG_00299"
FT                   /note="TBMG_00299.1"
FT   CDS_pept        361038..361823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00299"
FT                   /product="trans-aconitate methyltransferase tam"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23327"
FT                   /protein_id="ACT23327.1"
FT   gene            complement(361812..362615)
FT                   /locus_tag="TBMG_00300"
FT                   /note="TBMG_00300.1"
FT   CDS_pept        complement(361812..362615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23328"
FT                   /protein_id="ACT23328.1"
FT   gene            complement(362625..364031)
FT                   /locus_tag="TBMG_00301"
FT                   /note="TBMG_00301.1"
FT   CDS_pept        complement(362625..364031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00301"
FT                   /product="sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23329"
FT                   /protein_id="ACT23329.1"
FT                   ADRGIDEHCS"
FT   gene            364201..366039
FT                   /locus_tag="TBMG_00302"
FT                   /note="TBMG_00302.1"
FT   CDS_pept        364201..366039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00302"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00302"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23330"
FT                   /protein_id="ACT23330.1"
FT   gene            366109..366336
FT                   /locus_tag="TBMG_00303"
FT                   /note="TBMG_00303.1"
FT   CDS_pept        366109..366336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00303"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00303"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23331"
FT                   /protein_id="ACT23331.1"
FT   gene            366333..366635
FT                   /locus_tag="TBMG_00304"
FT                   /note="TBMG_00304.1"
FT   CDS_pept        366333..366635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00304"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00304"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23332"
FT                   /protein_id="ACT23332.1"
FT   gene            366683..366904
FT                   /locus_tag="TBMG_00305"
FT                   /note="TBMG_00305.1"
FT   CDS_pept        366683..366904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00305"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23333"
FT                   /protein_id="ACT23333.1"
FT   gene            366901..367326
FT                   /locus_tag="TBMG_00306"
FT                   /note="TBMG_00306.1"
FT   CDS_pept        366901..367326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00306"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23334"
FT                   /protein_id="ACT23334.1"
FT   gene            367462..368094
FT                   /locus_tag="TBMG_00307"
FT                   /note="TBMG_00307.1"
FT   CDS_pept        367462..368094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00307"
FT                   /product="transcriptional regulator, tetR/acrR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00307"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23335"
FT                   /protein_id="ACT23335.1"
FT   gene            368091..368999
FT                   /locus_tag="TBMG_00308"
FT                   /note="TBMG_00308.1"
FT   CDS_pept        368091..368999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00308"
FT                   /product="dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00308"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23336"
FT                   /protein_id="ACT23336.1"
FT   gene            complement(369007..378597)
FT                   /locus_tag="TBMG_00309"
FT                   /note="TBMG_00309.1"
FT   CDS_pept        complement(369007..378597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00309"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23337"
FT                   /protein_id="ACT23337.1"
FT   gene            378800..379471
FT                   /locus_tag="TBMG_00310"
FT                   /note="TBMG_00310.1"
FT   CDS_pept        378800..379471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00310"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23338"
FT                   /protein_id="ACT23338.1"
FT                   E"
FT   gene            complement(379459..379941)
FT                   /locus_tag="TBMG_00311"
FT                   /note="TBMG_00311.1"
FT   CDS_pept        complement(379459..379941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00311"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23339"
FT                   /protein_id="ACT23339.1"
FT   gene            379999..380715
FT                   /locus_tag="TBMG_00312"
FT                   /note="TBMG_00312.1"
FT   CDS_pept        379999..380715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00312"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23340"
FT                   /protein_id="ACT23340.1"
FT                   PVEVSRQPEPEVDTAR"
FT   gene            380817..381473
FT                   /locus_tag="TBMG_00313"
FT                   /note="TBMG_00313.1"
FT   CDS_pept        380817..381473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00313"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00313"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23341"
FT                   /protein_id="ACT23341.1"
FT   gene            complement(381543..382034)
FT                   /locus_tag="TBMG_00314"
FT                   /note="TBMG_00314.1"
FT   CDS_pept        complement(381543..382034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23342"
FT                   /protein_id="ACT23342.1"
FT                   "
FT   gene            382058..383287
FT                   /locus_tag="TBMG_00315"
FT                   /note="TBMG_00315.1"
FT   CDS_pept        382058..383287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23343"
FT                   /protein_id="ACT23343.1"
FT                   PRRSLPLTVK"
FT   gene            383442..385304
FT                   /locus_tag="TBMG_00316"
FT                   /note="TBMG_00316.1"
FT   CDS_pept        383442..385304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00316"
FT                   /product="conserved proline and threonine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23344"
FT                   /protein_id="ACT23344.1"
FT   gene            385376..385762
FT                   /locus_tag="TBMG_00317"
FT                   /note="TBMG_00317.1"
FT   CDS_pept        385376..385762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00317"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23345"
FT                   /protein_id="ACT23345.1"
FT   gene            complement(385765..386427)
FT                   /locus_tag="TBMG_00318"
FT                   /note="TBMG_00318.1"
FT   CDS_pept        complement(385765..386427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00318"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00318"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23346"
FT                   /protein_id="ACT23346.1"
FT   gene            386518..387372
FT                   /locus_tag="TBMG_00319"
FT                   /note="TBMG_00319.1"
FT   CDS_pept        386518..387372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00319"
FT                   /product="beta-1,3-glucanase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00319"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23347"
FT                   /protein_id="ACT23347.1"
FT                   RVF"
FT   gene            387421..388035
FT                   /locus_tag="TBMG_00320"
FT                   /note="TBMG_00320.1"
FT   CDS_pept        387421..388035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00320"
FT                   /product="muconolactone isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23348"
FT                   /protein_id="ACT23348.1"
FT   gene            complement(388059..388829)
FT                   /locus_tag="TBMG_00321"
FT                   /note="TBMG_00321.1"
FT   CDS_pept        complement(388059..388829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00321"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   glpQ2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23349"
FT                   /protein_id="ACT23349.1"
FT   gene            complement(389087..389160)
FT                   /locus_tag="TBMG_05004"
FT   tRNA            complement(389087..389160)
FT                   /locus_tag="TBMG_05004"
FT                   /product="tRNA-Gly"
FT   gene            complement(389191..389985)
FT                   /locus_tag="TBMG_00322"
FT                   /note="TBMG_00322.1"
FT   CDS_pept        complement(389191..389985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00322"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23350"
FT                   /protein_id="ACT23350.1"
FT   gene            390034..390702
FT                   /locus_tag="TBMG_00323"
FT                   /note="TBMG_00323.1"
FT   CDS_pept        390034..390702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00323"
FT                   /product="pyrrolidone-carboxylate peptidase pcp"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23351"
FT                   /protein_id="ACT23351.1"
FT                   "
FT   gene            390774..391436
FT                   /locus_tag="TBMG_00324"
FT                   /note="TBMG_00324.1"
FT   CDS_pept        390774..391436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00324"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23352"
FT                   /protein_id="ACT23352.1"
FT   gene            391468..392040
FT                   /locus_tag="TBMG_00325"
FT                   /note="TBMG_00325.1"
FT   CDS_pept        391468..392040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00325"
FT                   /product="deoxycytidine triphosphate deaminase dcd"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00325"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23353"
FT                   /protein_id="ACT23353.1"
FT   gene            392146..393477
FT                   /locus_tag="TBMG_00326"
FT                   /note="TBMG_00326.1"
FT   CDS_pept        392146..393477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00326"
FT                   /product="UDP-glucose 6-dehydrogenase udgA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00326"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23354"
FT                   /protein_id="ACT23354.1"
FT   gene            complement(393466..394137)
FT                   /locus_tag="TBMG_00327"
FT                   /note="TBMG_00327.1"
FT   CDS_pept        complement(393466..394137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00327"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23355"
FT                   /protein_id="ACT23355.1"
FT                   P"
FT   gene            394238..394918
FT                   /locus_tag="TBMG_00328"
FT                   /note="TBMG_00328.1"
FT   CDS_pept        394238..394918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00328"
FT                   /product="transcriptional regulator, arsR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00328"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23356"
FT                   /protein_id="ACT23356.1"
FT                   GHGD"
FT   gene            394925..395149
FT                   /locus_tag="TBMG_00329"
FT                   /note="TBMG_00329.1"
FT   CDS_pept        394925..395149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23357"
FT                   /protein_id="ACT23357.1"
FT   gene            395159..395614
FT                   /locus_tag="TBMG_00330"
FT                   /note="TBMG_00330.1"
FT   CDS_pept        395159..395614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23358"
FT                   /protein_id="ACT23358.1"
FT   gene            complement(395582..396931)
FT                   /locus_tag="TBMG_00331"
FT                   /note="TBMG_00331.1"
FT   CDS_pept        complement(395582..396931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00331"
FT                   /product="cytochrome P450 135A1 cyp135A1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23359"
FT                   /protein_id="ACT23359.1"
FT   gene            396997..397599
FT                   /locus_tag="TBMG_00332"
FT                   /note="TBMG_00332.1"
FT   CDS_pept        396997..397599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00332"
FT                   /product="transcriptional regulator, tetR/acrR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00332"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23360"
FT                   /protein_id="ACT23360.1"
FT   gene            complement(397580..398206)
FT                   /locus_tag="TBMG_00333"
FT                   /note="TBMG_00333.1"
FT   CDS_pept        complement(397580..398206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00333"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23361"
FT                   /protein_id="ACT23361.1"
FT   gene            complement(398233..398973)
FT                   /locus_tag="TBMG_00334"
FT                   /note="TBMG_00334.1"
FT   CDS_pept        complement(398233..398973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23362"
FT                   /protein_id="ACT23362.1"
FT   gene            399087..400253
FT                   /locus_tag="TBMG_00335"
FT                   /note="TBMG_00335.1"
FT   CDS_pept        399087..400253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00335"
FT                   /product="dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23363"
FT                   /protein_id="ACT23363.1"
FT   gene            400328..401113
FT                   /locus_tag="TBMG_00336"
FT                   /note="TBMG_00336.1"
FT   CDS_pept        400328..401113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23364"
FT                   /protein_id="ACT23364.1"
FT   gene            401140..401514
FT                   /locus_tag="TBMG_00337"
FT                   /note="TBMG_00337.1"
FT   CDS_pept        401140..401514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00337"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23365"
FT                   /protein_id="ACT23365.1"
FT   gene            401544..402410
FT                   /locus_tag="TBMG_00338"
FT                   /note="TBMG_00338.1"
FT   CDS_pept        401544..402410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00338"
FT                   /product="alpha-D-glucose-1-phosphate thymidylyltransferase
FT                   rmlA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23366"
FT                   /protein_id="ACT23366.1"
FT                   LELLERN"
FT   gene            complement(402421..402936)
FT                   /locus_tag="TBMG_00339"
FT                   /note="TBMG_00339.1"
FT   CDS_pept        complement(402421..402936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00339"
FT                   /product="PE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23367"
FT                   /protein_id="ACT23367.1"
FT                   RGFHNHRQ"
FT   gene            403054..404589
FT                   /locus_tag="TBMG_00340"
FT                   /note="TBMG_00340.1"
FT   CDS_pept        403054..404589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00340"
FT                   /product="13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23368"
FT                   /protein_id="ACT23368.1"
FT   gene            complement(404759..406048)
FT                   /locus_tag="TBMG_00341"
FT                   /note="TBMG_00341.1"
FT   CDS_pept        complement(404759..406048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00341"
FT                   /product="aspartate aminotransferase aspC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23369"
FT                   /protein_id="ACT23369.1"
FT   gene            complement(406079..408727)
FT                   /locus_tag="TBMG_00342"
FT                   /note="TBMG_00342.1"
FT   CDS_pept        complement(406079..408727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00342"
FT                   /product="iron-sulfur-binding reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23370"
FT                   /protein_id="ACT23370.1"
FT                   IARGARPPGKR"
FT   gene            complement(408836..411334)
FT                   /locus_tag="TBMG_00343"
FT                   /note="TBMG_00343.1"
FT   CDS_pept        complement(408836..411334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00343"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00343"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23371"
FT                   /protein_id="ACT23371.1"
FT   gene            411520..412059
FT                   /locus_tag="TBMG_00344"
FT                   /note="TBMG_00344.1"
FT   CDS_pept        411520..412059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00344"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23372"
FT                   /protein_id="ACT23372.1"
FT                   DPHTVEPDHHGYDIHG"
FT   gene            412242..413687
FT                   /locus_tag="TBMG_00345"
FT                   /note="TBMG_00345.1"
FT   CDS_pept        412242..413687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00345"
FT                   /product="isoniazid inductible protein iniB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23373"
FT                   /protein_id="ACT23373.1"
FT   gene            413724..415646
FT                   /locus_tag="TBMG_00346"
FT                   /note="TBMG_00346.1"
FT   CDS_pept        413724..415646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00346"
FT                   /product="isoniazid inductible protein iniA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23374"
FT                   /protein_id="ACT23374.1"
FT                   SLGRA"
FT   gene            415643..417124
FT                   /locus_tag="TBMG_00347"
FT                   /note="TBMG_00347.1"
FT   CDS_pept        415643..417124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00347"
FT                   /product="isoniazid inductible protein iniC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23375"
FT                   /protein_id="ACT23375.1"
FT   gene            complement(417267..417827)
FT                   /locus_tag="TBMG_00348"
FT                   /note="TBMG_00348.1"
FT   CDS_pept        complement(417267..417827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00348"
FT                   /product="lipoprotein lpqJ"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00348"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23376"
FT                   /protein_id="ACT23376.1"
FT   gene            417930..418346
FT                   /locus_tag="TBMG_00349"
FT                   /note="TBMG_00349.1"
FT   CDS_pept        417930..418346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00349"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00349"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23377"
FT                   /protein_id="ACT23377.1"
FT   gene            complement(418388..419851)
FT                   /locus_tag="TBMG_00350"
FT                   /note="TBMG_00350.1"
FT   CDS_pept        complement(418388..419851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00350"
FT                   /product="L-asparagine permease ansP2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23378"
FT                   /protein_id="ACT23378.1"
FT   gene            420190..421176
FT                   /locus_tag="TBMG_00351"
FT                   /note="TBMG_00351.1"
FT   CDS_pept        420190..421176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00351"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23379"
FT                   /protein_id="ACT23379.1"
FT   gene            421179..421832
FT                   /locus_tag="TBMG_00352"
FT                   /note="TBMG_00352.1"
FT   CDS_pept        421179..421832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00352"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23380"
FT                   /protein_id="ACT23380.1"
FT   gene            421835..422494
FT                   /locus_tag="TBMG_00353"
FT                   /note="TBMG_00353.1"
FT   CDS_pept        421835..422494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00353"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00353"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23381"
FT                   /protein_id="ACT23381.1"
FT   gene            422721..424598
FT                   /locus_tag="TBMG_00354"
FT                   /note="TBMG_00354.1"
FT   CDS_pept        422721..424598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00354"
FT                   /product="chaperone dnaK"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00354"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23382"
FT                   /protein_id="ACT23382.1"
FT   gene            424595..425302
FT                   /locus_tag="TBMG_00355"
FT                   /note="TBMG_00355.1"
FT   CDS_pept        424595..425302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00355"
FT                   /product="chaperone grpE"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23383"
FT                   /protein_id="ACT23383.1"
FT                   TSGEQAESEPSGS"
FT   gene            425338..426525
FT                   /locus_tag="TBMG_00356"
FT                   /note="TBMG_00356.1"
FT   CDS_pept        425338..426525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00356"
FT                   /product="chaperone dnaJ1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23384"
FT                   /protein_id="ACT23384.1"
FT   gene            426525..426905
FT                   /locus_tag="TBMG_00357"
FT                   /note="TBMG_00357.1"
FT   CDS_pept        426525..426905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00357"
FT                   /product="merR-family heat shock protein transcriptional
FT                   repressor hspR"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23385"
FT                   /protein_id="ACT23385.1"
FT   gene            complement(427081..427632)
FT                   /locus_tag="TBMG_00358"
FT                   /note="TBMG_00358.1"
FT   CDS_pept        complement(427081..427632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00358"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23386"
FT                   /protein_id="ACT23386.1"
FT   gene            complement(427715..437542)
FT                   /locus_tag="TBMG_00359"
FT                   /note="TBMG_00359.1"
FT   CDS_pept        complement(427715..437542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00359"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00359"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23387"
FT                   /protein_id="ACT23387.1"
FT   gene            complement(437693..438337)
FT                   /locus_tag="TBMG_00360"
FT                   /note="TBMG_00360.1"
FT   CDS_pept        complement(437693..438337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23388"
FT                   /protein_id="ACT23388.1"
FT   gene            complement(438334..439632)
FT                   /locus_tag="TBMG_00361"
FT                   /note="TBMG_00361.1"
FT   CDS_pept        complement(438334..439632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00361"
FT                   /product="adenylosuccinate synthetase purA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23389"
FT                   /protein_id="ACT23389.1"
FT   gene            439723..440370
FT                   /locus_tag="TBMG_00362"
FT                   /note="TBMG_00362.1"
FT   CDS_pept        439723..440370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00362"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23390"
FT                   /protein_id="ACT23390.1"
FT   gene            440381..441160
FT                   /locus_tag="TBMG_00363"
FT                   /note="TBMG_00363.1"
FT   CDS_pept        440381..441160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00363"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00363"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23391"
FT                   /protein_id="ACT23391.1"
FT   gene            complement(441165..441602)
FT                   /locus_tag="TBMG_00364"
FT                   /note="TBMG_00364.1"
FT   CDS_pept        complement(441165..441602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23392"
FT                   /protein_id="ACT23392.1"
FT   gene            441685..442512
FT                   /locus_tag="TBMG_00365"
FT                   /note="TBMG_00365.1"
FT   CDS_pept        441685..442512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00365"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23393"
FT                   /protein_id="ACT23393.1"
FT   gene            442734..444116
FT                   /locus_tag="TBMG_00366"
FT                   /note="TBMG_00366.1"
FT   CDS_pept        442734..444116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00366"
FT                   /product="Mg2+ transport transmembrane protein mgtE"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00366"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23394"
FT                   /protein_id="ACT23394.1"
FT                   GL"
FT   gene            complement(444128..445162)
FT                   /locus_tag="TBMG_00367"
FT                   /note="TBMG_00367.1"
FT   CDS_pept        complement(444128..445162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00367"
FT                   /product="fructose-bisphosphate aldolase fba"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23395"
FT                   /protein_id="ACT23395.1"
FT                   SLTH"
FT   gene            445258..445941
FT                   /locus_tag="TBMG_00368"
FT                   /note="TBMG_00368.1"
FT   CDS_pept        445258..445941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00368"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00368"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23396"
FT                   /protein_id="ACT23396.1"
FT                   LVLPE"
FT   gene            complement(445930..447060)
FT                   /locus_tag="TBMG_00369"
FT                   /note="TBMG_00369.1"
FT   CDS_pept        complement(445930..447060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00369"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23397"
FT                   /protein_id="ACT23397.1"
FT   gene            complement(447085..447678)
FT                   /locus_tag="TBMG_00370"
FT                   /note="TBMG_00370.1"
FT   CDS_pept        complement(447085..447678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23398"
FT                   /protein_id="ACT23398.1"
FT   gene            complement(447707..448096)
FT                   /locus_tag="TBMG_00371"
FT                   /note="TBMG_00371.1"
FT   CDS_pept        complement(447707..448096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23399"
FT                   /protein_id="ACT23399.1"
FT   gene            complement(448177..449388)
FT                   /locus_tag="TBMG_00372"
FT                   /note="TBMG_00372.1"
FT   CDS_pept        complement(448177..449388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00372"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23400"
FT                   /protein_id="ACT23400.1"
FT                   AGAR"
FT   gene            complement(449394..449996)
FT                   /locus_tag="TBMG_00373"
FT                   /note="TBMG_00373.1"
FT   CDS_pept        complement(449394..449996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00373"
FT                   /product="membrane oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23401"
FT                   /protein_id="ACT23401.1"
FT   gene            complement(450010..450906)
FT                   /locus_tag="TBMG_00374"
FT                   /note="TBMG_00374.1"
FT   CDS_pept        complement(450010..450906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00374"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23402"
FT                   /protein_id="ACT23402.1"
FT                   RTQIRDAYQAFTECSHA"
FT   gene            complement(450903..451496)
FT                   /locus_tag="TBMG_00375"
FT                   /note="TBMG_00375.1"
FT   CDS_pept        complement(450903..451496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00375"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23403"
FT                   /protein_id="ACT23403.1"
FT   gene            complement(451493..452248)
FT                   /locus_tag="TBMG_00376"
FT                   /note="TBMG_00376.1"
FT   CDS_pept        complement(451493..452248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00376"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23404"
FT                   /protein_id="ACT23404.1"
FT   gene            complement(452267..454666)
FT                   /locus_tag="TBMG_00377"
FT                   /note="TBMG_00377.1"
FT   CDS_pept        complement(452267..454666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00377"
FT                   /product="carbon monoxyde dehydrogenase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23405"
FT                   /protein_id="ACT23405.1"
FT   gene            complement(454663..455142)
FT                   /locus_tag="TBMG_00378"
FT                   /note="TBMG_00378.1"
FT   CDS_pept        complement(454663..455142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00378"
FT                   /product="carbon monoxyde dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23406"
FT                   /protein_id="ACT23406.1"
FT   gene            complement(455157..456059)
FT                   /locus_tag="TBMG_00379"
FT                   /note="TBMG_00379.1"
FT   CDS_pept        complement(455157..456059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00379"
FT                   /product="carbon monoxyde dehydrogenase subunit medium"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23407"
FT                   /protein_id="ACT23407.1"
FT   gene            456234..456449
FT                   /locus_tag="TBMG_00380"
FT                   /note="TBMG_00380.1"
FT   CDS_pept        456234..456449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00380"
FT                   /product="preprotein translocase subunit secE2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23408"
FT                   /protein_id="ACT23408.1"
FT   gene            complement(456525..457187)
FT                   /locus_tag="TBMG_00381"
FT                   /note="TBMG_00381.1"
FT   CDS_pept        complement(456525..457187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00381"
FT                   /product="RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23409"
FT                   /protein_id="ACT23409.1"
FT   gene            complement(457172..458080)
FT                   /locus_tag="TBMG_00382"
FT                   /note="TBMG_00382.1"
FT   CDS_pept        complement(457172..458080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23410"
FT                   /protein_id="ACT23410.1"
FT   gene            complement(458098..458637)
FT                   /locus_tag="TBMG_00383"
FT                   /note="TBMG_00383.1"
FT   CDS_pept        complement(458098..458637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00383"
FT                   /product="orotate phosphoribosyltransferase pyrE"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23411"
FT                   /protein_id="ACT23411.1"
FT                   GLRYRSVLGLADLGLD"
FT   gene            complement(458718..459572)
FT                   /locus_tag="TBMG_00384"
FT                   /note="TBMG_00384.1"
FT   CDS_pept        complement(458718..459572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00384"
FT                   /product="conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00384"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23412"
FT                   /protein_id="ACT23412.1"
FT                   YQH"
FT   gene            complement(459713..462259)
FT                   /locus_tag="TBMG_00385"
FT                   /note="TBMG_00385.1"
FT   CDS_pept        complement(459713..462259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00385"
FT                   /product="endopeptidase subunit ATP binding protein B clpB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23413"
FT                   /protein_id="ACT23413.1"
FT   gene            462287..463564
FT                   /locus_tag="TBMG_00386"
FT                   /note="TBMG_00386.1"
FT   CDS_pept        462287..463564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00386"
FT                   /product="monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00386"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23414"
FT                   /protein_id="ACT23414.1"
FT   gene            463668..466925
FT                   /locus_tag="TBMG_00387"
FT                   /note="TBMG_00387.1"
FT   CDS_pept        463668..466925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00387"
FT                   /product="transcriptional regulator, luxR/uhpA-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00387"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23415"
FT                   /protein_id="ACT23415.1"
FT   gene            complement(466929..468260)
FT                   /locus_tag="TBMG_00388"
FT                   /note="TBMG_00388.1"
FT   CDS_pept        complement(466929..468260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00388"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00388"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23416"
FT                   /protein_id="ACT23416.1"
FT   gene            468594..469853
FT                   /locus_tag="TBMG_00389"
FT                   /note="TBMG_00389.1"
FT   CDS_pept        468594..469853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00389"
FT                   /product="phosphoribosylglycinamide formyltransferase 2
FT                   purT"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00389"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23417"
FT                   /protein_id="ACT23417.1"
FT   gene            469850..470272
FT                   /locus_tag="TBMG_00390"
FT                   /note="TBMG_00390.1"
FT   CDS_pept        469850..470272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23418"
FT                   /protein_id="ACT23418.1"
FT   gene            470269..471489
FT                   /locus_tag="TBMG_00391"
FT                   /note="TBMG_00391.1"
FT   CDS_pept        470269..471489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00391"
FT                   /product="O-succinylhomoserine sulfhydrylase metZ"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23419"
FT                   /protein_id="ACT23419.1"
FT                   DIDRALS"
FT   gene            complement(471486..472898)
FT                   /locus_tag="TBMG_00392"
FT                   /note="TBMG_00392.1"
FT   CDS_pept        complement(471486..472898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00392"
FT                   /product="membrane NADH dehydrogenase ndhA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00392"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23420"
FT                   /protein_id="ACT23420.1"
FT                   EQAEHAEQEAAG"
FT   gene            473040..474365
FT                   /locus_tag="TBMG_00393"
FT                   /note="TBMG_00393.1"
FT   CDS_pept        473040..474365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00393"
FT                   /product="13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00393"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23421"
FT                   /protein_id="ACT23421.1"
FT   gene            complement(474381..475100)
FT                   /locus_tag="TBMG_00394"
FT                   /note="TBMG_00394.1"
FT   CDS_pept        complement(474381..475100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00394"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00394"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23422"
FT                   /protein_id="ACT23422.1"
FT                   GSAPTGDHPTPHPSTSR"
FT   gene            475199..475603
FT                   /locus_tag="TBMG_00395"
FT                   /note="TBMG_00395.1"
FT   CDS_pept        475199..475603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00395"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23423"
FT                   /protein_id="ACT23423.1"
FT   gene            475585..476001
FT                   /locus_tag="TBMG_00396"
FT                   /note="TBMG_00396.1"
FT   CDS_pept        475585..476001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00396"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23424"
FT                   /protein_id="ACT23424.1"
FT   gene            476075..476443
FT                   /locus_tag="TBMG_00397"
FT                   /note="TBMG_00397.1"
FT   CDS_pept        476075..476443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00397"
FT                   /product="13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23425"
FT                   /protein_id="ACT23425.1"
FT                   APETNGPPPDPDDDPPPF"
FT   gene            476653..476901
FT                   /locus_tag="TBMG_00398"
FT                   /note="TBMG_00398.1"
FT   CDS_pept        476653..476901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23426"
FT                   /protein_id="ACT23426.1"
FT   gene            complement(476938..477579)
FT                   /locus_tag="TBMG_00399"
FT                   /note="TBMG_00399.1"
FT   CDS_pept        complement(476938..477579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00399"
FT                   /product="secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00399"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23427"
FT                   /protein_id="ACT23427.1"
FT   gene            complement(477586..478815)
FT                   /locus_tag="TBMG_00400"
FT                   /note="TBMG_00400.1"
FT   CDS_pept        complement(477586..478815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00400"
FT                   /product="lipoprotein lpqK"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23428"
FT                   /protein_id="ACT23428.1"
FT                   NDAPPMPPGR"
FT   gene            complement(478825..480012)
FT                   /locus_tag="TBMG_00401"
FT                   /note="TBMG_00401.1"
FT   CDS_pept        complement(478825..480012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00401"
FT                   /product="acyl-CoA dehydrogenase fadE7"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23429"
FT                   /protein_id="ACT23429.1"
FT   gene            480048..480419
FT                   /locus_tag="TBMG_00402"
FT                   /note="TBMG_00402.1"
FT   CDS_pept        480048..480419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00402"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23430"
FT                   /protein_id="ACT23430.1"
FT   gene            complement(480614..483490)
FT                   /locus_tag="TBMG_00403"
FT                   /note="TBMG_00403.1"
FT   CDS_pept        complement(480614..483490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00403"
FT                   /product="transmembrane transporter mmpL1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00403"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23431"
FT                   /protein_id="ACT23431.1"
FT   gene            complement(483487..483915)
FT                   /locus_tag="TBMG_00404"
FT                   /note="TBMG_00404.1"
FT   CDS_pept        complement(483487..483915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00404"
FT                   /product="membrane protein mmpS1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00404"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23432"
FT                   /protein_id="ACT23432.1"
FT   gene            484236..485993
FT                   /locus_tag="TBMG_00405"
FT                   /note="TBMG_00405.1"
FT   CDS_pept        484236..485993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00405"
FT                   /product="fatty-acid-CoA ligase fadD30"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23433"
FT                   /protein_id="ACT23433.1"
FT                   KLQRVATFP"
FT   gene            485990..490198
FT                   /locus_tag="TBMG_00406"
FT                   /note="TBMG_00406.1"
FT   CDS_pept        485990..490198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00406"
FT                   /product="membrane bound polyketide synthase pks6"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23434"
FT                   /protein_id="ACT23434.1"
FT                   "
FT   gene            complement(490146..490964)
FT                   /locus_tag="TBMG_00407"
FT                   /note="TBMG_00407.1"
FT   CDS_pept        complement(490146..490964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00407"
FT                   /product="beta lactamase like protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23435"
FT                   /protein_id="ACT23435.1"
FT   gene            491042..492052
FT                   /locus_tag="TBMG_00408"
FT                   /note="TBMG_00408.1"
FT   CDS_pept        491042..492052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00408"
FT                   /product="F420-dependent glucose-6-phosphate dehydrogenase
FT                   fgd1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23436"
FT                   /protein_id="ACT23436.1"
FT   gene            492045..494117
FT                   /locus_tag="TBMG_00409"
FT                   /note="TBMG_00409.1"
FT   CDS_pept        492045..494117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00409"
FT                   /product="phosphate acetyltransferase pta"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23437"
FT                   /protein_id="ACT23437.1"
FT   gene            494110..495267
FT                   /locus_tag="TBMG_00410"
FT                   /note="TBMG_00410.1"
FT   CDS_pept        494110..495267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00410"
FT                   /product="acetate kinase ackA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23438"
FT                   /protein_id="ACT23438.1"
FT   gene            complement(495321..497573)
FT                   /locus_tag="TBMG_00411"
FT                   /note="TBMG_00411.1"
FT   CDS_pept        complement(495321..497573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00411"
FT                   /product="serine/threonine-protein kinase pknG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23439"
FT                   /protein_id="ACT23439.1"
FT   gene            complement(497573..498559)
FT                   /locus_tag="TBMG_00412"
FT                   /note="TBMG_00412.1"
FT   CDS_pept        complement(497573..498559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00412"
FT                   /product="glutamine-binding lipoprotein glnH"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00412"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23440"
FT                   /protein_id="ACT23440.1"
FT   gene            complement(498559..499878)
FT                   /locus_tag="TBMG_00413"
FT                   /note="TBMG_00413.1"
FT   CDS_pept        complement(498559..499878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00413"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23441"
FT                   /protein_id="ACT23441.1"
FT   gene            499972..500625
FT                   /locus_tag="TBMG_00414"
FT                   /note="TBMG_00414.1"
FT   CDS_pept        499972..500625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00414"
FT                   /product="mutator protein mutT3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23442"
FT                   /protein_id="ACT23442.1"
FT   gene            complement(500609..501277)
FT                   /locus_tag="TBMG_00415"
FT                   /note="TBMG_00415.1"
FT   CDS_pept        complement(500609..501277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00415"
FT                   /product="thiamine-phosphate pyrophosphorylase thiE"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23443"
FT                   /protein_id="ACT23443.1"
FT                   "
FT   gene            501407..502429
FT                   /locus_tag="TBMG_00416"
FT                   /note="TBMG_00416.1"
FT   CDS_pept        501407..502429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00416"
FT                   /product="thiamine biosynthesis oxidoreductase thiO"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23444"
FT                   /protein_id="ACT23444.1"
FT                   "
FT   gene            502426..502632
FT                   /locus_tag="TBMG_00417"
FT                   /note="TBMG_00417.1"
FT   CDS_pept        502426..502632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00417"
FT                   /product="hypothetical protein thiS"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23445"
FT                   /protein_id="ACT23445.1"
FT   gene            502625..503383
FT                   /locus_tag="TBMG_00418"
FT                   /note="TBMG_00418.1"
FT   CDS_pept        502625..503383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00418"
FT                   /product="thiamin biosynthesis protein thiG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00418"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23446"
FT                   /protein_id="ACT23446.1"
FT   gene            503405..503557
FT                   /locus_tag="TBMG_03984"
FT   CDS_pept        503405..503557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03984"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03984"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23447"
FT                   /protein_id="ACT23447.1"
FT                   WAYLA"
FT   gene            503755..505257
FT                   /locus_tag="TBMG_00419"
FT                   /note="TBMG_00419.1"
FT   CDS_pept        503755..505257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00419"
FT                   /product="lipoprotein aminopeptidase lpqL"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23448"
FT                   /protein_id="ACT23448.1"
FT   gene            505345..506841
FT                   /locus_tag="TBMG_00420"
FT                   /note="TBMG_00420.1"
FT   CDS_pept        505345..506841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00420"
FT                   /product="lipoprotein peptidase lpqM"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23449"
FT                   /protein_id="ACT23449.1"
FT   gene            complement(506820..507230)
FT                   /locus_tag="TBMG_00421"
FT                   /note="TBMG_00421.1"
FT   CDS_pept        complement(506820..507230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00421"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23450"
FT                   /protein_id="ACT23450.1"
FT   gene            complement(507391..508020)
FT                   /locus_tag="TBMG_00422"
FT                   /note="TBMG_00422.1"
FT   CDS_pept        complement(507391..508020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00422"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23451"
FT                   /protein_id="ACT23451.1"
FT   gene            complement(508017..508844)
FT                   /locus_tag="TBMG_00423"
FT                   /note="TBMG_00423.1"
FT   CDS_pept        complement(508017..508844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00423"
FT                   /product="phosphomethylpyrimidine kinase thiD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23452"
FT                   /protein_id="ACT23452.1"
FT   gene            complement(508841..510484)
FT                   /locus_tag="TBMG_00424"
FT                   /note="TBMG_00424.1"
FT   CDS_pept        complement(508841..510484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00424"
FT                   /product="thiamine biosynthesis protein thiC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00424"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23453"
FT                   /protein_id="ACT23453.1"
FT   gene            complement(510636..510914)
FT                   /locus_tag="TBMG_00425"
FT                   /note="TBMG_00425.1"
FT   CDS_pept        complement(510636..510914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23454"
FT                   /protein_id="ACT23454.1"
FT   gene            complement(510961..515580)
FT                   /locus_tag="TBMG_00426"
FT                   /note="TBMG_00426.1"
FT   CDS_pept        complement(510961..515580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00426"
FT                   /product="metal cation transporting P-type ATPase ctpH"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23455"
FT                   /protein_id="ACT23455.1"
FT   gene            complement(515632..516207)
FT                   /locus_tag="TBMG_00427"
FT                   /note="TBMG_00427.1"
FT   CDS_pept        complement(515632..516207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00427"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23456"
FT                   /protein_id="ACT23456.1"
FT   gene            complement(516276..517151)
FT                   /locus_tag="TBMG_00428"
FT                   /note="TBMG_00428.1"
FT   CDS_pept        complement(516276..517151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00428"
FT                   /product="exodeoxyribonuclease III protein xthA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23457"
FT                   /protein_id="ACT23457.1"
FT                   APVLVDLHAG"
FT   gene            complement(517154..518062)
FT                   /locus_tag="TBMG_00429"
FT                   /note="TBMG_00429.1"
FT   CDS_pept        complement(517154..518062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00429"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23458"
FT                   /protein_id="ACT23458.1"
FT   gene            complement(518062..518655)
FT                   /locus_tag="TBMG_00430"
FT                   /note="TBMG_00430.1"
FT   CDS_pept        complement(518062..518655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00430"
FT                   /product="polypeptide deformylase def"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23459"
FT                   /protein_id="ACT23459.1"
FT   gene            518848..519300
FT                   /locus_tag="TBMG_00431"
FT                   /note="TBMG_00431.1"
FT   CDS_pept        518848..519300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00431"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23460"
FT                   /protein_id="ACT23460.1"
FT   gene            519332..519826
FT                   /locus_tag="TBMG_00432"
FT                   /note="TBMG_00432.1"
FT   CDS_pept        519332..519826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00432"
FT                   /product="tuberculin related peptide"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23461"
FT                   /protein_id="ACT23461.1"
FT                   G"
FT   gene            519859..520581
FT                   /locus_tag="TBMG_00433"
FT                   /note="TBMG_00433.1"
FT   CDS_pept        519859..520581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00433"
FT                   /product="periplasmic superoxide dismutase [Cu-Zn] sodC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23462"
FT                   /protein_id="ACT23462.1"
FT                   LTTGDAGKRVACGVIGSG"
FT   gene            520583..521713
FT                   /locus_tag="TBMG_00434"
FT                   /note="TBMG_00434.1"
FT   CDS_pept        520583..521713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00434"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23463"
FT                   /protein_id="ACT23463.1"
FT   gene            521770..522426
FT                   /locus_tag="TBMG_00435"
FT                   /note="TBMG_00435.1"
FT   CDS_pept        521770..522426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00435"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23464"
FT                   /protein_id="ACT23464.1"
FT   gene            complement(522606..524792)
FT                   /locus_tag="TBMG_00436"
FT                   /note="TBMG_00436.1"
FT   CDS_pept        complement(522606..524792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00436"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00436"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23465"
FT                   /protein_id="ACT23465.1"
FT   gene            complement(524789..525649)
FT                   /locus_tag="TBMG_00437"
FT                   /note="TBMG_00437.1"
FT   CDS_pept        complement(524789..525649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00437"
FT                   /product="CDP-diacylglycerol-serine
FT                   O-phosphatidyltransferase pssA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00437"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23466"
FT                   /protein_id="ACT23466.1"
FT                   PGRRL"
FT   gene            complement(525646..526341)
FT                   /locus_tag="TBMG_00438"
FT                   /note="TBMG_00438.1"
FT   CDS_pept        complement(525646..526341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00438"
FT                   /product="phosphatidylserine decarboxylase psd"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00438"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23467"
FT                   /protein_id="ACT23467.1"
FT                   GETVLAECR"
FT   gene            complement(526402..527619)
FT                   /locus_tag="TBMG_00439"
FT                   /note="TBMG_00439.1"
FT   CDS_pept        complement(526402..527619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00439"
FT                   /product="molybdopterin biosynthesis protein moeA2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23468"
FT                   /protein_id="ACT23468.1"
FT                   QVWDLT"
FT   gene            complement(527638..528573)
FT                   /locus_tag="TBMG_00440"
FT                   /note="TBMG_00440.1"
FT   CDS_pept        complement(527638..528573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00440"
FT                   /product="dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23469"
FT                   /protein_id="ACT23469.1"
FT   gene            528867..530489
FT                   /locus_tag="TBMG_00441"
FT                   /note="TBMG_00441.1"
FT   CDS_pept        528867..530489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00441"
FT                   /product="60 kDa chaperonin 2 groEL2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23470"
FT                   /protein_id="ACT23470.1"
FT   gene            complement(530555..530983)
FT                   /locus_tag="TBMG_00442"
FT                   /note="TBMG_00442.1"
FT   CDS_pept        complement(530555..530983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23471"
FT                   /protein_id="ACT23471.1"
FT   gene            complement(531010..532473)
FT                   /locus_tag="TBMG_00443"
FT                   /note="TBMG_00443.1"
FT   CDS_pept        complement(531010..532473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00443"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23472"
FT                   /protein_id="ACT23472.1"
FT   gene            532613..533170
FT                   /locus_tag="TBMG_00444"
FT                   /note="TBMG_00444.1"
FT   CDS_pept        532613..533170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23473"
FT                   /protein_id="ACT23473.1"
FT   gene            complement(533350..534048)
FT                   /locus_tag="TBMG_00445"
FT                   /note="TBMG_00445.1"
FT   CDS_pept        complement(533350..534048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23474"
FT                   /protein_id="ACT23474.1"
FT                   GTILAELPLG"
FT   gene            complement(534092..534655)
FT                   /locus_tag="TBMG_00446"
FT                   /note="TBMG_00446.1"
FT   CDS_pept        complement(534092..534655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00446"
FT                   /product="alternative RNA polymerase sigma factor sigK"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23475"
FT                   /protein_id="ACT23475.1"
FT   gene            complement(534704..534892)
FT                   /locus_tag="TBMG_03985"
FT   CDS_pept        complement(534704..534892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03985"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03985"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23476"
FT                   /protein_id="ACT23476.1"
FT                   QRRTAYFVPRPPRSARR"
FT   gene            complement(534950..535486)
FT                   /locus_tag="TBMG_00447"
FT                   /note="TBMG_00447.1"
FT   CDS_pept        complement(534950..535486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00447"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23477"
FT                   /protein_id="ACT23477.1"
FT                   KSDPANRGVIMDRGL"
FT   gene            complement(535483..536766)
FT                   /locus_tag="TBMG_00448"
FT                   /note="TBMG_00448.1"
FT   CDS_pept        complement(535483..536766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00448"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase
FT                   ufaA1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23478"
FT                   /protein_id="ACT23478.1"
FT   gene            complement(536763..537428)
FT                   /locus_tag="TBMG_00449"
FT                   /note="TBMG_00449.1"
FT   CDS_pept        complement(536763..537428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00449"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23479"
FT                   /protein_id="ACT23479.1"
FT   gene            complement(537488..538807)
FT                   /locus_tag="TBMG_00450"
FT                   /note="TBMG_00450.1"
FT   CDS_pept        complement(537488..538807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23480"
FT                   /protein_id="ACT23480.1"
FT   gene            complement(538847..541750)
FT                   /locus_tag="TBMG_00451"
FT                   /note="TBMG_00451.1"
FT   CDS_pept        complement(538847..541750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00451"
FT                   /product="transmembrane transporter mmpL4"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23481"
FT                   /protein_id="ACT23481.1"
FT   gene            complement(541747..542169)
FT                   /locus_tag="TBMG_00452"
FT                   /note="TBMG_00452.1"
FT   CDS_pept        complement(541747..542169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00452"
FT                   /product="membrane protein mmpS4"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00452"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23482"
FT                   /protein_id="ACT23482.1"
FT   gene            542350..543111
FT                   /locus_tag="TBMG_00453"
FT                   /note="TBMG_00453.1"
FT   CDS_pept        542350..543111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00453"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00453"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23483"
FT                   /protein_id="ACT23483.1"
FT   gene            543433..544989
FT                   /locus_tag="TBMG_00454"
FT                   /note="TBMG_00454.1"
FT   CDS_pept        543433..544989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00454"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00454"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23484"
FT                   /protein_id="ACT23484.1"
FT                   D"
FT   gene            complement(544995..545549)
FT                   /locus_tag="TBMG_00455"
FT                   /note="TBMG_00455.1"
FT   CDS_pept        complement(544995..545549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23485"
FT                   /protein_id="ACT23485.1"
FT   gene            complement(545634..546161)
FT                   /locus_tag="TBMG_00456"
FT                   /note="TBMG_00456.1"
FT   CDS_pept        complement(545634..546161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00456"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23486"
FT                   /protein_id="ACT23486.1"
FT                   YPAGDMSVWNWA"
FT   gene            complement(546148..547062)
FT                   /locus_tag="TBMG_00457"
FT                   /note="TBMG_00457.1"
FT   CDS_pept        complement(546148..547062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00457"
FT                   /product="enoyl-CoA hydratase echA2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00457"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23487"
FT                   /protein_id="ACT23487.1"
FT   gene            complement(547335..547616)
FT                   /locus_tag="TBMG_03986"
FT                   /note="TBMG_00458.1"
FT   CDS_pept        complement(547335..547616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03986"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03986"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23488"
FT                   /protein_id="ACT23488.1"
FT   gene            complement(547603..547776)
FT                   /locus_tag="TBMG_03987"
FT                   /note="TBMG_00458.1"
FT   CDS_pept        complement(547603..547776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03987"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03987"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23489"
FT                   /protein_id="ACT23489.1"
FT                   RRFAANGVDAAR"
FT   gene            complement(547845..549875)
FT                   /locus_tag="TBMG_00459"
FT                   /note="TBMG_00459.1"
FT   CDS_pept        complement(547845..549875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00459"
FT                   /product="peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00459"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23490"
FT                   /protein_id="ACT23490.1"
FT   gene            549934..551457
FT                   /locus_tag="TBMG_00460"
FT                   /note="TBMG_00460.1"
FT   CDS_pept        549934..551457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00460"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23491"
FT                   /protein_id="ACT23491.1"
FT   gene            551457..551948
FT                   /locus_tag="TBMG_00461"
FT                   /note="TBMG_00461.1"
FT   CDS_pept        551457..551948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00461"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00461"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23492"
FT                   /protein_id="ACT23492.1"
FT                   "
FT   gene            551969..552247
FT                   /locus_tag="TBMG_00462"
FT                   /note="TBMG_00462.1"
FT   CDS_pept        551969..552247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00462"
FT                   /product="conserved hydrophobic protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00462"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23493"
FT                   /protein_id="ACT23493.1"
FT   gene            552240..552809
FT                   /locus_tag="TBMG_00463"
FT                   /note="TBMG_00463.1"
FT   CDS_pept        552240..552809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00463"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00463"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23494"
FT                   /protein_id="ACT23494.1"
FT   gene            552873..554267
FT                   /locus_tag="TBMG_00464"
FT                   /note="TBMG_00464.1"
FT   CDS_pept        552873..554267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00464"
FT                   /product="dihydrolipoamide dehydrogenase lpd"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00464"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23495"
FT                   /protein_id="ACT23495.1"
FT                   GHMINF"
FT   gene            554275..554568
FT                   /locus_tag="TBMG_00465"
FT                   /note="TBMG_00465.1"
FT   CDS_pept        554275..554568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00465"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23496"
FT                   /protein_id="ACT23496.1"
FT   gene            complement(554572..555144)
FT                   /locus_tag="TBMG_00466"
FT                   /note="TBMG_00466.1"
FT   CDS_pept        complement(554572..555144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00466"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23497"
FT                   /protein_id="ACT23497.1"
FT   gene            complement(555141..556565)
FT                   /locus_tag="TBMG_00467"
FT                   /note="TBMG_00467.1"
FT   CDS_pept        complement(555141..556565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00467"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00467"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23498"
FT                   /protein_id="ACT23498.1"
FT                   LDEHRSTVSPYLVKQL"
FT   gene            556717..557511
FT                   /locus_tag="TBMG_00468"
FT                   /note="TBMG_00468.1"
FT   CDS_pept        556717..557511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00468"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23499"
FT                   /protein_id="ACT23499.1"
FT   gene            557786..559072
FT                   /locus_tag="TBMG_00469"
FT                   /note="TBMG_00469.1"
FT   CDS_pept        557786..559072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00469"
FT                   /product="isocitrate lyase icl"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23500"
FT                   /protein_id="ACT23500.1"
FT   gene            559154..560014
FT                   /locus_tag="TBMG_00470"
FT                   /note="TBMG_00470.1"
FT   CDS_pept        559154..560014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00470"
FT                   /product="3-hydroxybutyryl-CoA dehydrogenase fadB2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23501"
FT                   /protein_id="ACT23501.1"
FT                   GFYTY"
FT   gene            560129..561007
FT                   /locus_tag="TBMG_00471"
FT                   /note="TBMG_00471.1"
FT   CDS_pept        560129..561007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00471"
FT                   /product="mycolic acid synthase umaA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23502"
FT                   /protein_id="ACT23502.1"
FT                   ISNVGQFTLTK"
FT   gene            complement(561107..561970)
FT                   /locus_tag="TBMG_00472"
FT                   /note="TBMG_00472.1"
FT   CDS_pept        complement(561107..561970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00472"
FT                   /product="mycolic acid synthase pcaA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00472"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23503"
FT                   /protein_id="ACT23503.1"
FT                   QFTLEK"
FT   gene            complement(562113..562553)
FT                   /locus_tag="TBMG_00473"
FT                   /note="TBMG_00473.1"
FT   CDS_pept        complement(562113..562553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00473"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23504"
FT                   /protein_id="ACT23504.1"
FT   gene            complement(562484..562972)
FT                   /locus_tag="TBMG_00474"
FT                   /note="TBMG_00474.1"
FT   CDS_pept        complement(562484..562972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23505"
FT                   /protein_id="ACT23505.1"
FT   gene            complement(562982..563752)
FT                   /locus_tag="TBMG_00475"
FT                   /note="TBMG_00475.1"
FT   CDS_pept        complement(562982..563752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00475"
FT                   /product="transcriptional regulator, tetR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23506"
FT                   /protein_id="ACT23506.1"
FT   gene            563823..565193
FT                   /locus_tag="TBMG_00476"
FT                   /note="TBMG_00476.1"
FT   CDS_pept        563823..565193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00476"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23507"
FT                   /protein_id="ACT23507.1"
FT   gene            565280..565702
FT                   /locus_tag="TBMG_00477"
FT                   /note="TBMG_00477.1"
FT   CDS_pept        565280..565702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00477"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23508"
FT                   /protein_id="ACT23508.1"
FT   gene            566041..566655
FT                   /locus_tag="TBMG_00478"
FT                   /note="TBMG_00478.1"
FT   CDS_pept        566041..566655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00478"
FT                   /product="iron-regulated heparin binding hemagglutinin
FT                   hbhA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23509"
FT                   /protein_id="ACT23509.1"
FT   gene            566767..567030
FT                   /locus_tag="TBMG_00479"
FT                   /note="TBMG_00479.1"
FT   CDS_pept        566767..567030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00479"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00479"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23510"
FT                   /protein_id="ACT23510.1"
FT   gene            567035..567481
FT                   /locus_tag="TBMG_00480"
FT                   /note="TBMG_00480.1"
FT   CDS_pept        567035..567481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00480"
FT                   /product="conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23511"
FT                   /protein_id="ACT23511.1"
FT   gene            567481..568155
FT                   /locus_tag="TBMG_00481"
FT                   /note="TBMG_00481.1"
FT   CDS_pept        567481..568155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00481"
FT                   /product="deoxyribose-phosphate aldolase deoC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23512"
FT                   /protein_id="ACT23512.1"
FT                   LS"
FT   gene            complement(568180..569226)
FT                   /locus_tag="TBMG_00482"
FT                   /note="TBMG_00482.1"
FT   CDS_pept        complement(568180..569226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00482"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23513"
FT                   /protein_id="ACT23513.1"
FT                   QNPCFSHI"
FT   gene            complement(569223..570065)
FT                   /locus_tag="TBMG_00483"
FT                   /note="TBMG_00483.1"
FT   CDS_pept        complement(569223..570065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00483"
FT                   /product="amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23514"
FT                   /protein_id="ACT23514.1"
FT   gene            complement(570191..570715)
FT                   /locus_tag="TBMG_00484"
FT                   /note="TBMG_00484.1"
FT   CDS_pept        complement(570191..570715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23515"
FT                   /protein_id="ACT23515.1"
FT                   RFTTLWITNNV"
FT   gene            570742..571851
FT                   /locus_tag="TBMG_00485"
FT                   /note="TBMG_00485.1"
FT   CDS_pept        570742..571851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00485"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase
FT                   MurB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23516"
FT                   /protein_id="ACT23516.1"
FT   gene            571913..573268
FT                   /locus_tag="TBMG_00486"
FT                   /note="TBMG_00486.1"
FT   CDS_pept        571913..573268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00486"
FT                   /product="lipoprotein lprQ"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00486"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23517"
FT                   /protein_id="ACT23517.1"
FT   gene            complement(573249..574004)
FT                   /locus_tag="TBMG_00487"
FT                   /note="TBMG_00487.1"
FT   CDS_pept        complement(573249..574004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00487"
FT                   /product="short-chain type oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00487"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23518"
FT                   /protein_id="ACT23518.1"
FT   gene            574187..575503
FT                   /locus_tag="TBMG_00488"
FT                   /note="TBMG_00488.1"
FT   CDS_pept        574187..575503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00488"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23519"
FT                   /protein_id="ACT23519.1"
FT   gene            575551..576993
FT                   /locus_tag="TBMG_00489"
FT                   /note="TBMG_00489.1"
FT   CDS_pept        575551..576993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00489"
FT                   /product="mannosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23520"
FT                   /db_xref="GOA:C6DT68"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR017814"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/Swiss-Prot:C6DT68"
FT                   /protein_id="ACT23520.1"
FT   gene            576990..577541
FT                   /locus_tag="TBMG_00490"
FT                   /note="TBMG_00490.1"
FT   CDS_pept        576990..577541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23521"
FT                   /protein_id="ACT23521.1"
FT   gene            577846..578472
FT                   /locus_tag="TBMG_00491"
FT                   /note="TBMG_00491.1"
FT   CDS_pept        577846..578472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00491"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23522"
FT                   /protein_id="ACT23522.1"
FT   gene            578608..579378
FT                   /locus_tag="TBMG_00492"
FT                   /note="TBMG_00492.1"
FT   CDS_pept        578608..579378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00492"
FT                   /product="phosphoglycerate mutase 1 gpm1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23523"
FT                   /protein_id="ACT23523.1"
FT   gene            579552..580784
FT                   /locus_tag="TBMG_00493"
FT                   /note="TBMG_00493.1"
FT   CDS_pept        579552..580784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00493"
FT                   /product="two component system sensor histidine kinase
FT                   senX3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23524"
FT                   /protein_id="ACT23524.1"
FT                   NRSQREEELSR"
FT   gene            complement(580700..580906)
FT                   /locus_tag="TBMG_00494"
FT                   /note="TBMG_00494.1"
FT   CDS_pept        complement(580700..580906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00494"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00494"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23525"
FT                   /protein_id="ACT23525.1"
FT   gene            580988..581671
FT                   /locus_tag="TBMG_00495"
FT                   /note="TBMG_00495.1"
FT   CDS_pept        580988..581671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00495"
FT                   /product="two component system sensor protein regX3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23526"
FT                   /protein_id="ACT23526.1"
FT                   YKLEG"
FT   gene            complement(581668..583557)
FT                   /locus_tag="TBMG_00496"
FT                   /note="TBMG_00496.1"
FT   CDS_pept        complement(581668..583557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00496"
FT                   /product="oxidoreductase gmc-type"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23527"
FT                   /protein_id="ACT23527.1"
FT   gene            complement(583554..583883)
FT                   /locus_tag="TBMG_00497"
FT                   /note="TBMG_00497.1"
FT   CDS_pept        complement(583554..583883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00497"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23528"
FT                   /protein_id="ACT23528.1"
FT                   LGRRI"
FT   gene            complement(583880..584869)
FT                   /locus_tag="TBMG_00498"
FT                   /note="TBMG_00498.1"
FT   CDS_pept        complement(583880..584869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00498"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23529"
FT                   /protein_id="ACT23529.1"
FT   gene            584874..585602
FT                   /locus_tag="TBMG_00499"
FT                   /note="TBMG_00499.1"
FT   CDS_pept        584874..585602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00499"
FT                   /product="transcriptional regulator, gntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23530"
FT                   /protein_id="ACT23530.1"
FT   gene            complement(585603..586493)
FT                   /locus_tag="TBMG_00500"
FT                   /note="TBMG_00500.1"
FT   CDS_pept        complement(585603..586493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23531"
FT                   /protein_id="ACT23531.1"
FT                   QLGLIAVHPATRAAQ"
FT   gene            586525..587559
FT                   /locus_tag="TBMG_00501"
FT                   /note="TBMG_00501.1"
FT   CDS_pept        586525..587559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00501"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23532"
FT                   /protein_id="ACT23532.1"
FT                   GSKP"
FT   gene            587556..588488
FT                   /locus_tag="TBMG_00502"
FT                   /note="TBMG_00502.1"
FT   CDS_pept        587556..588488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00502"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23533"
FT                   /protein_id="ACT23533.1"
FT   gene            588504..589346
FT                   /locus_tag="TBMG_00503"
FT                   /note="TBMG_00503.1"
FT   CDS_pept        588504..589346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23534"
FT                   /protein_id="ACT23534.1"
FT   gene            589362..590237
FT                   /locus_tag="TBMG_00504"
FT                   /note="TBMG_00504.1"
FT   CDS_pept        589362..590237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23535"
FT                   /protein_id="ACT23535.1"
FT                   TRQLAMVPAQ"
FT   gene            590262..591149
FT                   /locus_tag="TBMG_00505"
FT                   /note="TBMG_00505.1"
FT   CDS_pept        590262..591149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00505"
FT                   /product="pyrroline-5-carboxylate reductase proC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23536"
FT                   /protein_id="ACT23536.1"
FT                   AAKSRSEQLRITPE"
FT   gene            591290..591526
FT                   /locus_tag="TBMG_00506"
FT                   /note="TBMG_00506.1"
FT   CDS_pept        591290..591526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23537"
FT                   /protein_id="ACT23537.1"
FT   gene            591570..591755
FT                   /locus_tag="TBMG_00507"
FT                   /note="TBMG_00507.1"
FT   CDS_pept        591570..591755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23538"
FT                   /protein_id="ACT23538.1"
FT                   RKLLRRTRVQRRKLGK"
FT   gene            591833..592963
FT                   /locus_tag="TBMG_00508"
FT                   /note="TBMG_00508.1"
FT   CDS_pept        591833..592963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00508"
FT                   /product="UDP-glucose 4-epimerase galE2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23539"
FT                   /protein_id="ACT23539.1"
FT   gene            592970..594046
FT                   /locus_tag="TBMG_00509"
FT                   /note="TBMG_00509.1"
FT   CDS_pept        592970..594046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00509"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23540"
FT                   /protein_id="ACT23540.1"
FT                   IQQTLYRLLAGRRNIFFG"
FT   gene            complement(594050..595018)
FT                   /locus_tag="TBMG_00510"
FT                   /note="TBMG_00510.1"
FT   CDS_pept        complement(594050..595018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00510"
FT                   /product="cyclopropane-fatty-acyl-phospholipid synthase 2
FT                   cmaA2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23541"
FT                   /protein_id="ACT23541.1"
FT   gene            complement(594981..595481)
FT                   /locus_tag="TBMG_00511"
FT                   /note="TBMG_00511.1"
FT   CDS_pept        complement(594981..595481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23542"
FT                   /protein_id="ACT23542.1"
FT                   ASI"
FT   gene            complement(595643..596764)
FT                   /locus_tag="TBMG_00512"
FT                   /note="TBMG_00512.1"
FT   CDS_pept        complement(595643..596764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00512"
FT                   /product="phosphoserine phosphatase serB1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23543"
FT                   /protein_id="ACT23543.1"
FT   gene            596938..597381
FT                   /locus_tag="TBMG_00513"
FT                   /note="TBMG_00513.1"
FT   CDS_pept        596938..597381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00513"
FT                   /product="membrane protein mmpS2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00513"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23544"
FT                   /protein_id="ACT23544.1"
FT   gene            597378..600284
FT                   /locus_tag="TBMG_00514"
FT                   /note="TBMG_00514.1"
FT   CDS_pept        597378..600284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00514"
FT                   /product="transmembrane transporter mmpL2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00514"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23545"
FT                   /protein_id="ACT23545.1"
FT   gene            600277..600570
FT                   /locus_tag="TBMG_00515"
FT                   /note="TBMG_00515.1"
FT   CDS_pept        600277..600570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00515"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23546"
FT                   /protein_id="ACT23546.1"
FT   gene            600620..602026
FT                   /locus_tag="TBMG_00516"
FT                   /note="TBMG_00516.1"
FT   CDS_pept        600620..602026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00516"
FT                   /product="glutamyl-tRNA reductase hemA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00516"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23547"
FT                   /protein_id="ACT23547.1"
FT                   QSSPKRSPSN"
FT   gene            602027..602965
FT                   /locus_tag="TBMG_00517"
FT                   /note="TBMG_00517.1"
FT   CDS_pept        602027..602965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00517"
FT                   /product="porphobilinogen deaminase hemC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23548"
FT                   /protein_id="ACT23548.1"
FT   gene            602989..604695
FT                   /locus_tag="TBMG_00518"
FT                   /note="TBMG_00518.1"
FT   CDS_pept        602989..604695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00518"
FT                   /product="uroporphyrin-III C-methyltransferase hemD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00518"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23549"
FT                   /protein_id="ACT23549.1"
FT   gene            604781..605770
FT                   /locus_tag="TBMG_00519"
FT                   /note="TBMG_00519.1"
FT   CDS_pept        604781..605770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00519"
FT                   /product="delta-aminolevulinic acid dehydratase hemB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00519"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23550"
FT                   /protein_id="ACT23550.1"
FT   gene            605783..606331
FT                   /locus_tag="TBMG_00520"
FT                   /note="TBMG_00520.1"
FT   CDS_pept        605783..606331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00520"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23551"
FT                   /protein_id="ACT23551.1"
FT   gene            606328..606627
FT                   /locus_tag="TBMG_00521"
FT                   /note="TBMG_00521.1"
FT   CDS_pept        606328..606627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00521"
FT                   /product="transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23552"
FT                   /protein_id="ACT23552.1"
FT   gene            606706..608241
FT                   /locus_tag="TBMG_00522"
FT                   /note="TBMG_00522.1"
FT   CDS_pept        606706..608241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00522"
FT                   /product="13E12 repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23553"
FT                   /protein_id="ACT23553.1"
FT   gene            complement(608238..608714)
FT                   /locus_tag="TBMG_00523"
FT                   /note="TBMG_00523.1"
FT   CDS_pept        complement(608238..608714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00523"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00523"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23554"
FT                   /protein_id="ACT23554.1"
FT   gene            608925..610235
FT                   /locus_tag="TBMG_00524"
FT                   /note="TBMG_00524.1"
FT   CDS_pept        608925..610235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00524"
FT                   /product="membrane acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00524"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23555"
FT                   /protein_id="ACT23555.1"
FT   gene            610367..611062
FT                   /locus_tag="TBMG_00525"
FT                   /note="TBMG_00525.1"
FT   CDS_pept        610367..611062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00525"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23556"
FT                   /protein_id="ACT23556.1"
FT                   PLISMELVG"
FT   gene            complement(611351..612253)
FT                   /locus_tag="TBMG_00526"
FT                   /note="TBMG_00526.1"
FT   CDS_pept        complement(611351..612253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00526"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00526"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23557"
FT                   /protein_id="ACT23557.1"
FT   gene            612434..612784
FT                   /locus_tag="TBMG_00527"
FT                   /note="TBMG_00527.1"
FT   CDS_pept        612434..612784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00527"
FT                   /product="methyltransferase/methylase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23558"
FT                   /protein_id="ACT23558.1"
FT                   NLRDLGSMRFYA"
FT   gene            612777..613082
FT                   /locus_tag="TBMG_00528"
FT                   /note="TBMG_00528.1"
FT   CDS_pept        612777..613082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00528"
FT                   /product="methyltransferase/methylase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00528"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23559"
FT                   /protein_id="ACT23559.1"
FT   gene            613217..614521
FT                   /locus_tag="TBMG_00529"
FT                   /note="TBMG_00529.1"
FT   CDS_pept        613217..614521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00529"
FT                   /product="gabA permease gabP"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23560"
FT                   /protein_id="ACT23560.1"
FT   gene            complement(614505..614909)
FT                   /locus_tag="TBMG_00530"
FT                   /note="TBMG_00530.1"
FT   CDS_pept        complement(614505..614909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23561"
FT                   /protein_id="ACT23561.1"
FT   gene            615014..616402
FT                   /locus_tag="TBMG_00531"
FT                   /note="TBMG_00531.1"
FT   CDS_pept        615014..616402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00531"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase hemL"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23562"
FT                   /protein_id="ACT23562.1"
FT                   ERPA"
FT   gene            616402..617010
FT                   /locus_tag="TBMG_00532"
FT                   /note="TBMG_00532.1"
FT   CDS_pept        616402..617010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23563"
FT                   /protein_id="ACT23563.1"
FT   gene            617025..617675
FT                   /locus_tag="TBMG_00533"
FT                   /note="TBMG_00533.1"
FT   CDS_pept        617025..617675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00533"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00533"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23564"
FT                   /protein_id="ACT23564.1"
FT   gene            617672..618451
FT                   /locus_tag="TBMG_00534"
FT                   /note="TBMG_00534.1"
FT   CDS_pept        617672..618451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00534"
FT                   /product="cytochrome C biogenesis protein ccdA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23565"
FT                   /protein_id="ACT23565.1"
FT   gene            618484..620073
FT                   /locus_tag="TBMG_00535"
FT                   /note="TBMG_00535.1"
FT   CDS_pept        618484..620073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00535"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23566"
FT                   /protein_id="ACT23566.1"
FT                   AEAAAGTGRDVD"
FT   gene            620070..621044
FT                   /locus_tag="TBMG_00536"
FT                   /note="TBMG_00536.1"
FT   CDS_pept        620070..621044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00536"
FT                   /product="cytochrome C biogenesis protein ccsA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23567"
FT                   /protein_id="ACT23567.1"
FT   gene            621086..622303
FT                   /locus_tag="TBMG_00537"
FT                   /note="TBMG_00537.1"
FT   CDS_pept        621086..622303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00537"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23568"
FT                   /protein_id="ACT23568.1"
FT                   CKPSFT"
FT   gene            622508..622825
FT                   /locus_tag="TBMG_00538"
FT                   /note="TBMG_00538.1"
FT   CDS_pept        622508..622825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00538"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23569"
FT                   /protein_id="ACT23569.1"
FT                   Q"
FT   gene            622972..624840
FT                   /locus_tag="TBMG_03988"
FT   CDS_pept        622972..624840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03988"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03988"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23570"
FT                   /protein_id="ACT23570.1"
FT   gene            complement(624736..625743)
FT                   /locus_tag="TBMG_00539"
FT                   /note="TBMG_00539.1"
FT   CDS_pept        complement(624736..625743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00539"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III
FT                   fabH"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23571"
FT                   /protein_id="ACT23571.1"
FT   gene            complement(625911..626702)
FT                   /locus_tag="TBMG_00540"
FT                   /note="TBMG_00540.1"
FT   CDS_pept        complement(625911..626702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00540"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase
FT                   menA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23572"
FT                   /protein_id="ACT23572.1"
FT   gene            626719..627513
FT                   /locus_tag="TBMG_00541"
FT                   /note="TBMG_00541.1"
FT   CDS_pept        626719..627513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00541"
FT                   /product="5-methylthioadenosine phosphorylase pnp"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23573"
FT                   /protein_id="ACT23573.1"
FT   gene            627554..628549
FT                   /locus_tag="TBMG_00542"
FT                   /note="TBMG_00542.1"
FT   CDS_pept        627554..628549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00542"
FT                   /product="UDP-glucose 4-epimerase galE3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23574"
FT                   /protein_id="ACT23574.1"
FT   gene            complement(628559..629992)
FT                   /locus_tag="TBMG_00543"
FT                   /note="TBMG_00543.1"
FT   CDS_pept        complement(628559..629992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00543"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23575"
FT                   /protein_id="ACT23575.1"
FT   gene            630301..631947
FT                   /locus_tag="TBMG_00544"
FT                   /note="TBMG_00544.1"
FT   CDS_pept        630301..631947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00544"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23576"
FT                   /protein_id="ACT23576.1"
FT   gene            631980..632636
FT                   /locus_tag="TBMG_00545"
FT                   /note="TBMG_00545.1"
FT   CDS_pept        631980..632636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00545"
FT                   /product="dolichyl-phosphate sugar synthase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23577"
FT                   /protein_id="ACT23577.1"
FT   gene            632633..633295
FT                   /locus_tag="TBMG_00546"
FT                   /note="TBMG_00546.1"
FT   CDS_pept        632633..633295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00546"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23578"
FT                   /protein_id="ACT23578.1"
FT   gene            complement(633316..634665)
FT                   /locus_tag="TBMG_00547"
FT                   /note="TBMG_00547.1"
FT   CDS_pept        complement(633316..634665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00547"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23579"
FT                   /protein_id="ACT23579.1"
FT   gene            complement(634677..635765)
FT                   /locus_tag="TBMG_00548"
FT                   /note="TBMG_00548.1"
FT   CDS_pept        complement(634677..635765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00548"
FT                   /product="O-succinylbenzoic acid-CoA ligase menE"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23580"
FT                   /protein_id="ACT23580.1"
FT   gene            complement(635834..636136)
FT                   /locus_tag="TBMG_00549"
FT                   /note="TBMG_00549.1"
FT   CDS_pept        complement(635834..636136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00549"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23581"
FT                   /protein_id="ACT23581.1"
FT   gene            complement(636196..636474)
FT                   /locus_tag="TBMG_00550"
FT                   /note="TBMG_00550.1"
FT   CDS_pept        complement(636196..636474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00550"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23582"
FT                   /protein_id="ACT23582.1"
FT   gene            complement(636471..637724)
FT                   /locus_tag="TBMG_00551"
FT                   /note="TBMG_00551.1"
FT   CDS_pept        complement(636471..637724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00551"
FT                   /product="low affinity inorganic phosphate transporter
FT                   membrane protein pitA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23583"
FT                   /protein_id="ACT23583.1"
FT                   PPPNHRAPQFGVTTRNAP"
FT   gene            complement(637844..638230)
FT                   /locus_tag="TBMG_00552"
FT                   /note="TBMG_00552.1"
FT   CDS_pept        complement(637844..638230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00552"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23584"
FT                   /protein_id="ACT23584.1"
FT   gene            complement(638293..639177)
FT                   /locus_tag="TBMG_00553"
FT                   /note="TBMG_00553.1"
FT   CDS_pept        complement(638293..639177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00553"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00553"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23585"
FT                   /protein_id="ACT23585.1"
FT                   NALMQRRNEQLNP"
FT   gene            complement(639273..640217)
FT                   /locus_tag="TBMG_00554"
FT                   /note="TBMG_00554.1"
FT   CDS_pept        complement(639273..640217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00554"
FT                   /product="naphthoate synthase menB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23586"
FT                   /protein_id="ACT23586.1"
FT   gene            complement(640489..640902)
FT                   /locus_tag="TBMG_00555"
FT                   /note="TBMG_00555.1"
FT   CDS_pept        complement(640489..640902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00555"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23587"
FT                   /protein_id="ACT23587.1"
FT   gene            complement(640899..641165)
FT                   /locus_tag="TBMG_03989"
FT   CDS_pept        complement(640899..641165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03989"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03989"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23588"
FT                   /protein_id="ACT23588.1"
FT   gene            complement(641357..643072)
FT                   /locus_tag="TBMG_00556"
FT                   /note="TBMG_00556.1"
FT   CDS_pept        complement(641357..643072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00556"
FT                   /product="fatty-acid-CoA ligase fadD8"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00556"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23589"
FT                   /protein_id="ACT23589.1"
FT   gene            643141..644754
FT                   /locus_tag="TBMG_00557"
FT                   /note="TBMG_00557.1"
FT   CDS_pept        643141..644754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00557"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23590"
FT                   /protein_id="ACT23590.1"
FT   gene            644751..645731
FT                   /locus_tag="TBMG_00558"
FT                   /note="TBMG_00558.1"
FT   CDS_pept        644751..645731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00558"
FT                   /product="muconate cycloisomerase menC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00558"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23591"
FT                   /protein_id="ACT23591.1"
FT   gene            645728..646516
FT                   /locus_tag="TBMG_00559"
FT                   /note="TBMG_00559.1"
FT   CDS_pept        645728..646516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00559"
FT                   /product="peroxidase bpoC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23592"
FT                   /protein_id="ACT23592.1"
FT   gene            646559..648223
FT                   /locus_tag="TBMG_00560"
FT                   /note="TBMG_00560.1"
FT   CDS_pept        646559..648223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00560"
FT                   /product="bifunctional menaquinone biosynthesis protein
FT                   menD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23593"
FT                   /protein_id="ACT23593.1"
FT   gene            648220..648735
FT                   /locus_tag="TBMG_00561"
FT                   /note="TBMG_00561.1"
FT   CDS_pept        648220..648735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00561"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23594"
FT                   /protein_id="ACT23594.1"
FT                   ENSASATG"
FT   gene            648797..649933
FT                   /locus_tag="TBMG_00562"
FT                   /note="TBMG_00562.1"
FT   CDS_pept        648797..649933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00562"
FT                   /product="mannosyltransferase pimB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23595"
FT                   /protein_id="ACT23595.1"
FT   gene            649950..650654
FT                   /locus_tag="TBMG_00563"
FT                   /note="TBMG_00563.1"
FT   CDS_pept        649950..650654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00563"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase menH"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00563"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23596"
FT                   /protein_id="ACT23596.1"
FT                   HAGYKPGKQTPQ"
FT   gene            complement(650668..651006)
FT                   /locus_tag="TBMG_00564"
FT                   /note="TBMG_00564.1"
FT   CDS_pept        complement(650668..651006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00564"
FT                   /product="conserved secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00564"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23597"
FT                   /protein_id="ACT23597.1"
FT                   VLQRAGTR"
FT   gene            complement(651040..651765)
FT                   /locus_tag="TBMG_00565"
FT                   /note="TBMG_00565.1"
FT   CDS_pept        complement(651040..651765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00565"
FT                   /product="benzoquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23598"
FT                   /protein_id="ACT23598.1"
FT   gene            complement(651790..653016)
FT                   /locus_tag="TBMG_00566"
FT                   /note="TBMG_00566.1"
FT   CDS_pept        complement(651790..653016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00566"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00566"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23599"
FT                   /protein_id="ACT23599.1"
FT                   LVDRRPPFS"
FT   gene            653032..654039
FT                   /locus_tag="TBMG_00567"
FT                   /note="TBMG_00567.1"
FT   CDS_pept        653032..654039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00567"
FT                   /product="polyprenyl-diphosphate synthase grcC1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00567"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23600"
FT                   /protein_id="ACT23600.1"
FT   gene            654140..655000
FT                   /locus_tag="TBMG_00568"
FT                   /note="TBMG_00568.1"
FT   CDS_pept        654140..655000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00568"
FT                   /product="protease transmembrane protein heat shock protein
FT                   htpX"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00568"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23601"
FT                   /protein_id="ACT23601.1"
FT                   AMARG"
FT   gene            complement(655185..656270)
FT                   /locus_tag="TBMG_00569"
FT                   /note="TBMG_00569.1"
FT   CDS_pept        complement(655185..656270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00569"
FT                   /product="glycerol-3-phosphate dehydrogenase [NAD(P)+]
FT                   gpdA1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23602"
FT                   /protein_id="ACT23602.1"
FT   gene            complement(656271..657731)
FT                   /locus_tag="TBMG_00570"
FT                   /note="TBMG_00570.1"
FT   CDS_pept        complement(656271..657731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00570"
FT                   /product="monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23603"
FT                   /protein_id="ACT23603.1"
FT   gene            complement(657809..658300)
FT                   /locus_tag="TBMG_00571"
FT                   /note="TBMG_00571.1"
FT   CDS_pept        complement(657809..658300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00571"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23604"
FT                   /protein_id="ACT23604.1"
FT                   "
FT   gene            658370..658453
FT                   /locus_tag="TBMG_05005"
FT   tRNA            658370..658453
FT                   /locus_tag="TBMG_05005"
FT                   /product="tRNA-Tyr"
FT   gene            658579..659601
FT                   /locus_tag="TBMG_00572"
FT                   /note="TBMG_00572.1"
FT   CDS_pept        658579..659601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00572"
FT                   /product="methyltransferase/methylase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00572"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23605"
FT                   /protein_id="ACT23605.1"
FT                   "
FT   gene            659711..661129
FT                   /locus_tag="TBMG_00573"
FT                   /note="TBMG_00573.1"
FT   CDS_pept        659711..661129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00573"
FT                   /product="cytochrome P450 135B1 cyp135B1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23606"
FT                   /protein_id="ACT23606.1"
FT                   AARGGGPSRAVGSQ"
FT   gene            661195..661530
FT                   /locus_tag="TBMG_00574"
FT                   /note="TBMG_00574.1"
FT   CDS_pept        661195..661530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23607"
FT                   /protein_id="ACT23607.1"
FT                   ILHARGT"
FT   gene            661514..663634
FT                   /locus_tag="TBMG_00575"
FT                   /note="TBMG_00575.1"
FT   CDS_pept        661514..663634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00575"
FT                   /product="ribonucleoside-diphosphate reductase large
FT                   subunit nrdZ"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23608"
FT                   /protein_id="ACT23608.1"
FT                   FSGGCAGRSCEF"
FT   gene            complement(663748..665079)
FT                   /locus_tag="TBMG_00576"
FT                   /note="TBMG_00576.1"
FT   CDS_pept        complement(663748..665079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00576"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23609"
FT                   /protein_id="ACT23609.1"
FT   gene            complement(665303..665644)
FT                   /locus_tag="TBMG_00577"
FT                   /note="TBMG_00577.1"
FT   CDS_pept        complement(665303..665644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00577"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23610"
FT                   /protein_id="ACT23610.1"
FT                   SRSPQSDDL"
FT   gene            complement(665695..665862)
FT                   /locus_tag="TBMG_03990"
FT   CDS_pept        complement(665695..665862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03990"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03990"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23611"
FT                   /protein_id="ACT23611.1"
FT                   PHPGEHVPRS"
FT   gene            complement(666112..667503)
FT                   /locus_tag="TBMG_00578"
FT                   /note="TBMG_00578.1"
FT   CDS_pept        complement(666112..667503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00578"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00578"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23612"
FT                   /protein_id="ACT23612.1"
FT                   KAKRP"
FT   gene            complement(667513..668655)
FT                   /locus_tag="TBMG_00579"
FT                   /note="TBMG_00579.1"
FT   CDS_pept        complement(667513..668655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00579"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23613"
FT                   /protein_id="ACT23613.1"
FT   gene            complement(668840..670006)
FT                   /locus_tag="TBMG_00580"
FT                   /note="TBMG_00580.1"
FT   CDS_pept        complement(668840..670006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00580"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23614"
FT                   /protein_id="ACT23614.1"
FT   gene            670100..671413
FT                   /locus_tag="TBMG_00581"
FT                   /note="TBMG_00581.1"
FT   CDS_pept        670100..671413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00581"
FT                   /product="transcriptional regulator, arsR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00581"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23615"
FT                   /protein_id="ACT23615.1"
FT   gene            671427..672212
FT                   /locus_tag="TBMG_00582"
FT                   /note="TBMG_00582.1"
FT   CDS_pept        671427..672212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00582"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00582"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23616"
FT                   /protein_id="ACT23616.1"
FT   gene            complement(672257..676168)
FT                   /locus_tag="TBMG_03991"
FT                   /note="TBMG_00584.1"
FT   CDS_pept        complement(672257..676168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03991"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03991"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23617"
FT                   /protein_id="ACT23617.1"
FT   gene            676284..676562
FT                   /locus_tag="TBMG_00585"
FT                   /note="TBMG_00585.1"
FT   CDS_pept        676284..676562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00585"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00585"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23618"
FT                   /protein_id="ACT23618.1"
FT   gene            676490..677248
FT                   /locus_tag="TBMG_00586"
FT                   /note="TBMG_00586.1"
FT   CDS_pept        676490..677248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00586"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00586"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23619"
FT                   /protein_id="ACT23619.1"
FT   gene            complement(677377..677955)
FT                   /locus_tag="TBMG_00587"
FT                   /note="TBMG_00587.1"
FT   CDS_pept        complement(677377..677955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00587"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23620"
FT                   /protein_id="ACT23620.1"
FT   gene            677962..678177
FT                   /locus_tag="TBMG_00588"
FT                   /note="TBMG_00588.1"
FT   CDS_pept        677962..678177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00588"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00588"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23621"
FT                   /protein_id="ACT23621.1"
FT   gene            678174..678581
FT                   /locus_tag="TBMG_00589"
FT                   /note="TBMG_00589.1"
FT   CDS_pept        678174..678581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00589"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00589"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23622"
FT                   /protein_id="ACT23622.1"
FT   gene            complement(678641..679327)
FT                   /locus_tag="TBMG_00590"
FT                   /note="TBMG_00590.1"
FT   CDS_pept        complement(678641..679327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00590"
FT                   /product="lipoprotein lpqN"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00590"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23623"
FT                   /protein_id="ACT23623.1"
FT                   QTTITP"
FT   gene            679481..682114
FT                   /locus_tag="TBMG_00591"
FT                   /note="TBMG_00591.1"
FT   CDS_pept        679481..682114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00591"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00591"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23624"
FT                   /protein_id="ACT23624.1"
FT                   VAEAVE"
FT   gene            complement(682137..684524)
FT                   /locus_tag="TBMG_00592"
FT                   /note="TBMG_00592.1"
FT   CDS_pept        complement(682137..684524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00592"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00592"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23625"
FT                   /protein_id="ACT23625.1"
FT   gene            684662..685384
FT                   /locus_tag="TBMG_00593"
FT                   /note="TBMG_00593.1"
FT   CDS_pept        684662..685384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00593"
FT                   /product="transcriptional regulator, gntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00593"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23626"
FT                   /protein_id="ACT23626.1"
FT                   ELANTSLMAVLVSQASRQ"
FT   gene            685381..686178
FT                   /locus_tag="TBMG_00594"
FT                   /note="TBMG_00594.1"
FT   CDS_pept        685381..686178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00594"
FT                   /product="hypothetical membrane protein yrbE2A"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00594"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23627"
FT                   /protein_id="ACT23627.1"
FT   gene            686180..687067
FT                   /locus_tag="TBMG_00595"
FT                   /note="TBMG_00595.1"
FT   CDS_pept        686180..687067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00595"
FT                   /product="hypothetical membrane protein yrbE2B"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00595"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23628"
FT                   /protein_id="ACT23628.1"
FT                   LALYGVDPNFNLTV"
FT   gene            687073..688287
FT                   /locus_tag="TBMG_00596"
FT                   /note="TBMG_00596.1"
FT   CDS_pept        687073..688287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00596"
FT                   /product="MCE-family protein mce2A"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00596"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23629"
FT                   /protein_id="ACT23629.1"
FT                   NTINP"
FT   gene            688284..689111
FT                   /locus_tag="TBMG_00597"
FT                   /note="TBMG_00597.1"
FT   CDS_pept        688284..689111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00597"
FT                   /product="MCE-family protein mce2B"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00597"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23630"
FT                   /protein_id="ACT23630.1"
FT   gene            689060..689314
FT                   /locus_tag="TBMG_00598"
FT                   /note="TBMG_00598.1"
FT   CDS_pept        689060..689314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00598"
FT                   /product="MCE-family related protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00598"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23631"
FT                   /protein_id="ACT23631.1"
FT   gene            689311..690756
FT                   /locus_tag="TBMG_00599"
FT                   /note="TBMG_00599.1"
FT   CDS_pept        689311..690756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00599"
FT                   /product="MCE-family protein mce2C"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00599"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23632"
FT                   /protein_id="ACT23632.1"
FT   gene            690753..692279
FT                   /locus_tag="TBMG_00600"
FT                   /note="TBMG_00600.1"
FT   CDS_pept        690753..692279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00600"
FT                   /product="MCE-family protein mce2D"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23633"
FT                   /protein_id="ACT23633.1"
FT   gene            692276..693484
FT                   /locus_tag="TBMG_00601"
FT                   /note="TBMG_00601.1"
FT   CDS_pept        692276..693484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00601"
FT                   /product="MCE-family lipoprotein mce2E"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00601"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23634"
FT                   /protein_id="ACT23634.1"
FT                   RAE"
FT   gene            693489..695039
FT                   /locus_tag="TBMG_00602"
FT                   /note="TBMG_00602.1"
FT   CDS_pept        693489..695039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00602"
FT                   /product="MCE-family protein mce2F"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00602"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23635"
FT                   /protein_id="ACT23635.1"
FT   gene            complement(695091..695483)
FT                   /locus_tag="TBMG_00603"
FT                   /note="TBMG_00603.1"
FT   CDS_pept        complement(695091..695483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00603"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00603"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23636"
FT                   /protein_id="ACT23636.1"
FT   gene            complement(695480..695737)
FT                   /locus_tag="TBMG_00604"
FT                   /note="TBMG_00604.1"
FT   CDS_pept        complement(695480..695737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00604"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00604"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23637"
FT                   /protein_id="ACT23637.1"
FT   gene            complement(695920..697155)
FT                   /locus_tag="TBMG_00605"
FT                   /note="TBMG_00605.1"
FT   CDS_pept        complement(695920..697155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00605"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23638"
FT                   /protein_id="ACT23638.1"
FT                   LAALPVSTLWAG"
FT   gene            complement(697406..697819)
FT                   /locus_tag="TBMG_00606"
FT                   /note="TBMG_00606.1"
FT   CDS_pept        complement(697406..697819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00606"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00606"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23639"
FT                   /protein_id="ACT23639.1"
FT   gene            complement(697816..698052)
FT                   /locus_tag="TBMG_00607"
FT                   /note="TBMG_00607.1"
FT   CDS_pept        complement(697816..698052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00607"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00607"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23640"
FT                   /protein_id="ACT23640.1"
FT   gene            complement(698156..699289)
FT                   /locus_tag="TBMG_00608"
FT                   /note="TBMG_00608.1"
FT   CDS_pept        complement(698156..699289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00608"
FT                   /product="two component system sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00608"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23641"
FT                   /protein_id="ACT23641.1"
FT   gene            complement(699290..700051)
FT                   /locus_tag="TBMG_00609"
FT                   /note="TBMG_00609.1"
FT   CDS_pept        complement(699290..700051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00609"
FT                   /product="two component system transcriptional regulator
FT                   tcrA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00609"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23642"
FT                   /protein_id="ACT23642.1"
FT   gene            700108..700419
FT                   /locus_tag="TBMG_00610"
FT                   /note="TBMG_00610.1"
FT   CDS_pept        700108..700419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00610"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00610"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23643"
FT                   /protein_id="ACT23643.1"
FT   gene            700515..701441
FT                   /locus_tag="TBMG_00611"
FT                   /note="TBMG_00611.1"
FT   CDS_pept        700515..701441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00611"
FT                   /product="lipoprotein lpqO"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00611"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23644"
FT                   /protein_id="ACT23644.1"
FT   gene            701658..702266
FT                   /locus_tag="TBMG_00612"
FT                   /note="TBMG_00612.1"
FT   CDS_pept        701658..702266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00612"
FT                   /product="resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00612"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23645"
FT                   /protein_id="ACT23645.1"
FT   gene            702268..703011
FT                   /locus_tag="TBMG_00613"
FT                   /note="TBMG_00613.1"
FT   CDS_pept        702268..703011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00613"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00613"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23646"
FT                   /protein_id="ACT23646.1"
FT   gene            702981..703451
FT                   /locus_tag="TBMG_00614"
FT                   /note="TBMG_00614.1"
FT   CDS_pept        702981..703451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00614"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00614"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23647"
FT                   /protein_id="ACT23647.1"
FT   gene            703496..703741
FT                   /locus_tag="TBMG_00615"
FT                   /note="TBMG_00615.1"
FT   CDS_pept        703496..703741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00615"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00615"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23648"
FT                   /protein_id="ACT23648.1"
FT   gene            703738..704139
FT                   /locus_tag="TBMG_03992"
FT                   /note="TBMG_00616.1"
FT   CDS_pept        703738..704139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03992"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03992"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23649"
FT                   /protein_id="ACT23649.1"
FT   gene            704082..704309
FT                   /locus_tag="TBMG_03993"
FT                   /note="TBMG_00616.1"
FT   CDS_pept        704082..704309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03993"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03993"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23650"
FT                   /protein_id="ACT23650.1"
FT   gene            704237..704464
FT                   /locus_tag="TBMG_03994"
FT                   /note="TBMG_00616.1"
FT   CDS_pept        704237..704464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03994"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03994"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23651"
FT                   /protein_id="ACT23651.1"
FT   gene            704676..705011
FT                   /locus_tag="TBMG_00617"
FT                   /note="TBMG_00617.1"
FT   CDS_pept        704676..705011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00617"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00617"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23652"
FT                   /protein_id="ACT23652.1"
FT                   GAAASFT"
FT   gene            complement(705004..706161)
FT                   /locus_tag="TBMG_00618"
FT                   /note="TBMG_00618.1"
FT   CDS_pept        complement(705004..706161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00618"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00618"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23653"
FT                   /protein_id="ACT23653.1"
FT   gene            complement(706213..706596)
FT                   /locus_tag="TBMG_00619"
FT                   /note="TBMG_00619.1"
FT   CDS_pept        complement(706213..706596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00619"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00619"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23655"
FT                   /protein_id="ACT23655.1"
FT   gene            706576..707181
FT                   /locus_tag="TBMG_00620"
FT                   /note="TBMG_00620.1"
FT   CDS_pept        706576..707181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00620"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23654"
FT                   /protein_id="ACT23654.1"
FT   gene            complement(707200..709767)
FT                   /locus_tag="TBMG_00621"
FT                   /note="TBMG_00621.1"
FT   CDS_pept        complement(707200..709767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00621"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23657"
FT                   /protein_id="ACT23657.1"
FT   gene            709707..710600
FT                   /locus_tag="TBMG_00622"
FT                   /note="TBMG_00622.1"
FT   CDS_pept        709707..710600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00622"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23656"
FT                   /protein_id="ACT23656.1"
FT                   AATAGVSLLQCLVGSK"
FT   gene            710597..710839
FT                   /locus_tag="TBMG_00623"
FT                   /note="TBMG_00623.1"
FT   CDS_pept        710597..710839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00623"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00623"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23658"
FT                   /protein_id="ACT23658.1"
FT   gene            complement(710836..711102)
FT                   /locus_tag="TBMG_00624"
FT                   /note="TBMG_00624.1"
FT   CDS_pept        complement(710836..711102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00624"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23660"
FT                   /protein_id="ACT23660.1"
FT   gene            711034..711261
FT                   /locus_tag="TBMG_00625"
FT                   /note="TBMG_00625.1"
FT   CDS_pept        711034..711261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00625"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00625"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23659"
FT                   /protein_id="ACT23659.1"
FT   gene            711258..711659
FT                   /locus_tag="TBMG_00626"
FT                   /note="TBMG_00626.1"
FT   CDS_pept        711258..711659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00626"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00626"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23661"
FT                   /protein_id="ACT23661.1"
FT   gene            711788..712483
FT                   /locus_tag="TBMG_00627"
FT                   /note="TBMG_00627.1"
FT   CDS_pept        711788..712483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00627"
FT                   /product="galactose-1-phosphate uridylyltransferase galTa"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00627"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23662"
FT                   /protein_id="ACT23662.1"
FT                   TARFTPIRI"
FT   gene            712501..712971
FT                   /locus_tag="TBMG_00628"
FT                   /note="TBMG_00628.1"
FT   CDS_pept        712501..712971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00628"
FT                   /product="galactose-1-phosphate uridylyltransferase galTb"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00628"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23663"
FT                   /protein_id="ACT23663.1"
FT   gene            712968..714059
FT                   /locus_tag="TBMG_00629"
FT                   /note="TBMG_00629.1"
FT   CDS_pept        712968..714059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00629"
FT                   /product="galactokinase galK"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00629"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23664"
FT                   /protein_id="ACT23664.1"
FT   gene            714445..715518
FT                   /locus_tag="TBMG_00630"
FT                   /note="TBMG_00630.1"
FT   CDS_pept        714445..715518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00630"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23665"
FT                   /protein_id="ACT23665.1"
FT                   WVTVVGPAQPTAAEANR"
FT   gene            715544..716569
FT                   /locus_tag="TBMG_00631"
FT                   /note="TBMG_00631.1"
FT   CDS_pept        715544..716569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00631"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00631"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23666"
FT                   /protein_id="ACT23666.1"
FT                   G"
FT   gene            716662..716916
FT                   /locus_tag="TBMG_00632"
FT                   /note="TBMG_00632.1"
FT   CDS_pept        716662..716916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00632"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00632"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23667"
FT                   /protein_id="ACT23667.1"
FT   gene            716916..717311
FT                   /locus_tag="TBMG_00633"
FT                   /note="TBMG_00633.1"
FT   CDS_pept        716916..717311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00633"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00633"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23668"
FT                   /protein_id="ACT23668.1"
FT   gene            complement(717405..718145)
FT                   /locus_tag="TBMG_00634"
FT                   /note="TBMG_00634.1"
FT   CDS_pept        complement(717405..718145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00634"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00634"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23669"
FT                   /protein_id="ACT23669.1"
FT   gene            718277..718537
FT                   /locus_tag="TBMG_00635"
FT                   /note="TBMG_00635.1"
FT   CDS_pept        718277..718537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00635"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00635"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23670"
FT                   /protein_id="ACT23670.1"
FT   gene            718534..718941
FT                   /locus_tag="TBMG_00636"
FT                   /note="TBMG_00636.1"
FT   CDS_pept        718534..718941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00636"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00636"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23671"
FT                   /protein_id="ACT23671.1"
FT   gene            complement(719013..720164)
FT                   /locus_tag="TBMG_00637"
FT                   /note="TBMG_00637.1"
FT   CDS_pept        complement(719013..720164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00637"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00637"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23672"
FT                   /protein_id="ACT23672.1"
FT   gene            complement(720257..721984)
FT                   /locus_tag="TBMG_00638"
FT                   /note="TBMG_00638.1"
FT   CDS_pept        complement(720257..721984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00638"
FT                   /product="exonuclease subunit V alpha recD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00638"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23673"
FT                   /protein_id="ACT23673.1"
FT   gene            complement(721981..725265)
FT                   /locus_tag="TBMG_00639"
FT                   /note="TBMG_00639.1"
FT   CDS_pept        complement(721981..725265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00639"
FT                   /product="exonuclease subunit V beta recB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00639"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23674"
FT                   /protein_id="ACT23674.1"
FT   gene            complement(725265..728558)
FT                   /locus_tag="TBMG_00640"
FT                   /note="TBMG_00640.1"
FT   CDS_pept        complement(725265..728558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00640"
FT                   /product="exonuclease subunit V gamma recC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00640"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23675"
FT                   /protein_id="ACT23675.1"
FT   gene            complement(728835..729530)
FT                   /locus_tag="TBMG_00641"
FT                   /note="TBMG_00641.1"
FT   CDS_pept        complement(728835..729530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00641"
FT                   /product="enoyl-CoA hydratase echA3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00641"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23676"
FT                   /protein_id="ACT23676.1"
FT                   DGIAAEFGL"
FT   gene            complement(729579..730439)
FT                   /locus_tag="TBMG_00642"
FT                   /note="TBMG_00642.1"
FT   CDS_pept        complement(729579..730439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00642"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00642"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23677"
FT                   /protein_id="ACT23677.1"
FT                   RIPAG"
FT   gene            complement(730572..731285)
FT                   /locus_tag="TBMG_00643"
FT                   /note="TBMG_00643.1"
FT   CDS_pept        complement(730572..731285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00643"
FT                   /product="glyoxalase II"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00643"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23678"
FT                   /protein_id="ACT23678.1"
FT                   YRPASLDQWRMLMGG"
FT   gene            731365..731616
FT                   /locus_tag="TBMG_00644"
FT                   /note="TBMG_00644.1"
FT   CDS_pept        731365..731616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00644"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00644"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23679"
FT                   /protein_id="ACT23679.1"
FT   gene            731746..731818
FT                   /locus_tag="TBMG_05006"
FT   tRNA            731746..731818
FT                   /locus_tag="TBMG_05006"
FT                   /product="tRNA-Thr"
FT   gene            731855..731931
FT                   /locus_tag="TBMG_05007"
FT   tRNA            731855..731931
FT                   /locus_tag="TBMG_05007"
FT                   /product="tRNA-Met"
FT   gene            731964..732131
FT                   /locus_tag="TBMG_00645"
FT                   /note="TBMG_00645.1"
FT   CDS_pept        731964..732131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00645"
FT                   /product="50S ribosomal protein L33 rpmG2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00645"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23680"
FT                   /protein_id="ACT23680.1"
FT                   GKHQAHRETR"
FT   gene            732182..732658
FT                   /locus_tag="TBMG_00646"
FT                   /note="TBMG_00646.1"
FT   CDS_pept        732182..732658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00646"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00646"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23681"
FT                   /protein_id="ACT23681.1"
FT   gene            732576..733073
FT                   /locus_tag="TBMG_00647"
FT                   /note="TBMG_00647.1"
FT   CDS_pept        732576..733073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00647"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00647"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23682"
FT                   /protein_id="ACT23682.1"
FT                   LA"
FT   gene            733077..733577
FT                   /locus_tag="TBMG_00648"
FT                   /note="TBMG_00648.1"
FT   CDS_pept        733077..733577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00648"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00648"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23683"
FT                   /protein_id="ACT23683.1"
FT                   RTA"
FT   gene            733776..733848
FT                   /locus_tag="TBMG_05008"
FT   tRNA            733776..733848
FT                   /locus_tag="TBMG_05008"
FT                   /product="tRNA-Trp"
FT   gene            733989..734474
FT                   /locus_tag="TBMG_00649"
FT                   /note="TBMG_00649.1"
FT   CDS_pept        733989..734474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00649"
FT                   /product="preprotein translocase subunit secE1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00649"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23684"
FT                   /protein_id="ACT23684.1"
FT   gene            734506..735222
FT                   /locus_tag="TBMG_00650"
FT                   /note="TBMG_00650.1"
FT   CDS_pept        734506..735222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00650"
FT                   /product="transcription antitermination protein nusG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00650"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23685"
FT                   /protein_id="ACT23685.1"
FT                   GRETPVELTFGQVSKI"
FT   gene            735274..735702
FT                   /locus_tag="TBMG_00651"
FT                   /note="TBMG_00651.1"
FT   CDS_pept        735274..735702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00651"
FT                   /product="50S ribosomal protein L11 rplK"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00651"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23686"
FT                   /protein_id="ACT23686.1"
FT   gene            735769..736476
FT                   /locus_tag="TBMG_00652"
FT                   /note="TBMG_00652.1"
FT   CDS_pept        735769..736476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00652"
FT                   /product="50S ribosomal protein L1 rplA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00652"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23687"
FT                   /protein_id="ACT23687.1"
FT                   PVDPSITRNFAGE"
FT   gene            complement(736550..737497)
FT                   /locus_tag="TBMG_00653"
FT                   /note="TBMG_00653.1"
FT   CDS_pept        complement(736550..737497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00653"
FT                   /product="methoxy mycolic acid synthase 4 mmaA4"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00653"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23688"
FT                   /protein_id="ACT23688.1"
FT   gene            complement(737520..738413)
FT                   /locus_tag="TBMG_00654"
FT                   /note="TBMG_00654.1"
FT   CDS_pept        complement(737520..738413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00654"
FT                   /product="methoxy mycolic acid synthase 3 mmaA3"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00654"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23689"
FT                   /protein_id="ACT23689.1"
FT                   AFRMGYIDCNQFTLAK"
FT   gene            complement(738549..739502)
FT                   /locus_tag="TBMG_00655"
FT                   /note="TBMG_00655.1"
FT   CDS_pept        complement(738549..739502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00655"
FT                   /product="methoxy mycolic acid synthase 2 mmaA2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00655"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23690"
FT                   /protein_id="ACT23690.1"
FT   gene            complement(739579..740469)
FT                   /locus_tag="TBMG_00656"
FT                   /note="TBMG_00656.1"
FT   CDS_pept        complement(739579..740469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00656"
FT                   /product="methoxy mycolic acid synthase 1 mmaA1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00656"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23691"
FT                   /protein_id="ACT23691.1"
FT                   FRRGLINVAQFTMTK"
FT   gene            complement(740486..741391)
FT                   /locus_tag="TBMG_00657"
FT                   /note="TBMG_00657.1"
FT   CDS_pept        complement(740486..741391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00657"
FT                   /product="lipase/esterase lipG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00657"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23692"
FT                   /protein_id="ACT23692.1"
FT   gene            complement(741403..742869)
FT                   /locus_tag="TBMG_00658"
FT                   /note="TBMG_00658.1"
FT   CDS_pept        complement(741403..742869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00658"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00658"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23693"
FT                   /protein_id="ACT23693.1"
FT   gene            742955..747151
FT                   /locus_tag="TBMG_00659"
FT                   /note="TBMG_00659.1"
FT   CDS_pept        742955..747151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00659"
FT                   /product="alpha-mannosidase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00659"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23694"
FT                   /protein_id="ACT23694.1"
FT   gene            747148..747822
FT                   /locus_tag="TBMG_00660"
FT                   /note="TBMG_00660.1"
FT   CDS_pept        747148..747822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00660"
FT                   /product="malonyl CoA-acyl carrier protein transacylase
FT                   fabD2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23695"
FT                   /protein_id="ACT23695.1"
FT                   RH"
FT   gene            747822..748730
FT                   /locus_tag="TBMG_00661"
FT                   /note="TBMG_00661.1"
FT   CDS_pept        747822..748730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00661"
FT                   /product="sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00661"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23696"
FT                   /protein_id="ACT23696.1"
FT   gene            749061..749597
FT                   /locus_tag="TBMG_00662"
FT                   /note="TBMG_00662.1"
FT   CDS_pept        749061..749597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00662"
FT                   /product="50S ribosomal protein L10 rplJ"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00662"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23697"
FT                   /protein_id="ACT23697.1"
FT                   ALQEKKACPGPDSAE"
FT   gene            749634..750026
FT                   /locus_tag="TBMG_00663"
FT                   /note="TBMG_00663.1"
FT   CDS_pept        749634..750026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00663"
FT                   /product="50S ribosomal protein L7/L12 rplL"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00663"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23698"
FT                   /protein_id="ACT23698.1"
FT   gene            complement(750019..750786)
FT                   /locus_tag="TBMG_00664"
FT                   /note="TBMG_00664.1"
FT   CDS_pept        complement(750019..750786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00664"
FT                   /product="transcriptional regulator, tetR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00664"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23700"
FT                   /protein_id="ACT23700.1"
FT   gene            750785..752290
FT                   /locus_tag="TBMG_00665"
FT                   /note="TBMG_00665.1"
FT   CDS_pept        750785..752290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00665"
FT                   /product="dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00665"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23699"
FT                   /protein_id="ACT23699.1"
FT   gene            752302..753381
FT                   /locus_tag="TBMG_00666"
FT                   /note="TBMG_00666.1"
FT   CDS_pept        752302..753381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00666"
FT                   /product="ribonucleotide-transport ATP-binding protein ABC
FT                   transporter mkl"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00666"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23701"
FT                   /protein_id="ACT23701.1"
FT   gene            complement(753769..754152)
FT                   /locus_tag="TBMG_00667"
FT                   /note="TBMG_00667.1"
FT   CDS_pept        complement(753769..754152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00667"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00667"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23702"
FT                   /protein_id="ACT23702.1"
FT   gene            complement(754247..754402)
FT                   /locus_tag="TBMG_00668"
FT                   /note="TBMG_00668.1"
FT   CDS_pept        complement(754247..754402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00668"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00668"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23703"
FT                   /protein_id="ACT23703.1"
FT                   LARSRE"
FT   gene            complement(754478..755194)
FT                   /locus_tag="TBMG_00669"
FT                   /note="TBMG_00669.1"
FT   CDS_pept        complement(754478..755194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00669"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00669"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23704"
FT                   /protein_id="ACT23704.1"
FT                   PGIVLLLGLTGAISLP"
FT   gene            complement(755470..755778)
FT                   /locus_tag="TBMG_00670"
FT                   /note="TBMG_00670.1"
FT   CDS_pept        complement(755470..755778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00670"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23705"
FT                   /protein_id="ACT23705.1"
FT   gene            complement(755765..756010)
FT                   /locus_tag="TBMG_00671"
FT                   /note="TBMG_00671.1"
FT   CDS_pept        complement(755765..756010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00671"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00671"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23706"
FT                   /protein_id="ACT23706.1"
FT   gene            complement(756120..756557)
FT                   /locus_tag="TBMG_00672"
FT                   /note="TBMG_00672.1"
FT   CDS_pept        complement(756120..756557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00672"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00672"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23707"
FT                   /protein_id="ACT23707.1"
FT   gene            complement(756554..756922)
FT                   /locus_tag="TBMG_00673"
FT                   /note="TBMG_00673.1"
FT   CDS_pept        complement(756554..756922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00673"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00673"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23708"
FT                   /protein_id="ACT23708.1"
FT                   PEPRELKQELEALRARRG"
FT   gene            756922..759285
FT                   /locus_tag="TBMG_00674"
FT                   /note="TBMG_00674.1"
FT   CDS_pept        756922..759285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00674"
FT                   /product="arylsulfatase atsD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00674"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23709"
FT                   /protein_id="ACT23709.1"
FT   gene            759317..759589
FT                   /locus_tag="TBMG_00675"
FT                   /note="TBMG_00675.1"
FT   CDS_pept        759317..759589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00675"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00675"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23710"
FT                   /protein_id="ACT23710.1"
FT   gene            759586..759924
FT                   /locus_tag="TBMG_00676"
FT                   /note="TBMG_00676.1"
FT   CDS_pept        759586..759924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00676"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00676"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23711"
FT                   /protein_id="ACT23711.1"
FT                   AATAEIKV"
FT   gene            759921..760094
FT                   /locus_tag="TBMG_00677"
FT                   /note="TBMG_00677.1"
FT   CDS_pept        759921..760094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00677"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00677"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23712"
FT                   /protein_id="ACT23712.1"
FT                   LVRARSCRCTAD"
FT   gene            760079..760309
FT                   /locus_tag="TBMG_00678"
FT                   /note="TBMG_00678.1"
FT   CDS_pept        760079..760309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00678"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00678"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23713"
FT                   /protein_id="ACT23713.1"
FT   gene            760574..764110
FT                   /locus_tag="TBMG_00679"
FT                   /note="TBMG_00679.1"
FT   CDS_pept        760574..764110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00679"
FT                   /product="DNA-directed RNA polymerase subunit beta rpoB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00679"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23714"
FT                   /protein_id="ACT23714.1"
FT                   SRNESASVEDLA"
FT   gene            764155..768105
FT                   /locus_tag="TBMG_00680"
FT                   /note="TBMG_00680.1"
FT   CDS_pept        764155..768105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00680"
FT                   /product="DNA-directed RNA polymerase subunit beta rpoC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00680"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23715"
FT                   /protein_id="ACT23715.1"
FT   gene            complement(768102..768422)
FT                   /locus_tag="TBMG_00681"
FT                   /note="TBMG_00681.1"
FT   CDS_pept        complement(768102..768422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00681"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23716"
FT                   /protein_id="ACT23716.1"
FT                   PT"
FT   gene            complement(768469..770382)
FT                   /locus_tag="TBMG_00682"
FT                   /note="TBMG_00682.1"
FT   CDS_pept        complement(768469..770382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00682"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00682"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23717"
FT                   /protein_id="ACT23717.1"
FT                   VV"
FT   gene            770675..771334
FT                   /locus_tag="TBMG_00683"
FT                   /note="TBMG_00683.1"
FT   CDS_pept        770675..771334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00683"
FT                   /product="endonuclease IV end"
FT                   /note="truncated CDS"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00683"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23718"
FT                   /protein_id="ACT23718.1"
FT   gene            771366..772208
FT                   /locus_tag="TBMG_00684"
FT                   /note="TBMG_00684.1"
FT   CDS_pept        771366..772208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00684"
FT                   /product="lipoprotein lpqP"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00684"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23719"
FT                   /protein_id="ACT23719.1"
FT   gene            772268..773896
FT                   /locus_tag="TBMG_00685"
FT                   /note="TBMG_00685.1"
FT   CDS_pept        772268..773896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00685"
FT                   /product="acyl-CoA dehydrogenase fadE8"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00685"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23720"
FT                   /protein_id="ACT23720.1"
FT   gene            773907..774845
FT                   /locus_tag="TBMG_00686"
FT                   /note="TBMG_00686.1"
FT   CDS_pept        773907..774845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00686"
FT                   /product="enoyl-CoA hydratase echA4"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00686"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23721"
FT                   /protein_id="ACT23721.1"
FT   gene            774848..775570
FT                   /locus_tag="TBMG_00687"
FT                   /note="TBMG_00687.1"
FT   CDS_pept        774848..775570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00687"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00687"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23722"
FT                   /protein_id="ACT23722.1"
FT                   FATAMAKRRDATQLLEVT"
FT   gene            775567..776358
FT                   /locus_tag="TBMG_00688"
FT                   /note="TBMG_00688.1"
FT   CDS_pept        775567..776358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00688"
FT                   /product="enoyl-CoA hydratase echA5"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00688"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23723"
FT                   /protein_id="ACT23723.1"
FT   gene            complement(776370..779264)
FT                   /locus_tag="TBMG_00689"
FT                   /note="TBMG_00689.1"
FT   CDS_pept        complement(776370..779264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00689"
FT                   /product="transmembrane transporter mmpL5"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00689"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23724"
FT                   /protein_id="ACT23724.1"
FT   gene            complement(779261..779689)
FT                   /locus_tag="TBMG_00690"
FT                   /note="TBMG_00690.1"
FT   CDS_pept        complement(779261..779689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00690"
FT                   /product="membrane protein mmpS5"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23725"
FT                   /protein_id="ACT23725.1"
FT   gene            779774..780271
FT                   /locus_tag="TBMG_00691"
FT                   /note="TBMG_00691.1"
FT   CDS_pept        779774..780271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00691"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00691"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23726"
FT                   /protein_id="ACT23726.1"
FT                   DD"
FT   gene            complement(780327..780824)
FT                   /locus_tag="TBMG_00692"
FT                   /note="TBMG_00692.1"
FT   CDS_pept        complement(780327..780824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00692"
FT                   /product="conserved threonine rich protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00692"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23727"
FT                   /protein_id="ACT23727.1"
FT                   KE"
FT   gene            complement(780826..781200)
FT                   /locus_tag="TBMG_00693"
FT                   /note="TBMG_00693.1"
FT   CDS_pept        complement(780826..781200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00693"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00693"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23728"
FT                   /protein_id="ACT23728.1"
FT   gene            781439..782095
FT                   /locus_tag="TBMG_00694"
FT                   /note="TBMG_00694.1"
FT   CDS_pept        781439..782095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00694"
FT                   /product="transcriptional regulator, tetR-family"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00694"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23729"
FT                   /protein_id="ACT23729.1"
FT   gene            782344..782718
FT                   /locus_tag="TBMG_00695"
FT                   /note="TBMG_00695.1"
FT   CDS_pept        782344..782718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00695"
FT                   /product="30S ribosomal protein S12 rpsL"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00695"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23730"
FT                   /protein_id="ACT23730.1"
FT   gene            782718..783188
FT                   /locus_tag="TBMG_00696"
FT                   /note="TBMG_00696.1"
FT   CDS_pept        782718..783188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00696"
FT                   /product="30S ribosomal protein S7 rpsG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00696"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23731"
FT                   /protein_id="ACT23731.1"
FT   gene            783269..785374
FT                   /locus_tag="TBMG_00697"
FT                   /note="TBMG_00697.1"
FT   CDS_pept        783269..785374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00697"
FT                   /product="elongation factor G fusA1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00697"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23732"
FT                   /protein_id="ACT23732.1"
FT                   IAKATGE"
FT   gene            785605..786795
FT                   /locus_tag="TBMG_00698"
FT                   /note="TBMG_00698.1"
FT   CDS_pept        785605..786795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00698"
FT                   /product="iron-regulated elongation factor tu tuf"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00698"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23733"
FT                   /protein_id="ACT23733.1"
FT   gene            786933..787730
FT                   /locus_tag="TBMG_00699"
FT                   /note="TBMG_00699.1"
FT   CDS_pept        786933..787730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00699"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00699"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23734"
FT                   /protein_id="ACT23734.1"
FT   gene            787883..788710
FT                   /locus_tag="TBMG_00700"
FT                   /note="TBMG_00700.1"
FT   CDS_pept        787883..788710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00700"
FT                   /product="short-chain type dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00700"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23735"
FT                   /protein_id="ACT23735.1"
FT   gene            788724..789944
FT                   /locus_tag="TBMG_00701"
FT                   /note="TBMG_00701.1"
FT   CDS_pept        788724..789944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00701"
FT                   /product="ferredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00701"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23736"
FT                   /protein_id="ACT23736.1"
FT                   VLDQTQA"
FT   gene            complement(789941..790195)
FT                   /locus_tag="TBMG_00702"
FT                   /note="TBMG_00702.1"
FT   CDS_pept        complement(789941..790195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00702"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23737"
FT                   /protein_id="ACT23737.1"
FT   gene            complement(790808..791857)
FT                   /locus_tag="TBMG_00703"
FT                   /note="TBMG_00703.1"
FT   CDS_pept        complement(790808..791857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00703"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23738"
FT                   /protein_id="ACT23738.1"
FT                   PHGPPVTWQ"
FT   gene            complement(791854..792450)
FT                   /locus_tag="TBMG_00704"
FT                   /note="TBMG_00704.1"
FT   CDS_pept        complement(791854..792450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00704"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00704"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23739"
FT                   /protein_id="ACT23739.1"
FT   gene            792615..792944
FT                   /locus_tag="TBMG_00705"
FT                   /note="TBMG_00705.1"
FT   CDS_pept        792615..792944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00705"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00705"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23740"
FT                   /protein_id="ACT23740.1"
FT                   PRQTT"
FT   gene            792941..794116
FT                   /locus_tag="TBMG_00706"
FT                   /note="TBMG_00706.1"
FT   CDS_pept        792941..794116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00706"
FT                   /product="coenzyme pqq synthesis protein E pqqE"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00706"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23741"
FT                   /protein_id="ACT23741.1"
FT   gene            794119..795309
FT                   /locus_tag="TBMG_00707"
FT                   /note="TBMG_00707.1"
FT   CDS_pept        794119..795309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00707"
FT                   /product="L-lactate dehydrogenase lldD1"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00707"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23742"
FT                   /protein_id="ACT23742.1"
FT   gene            795499..796254
FT                   /locus_tag="TBMG_00708"
FT                   /note="TBMG_00708.1"
FT   CDS_pept        795499..796254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00708"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00708"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23743"
FT                   /protein_id="ACT23743.1"
FT   gene            796303..797715
FT                   /locus_tag="TBMG_00709"
FT                   /note="TBMG_00709.1"
FT   CDS_pept        796303..797715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00709"
FT                   /product="membrane sugar transferase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00709"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23744"
FT                   /protein_id="ACT23744.1"
FT                   RNIGALKPQIRT"
FT   gene            797717..799156
FT                   /locus_tag="TBMG_00710"
FT                   /note="TBMG_00710.1"
FT   CDS_pept        797717..799156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00710"
FT                   /product="dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00710"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23745"
FT                   /protein_id="ACT23745.1"
FT   gene            799617..800228
FT                   /locus_tag="TBMG_03995"
FT   CDS_pept        799617..800228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03995"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03995"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23746"
FT                   /protein_id="ACT23746.1"
FT   gene            complement(799944..800591)
FT                   /locus_tag="TBMG_00711"
FT                   /note="TBMG_00711.1"
FT   CDS_pept        complement(799944..800591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00711"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00711"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23747"
FT                   /protein_id="ACT23747.1"
FT   gene            complement(800888..801178)
FT                   /locus_tag="TBMG_00712"
FT                   /note="TBMG_00712.1"
FT   CDS_pept        complement(800888..801178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00712"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00712"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23748"
FT                   /protein_id="ACT23748.1"
FT   gene            801271..801576
FT                   /locus_tag="TBMG_00713"
FT                   /note="TBMG_00713.1"
FT   CDS_pept        801271..801576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00713"
FT                   /product="30S ribosomal protein S10 rpsJ"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00713"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23749"
FT                   /protein_id="ACT23749.1"
FT   gene            801593..802246
FT                   /locus_tag="TBMG_00714"
FT                   /note="TBMG_00714.1"
FT   CDS_pept        801593..802246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00714"
FT                   /product="50S ribosomal protein L3 rplC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00714"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23750"
FT                   /protein_id="ACT23750.1"
FT   gene            802246..802917
FT                   /locus_tag="TBMG_00715"
FT                   /note="TBMG_00715.1"
FT   CDS_pept        802246..802917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00715"
FT                   /product="50S ribosomal protein L4 rplD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00715"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23751"
FT                   /protein_id="ACT23751.1"
FT                   A"
FT   gene            802917..803219
FT                   /locus_tag="TBMG_00716"
FT                   /note="TBMG_00716.1"
FT   CDS_pept        802917..803219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00716"
FT                   /product="50S ribosomal protein L23 rplW"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00716"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23752"
FT                   /protein_id="ACT23752.1"
FT   gene            803528..804370
FT                   /locus_tag="TBMG_00718"
FT                   /note="TBMG_00718.1"
FT   CDS_pept        803528..804370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00718"
FT                   /product="50S ribosomal protein L2 rplB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00718"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23753"
FT                   /protein_id="ACT23753.1"
FT   gene            804411..804692
FT                   /locus_tag="TBMG_00719"
FT                   /note="TBMG_00719.1"
FT   CDS_pept        804411..804692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00719"
FT                   /product="30S ribosomal protein S19 rpsS"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00719"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23754"
FT                   /protein_id="ACT23754.1"
FT   gene            804689..805282
FT                   /locus_tag="TBMG_00720"
FT                   /note="TBMG_00720.1"
FT   CDS_pept        804689..805282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00720"
FT                   /product="50S ribosomal protein L22 rplV"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00720"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23755"
FT                   /protein_id="ACT23755.1"
FT   gene            805282..806106
FT                   /locus_tag="TBMG_00721"
FT                   /note="TBMG_00721.1"
FT   CDS_pept        805282..806106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00721"
FT                   /product="30S ribosomal protein S3 rpsC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00721"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23756"
FT                   /protein_id="ACT23756.1"
FT   gene            806110..806526
FT                   /locus_tag="TBMG_00722"
FT                   /note="TBMG_00722.1"
FT   CDS_pept        806110..806526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00722"
FT                   /product="50S ribosomal protein L16 rplP"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00722"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23757"
FT                   /protein_id="ACT23757.1"
FT   gene            806526..806759
FT                   /locus_tag="TBMG_00723"
FT                   /note="TBMG_00723.1"
FT   CDS_pept        806526..806759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00723"
FT                   /product="50S ribosomal protein L29 rpmC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00723"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23758"
FT                   /protein_id="ACT23758.1"
FT   gene            806798..807166
FT                   /locus_tag="TBMG_00724"
FT                   /note="TBMG_00724.1"
FT   CDS_pept        806798..807166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00724"
FT                   /product="30S ribosomal protein S17 rpsQ"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00724"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23759"
FT                   /protein_id="ACT23759.1"
FT                   PLSATKRWRLVEILEKAK"
FT   gene            807335..809698
FT                   /locus_tag="TBMG_00725"
FT                   /note="TBMG_00725.1"
FT   CDS_pept        807335..809698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00725"
FT                   /product="arylsulfatase atsA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00725"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23760"
FT                   /protein_id="ACT23760.1"
FT   gene            809746..810645
FT                   /locus_tag="TBMG_00726"
FT                   /note="TBMG_00726.1"
FT   CDS_pept        809746..810645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00726"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00726"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23761"
FT                   /protein_id="ACT23761.1"
FT                   DTATTHIGFRCVADPVSG"
FT   gene            810946..811887
FT                   /locus_tag="TBMG_00727"
FT                   /note="TBMG_00727.1"
FT   CDS_pept        810946..811887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00727"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00727"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23762"
FT                   /protein_id="ACT23762.1"
FT   gene            812373..812741
FT                   /locus_tag="TBMG_00728"
FT                   /note="TBMG_00728.1"
FT   CDS_pept        812373..812741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00728"
FT                   /product="50S ribosomal protein L14 rplN"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00728"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23763"
FT                   /protein_id="ACT23763.1"
FT                   ELREKRFMKIISLAPEVL"
FT   gene            812742..813059
FT                   /locus_tag="TBMG_00729"
FT                   /note="TBMG_00729.1"
FT   CDS_pept        812742..813059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00729"
FT                   /product="50S ribosomal protein L24 rplX"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00729"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23764"
FT                   /protein_id="ACT23764.1"
FT                   I"
FT   gene            813059..813622
FT                   /locus_tag="TBMG_00730"
FT                   /note="TBMG_00730.1"
FT   CDS_pept        813059..813622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00730"
FT                   /product="50S ribosomal protein L5 rplE"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23765"
FT                   /protein_id="ACT23765.1"
FT   gene            813627..813809
FT                   /locus_tag="TBMG_00731"
FT                   /note="TBMG_00731.1"
FT   CDS_pept        813627..813809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00731"
FT                   /product="ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00731"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23766"
FT                   /protein_id="ACT23766.1"
FT                   EMAHAGELPGVQKSS"
FT   gene            813976..814374
FT                   /locus_tag="TBMG_00732"
FT                   /note="TBMG_00732.1"
FT   CDS_pept        813976..814374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00732"
FT                   /product="30S ribosomal protein S8 rpsH"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00732"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23767"
FT                   /protein_id="ACT23767.1"
FT   gene            814398..814937
FT                   /locus_tag="TBMG_00733"
FT                   /note="TBMG_00733.1"
FT   CDS_pept        814398..814937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00733"
FT                   /product="50S ribosomal protein L6 rplF"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00733"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23768"
FT                   /protein_id="ACT23768.1"
FT                   RYEGEQIRRKVGKTGK"
FT   gene            814940..815308
FT                   /locus_tag="TBMG_00734"
FT                   /note="TBMG_00734.1"
FT   CDS_pept        814940..815308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00734"
FT                   /product="50S ribosomal protein L18 rplR"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00734"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23769"
FT                   /protein_id="ACT23769.1"
FT                   GGRIAALADAARENGLSF"
FT   gene            815328..815990
FT                   /locus_tag="TBMG_00735"
FT                   /note="TBMG_00735.1"
FT   CDS_pept        815328..815990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00735"
FT                   /product="30S ribosomal protein S5 rpsE"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00735"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23770"
FT                   /protein_id="ACT23770.1"
FT   gene            815993..816190
FT                   /locus_tag="TBMG_00736"
FT                   /note="TBMG_00736.1"
FT   CDS_pept        815993..816190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00736"
FT                   /product="50S ribosomal protein L30 rpmD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00736"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23771"
FT                   /protein_id="ACT23771.1"
FT   gene            816190..816630
FT                   /locus_tag="TBMG_00737"
FT                   /note="TBMG_00737.1"
FT   CDS_pept        816190..816630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00737"
FT                   /product="50S ribosomal protein L15 rplO"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00737"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23772"
FT                   /protein_id="ACT23772.1"
FT   gene            816663..818534
FT                   /locus_tag="TBMG_00738"
FT                   /note="TBMG_00738.1"
FT   CDS_pept        816663..818534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00738"
FT                   /product="protease IV sppA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00738"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23773"
FT                   /protein_id="ACT23773.1"
FT   gene            complement(818531..818905)
FT                   /locus_tag="TBMG_03996"
FT                   /note="TBMG_00739.1"
FT   CDS_pept        complement(818531..818905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03996"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03996"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23774"
FT                   /protein_id="ACT23774.1"
FT   gene            complement(818539..819444)
FT                   /locus_tag="TBMG_03997"
FT                   /note="TBMG_00739.1"
FT   CDS_pept        complement(818539..819444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03997"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03997"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23775"
FT                   /protein_id="ACT23775.1"
FT   gene            complement(819537..820640)
FT                   /locus_tag="TBMG_00740"
FT                   /note="TBMG_00740.1"
FT   CDS_pept        complement(819537..820640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00740"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23776"
FT                   /protein_id="ACT23776.1"
FT   gene            complement(820843..821499)
FT                   /locus_tag="TBMG_00741"
FT                   /note="TBMG_00741.1"
FT   CDS_pept        complement(820843..821499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00741"
FT                   /product="L-fuculose phosphate aldolase fucA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00741"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23777"
FT                   /protein_id="ACT23777.1"
FT   gene            complement(821496..822476)
FT                   /locus_tag="TBMG_00742"
FT                   /note="TBMG_00742.1"
FT   CDS_pept        complement(821496..822476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00742"
FT                   /product="D-3-phosphoglycerate dehydrogenase serA2"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00742"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23778"
FT                   /protein_id="ACT23778.1"
FT   gene            822507..823853
FT                   /locus_tag="TBMG_00743"
FT                   /note="TBMG_00743.1"
FT   CDS_pept        822507..823853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00743"
FT                   /product="D-xylulose kinase xylB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00743"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23779"
FT                   /protein_id="ACT23779.1"
FT   gene            823866..824594
FT                   /locus_tag="TBMG_00744"
FT                   /note="TBMG_00744.1"
FT   CDS_pept        823866..824594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00744"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00744"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23780"
FT                   /protein_id="ACT23780.1"
FT   gene            complement(824683..825639)
FT                   /locus_tag="TBMG_00745"
FT                   /note="TBMG_00745.1"
FT   CDS_pept        complement(824683..825639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00745"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00745"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23781"
FT                   /protein_id="ACT23781.1"
FT   gene            825800..827125
FT                   /locus_tag="TBMG_00746"
FT                   /note="TBMG_00746.1"
FT   CDS_pept        825800..827125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00746"
FT                   /product="preprotein translocase subunit secY"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00746"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23782"
FT                   /protein_id="ACT23782.1"
FT   gene            827122..827667
FT                   /locus_tag="TBMG_00747"
FT                   /note="TBMG_00747.1"
FT   CDS_pept        827122..827667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00747"
FT                   /product="adenylate kinase adk"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00747"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23783"
FT                   /protein_id="ACT23783.1"
FT                   AVGTMDEVFARALRALGK"
FT   gene            827670..828470
FT                   /locus_tag="TBMG_00748"
FT                   /note="TBMG_00748.1"
FT   CDS_pept        827670..828470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00748"
FT                   /product="methionine aminopeptidase mapA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00748"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23784"
FT                   /protein_id="ACT23784.1"
FT   gene            828543..829076
FT                   /locus_tag="TBMG_00749"
FT                   /note="TBMG_00749.1"
FT   CDS_pept        828543..829076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00749"
FT                   /product="alternative RNA polymerase sigma factor sigL"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00749"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23785"
FT                   /protein_id="ACT23785.1"
FT                   RALRLTLQELGVTR"
FT   gene            829140..829892
FT                   /locus_tag="TBMG_00750"
FT                   /note="TBMG_00750.1"
FT   CDS_pept        829140..829892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00750"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00750"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23786"
FT                   /protein_id="ACT23786.1"
FT   gene            830207..830704
FT                   /locus_tag="TBMG_00751"
FT                   /note="TBMG_00751.1"
FT   CDS_pept        830207..830704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00751"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00751"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23787"
FT                   /protein_id="ACT23787.1"
FT                   DF"
FT   gene            831062..831610
FT                   /locus_tag="TBMG_00752"
FT                   /note="TBMG_00752.1"
FT   CDS_pept        831062..831610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00752"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00752"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23788"
FT                   /protein_id="ACT23788.1"
FT   gene            831855..832661
FT                   /locus_tag="TBMG_00753"
FT                   /note="TBMG_00753.1"
FT   CDS_pept        831855..832661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00753"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00753"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23789"
FT                   /protein_id="ACT23789.1"
FT   gene            832695..833303
FT                   /locus_tag="TBMG_00754"
FT                   /note="TBMG_00754.1"
FT   CDS_pept        832695..833303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00754"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00754"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23790"
FT                   /protein_id="ACT23790.1"
FT   gene            833534..833848
FT                   /locus_tag="TBMG_00755"
FT                   /note="TBMG_00755.1"
FT   CDS_pept        833534..833848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00755"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00755"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23791"
FT                   /protein_id="ACT23791.1"
FT                   "
FT   gene            833990..834508
FT                   /locus_tag="TBMG_00756"
FT                   /note="TBMG_00756.1"
FT   CDS_pept        833990..834508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00756"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00756"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23792"
FT                   /protein_id="ACT23792.1"
FT                   PGASGGALG"
FT   gene            complement(834886..835443)
FT                   /locus_tag="TBMG_00757"
FT                   /note="TBMG_00757.1"
FT   CDS_pept        complement(834886..835443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00757"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23793"
FT                   /protein_id="ACT23793.1"
FT   gene            complement(835440..835946)
FT                   /locus_tag="TBMG_00758"
FT                   /note="TBMG_00758.1"
FT   CDS_pept        complement(835440..835946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00758"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00758"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23794"
FT                   /protein_id="ACT23794.1"
FT                   RAMTE"
FT   gene            complement(836059..836205)
FT                   /locus_tag="TBMG_03998"
FT   CDS_pept        complement(836059..836205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03998"
FT                   /product="3-hydroxyisobutyrate dehydrogenase mmsB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03998"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23796"
FT                   /protein_id="ACT23796.1"
FT                   RGS"
FT   gene            836154..836681
FT                   /locus_tag="TBMG_00759"
FT                   /note="TBMG_00759.1"
FT   CDS_pept        836154..836681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00759"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00759"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23795"
FT                   /protein_id="ACT23795.1"
FT                   LWSSGVSWALAR"
FT   gene            836701..839052
FT                   /locus_tag="TBMG_00760"
FT                   /note="TBMG_00760.1"
FT   CDS_pept        836701..839052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00760"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23797"
FT                   /protein_id="ACT23797.1"
FT   gene            839451..842054
FT                   /locus_tag="TBMG_00761"
FT                   /note="TBMG_00761.1"
FT   CDS_pept        839451..842054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00761"
FT                   /product="predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00761"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23798"
FT                   /protein_id="ACT23798.1"
FT   gene            842145..842402
FT                   /locus_tag="TBMG_00762"
FT                   /note="TBMG_00762.1"
FT   CDS_pept        842145..842402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00762"
FT                   /product="antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00762"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23799"
FT                   /protein_id="ACT23799.1"
FT   gene            842426..842854
FT                   /locus_tag="TBMG_00763"
FT                   /note="TBMG_00763.1"
FT   CDS_pept        842426..842854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00763"
FT                   /product="toxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00763"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23800"
FT                   /protein_id="ACT23800.1"
FT   gene            843207..843476
FT                   /locus_tag="TBMG_00764"
FT                   /note="TBMG_00764.1"
FT   CDS_pept        843207..843476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00764"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00764"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23801"
FT                   /protein_id="ACT23801.1"
FT   gene            complement(843545..844429)
FT                   /locus_tag="TBMG_00765"
FT                   /note="TBMG_00765.1"
FT   CDS_pept        complement(843545..844429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00765"
FT                   /product="3-hydroxyisobutyrate dehydrogenase mmsB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00765"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23802"
FT                   /protein_id="ACT23802.1"
FT                   SAVIHTLRARADA"
FT   gene            complement(844440..845612)
FT                   /locus_tag="TBMG_00766"
FT                   /note="TBMG_00766.1"
FT   CDS_pept        complement(844440..845612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00766"
FT                   /product="acyl-CoA dehydrogenase fadE9"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00766"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23803"
FT                   /protein_id="ACT23803.1"
FT   gene            complement(845619..847151)
FT                   /locus_tag="TBMG_00767"
FT                   /note="TBMG_00767.1"
FT   CDS_pept        complement(845619..847151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00767"
FT                   /product="methylmalonate-semialdehyde dehydrogenase mmsA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00767"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23804"
FT                   /protein_id="ACT23804.1"
FT   gene            847357..849111
FT                   /locus_tag="TBMG_00768"
FT                   /note="TBMG_00768.1"
FT   CDS_pept        847357..849111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00768"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00768"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23805"
FT                   /protein_id="ACT23805.1"
FT                   IGLPSLIP"
FT   gene            complement(849301..851241)
FT                   /locus_tag="TBMG_00769"
FT                   /note="TBMG_00769.1"
FT   CDS_pept        complement(849301..851241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00769"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00769"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23806"
FT                   /protein_id="ACT23806.1"
FT                   SIDFVSGFFHR"
FT   gene            complement(851540..851725)
FT                   /locus_tag="TBMG_00770"
FT                   /note="TBMG_00770.1"
FT   CDS_pept        complement(851540..851725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00770"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00770"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23807"
FT                   /protein_id="ACT23807.1"
FT                   EAEGLDGLRIGTGTAL"
FT   gene            complement(851837..851911)
FT                   /locus_tag="TBMG_05009"
FT   tRNA            complement(851837..851911)
FT                   /locus_tag="TBMG_05009"
FT                   /product="tRNA-Thr"
FT   gene            complement(851939..852664)
FT                   /locus_tag="TBMG_00771"
FT                   /note="TBMG_00771.1"
FT   CDS_pept        complement(851939..852664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00771"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00771"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23808"
FT                   /protein_id="ACT23808.1"
FT   gene            852806..853549
FT                   /locus_tag="TBMG_00772"
FT                   /note="TBMG_00772.1"
FT   CDS_pept        852806..853549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00772"
FT                   /product="two component system transcriptional regulator
FT                   phoP"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00772"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23809"
FT                   /protein_id="ACT23809.1"
FT   gene            853594..855051
FT                   /locus_tag="TBMG_00773"
FT                   /note="TBMG_00773.1"
FT   CDS_pept        853594..855051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00773"
FT                   /product="two component system sensor kinase phoR"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00773"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23810"
FT                   /protein_id="ACT23810.1"
FT   gene            complement(855023..855424)
FT                   /locus_tag="TBMG_00774"
FT                   /note="TBMG_00774.1"
FT   CDS_pept        complement(855023..855424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00774"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00774"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23811"
FT                   /protein_id="ACT23811.1"
FT   gene            complement(855464..855883)
FT                   /locus_tag="TBMG_00775"
FT                   /note="TBMG_00775.1"
FT   CDS_pept        complement(855464..855883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00775"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00775"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23812"
FT                   /protein_id="ACT23812.1"
FT   gene            complement(855896..857023)
FT                   /locus_tag="TBMG_00776"
FT                   /note="TBMG_00776.1"
FT   CDS_pept        complement(855896..857023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00776"
FT                   /product="zinc-type alcohol dehydrogenase NAD dependent
FT                   adhB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00776"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23813"
FT                   /protein_id="ACT23813.1"
FT   gene            complement(857122..857667)
FT                   /locus_tag="TBMG_00777"
FT                   /note="TBMG_00777.1"
FT   CDS_pept        complement(857122..857667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00777"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00777"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23814"
FT                   /protein_id="ACT23814.1"
FT                   GNKVPGYYPLGKTPVPLW"
FT   gene            complement(857670..857876)
FT                   /locus_tag="TBMG_00778"
FT                   /note="TBMG_00778.1"
FT   CDS_pept        complement(857670..857876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00778"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00778"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23815"
FT                   /protein_id="ACT23815.1"
FT   gene            complement(857879..859234)
FT                   /locus_tag="TBMG_00779"
FT                   /note="TBMG_00779.1"
FT   CDS_pept        complement(857879..859234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00779"
FT                   /product="cytochrome P450 51 cyp51"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00779"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23816"
FT                   /protein_id="ACT23816.1"
FT   gene            complement(859234..860061)
FT                   /locus_tag="TBMG_00780"
FT                   /note="TBMG_00780.1"
FT   CDS_pept        complement(859234..860061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00780"
FT                   /product="oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00780"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23817"
FT                   /protein_id="ACT23817.1"
FT   gene            complement(860311..861270)
FT                   /locus_tag="TBMG_00781"
FT                   /note="TBMG_00781.1"
FT   CDS_pept        complement(860311..861270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00781"
FT                   /product="cytochrome P450 123 cyp123"
FT                   /note="truncated CDS"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00781"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23818"
FT                   /protein_id="ACT23818.1"
FT   gene            complement(861295..861909)
FT                   /locus_tag="TBMG_00782"
FT                   /note="TBMG_00782.1"
FT   CDS_pept        complement(861295..861909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00782"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00782"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23819"
FT                   /protein_id="ACT23819.1"
FT   gene            862111..863580
FT                   /locus_tag="TBMG_00783"
FT                   /note="TBMG_00783.1"
FT   CDS_pept        862111..863580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00783"
FT                   /product="aldehyde dehydrogenase NAD-dependent aldA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00783"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23820"
FT                   /protein_id="ACT23820.1"
FT   gene            863611..864357
FT                   /locus_tag="TBMG_00784"
FT                   /note="TBMG_00784.1"
FT   CDS_pept        863611..864357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00784"
FT                   /product="dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00784"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23821"
FT                   /protein_id="ACT23821.1"
FT   gene            864455..865342
FT                   /locus_tag="TBMG_00785"
FT                   /note="TBMG_00785.1"
FT   CDS_pept        864455..865342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00785"
FT                   /product="dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00785"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23822"
FT                   /protein_id="ACT23822.1"
FT                   LGVPHPDTEPAKET"
FT   gene            865339..865773
FT                   /locus_tag="TBMG_00786"
FT                   /note="TBMG_00786.1"
FT   CDS_pept        865339..865773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00786"
FT                   /product="4-carboxymuconolactone decarboxylase cmd"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00786"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23823"
FT                   /protein_id="ACT23823.1"
FT   gene            865785..867053
FT                   /locus_tag="TBMG_00787"
FT                   /note="TBMG_00787.1"
FT   CDS_pept        865785..867053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00787"
FT                   /product="phosphoribosylamine-glycine ligase purD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00787"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23824"
FT                   /protein_id="ACT23824.1"
FT   gene            complement(867050..868588)
FT                   /locus_tag="TBMG_00788"
FT                   /note="TBMG_00788.1"
FT   CDS_pept        complement(867050..868588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00788"
FT                   /product="bifunctional acylase ggtA"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00788"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23825"
FT                   /protein_id="ACT23825.1"
FT   gene            complement(868639..869550)
FT                   /locus_tag="TBMG_00789"
FT                   /note="TBMG_00789.1"
FT   CDS_pept        complement(868639..869550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00789"
FT                   /product="hypothetical exported protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00789"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23826"
FT                   /protein_id="ACT23826.1"
FT   gene            869606..870229
FT                   /locus_tag="TBMG_00790"
FT                   /note="TBMG_00790.1"
FT   CDS_pept        869606..870229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23827"
FT                   /protein_id="ACT23827.1"
FT   gene            complement(870183..870962)
FT                   /locus_tag="TBMG_00791"
FT                   /note="TBMG_00791.1"
FT   CDS_pept        complement(870183..870962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00791"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00791"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23828"
FT                   /protein_id="ACT23828.1"
FT   gene            871207..872625
FT                   /locus_tag="TBMG_00792"
FT                   /note="TBMG_00792.1"
FT   CDS_pept        871207..872625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00792"
FT                   /product="adenylosuccinate lyase purB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00792"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23829"
FT                   /protein_id="ACT23829.1"
FT                   RYPDAAKYTPGAIL"
FT   gene            872630..873874
FT                   /locus_tag="TBMG_00793"
FT                   /note="TBMG_00793.1"
FT   CDS_pept        872630..873874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00793"
FT                   /product="cytochrome P450 126 cyp126"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00793"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23830"
FT                   /protein_id="ACT23830.1"
FT                   RHTGIRHLVVELRGG"
FT   gene            complement(873871..874554)
FT                   /locus_tag="TBMG_00794"
FT                   /note="TBMG_00794.1"
FT   CDS_pept        complement(873871..874554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00794"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00794"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23832"
FT                   /protein_id="ACT23832.1"
FT                   PLRGD"
FT   gene            874542..875435
FT                   /locus_tag="TBMG_00795"
FT                   /note="TBMG_00795.1"
FT   CDS_pept        874542..875435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00795"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase purC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00795"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23831"
FT                   /protein_id="ACT23831.1"
FT                   ERISELKFDDWIGPGA"
FT   gene            875435..877591
FT                   /locus_tag="TBMG_00796"
FT                   /note="TBMG_00796.1"
FT   CDS_pept        875435..877591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00796"
FT                   /product="protease II ptrB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00796"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23833"
FT                   /protein_id="ACT23833.1"
FT   gene            complement(877520..877912)
FT                   /locus_tag="TBMG_00797"
FT                   /note="TBMG_00797.1"
FT   CDS_pept        complement(877520..877912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00797"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00797"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23835"
FT                   /protein_id="ACT23835.1"
FT   gene            877890..878030
FT                   /locus_tag="TBMG_03999"
FT   CDS_pept        877890..878030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_03999"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_03999"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23834"
FT                   /protein_id="ACT23834.1"
FT                   G"
FT   gene            complement(878019..879656)
FT                   /locus_tag="TBMG_00798"
FT                   /note="TBMG_00798.1"
FT   CDS_pept        complement(878019..879656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00798"
FT                   /product="multidrug resistance membrane efflux protein
FT                   emrB"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00798"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23836"
FT                   /protein_id="ACT23836.1"
FT   gene            879821..880525
FT                   /locus_tag="TBMG_00799"
FT                   /note="TBMG_00799.1"
FT   CDS_pept        879821..880525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00799"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00799"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23837"
FT                   /protein_id="ACT23837.1"
FT                   RWRADAAVLDAA"
FT   gene            880541..882241
FT                   /locus_tag="TBMG_00800"
FT                   /note="TBMG_00800.1"
FT   CDS_pept        880541..882241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00800"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23838"
FT                   /protein_id="ACT23838.1"
FT   gene            complement(882276..882914)
FT                   /locus_tag="TBMG_00801"
FT                   /note="TBMG_00801.1"
FT   CDS_pept        complement(882276..882914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00801"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23840"
FT                   /protein_id="ACT23840.1"
FT   gene            882660..883619
FT                   /locus_tag="TBMG_00802"
FT                   /note="TBMG_00802.1"
FT   CDS_pept        882660..883619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00802"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00802"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23839"
FT                   /protein_id="ACT23839.1"
FT   gene            883725..883964
FT                   /locus_tag="TBMG_00803"
FT                   /note="TBMG_00803.1"
FT   CDS_pept        883725..883964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00803"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00803"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23841"
FT                   /protein_id="ACT23841.1"
FT   gene            883961..884635
FT                   /locus_tag="TBMG_00804"
FT                   /note="TBMG_00804.1"
FT   CDS_pept        883961..884635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00804"
FT                   /product="phosphoribosylformylglycinamidine synthase I
FT                   purG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00804"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23842"
FT                   /protein_id="ACT23842.1"
FT                   TG"
FT   gene            complement(884652..885251)
FT                   /locus_tag="TBMG_00805"
FT                   /note="TBMG_00805.1"
FT   CDS_pept        complement(884652..885251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00805"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23843"
FT                   /protein_id="ACT23843.1"
FT   gene            complement(885273..886001)
FT                   /locus_tag="TBMG_00806"
FT                   /note="TBMG_00806.1"
FT   CDS_pept        complement(885273..886001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00806"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23844"
FT                   /protein_id="ACT23844.1"
FT   gene            complement(885998..887041)
FT                   /locus_tag="TBMG_00807"
FT                   /note="TBMG_00807.1"
FT   CDS_pept        complement(885998..887041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00807"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00807"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23845"
FT                   /protein_id="ACT23845.1"
FT                   /translation="MNAKDDPHFGLMLAATVNGLAVGSYREMVV