(data stored in ACNUC8465 zone)

EMBL: CP001666

ID   CP001666; SV 1; circular; genomic DNA; STD; PRO; 4630065 BP.
XX
AC   CP001666;
XX
PR   Project:PRJNA13492;
XX
DT   13-JUL-2010 (Rel. 105, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Clostridium ljungdahlii DSM 13528, complete genome.
XX
KW   .
XX
OS   Clostridium ljungdahlii DSM 13528
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Clostridium.
XX
RN   [1]
RP   1-4630065
RX   DOI; 10.1073/pnas.1004716107.
RX   PUBMED; 20616070.
RA   Kopke M., Held C., Hujer S., Liesegang H., Wiezer A., Wollherr A.,
RA   Ehrenreich A., Liebl W., Gottschalk G., Durre P.;
RT   "Clostridium ljungdahlii represents a microbial production platform based
RT   on syngas";
RL   Proc. Natl. Acad. Sci. U.S.A. 107(29):13087-13092(2010).
XX
RN   [2]
RP   1-4630065
RA   Koepke M., Hujer S., Held C., Wiezer A., Liesegang H., Ehrenreich A.,
RA   Gottschalk G., Duerre P.;
RT   ;
RL   Submitted (06-JUL-2009) to the INSDC.
RL   Goettingen Genomics Laboratory, Georg-August University Goettingen,
RL   Grisebachstrasse 8, Goettingen, Lower-Saxony D-37077, Germany
XX
DR   MD5; 8bbf93eb9e43a9a7399f35a03160148f.
DR   BioSample; SAMN02603159.
DR   CABRI; DSM 13528.
DR   EnsemblGenomes-Gn; CLJU_c00080.
DR   EnsemblGenomes-Gn; CLJU_c00090.
DR   EnsemblGenomes-Gn; CLJU_c00100.
DR   EnsemblGenomes-Gn; CLJU_c00110.
DR   EnsemblGenomes-Gn; CLJU_c00180.
DR   EnsemblGenomes-Gn; CLJU_c00190.
DR   EnsemblGenomes-Gn; CLJU_c00200.
DR   EnsemblGenomes-Gn; CLJU_c00750.
DR   EnsemblGenomes-Gn; CLJU_c00770.
DR   EnsemblGenomes-Gn; CLJU_c00840.
DR   EnsemblGenomes-Gn; CLJU_c01000.
DR   EnsemblGenomes-Gn; CLJU_c01010.
DR   EnsemblGenomes-Gn; CLJU_c01020.
DR   EnsemblGenomes-Gn; CLJU_c01030.
DR   EnsemblGenomes-Gn; CLJU_c01140.
DR   EnsemblGenomes-Gn; CLJU_c01150.
DR   EnsemblGenomes-Gn; CLJU_c01160.
DR   EnsemblGenomes-Gn; CLJU_c01170.
DR   EnsemblGenomes-Gn; CLJU_c01290.
DR   EnsemblGenomes-Gn; CLJU_c01300.
DR   EnsemblGenomes-Gn; CLJU_c01310.
DR   EnsemblGenomes-Gn; CLJU_c01330.
DR   EnsemblGenomes-Gn; CLJU_c02530.
DR   EnsemblGenomes-Gn; CLJU_c02540.
DR   EnsemblGenomes-Gn; CLJU_c02550.
DR   EnsemblGenomes-Gn; CLJU_c02560.
DR   EnsemblGenomes-Gn; CLJU_c02570.
DR   EnsemblGenomes-Gn; CLJU_c02760.
DR   EnsemblGenomes-Gn; CLJU_c06230.
DR   EnsemblGenomes-Gn; CLJU_c06240.
DR   EnsemblGenomes-Gn; CLJU_c06250.
DR   EnsemblGenomes-Gn; CLJU_c06260.
DR   EnsemblGenomes-Gn; CLJU_c06310.
DR   EnsemblGenomes-Gn; CLJU_c06320.
DR   EnsemblGenomes-Gn; CLJU_c06520.
DR   EnsemblGenomes-Gn; CLJU_c06530.
DR   EnsemblGenomes-Gn; CLJU_c06540.
DR   EnsemblGenomes-Gn; CLJU_c06550.
DR   EnsemblGenomes-Gn; CLJU_c06560.
DR   EnsemblGenomes-Gn; CLJU_c06570.
DR   EnsemblGenomes-Gn; CLJU_c14920.
DR   EnsemblGenomes-Gn; CLJU_c14930.
DR   EnsemblGenomes-Gn; CLJU_c14940.
DR   EnsemblGenomes-Gn; CLJU_c14950.
DR   EnsemblGenomes-Gn; CLJU_c27280.
DR   EnsemblGenomes-Gn; CLJU_c27690.
DR   EnsemblGenomes-Gn; CLJU_c28240.
DR   EnsemblGenomes-Gn; CLJU_c28250.
DR   EnsemblGenomes-Gn; CLJU_c28260.
DR   EnsemblGenomes-Gn; CLJU_c28440.
DR   EnsemblGenomes-Gn; CLJU_c28450.
DR   EnsemblGenomes-Gn; CLJU_c28460.
DR   EnsemblGenomes-Gn; CLJU_c31750.
DR   EnsemblGenomes-Gn; CLJU_c32740.
DR   EnsemblGenomes-Gn; CLJU_c33580.
DR   EnsemblGenomes-Gn; CLJU_c34490.
DR   EnsemblGenomes-Gn; CLJU_c34500.
DR   EnsemblGenomes-Gn; CLJU_c34510.
DR   EnsemblGenomes-Gn; CLJU_c34520.
DR   EnsemblGenomes-Gn; CLJU_c36690.
DR   EnsemblGenomes-Gn; CLJU_c36700.
DR   EnsemblGenomes-Gn; CLJU_c36710.
DR   EnsemblGenomes-Gn; CLJU_c36720.
DR   EnsemblGenomes-Gn; CLJU_c36730.
DR   EnsemblGenomes-Gn; CLJU_c36740.
DR   EnsemblGenomes-Gn; CLJU_c36750.
DR   EnsemblGenomes-Gn; CLJU_c36760.
DR   EnsemblGenomes-Gn; CLJU_c36770.
DR   EnsemblGenomes-Gn; CLJU_c36780.
DR   EnsemblGenomes-Gn; CLJU_c36790.
DR   EnsemblGenomes-Gn; CLJU_c36800.
DR   EnsemblGenomes-Gn; CLJU_c36810.
DR   EnsemblGenomes-Gn; CLJU_c36820.
DR   EnsemblGenomes-Gn; CLJU_c36830.
DR   EnsemblGenomes-Gn; CLJU_c38150.
DR   EnsemblGenomes-Gn; CLJU_c39240.
DR   EnsemblGenomes-Gn; CLJU_c41210.
DR   EnsemblGenomes-Gn; CLJU_c41220.
DR   EnsemblGenomes-Gn; CLJU_c41390.
DR   EnsemblGenomes-Gn; CLJU_c41400.
DR   EnsemblGenomes-Gn; CLJU_c41410.
DR   EnsemblGenomes-Gn; CLJU_c41420.
DR   EnsemblGenomes-Gn; CLJU_c41430.
DR   EnsemblGenomes-Gn; CLJU_c41440.
DR   EnsemblGenomes-Gn; CLJU_c41470.
DR   EnsemblGenomes-Gn; CLJU_c41570.
DR   EnsemblGenomes-Gn; CLJU_c41580.
DR   EnsemblGenomes-Gn; CLJU_c41590.
DR   EnsemblGenomes-Gn; CLJU_c41600.
DR   EnsemblGenomes-Gn; CLJU_c41610.
DR   EnsemblGenomes-Gn; CLJU_c41830.
DR   EnsemblGenomes-Gn; CLJU_c42240.
DR   EnsemblGenomes-Gn; CLJU_c42250.
DR   EnsemblGenomes-Gn; CLJU_c42260.
DR   EnsemblGenomes-Gn; CLJU_c42270.
DR   EnsemblGenomes-Gn; CLJU_c42280.
DR   EnsemblGenomes-Gn; CLJU_c42290.
DR   EnsemblGenomes-Gn; CLJU_c42300.
DR   EnsemblGenomes-Gn; CLJU_c42680.
DR   EnsemblGenomes-Gn; EBG00001164452.
DR   EnsemblGenomes-Gn; EBG00001164453.
DR   EnsemblGenomes-Gn; EBG00001164454.
DR   EnsemblGenomes-Gn; EBG00001164455.
DR   EnsemblGenomes-Gn; EBG00001164456.
DR   EnsemblGenomes-Gn; EBG00001164457.
DR   EnsemblGenomes-Gn; EBG00001164458.
DR   EnsemblGenomes-Gn; EBG00001164459.
DR   EnsemblGenomes-Gn; EBG00001164460.
DR   EnsemblGenomes-Gn; EBG00001164461.
DR   EnsemblGenomes-Gn; EBG00001164462.
DR   EnsemblGenomes-Gn; EBG00001164463.
DR   EnsemblGenomes-Gn; EBG00001164464.
DR   EnsemblGenomes-Gn; EBG00001164465.
DR   EnsemblGenomes-Gn; EBG00001164466.
DR   EnsemblGenomes-Gn; EBG00001164467.
DR   EnsemblGenomes-Gn; EBG00001164468.
DR   EnsemblGenomes-Gn; EBG00001164469.
DR   EnsemblGenomes-Gn; EBG00001164470.
DR   EnsemblGenomes-Gn; EBG00001164471.
DR   EnsemblGenomes-Gn; EBG00001164472.
DR   EnsemblGenomes-Gn; EBG00001164473.
DR   EnsemblGenomes-Gn; EBG00001164474.
DR   EnsemblGenomes-Gn; EBG00001164475.
DR   EnsemblGenomes-Gn; EBG00001164476.
DR   EnsemblGenomes-Gn; EBG00001164477.
DR   EnsemblGenomes-Gn; EBG00001164478.
DR   EnsemblGenomes-Gn; EBG00001164479.
DR   EnsemblGenomes-Gn; EBG00001164480.
DR   EnsemblGenomes-Gn; EBG00001164481.
DR   EnsemblGenomes-Gn; EBG00001164482.
DR   EnsemblGenomes-Gn; EBG00001164483.
DR   EnsemblGenomes-Gn; EBG00001164484.
DR   EnsemblGenomes-Gn; EBG00001164485.
DR   EnsemblGenomes-Gn; EBG00001164486.
DR   EnsemblGenomes-Gn; EBG00001164487.
DR   EnsemblGenomes-Gn; EBG00001164488.
DR   EnsemblGenomes-Gn; EBG00001164489.
DR   EnsemblGenomes-Gn; EBG00001164490.
DR   EnsemblGenomes-Gn; EBG00001164491.
DR   EnsemblGenomes-Gn; EBG00001164492.
DR   EnsemblGenomes-Gn; EBG00001164493.
DR   EnsemblGenomes-Gn; EBG00001164494.
DR   EnsemblGenomes-Gn; EBG00001164495.
DR   EnsemblGenomes-Gn; EBG00001164496.
DR   EnsemblGenomes-Gn; EBG00001164497.
DR   EnsemblGenomes-Gn; EBG00001164498.
DR   EnsemblGenomes-Gn; EBG00001164499.
DR   EnsemblGenomes-Gn; EBG00001164500.
DR   EnsemblGenomes-Gn; EBG00001164501.
DR   EnsemblGenomes-Gn; EBG00001164502.
DR   EnsemblGenomes-Gn; EBG00001164503.
DR   EnsemblGenomes-Gn; EBG00001164504.
DR   EnsemblGenomes-Gn; EBG00001164505.
DR   EnsemblGenomes-Gn; EBG00001164506.
DR   EnsemblGenomes-Gn; EBG00001164507.
DR   EnsemblGenomes-Gn; EBG00001164508.
DR   EnsemblGenomes-Gn; EBG00001164509.
DR   EnsemblGenomes-Gn; EBG00001164510.
DR   EnsemblGenomes-Gn; EBG00001164511.
DR   EnsemblGenomes-Gn; EBG00001164512.
DR   EnsemblGenomes-Gn; EBG00001164513.
DR   EnsemblGenomes-Gn; EBG00001164514.
DR   EnsemblGenomes-Gn; EBG00001164515.
DR   EnsemblGenomes-Gn; EBG00001164516.
DR   EnsemblGenomes-Gn; EBG00001164517.
DR   EnsemblGenomes-Gn; EBG00001164518.
DR   EnsemblGenomes-Gn; EBG00001164519.
DR   EnsemblGenomes-Gn; EBG00001164520.
DR   EnsemblGenomes-Gn; EBG00001164521.
DR   EnsemblGenomes-Gn; EBG00001164522.
DR   EnsemblGenomes-Gn; EBG00001164523.
DR   EnsemblGenomes-Gn; EBG00001164524.
DR   EnsemblGenomes-Gn; EBG00001164525.
DR   EnsemblGenomes-Gn; EBG00001164526.
DR   EnsemblGenomes-Gn; EBG00001164527.
DR   EnsemblGenomes-Gn; EBG00001164528.
DR   EnsemblGenomes-Gn; EBG00001164529.
DR   EnsemblGenomes-Gn; EBG00001164530.
DR   EnsemblGenomes-Gn; EBG00001164531.
DR   EnsemblGenomes-Gn; EBG00001164532.
DR   EnsemblGenomes-Gn; EBG00001164533.
DR   EnsemblGenomes-Gn; EBG00001164534.
DR   EnsemblGenomes-Gn; EBG00001164535.
DR   EnsemblGenomes-Gn; EBG00001164536.
DR   EnsemblGenomes-Gn; EBG00001164537.
DR   EnsemblGenomes-Gn; EBG00001164538.
DR   EnsemblGenomes-Gn; EBG00001164539.
DR   EnsemblGenomes-Gn; EBG00001164540.
DR   EnsemblGenomes-Gn; EBG00001164541.
DR   EnsemblGenomes-Gn; EBG00001164542.
DR   EnsemblGenomes-Gn; EBG00001164543.
DR   EnsemblGenomes-Gn; EBG00001164544.
DR   EnsemblGenomes-Gn; EBG00001164545.
DR   EnsemblGenomes-Gn; EBG00001164546.
DR   EnsemblGenomes-Gn; EBG00001164547.
DR   EnsemblGenomes-Gn; EBG00001164548.
DR   EnsemblGenomes-Gn; EBG00001164549.
DR   EnsemblGenomes-Gn; EBG00001164550.
DR   EnsemblGenomes-Gn; EBG00001164551.
DR   EnsemblGenomes-Gn; EBG00001164552.
DR   EnsemblGenomes-Gn; EBG00001164553.
DR   EnsemblGenomes-Gn; EBG00001164554.
DR   EnsemblGenomes-Gn; EBG00001164555.
DR   EnsemblGenomes-Gn; EBG00001164556.
DR   EnsemblGenomes-Gn; EBG00001164557.
DR   EnsemblGenomes-Gn; EBG00001164558.
DR   EnsemblGenomes-Gn; EBG00001164559.
DR   EnsemblGenomes-Gn; EBG00001164560.
DR   EnsemblGenomes-Gn; EBG00001164561.
DR   EnsemblGenomes-Gn; EBG00001164562.
DR   EnsemblGenomes-Gn; EBG00001164563.
DR   EnsemblGenomes-Gn; EBG00001164564.
DR   EnsemblGenomes-Gn; EBG00001164565.
DR   EnsemblGenomes-Gn; EBG00001164566.
DR   EnsemblGenomes-Gn; EBG00001164567.
DR   EnsemblGenomes-Gn; EBG00001164568.
DR   EnsemblGenomes-Gn; EBG00001164569.
DR   EnsemblGenomes-Gn; EBG00001164570.
DR   EnsemblGenomes-Tr; CLJU_c00080-1.
DR   EnsemblGenomes-Tr; CLJU_c00090-1.
DR   EnsemblGenomes-Tr; CLJU_c00100-1.
DR   EnsemblGenomes-Tr; CLJU_c00110-1.
DR   EnsemblGenomes-Tr; CLJU_c00180-1.
DR   EnsemblGenomes-Tr; CLJU_c00190-1.
DR   EnsemblGenomes-Tr; CLJU_c00200-1.
DR   EnsemblGenomes-Tr; CLJU_c00750-1.
DR   EnsemblGenomes-Tr; CLJU_c00770-1.
DR   EnsemblGenomes-Tr; CLJU_c00840-1.
DR   EnsemblGenomes-Tr; CLJU_c01000-1.
DR   EnsemblGenomes-Tr; CLJU_c01010-1.
DR   EnsemblGenomes-Tr; CLJU_c01020-1.
DR   EnsemblGenomes-Tr; CLJU_c01030-1.
DR   EnsemblGenomes-Tr; CLJU_c01140-1.
DR   EnsemblGenomes-Tr; CLJU_c01150-1.
DR   EnsemblGenomes-Tr; CLJU_c01160-1.
DR   EnsemblGenomes-Tr; CLJU_c01170-1.
DR   EnsemblGenomes-Tr; CLJU_c01290-1.
DR   EnsemblGenomes-Tr; CLJU_c01300-1.
DR   EnsemblGenomes-Tr; CLJU_c01310-1.
DR   EnsemblGenomes-Tr; CLJU_c01330-1.
DR   EnsemblGenomes-Tr; CLJU_c02530-1.
DR   EnsemblGenomes-Tr; CLJU_c02540-1.
DR   EnsemblGenomes-Tr; CLJU_c02550-1.
DR   EnsemblGenomes-Tr; CLJU_c02560-1.
DR   EnsemblGenomes-Tr; CLJU_c02570-1.
DR   EnsemblGenomes-Tr; CLJU_c02760-1.
DR   EnsemblGenomes-Tr; CLJU_c06230-1.
DR   EnsemblGenomes-Tr; CLJU_c06240-1.
DR   EnsemblGenomes-Tr; CLJU_c06250-1.
DR   EnsemblGenomes-Tr; CLJU_c06260-1.
DR   EnsemblGenomes-Tr; CLJU_c06310-1.
DR   EnsemblGenomes-Tr; CLJU_c06320-1.
DR   EnsemblGenomes-Tr; CLJU_c06520-1.
DR   EnsemblGenomes-Tr; CLJU_c06530-1.
DR   EnsemblGenomes-Tr; CLJU_c06540-1.
DR   EnsemblGenomes-Tr; CLJU_c06550-1.
DR   EnsemblGenomes-Tr; CLJU_c06560-1.
DR   EnsemblGenomes-Tr; CLJU_c06570-1.
DR   EnsemblGenomes-Tr; CLJU_c14920-1.
DR   EnsemblGenomes-Tr; CLJU_c14930-1.
DR   EnsemblGenomes-Tr; CLJU_c14940-1.
DR   EnsemblGenomes-Tr; CLJU_c14950-1.
DR   EnsemblGenomes-Tr; CLJU_c27280-1.
DR   EnsemblGenomes-Tr; CLJU_c27690-1.
DR   EnsemblGenomes-Tr; CLJU_c28240-1.
DR   EnsemblGenomes-Tr; CLJU_c28250-1.
DR   EnsemblGenomes-Tr; CLJU_c28260-1.
DR   EnsemblGenomes-Tr; CLJU_c28440-1.
DR   EnsemblGenomes-Tr; CLJU_c28450-1.
DR   EnsemblGenomes-Tr; CLJU_c28460-1.
DR   EnsemblGenomes-Tr; CLJU_c31750-1.
DR   EnsemblGenomes-Tr; CLJU_c32740-1.
DR   EnsemblGenomes-Tr; CLJU_c33580-1.
DR   EnsemblGenomes-Tr; CLJU_c34490-1.
DR   EnsemblGenomes-Tr; CLJU_c34500-1.
DR   EnsemblGenomes-Tr; CLJU_c34510-1.
DR   EnsemblGenomes-Tr; CLJU_c34520-1.
DR   EnsemblGenomes-Tr; CLJU_c36690-1.
DR   EnsemblGenomes-Tr; CLJU_c36700-1.
DR   EnsemblGenomes-Tr; CLJU_c36710-1.
DR   EnsemblGenomes-Tr; CLJU_c36720-1.
DR   EnsemblGenomes-Tr; CLJU_c36730-1.
DR   EnsemblGenomes-Tr; CLJU_c36740-1.
DR   EnsemblGenomes-Tr; CLJU_c36750-1.
DR   EnsemblGenomes-Tr; CLJU_c36760-1.
DR   EnsemblGenomes-Tr; CLJU_c36770-1.
DR   EnsemblGenomes-Tr; CLJU_c36780-1.
DR   EnsemblGenomes-Tr; CLJU_c36790-1.
DR   EnsemblGenomes-Tr; CLJU_c36800-1.
DR   EnsemblGenomes-Tr; CLJU_c36810-1.
DR   EnsemblGenomes-Tr; CLJU_c36820-1.
DR   EnsemblGenomes-Tr; CLJU_c36830-1.
DR   EnsemblGenomes-Tr; CLJU_c38150-1.
DR   EnsemblGenomes-Tr; CLJU_c39240-1.
DR   EnsemblGenomes-Tr; CLJU_c41210-1.
DR   EnsemblGenomes-Tr; CLJU_c41220-1.
DR   EnsemblGenomes-Tr; CLJU_c41390-1.
DR   EnsemblGenomes-Tr; CLJU_c41400-1.
DR   EnsemblGenomes-Tr; CLJU_c41410-1.
DR   EnsemblGenomes-Tr; CLJU_c41420-1.
DR   EnsemblGenomes-Tr; CLJU_c41430-1.
DR   EnsemblGenomes-Tr; CLJU_c41440-1.
DR   EnsemblGenomes-Tr; CLJU_c41470-1.
DR   EnsemblGenomes-Tr; CLJU_c41570-1.
DR   EnsemblGenomes-Tr; CLJU_c41580-1.
DR   EnsemblGenomes-Tr; CLJU_c41590-1.
DR   EnsemblGenomes-Tr; CLJU_c41600-1.
DR   EnsemblGenomes-Tr; CLJU_c41610-1.
DR   EnsemblGenomes-Tr; CLJU_c41830-1.
DR   EnsemblGenomes-Tr; CLJU_c42240-1.
DR   EnsemblGenomes-Tr; CLJU_c42250-1.
DR   EnsemblGenomes-Tr; CLJU_c42260-1.
DR   EnsemblGenomes-Tr; CLJU_c42270-1.
DR   EnsemblGenomes-Tr; CLJU_c42280-1.
DR   EnsemblGenomes-Tr; CLJU_c42290-1.
DR   EnsemblGenomes-Tr; CLJU_c42300-1.
DR   EnsemblGenomes-Tr; CLJU_c42680-1.
DR   EnsemblGenomes-Tr; EBT00001731486.
DR   EnsemblGenomes-Tr; EBT00001731487.
DR   EnsemblGenomes-Tr; EBT00001731488.
DR   EnsemblGenomes-Tr; EBT00001731489.
DR   EnsemblGenomes-Tr; EBT00001731490.
DR   EnsemblGenomes-Tr; EBT00001731491.
DR   EnsemblGenomes-Tr; EBT00001731492.
DR   EnsemblGenomes-Tr; EBT00001731493.
DR   EnsemblGenomes-Tr; EBT00001731494.
DR   EnsemblGenomes-Tr; EBT00001731495.
DR   EnsemblGenomes-Tr; EBT00001731496.
DR   EnsemblGenomes-Tr; EBT00001731497.
DR   EnsemblGenomes-Tr; EBT00001731498.
DR   EnsemblGenomes-Tr; EBT00001731499.
DR   EnsemblGenomes-Tr; EBT00001731500.
DR   EnsemblGenomes-Tr; EBT00001731501.
DR   EnsemblGenomes-Tr; EBT00001731502.
DR   EnsemblGenomes-Tr; EBT00001731503.
DR   EnsemblGenomes-Tr; EBT00001731504.
DR   EnsemblGenomes-Tr; EBT00001731505.
DR   EnsemblGenomes-Tr; EBT00001731506.
DR   EnsemblGenomes-Tr; EBT00001731507.
DR   EnsemblGenomes-Tr; EBT00001731508.
DR   EnsemblGenomes-Tr; EBT00001731509.
DR   EnsemblGenomes-Tr; EBT00001731510.
DR   EnsemblGenomes-Tr; EBT00001731511.
DR   EnsemblGenomes-Tr; EBT00001731512.
DR   EnsemblGenomes-Tr; EBT00001731513.
DR   EnsemblGenomes-Tr; EBT00001731514.
DR   EnsemblGenomes-Tr; EBT00001731515.
DR   EnsemblGenomes-Tr; EBT00001731516.
DR   EnsemblGenomes-Tr; EBT00001731517.
DR   EnsemblGenomes-Tr; EBT00001731518.
DR   EnsemblGenomes-Tr; EBT00001731519.
DR   EnsemblGenomes-Tr; EBT00001731520.
DR   EnsemblGenomes-Tr; EBT00001731521.
DR   EnsemblGenomes-Tr; EBT00001731522.
DR   EnsemblGenomes-Tr; EBT00001731523.
DR   EnsemblGenomes-Tr; EBT00001731524.
DR   EnsemblGenomes-Tr; EBT00001731525.
DR   EnsemblGenomes-Tr; EBT00001731526.
DR   EnsemblGenomes-Tr; EBT00001731527.
DR   EnsemblGenomes-Tr; EBT00001731528.
DR   EnsemblGenomes-Tr; EBT00001731529.
DR   EnsemblGenomes-Tr; EBT00001731530.
DR   EnsemblGenomes-Tr; EBT00001731531.
DR   EnsemblGenomes-Tr; EBT00001731532.
DR   EnsemblGenomes-Tr; EBT00001731533.
DR   EnsemblGenomes-Tr; EBT00001731534.
DR   EnsemblGenomes-Tr; EBT00001731535.
DR   EnsemblGenomes-Tr; EBT00001731536.
DR   EnsemblGenomes-Tr; EBT00001731537.
DR   EnsemblGenomes-Tr; EBT00001731538.
DR   EnsemblGenomes-Tr; EBT00001731539.
DR   EnsemblGenomes-Tr; EBT00001731540.
DR   EnsemblGenomes-Tr; EBT00001731541.
DR   EnsemblGenomes-Tr; EBT00001731542.
DR   EnsemblGenomes-Tr; EBT00001731543.
DR   EnsemblGenomes-Tr; EBT00001731544.
DR   EnsemblGenomes-Tr; EBT00001731545.
DR   EnsemblGenomes-Tr; EBT00001731546.
DR   EnsemblGenomes-Tr; EBT00001731547.
DR   EnsemblGenomes-Tr; EBT00001731548.
DR   EnsemblGenomes-Tr; EBT00001731549.
DR   EnsemblGenomes-Tr; EBT00001731550.
DR   EnsemblGenomes-Tr; EBT00001731551.
DR   EnsemblGenomes-Tr; EBT00001731552.
DR   EnsemblGenomes-Tr; EBT00001731553.
DR   EnsemblGenomes-Tr; EBT00001731554.
DR   EnsemblGenomes-Tr; EBT00001731555.
DR   EnsemblGenomes-Tr; EBT00001731556.
DR   EnsemblGenomes-Tr; EBT00001731557.
DR   EnsemblGenomes-Tr; EBT00001731558.
DR   EnsemblGenomes-Tr; EBT00001731559.
DR   EnsemblGenomes-Tr; EBT00001731560.
DR   EnsemblGenomes-Tr; EBT00001731561.
DR   EnsemblGenomes-Tr; EBT00001731562.
DR   EnsemblGenomes-Tr; EBT00001731563.
DR   EnsemblGenomes-Tr; EBT00001731564.
DR   EnsemblGenomes-Tr; EBT00001731565.
DR   EnsemblGenomes-Tr; EBT00001731566.
DR   EnsemblGenomes-Tr; EBT00001731567.
DR   EnsemblGenomes-Tr; EBT00001731568.
DR   EnsemblGenomes-Tr; EBT00001731569.
DR   EnsemblGenomes-Tr; EBT00001731570.
DR   EnsemblGenomes-Tr; EBT00001731571.
DR   EnsemblGenomes-Tr; EBT00001731572.
DR   EnsemblGenomes-Tr; EBT00001731573.
DR   EnsemblGenomes-Tr; EBT00001731574.
DR   EnsemblGenomes-Tr; EBT00001731575.
DR   EnsemblGenomes-Tr; EBT00001731576.
DR   EnsemblGenomes-Tr; EBT00001731577.
DR   EnsemblGenomes-Tr; EBT00001731578.
DR   EnsemblGenomes-Tr; EBT00001731579.
DR   EnsemblGenomes-Tr; EBT00001731580.
DR   EnsemblGenomes-Tr; EBT00001731581.
DR   EnsemblGenomes-Tr; EBT00001731582.
DR   EnsemblGenomes-Tr; EBT00001731583.
DR   EnsemblGenomes-Tr; EBT00001731584.
DR   EnsemblGenomes-Tr; EBT00001731585.
DR   EnsemblGenomes-Tr; EBT00001731586.
DR   EnsemblGenomes-Tr; EBT00001731587.
DR   EnsemblGenomes-Tr; EBT00001731588.
DR   EnsemblGenomes-Tr; EBT00001731589.
DR   EnsemblGenomes-Tr; EBT00001731590.
DR   EnsemblGenomes-Tr; EBT00001731591.
DR   EnsemblGenomes-Tr; EBT00001731592.
DR   EnsemblGenomes-Tr; EBT00001731593.
DR   EnsemblGenomes-Tr; EBT00001731594.
DR   EnsemblGenomes-Tr; EBT00001731595.
DR   EnsemblGenomes-Tr; EBT00001731596.
DR   EnsemblGenomes-Tr; EBT00001731597.
DR   EnsemblGenomes-Tr; EBT00001731598.
DR   EnsemblGenomes-Tr; EBT00001731599.
DR   EnsemblGenomes-Tr; EBT00001731600.
DR   EnsemblGenomes-Tr; EBT00001731601.
DR   EnsemblGenomes-Tr; EBT00001731602.
DR   EnsemblGenomes-Tr; EBT00001731603.
DR   EnsemblGenomes-Tr; EBT00001731604.
DR   EuropePMC; PMC2930579.
DR   EuropePMC; PMC3744686; 23950130.
DR   EuropePMC; PMC4600107; 26350967.
DR   EuropePMC; PMC4644658; 26431975.
DR   EuropePMC; PMC4895105; 27222467.
DR   EuropePMC; PMC6507227; 31086564.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF00558; L20_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01316; CRISPR-DR3.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01786; c-di-GMP-II.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01990; SECIS_4.
DR   SILVA-LSU; CP001666.
DR   SILVA-SSU; CP001666.
DR   StrainInfo; 163726; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4630065
FT                   /organism="Clostridium ljungdahlii DSM 13528"
FT                   /strain="DSM 13528"
FT                   /mol_type="genomic DNA"
FT                   /isolation_source="chicken yard waste"
FT                   /db_xref="taxon:748727"
FT   gene            101..1453
FT                   /gene="dnaA"
FT                   /locus_tag="CLJU_c00010"
FT   CDS_pept        101..1453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CLJU_c00010"
FT                   /product="predicted chromosomal replication initiator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13115"
FT                   /db_xref="GOA:D8GJZ7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D8GJZ7"
FT                   /protein_id="ADK13115.1"
FT                   /translation="MNAHPKEIWEQSLNIINGEITEVSFNTWIKSITPVSIENDTFILS
FT                   VPNDLTKGILTSKYKNLIANALKLITSKKYNIKFLIASESEEALTLDNTNKRHNKNSVL
FT                   VNDEMSTMLNPKYTFDSFVIGNSNRFAHAASLAVAESPSKAYNPLFIYGGVGLGKTHLM
FT                   HAIGHYILNNNSKSKVVYVSSEKFTNELINSIKDDKNVEFRNKYRNIDVLLIDDIQFIA
FT                   GKERTQEEFFHTFNALYEANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQPPDFE
FT                   TRMAILKKKADVENLNIPNEVMVYIATKIKSNIRELEGALIRIVAFSSLTNKEISIDLA
FT                   VEALKDIISSKQSKQVTIDLIQDVVANYYNLKVDDLKSARRTRNVAFPRQIAMYLCRKL
FT                   TDMSLPKIGEEFGGRDHTTVIHAYEKISTNLKQDESLQNAIGDLTKRLNQN"
FT   gene            1710..2813
FT                   /gene="dnaN"
FT                   /locus_tag="CLJU_c00020"
FT   CDS_pept        1710..2813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="CLJU_c00020"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13116"
FT                   /db_xref="GOA:D8GJZ8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D8GJZ8"
FT                   /protein_id="ADK13116.1"
FT                   /translation="MNFICTKTELQEAISIAQKAITGKSSMPILNGLLITTCKNQIKLT
FT                   GSDIDLSIETKINAEIKEEGSVVVDSRLFGEIIRKLPNDNINISTTENNSIEIICQKSK
FT                   FNLIHMNAEDFPEIPNINENIIFLIPQKILKDMIKSTIFAAAQDETRPILTGILFEIKD
FT                   KKLNLVALDGYRLALKSEYLNTENIINAVIPEKTLSEVSKILEDNDKNVNITFTPNHIL
FT                   FNLDNTKIISRLLEGEFIKYNSIIPDEFNLQVTAKREELLSCIERASLMAKDSNTNLIK
FT                   LEIEENNMIITSNSQLGMVREELNILLQGDTLKIAFNSKYLIDVLKIMDEEEIIMKFSS
FT                   SVSPCVIKNKDKDNCTYLVLPVRLLNN"
FT   gene            2841..3047
FT                   /locus_tag="CLJU_c00030"
FT   CDS_pept        2841..3047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00030"
FT                   /product="conserved protein with S4 RNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13117"
FT                   /db_xref="GOA:D8GJZ9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D8GJZ9"
FT                   /protein_id="ADK13117.1"
FT                   /translation="MNEIKINTDVIKLDSFLKWCGAVSQGSEAKMFIKDGMVKVNGEVE
FT                   TRRGRKLSQGFTVEFQEKTYKII"
FT   gene            3117..4217
FT                   /gene="recF"
FT                   /locus_tag="CLJU_c00040"
FT   CDS_pept        3117..4217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="CLJU_c00040"
FT                   /product="predicted DNA replication and repair protein
FT                   RecF"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13118"
FT                   /db_xref="GOA:D8GK00"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK00"
FT                   /protein_id="ADK13118.1"
FT                   /translation="MYIKYLKLINFRNYKELEMEFDKNLNVFIGDNAQGKTNILESIYY
FT                   CSIGKSPRTNKDKELINWNGKYAYIKAGVYSSSHNLNDKKIEIKIFKEGKKGININSIR
FT                   VNKLSELMGIFNVVMFSPEDLKIIKESPSFRRKFLDIELCKFSKRYYYNLVQYNKVLSE
FT                   RNLLLRKRNNSNSDILDIYDIQLSKYGAVIIDLRNKYINKLSKMGKIIHEDITSQTEKI
FT                   EFKYVTSITDLDNIENSLFKVLETNRQRDIEKGITLYGPHRDDFVTSINGINVRNFGSQ
FT                   GQQRTSVLTMKFASLEIIKEITGEYPVLLLDDVLSELDANRQKYILNSIDEIQTFITGT
FT                   GIGDIKKNVKKENQIFIVKSGKMNRI"
FT   gene            4236..4499
FT                   /locus_tag="CLJU_c00050"
FT   CDS_pept        4236..4499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13119"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK01"
FT                   /protein_id="ADK13119.1"
FT                   /translation="MFLHLGENIVVPIKDIIGIFDIETSTYNSDTTQFLRMAEEDGFVQ
FT                   KITKDKPKSFIIAEVNKKSRIYLSPISSSTLAKRSEILCYEL"
FT   gene            4517..6430
FT                   /gene="gyrB1"
FT                   /locus_tag="CLJU_c00060"
FT   CDS_pept        4517..6430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB1"
FT                   /locus_tag="CLJU_c00060"
FT                   /product="DNA gyrase, subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13120"
FT                   /db_xref="GOA:D8GK02"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK02"
FT                   /protein_id="ADK13120.1"
FT                   /translation="MMQEKKQTYDENQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYE
FT                   IVDNSIDEALAGYCDKINVIIHKDNSITVTDNGRGMPVGMHHKMKKPTVEVIMTILHAG
FT                   GKFGGGGYKVSGGLHGVGASVVNALSEICEVEVKRESHIWRQVFKRGKVASGLDIIGDS
FT                   EEHGTKIHFKPDAEIFDEIEYDYDTLAQRLRELAFLNKGIKIRLEDERDDKEEIFHYEG
FT                   GIKSFVTYLNRNKQPIHKEPIYVEGKKDDYSVEIAIQYNDGYTENIFAFANNIDTVEGG
FT                   THLAGFKSALTRVFNDYAKKFGILKENDKNLSGEDIREGLTAVISVKLVDPQFEGQTKT
FT                   KLGNSEVRGIVDSIMGESLNNFLQENPQVAKMILDKSLMASRAREAARKARELTRRKSI
FT                   LENTSLPGKLADCSSKDPSECEIYLVEGDSAGGSAKQGRNRKFQAILPLRGKIMNVEKQ
FT                   RLDKILGYEEIRAMITAFGAGIGKDFDVNKIRYNKIIIMTDADVDGAHIRTLLLTFFFR
FT                   YMKELVEKCHVYIAQPPLYRVAKGKKEYYAYSDDELDVLLTEIGGKDSNVDIQRYKGLG
FT                   EMDSEQLWDTTMNPETRTLIQVNVEDTMAADEIFTILMGDKVEPRRNFIQENAKKVVNL
FT                   DI"
FT   gene            6448..8919
FT                   /gene="gyrA1"
FT                   /locus_tag="CLJU_c00070"
FT   CDS_pept        6448..8919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA1"
FT                   /locus_tag="CLJU_c00070"
FT                   /product="DNA gyrase, subunit A"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13121"
FT                   /db_xref="GOA:D8GK03"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK03"
FT                   /protein_id="ADK13121.1"
FT                   /translation="MFDEGKILPVDISREMKKSYIDYAMSVIVSRALPDVRDGLKPVHR
FT                   RILYSMYELGLTPEKGYRKCARIVGDVLGKYHPHGDTAVYDALVRLAQDFSIRYTLVDG
FT                   HGNFGSVDGDSAAAMRYTEAKMNKITLEMLRGINKNTVDFVPNFDGEEKEPSVLPSRFP
FT                   NLLVNGSAGIAVGMATNIPPHNLTEVINGVIMIIDNPDITISELMTSIKGPDFPTAGII
FT                   IGTSGIRSAYETGRGKILVRAKAEIEEVKGRNRIIITEIPYQVNKSKLIENMADLVKNK
FT                   KIDGISDIRDESDRDGMRIVIELKRDANPNVTLNQLYKHTRMQDTFGIIMISLVNNEPK
FT                   VLNLKQMLVYYLQFQEEIVTRRTKFDLDKAQARAHILEGLKIALDHIDEVIHLIRSSKT
FT                   AENARNGLMSEFSLSEKQAQAILDMRLQRLTGLEREKIENEYNELMETIKHLKEILENK
FT                   ELLLKIIKDELIEIRDKYGDERKTEIQISNDDINIEDLIEEQEVVITLTHSGYIKRISA
FT                   DTYSSQRRGGKGIQAMSTKEDDFVEHIFITSTHNNILFFTNKGKVYKLKGYEIPDAGRT
FT                   AKGTNLVNLIPLQGDEQIQAVISFKEVDKDNYFIMATRCGLIKKTKISQYASIRKNGLN
FT                   AINLKDEDELIGVRMTTGESEILIFTKNGYAIRFSEDDVRPTGRNTTGVRAITLRTGDI
FT                   AVAMDIVDKSQDVLVISENGFGKRTPVSEYTIHRRGGKGIITYKVTEKTGLIVGARVVK
FT                   DEDEMMLINSSNVAIRLNVSEISVTNRNTMGVTLMRTDEEQRVVAIAKINCSDDTSDNT
FT                   SNDIDDKKVEE"
FT   gene            9416..10876
FT                   /gene="rrsA"
FT                   /locus_tag="CLJU_c00080"
FT   rRNA            9416..10876
FT                   /gene="rrsA"
FT                   /locus_tag="CLJU_c00080"
FT                   /product="16S ribosomal RNA"
FT   gene            11390..14100
FT                   /gene="rrlA"
FT                   /locus_tag="CLJU_c00090"
FT   rRNA            11390..14100
FT                   /gene="rrlA"
FT                   /locus_tag="CLJU_c00090"
FT                   /product="23S ribosomal RNA"
FT   gene            14308..14420
FT                   /gene="rrfA"
FT                   /locus_tag="CLJU_c00100"
FT   rRNA            14308..14420
FT                   /gene="rrfA"
FT                   /locus_tag="CLJU_c00100"
FT                   /product="5S ribosomal RNA"
FT   gene            14430..14506
FT                   /gene="trnM1"
FT                   /locus_tag="CLJU_c00110"
FT                   /note="tRNA-Met-CAT"
FT   tRNA            14430..14506
FT                   /gene="trnM1"
FT                   /locus_tag="CLJU_c00110"
FT                   /product="tRNA-Met"
FT                   /note="codon recognized: AUG"
FT   gene            14599..15102
FT                   /locus_tag="CLJU_c00120"
FT   CDS_pept        14599..15102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13122"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK04"
FT                   /protein_id="ADK13122.1"
FT                   /translation="MIFYRIKQFYWALTSRINEQDSRFIKSILSIEELKLFNKLSINEQ
FT                   KHCVKVAYDVERICNSKKGKVDEKLLLKAALLHDIGKIHRKLNLIDKSFIVSMDRISKG
FT                   KLRKFSQKQKINVYYNHSKIGVDLLKKIEYNEKLFYLIENHHNNDIHHNNLELKILKYC
FT                   DKRN"
FT   gene            15222..15737
FT                   /locus_tag="CLJU_c00130"
FT   CDS_pept        15222..15737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00130"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13123"
FT                   /db_xref="GOA:D8GK05"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026043"
FT                   /db_xref="InterPro:IPR035922"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK05"
FT                   /protein_id="ADK13123.1"
FT                   /translation="MDSKKRRIYIKEILEKNDKPQKGHILAEKLGVTRQIIVKDIAILR
FT                   AEGKDIIATPDGYLIPKAEKNLVKAVIAVSHETNEIEDELKTIVKFGGKVQDVIVEHPL
FT                   YGEIKSMLMIKNLYDVENFINKIKQYKAEPLLILTGGVHLHTIVAENDDIIKNIKRELK
FT                   EKKYIISD"
FT   gene            15783..18500
FT                   /locus_tag="CLJU_c00140"
FT   CDS_pept        15783..18500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00140"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13124"
FT                   /db_xref="GOA:D8GK06"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK06"
FT                   /protein_id="ADK13124.1"
FT                   /translation="MKRKMAIGIFILVLVLCISFLNNIVNFVINIQWYKQVGYLSVYFT
FT                   KLVAVCKLMIPLFIISFIGIWLYYKSLRVSIIKYRKVVEVKSSKVKIERKIVFFIDLIV
FT                   SFLASYVFASAYWYRILQFTNSVPFNKKDPILNLDISFYIFKLPLIQSIYSALVSLFIL
FT                   LGLITLFTYFILSMKDKFVSRNFKRNFGKINILDSGLTRFAGKQLAVLAALIILCISIG
FT                   YILKCINLVYSQNGVAFGASYTDAHVSLLFYKIIAVASFIAAIVIFISIIRVKIKPIVA
FT                   SIVVIIVLIISGNLMAFVVQNFVVKSNQKTLESPYIKYNIDYTRSAFNIDNVDTRSFEV
FT                   KDDLTSKDIENNMDTINNIRINSFDPTLEFYNQVQIIRYYYNFNNIDIDRYNINGKFNQ
FT                   VFVGAREINSKAIDPNTWQNRHLIYTHGYGIVMNKVNSVTSEGQPNFVIKDMPPNNSTD
FT                   IKIGNPRIYFGEKTDNYAVVNTKIGEFDYPKGSNNATNIYNGTDGIKLGFLNRLLFAIN
FT                   QKDLNFLLSRDISKESKILINRNIVDRVNKIAPFLNYDSDPYIVASGGKLYWVLDGYTV
FT                   SNRYPFSQPQNDVNYIRNSVKVTVDALNGDVNFYIVDKTDPIIKSYAKIFPNLFKNMNQ
FT                   LSPDIVKHFKYPKDLFNIQCSVLGKYHVTDPGVFYSGEDLWEVAKNQKQVSGEKNLMES
FT                   PYVVMKLPGANKEEMILLQYFNMRDKDNMVALFGARMDGKNYGKMILYKFPPEKTIYSP
FT                   YLFKQKLNQDTTISTQLSLWNKDGSKVQFGDTMIVPINNSLVYIEPMYLRASGKDSIPE
FT                   MKRVVVSYGDKIILAESIDDALQQIFNYNQNNQLQGNSTAQSQLVPTNNDNQEKIQQAK
FT                   SLYENALNAQKNGDWSGYGDNIKKLGDILNSLSK"
FT   gene            18576..19967
FT                   /locus_tag="CLJU_c00150"
FT   CDS_pept        18576..19967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00150"
FT                   /product="putative FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13125"
FT                   /db_xref="GOA:D8GK07"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK07"
FT                   /protein_id="ADK13125.1"
FT                   /translation="MDYDVLILGGGIIGCAVSYELSKYNLNIALIEKDYDIANDVAPID
FT                   YSIVYDGLECEDISLSKLEFAGSKIMSDLASKFNIFFEKKGYLLLADTKESEKKLICMY
FT                   NKALNRGMENIQLLDGEEVRKIEPNLGKNIKKAIYSKNTGIISPYDLAISYGEIACDNG
FT                   VNFKLGEEVLDIESISKGFKVVTNKNKFTCNMVLNTTPGKNYSIDRENRVNQNVKYLEY
FT                   FSVEKKLSKPYNNIISTIGDGDNKTCIIPGKENKLLVGLKNYEKISYEEGLQKISGFIK
FT                   DLSQENIGDFYNSHFYDDFLIIDDSLIDEDYIKIIGKHYGQVTMTPSIANIVCKTVVNK
FT                   LNCRLKKDFVDKRREFYKFRELSNEERKKIIKLNRKYGKVICYCNKVTEGEIIDAISRP
FT                   LGARTIEGIKRRTGATFGDCRGTRCLYEVASILARETNKKMTDIVKDSKNSNIMVGRIK
FT                   EFDEM"
FT   gene            19983..20333
FT                   /locus_tag="CLJU_c00160"
FT   CDS_pept        19983..20333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13126"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="InterPro:IPR036593"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK08"
FT                   /protein_id="ADK13126.1"
FT                   /translation="MIKERTGTKFDRQCIDIKDREDIKENLYSGEENLKLKEDNKCDIF
FT                   TTIVRIKGCNCNVVPVKSSKPLDKSLWLECSKVLARIHVGAPIKIGDIICKNILNTKVD
FT                   IICTKNVNKITK"
FT   gene            20707..21987
FT                   /gene="serS"
FT                   /locus_tag="CLJU_c00170"
FT   CDS_pept        20707..21987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serS"
FT                   /locus_tag="CLJU_c00170"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13127"
FT                   /db_xref="GOA:D8GK09"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK09"
FT                   /protein_id="ADK13127.1"
FT                   /translation="MLDLKRIRNNPEEVKKQLSNRGEDFDPATIDEVIALDEKRRKILV
FT                   EVEALKNKRNQDSAQIAKMKRNGENADDLVAEMKHVSDNIKQYDTELSELNGKIEYIML
FT                   RIPNIPNPAVPEGKSDEDNVEIRKWSEPTKFDFKPKAHWDIGTDLDILDFERGGKVSGS
FT                   RFTFYKGLGAKLERAIITYYLDFHTEKHGYTEILPPYMVNRTSMTGTGQLPKFEEDAFR
FT                   ISNNDYFLIPTAEVPVTNFHRDEVLKGENLPLKYVAYSACFRAEAGSAGRDTRGIIRQH
FT                   QFNKVEMVKFTKPEESYDELEKLTNDAEDVLKGLKIPYRVVRICKGDLGFTAALKYDIE
FT                   VWMPSYNRYVEISSCSNFEDFQARRANIKYKETPKDKPRYVHTLNGSGVAIGRTVAAIL
FT                   ENYQQEDGSVIIPEILRPYMGGKEVIK"
FT   gene            22245..22335
FT                   /gene="trnS1"
FT                   /locus_tag="CLJU_c00180"
FT                   /note="tRNA-Ser-TGA"
FT   tRNA            22245..22335
FT                   /gene="trnS1"
FT                   /locus_tag="CLJU_c00180"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCA"
FT   gene            22365..22455
FT                   /gene="trnS2"
FT                   /locus_tag="CLJU_c00190"
FT                   /note="tRNA-Ser-GCT"
FT   tRNA            22365..22455
FT                   /gene="trnS2"
FT                   /locus_tag="CLJU_c00190"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: AGC"
FT   gene            22619..22695
FT                   /gene="trnR1"
FT                   /locus_tag="CLJU_c00200"
FT                   /note="tRNA-Arg-ACG"
FT   tRNA            22619..22695
FT                   /gene="trnR1"
FT                   /locus_tag="CLJU_c00200"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGU"
FT   gene            complement(22791..23966)
FT                   /locus_tag="CLJU_c00210"
FT   CDS_pept        complement(22791..23966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00210"
FT                   /product="phage integrase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13128"
FT                   /db_xref="GOA:D8GK10"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK10"
FT                   /protein_id="ADK13128.1"
FT                   /translation="MATKTNCIRNGKKYYRLRVDLGRDSDGNRIRKTFYGKSKKDAEDK
FT                   LQEYKNGLNSGLSNDYDKLTLGNVCKLWLFEKIKNTVKPSTFERYEGVYRIYIKSSPLY
FT                   PVKLKELKSLDIQRYYNDLFNSGKSTSIIKNLDKLLKSFFNYCIDEGYIVRNYCIGKSI
FT                   TIPESNSVNENKKDDITVFTVDEQNQFINAVQDHRLKALFLLDLGTGLREGEILGLKWS
FT                   DIDFENCTLSVKRAIKGVTLIEGTKRNYHLIEQTPKTKNSIRTIPFPENLIPILEKHQL
FT                   QQKEEKIKAGPAYTKNDYVFCTELGLPIDPRNLRRSYERVLKNNNIPYKKFHSLRHTFA
FT                   TRLFENNVPLKTVQMLLGHSNINITANIYTHVMPPEKFKAIDKINSIFNVK"
FT   gene            complement(24696..25259)
FT                   /locus_tag="CLJU_c00220"
FT   CDS_pept        complement(24696..25259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00220"
FT                   /product="putative phage protein with HTH motif"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13129"
FT                   /db_xref="GOA:D8GK11"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK11"
FT                   /protein_id="ADK13129.1"
FT                   /translation="MLGDNIKKFRTQIGISQRELGRRIGKTGQYISYLEKNMNTNPSLE
FT                   VLNNISKELNVNTNDLIKPTINIEMHESEKNSLQGEKIINILNTLKQDISTYARTYQLA
FT                   GDTNELGLELINKLLKDITEFIELLSFNVSDITPEKFINSSYKMSTTEKNKKIQKTEEK
FT                   HSAISMSIGNICMDLSKLFSFSKI"
FT   gene            25405..25608
FT                   /locus_tag="CLJU_c00230"
FT   CDS_pept        25405..25608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00230"
FT                   /product="putative DNA binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13130"
FT                   /db_xref="GOA:D8GK12"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK12"
FT                   /protein_id="ADK13130.1"
FT                   /translation="MGLKIKLKRIERGIKQYELANKVGISRYYMQLLEKGKAKNPSIAV
FT                   MKAISKELDMPVQDLFFNDEEE"
FT   gene            25611..26405
FT                   /locus_tag="CLJU_c00240"
FT   CDS_pept        25611..26405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00240"
FT                   /product="putative phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13131"
FT                   /db_xref="InterPro:IPR014054"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK13"
FT                   /protein_id="ADK13131.1"
FT                   /translation="MDQNKPVTLDSREVAKMVDKDHHKLLRDIREYISQMKEANEDNPK
FT                   MDTPLNPDEYFIESTYINSQNKEQPCYEITKMGCDFIAHKMRGVKGTAFTALYIRRFYE
FT                   MQNPQIQLKKYSYMIEDPAERARVWANEFEEKKKIEAESKGKDEVIEHKENVIINLVDE
FT                   VSLAQKRQVLNRVVRYKGANFQKRWRELYKQFEMKYHINLNIRLDHYNREHKPKLRNKL
FT                   DYIDKVMGKIPEIYEIACKIYENDIKELVQQMYELNSSKKIS"
FT   gene            26720..26938
FT                   /locus_tag="CLJU_c00250"
FT   CDS_pept        26720..26938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13132"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK14"
FT                   /protein_id="ADK13132.1"
FT                   /translation="MAEHKYKILDSQPSKCKTMTVKDICREYDIGVNKAYSLAHMQGAP
FT                   VIYNGNRILFIRSKVDEWICSMIGEKF"
FT   gene            26966..27394
FT                   /locus_tag="CLJU_c00260"
FT   CDS_pept        26966..27394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13133"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK15"
FT                   /protein_id="ADK13133.1"
FT                   /translation="MLRKKTNFQSFQSSKGGRMIPLYFDMFDSEAWQSLSANAIKLYLH
FT                   MLRKYAAKYVKGELLRCNKDNISMPRSEYLKFMAKNTFEKCVDELIDYGFIRIVEYKPM
FT                   AGSRKVIIYGFNDMWKKYGTDKFHVKEEWKRAKHRSYI"
FT   gene            27678..28085
FT                   /locus_tag="CLJU_c00270"
FT   CDS_pept        27678..28085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13134"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK16"
FT                   /protein_id="ADK13134.1"
FT                   /translation="MENFKYSINNISSQIFHIKKINSELKGLLEESKKCWKELKSTPNG
FT                   LPNDLKHVVDNLFMIAFKDSAVKDKHINKFTYMLKALNPEDKAKIRDIKQIGVEVQRLN
FT                   DKDTVIAKAVLTIIKEFKVVFYKELERRSKE"
FT   gene            28156..28335
FT                   /locus_tag="CLJU_c00280"
FT   CDS_pept        28156..28335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13135"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK17"
FT                   /protein_id="ADK13135.1"
FT                   /translation="MIEKLLKILRILKNKNNEDMQVCQRSCGAKDSNYVRGYIDALKQQ
FT                   NELLDKQIAIFEEE"
FT   gene            28437..29180
FT                   /locus_tag="CLJU_c00290"
FT   CDS_pept        28437..29180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13136"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK18"
FT                   /protein_id="ADK13136.1"
FT                   /translation="MNDDSINYVLDNYKGVRRDRALKIISGQLKETDLEFKQYVKNELV
FT                   RDRKTIIEQYKNIEGLHEVRKACEREYKYYEKINDVVNKAEFQLNISEVDKLAKEILRI
FT                   IATLGEHFIDVLSLNILEEHDVCQLLNINWKIFKNNKQAYIKQFGEKDKLVYKVISVMG
FT                   PEYRYRKGRMKEIYDCPKYEMPVYWAMNERIMQEVDNNKELKKLADEAFEKLFPDVKTY
FT                   RVVKDLEGNVIKVVEETEKSSSESN"
FT   gene            29659..30426
FT                   /locus_tag="CLJU_c00300"
FT   CDS_pept        29659..30426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13137"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK19"
FT                   /protein_id="ADK13137.1"
FT                   /translation="MNKEEFLKLNIEDRVKYFNEKIKEVGSYNKVCKELNISTCQSGIL
FT                   KKHGWIRSGDKFIYDKNSDKNNNVNIDGKVIPVQKTLFDTSEDLRGYQGNAKDTGEIEK
FT                   HTNMEREDNKISDKVKRHMYPTNNKNDGLQRIWPDNRQSMEVEANVLTNNIDKSVNQQK
FT                   VTPKLEISKEEELSYDTNKNGIKQVNDDIYDSDNATKKLGRPSKPGRKKYSLNLNIADF
FT                   KQLQIYCILNDVSPSDIINNFIKDFLKTVNQHK"
FT   gene            30647..30898
FT                   /locus_tag="CLJU_c00310"
FT   CDS_pept        30647..30898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13138"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK20"
FT                   /protein_id="ADK13138.1"
FT                   /translation="MKDKTNFSHYDGKVFNAENFKYINDPIAVIVDSIAILVGDYEPAR
FT                   KQAAMLLLKALLKDKFLKDLLKDIQNEKAERAKKSCEA"
FT   gene            30921..31343
FT                   /locus_tag="CLJU_c00320"
FT   CDS_pept        30921..31343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00320"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13139"
FT                   /db_xref="GOA:D8GK21"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK21"
FT                   /protein_id="ADK13139.1"
FT                   /translation="MSLLKSKWNDIKDKLILIQGWARDGLTDEQIANNLGIGTTTLYKW
FT                   KNQHKEFQEALKKGKEVADREVENALYKSALGFKYKEQVVTNKGDVVEVERYEKPNTTA
FT                   AIFWLKNRKPAQWRDRQEIDQKCNLGVQIIDDIPDN"
FT   gene            31535..31783
FT                   /locus_tag="CLJU_c00330"
FT   CDS_pept        31535..31783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13140"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK22"
FT                   /protein_id="ADK13140.1"
FT                   /translation="MKCKACGYEHEGHYTEDNKYVTTKGDKPFIEVSQNIAVKEKDKFN
FT                   NTKEILSTKLYACPNCGTVKMEEDQMCDGEKVHIYKF"
FT   gene            31836..32198
FT                   /locus_tag="CLJU_c00340"
FT   CDS_pept        31836..32198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13141"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK23"
FT                   /protein_id="ADK13141.1"
FT                   /translation="MEVYFSVNNREKLLRGDIKDFLVEYKHKNTKYGSIYQIYLKGLNL
FT                   KNIELRNLKSDTVLPEPMKFLEDLYLKNKEFRFVIINKNLVLEESNFIATFKEFRISNN
FT                   LLFAIVRKKYKENLTL"
FT   gene            32430..33335
FT                   /locus_tag="CLJU_c00350"
FT   CDS_pept        32430..33335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00350"
FT                   /product="putative phage-related terminase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13142"
FT                   /db_xref="GOA:D8GK24"
FT                   /db_xref="InterPro:IPR005335"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR038713"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK24"
FT                   /protein_id="ADK13142.1"
FT                   /translation="MVDVNKDLVKIDYLQGMKYKDIASKFGVSIDTVKSWVKRYGWSKE
FT                   RQKFKKMSAHKEAKKVENKCTQNKKVSSSKKEGPENKKRVQKGKVELDDYEPTPYIENK
FT                   ELNDKQKLFCVYYIKCFNATKAYQKAYGCDYMSAASNGPRLMGNDRIRAEIERLKADKF
FT                   KGAMLSPMDILQKYIDIAFSDITDYADFGNAEYKAKNKDGKEEMHTYSFVNFKNSNEVD
FT                   GTIISEIKQGKDGISLKLESKKWALDFLAKHIGLLDIPTQEKLKNEQKKMEIAEKQADN
FT                   LDDDIEYAVEGGMNEDYEEG"
FT   gene            complement(33507..34031)
FT                   /locus_tag="CLJU_c00360"
FT   CDS_pept        complement(33507..34031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13143"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK25"
FT                   /protein_id="ADK13143.1"
FT                   /translation="MNNKYLVDLRHLIDLSRIKAYIEISNCIEFQHPTDVMDNLTRLLS
FT                   YANKNSICMPKQIDTGIFNSLIKKVEANRDYLHELNEYIEDSSRKLKEDNGWEENDMSK
FT                   VGIPRSSFGITLEELIVFYKVLENLENCYDIIKNDIVTFWSVETYFNNIKTIKNMLEKR
FT                   LAHAIINVPAL"
FT   gene            34264..34629
FT                   /locus_tag="CLJU_c00370"
FT   CDS_pept        34264..34629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13144"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK26"
FT                   /protein_id="ADK13144.1"
FT                   /translation="MKNQLYKEKAYEFNIVRECEILSISCKKIMKAIDNTDLELMSTSF
FT                   NFIVSSCNQIRRTKAPLKYVQIYKDIRRVCNLLMKIYHNIFHRFIDEIWVNKYNEKISE
FT                   VAELLKIPLSKIENVNI"
FT   gene            complement(34920..35465)
FT                   /locus_tag="CLJU_c00380"
FT   CDS_pept        complement(34920..35465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13145"
FT                   /db_xref="GOA:D8GK27"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK27"
FT                   /protein_id="ADK13145.1"
FT                   /translation="MITSICVFVLIPYIIAHWKQGLKKNISYGNLSKDDTSRNVKQTRK
FT                   QASAGLAIIGVILFALGIYTLNNSYKNSNQNVSSNKSNTVQTSTSDINSSKGATATLAK
FT                   SEQSKKDDFIKEGMYKVGTDIQPGEYKVNSPGDGYVEVATNSRHTVNGIVSNDNFSGDK
FT                   YISVQNGRYLKISHATLK"
FT   gene            complement(35488..36351)
FT                   /locus_tag="CLJU_c00390"
FT   CDS_pept        complement(35488..36351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13146"
FT                   /db_xref="GOA:D8GK28"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK28"
FT                   /protein_id="ADK13146.1"
FT                   /translation="MNNKFYQKDWLMWLMFAIFIPVGVVLMWVNSRYKKAVRVIVSLLY
FT                   LFLFSVEYNVLKDYNNGFAIFIGYVLVFVLLPYVIVHWKQLHKRNFSDSNTSGEQLKYN
FT                   YNNEYKKTSSQKSIGIYIVGVILVTVGFLTVNSPHKNVESASQPAQNTTKQEVKKVDNA
FT                   NLQADLRDKLKDNAIQIEDSTDSTGYILIKNKCQADTRSRISYETYLMLNEARQRPEYK
FT                   KCNKIGVMITADLTDKYGNTSNDKVYMQDFDKSELDKVNWDNIDENKMDAIGETPWYHE
FT                   IINLDK"
FT   gene            36463..40182
FT                   /locus_tag="CLJU_c00400"
FT   CDS_pept        36463..40182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00400"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13147"
FT                   /db_xref="GOA:D8GK29"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK29"
FT                   /protein_id="ADK13147.1"
FT                   /translation="MSLQDLTYEIGYNVDTSGLSKSLDILNSFETNLVGKAKEVESMFS
FT                   NIGKASSSITELSKVTSGLNVDGLSSSLKNSVGSSNELNLSTERQQRLEKLVDDYVDEY
FT                   NTKLEKSSDLTEQWNNRTVELNKPLSQYAEEQQKIDDEINQSINKTDDLASSVNKVSEN
FT                   TSKAKDKTDELKNSLGAVNKVSGGIGNMLGAFGFIGIGYGVASGIKGAIGAFTEFQQEM
FT                   ANVHATLGDVTNNDLTALSNKAIEISNNYGISSAQISQGEDELASHGLNAKQIMDTIQP
FT                   STLLAVAGNIKMKDSTLDVSSALRNFNLDMSQAGHVADTYAAAAASTAAAMPDMAQALK
FT                   NVAPIAGEVGYSIEETAADIGALADKGIKGGIAGTDLKIMIERLISPVGKGAELIKELG
FT                   FNAIDPTTGKLKSMSTVIRDLNKAFESHGLTTAPEKNSALSIIFGKEALPGTAAIFGTA
FT                   PDQLDKLTKSLENSKGAAQKMADTMNDTLQGSLNKLKSKIDNVFITDISKTTLGKSMKN
FT                   FIDSVNTNMPTIENNLAWVLNGALKIGSGIKQNWGPISDTVLEVGLSFLTLKGILTVAK
FT                   FAESISVLGKLSAPILLISMSVGAAATGFKDIKEGNKGLGALMLGTAAGLDAMAAALLL
FT                   TDMSLGPVILVGVAVAALATGIIYFKSNWAQTWINIKETTMEYVNPIIDKINGLITLLD
FT                   KIPGVNIGKISDIKMSSDDIKMAQSLGMSPDQIQKLTGSENKIQSFKPTSGTQALTNMV
FT                   SNNNNVYSWFPKTKYASGTDYATGGTALVGEKGPEIVNLPTGSQVIPAQQTASMLSNTN
FT                   SKMGTGAAASQNGFNSSTKKLLAENKAIIMDYVSHQTVYGQNSVKNFSTAVLDREPLAT
FT                   TATNKVSTDNKNIMSNLANSALTYGTQIDTELGQGIKDSEGSLLSIVDDLATKVVQQFK
FT                   VTFGIASPSKVMYRIGDFLGQGLINGMQANDINSFITKWIGDTSSLTQNGLGSVIGQLL
FT                   QPMFVSGDNKGIISMVYNLVHNGLGSLFSSGGAVSGNVAEWLTAAIALTGAPMSWLPAL
FT                   EMIAMGESGGDPMSINTYDINAQEGHPSEGLMQLIQENMDDYHLPGMTDIFNPIENGAA
FT                   SIRLIEHDYGSPWNTPGVRSEMAGGPYMGYAGGTSNATPGIHLVGEKGPELVSFNGGEK
FT                   VTPNNQLASISQKPYFAGGSDVKAEISPNISFNIYESKDPRATAQEVYKVLKQHFGDLF
FT                   DEKMGTLKIQMGFR"
FT   gene            41230..42066
FT                   /locus_tag="CLJU_c00410"
FT   CDS_pept        41230..42066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13148"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK30"
FT                   /protein_id="ADK13148.1"
FT                   /translation="MRKTIAIVVIVLCIIAIGIGGYKYKENKNYQKALIEQTRFTKYFK
FT                   TVGSIDGTKVSNKDFIDKSISSSSITKNDLKQSHVEGNKYVVAYKFKHKDTKGIHDVEV
FT                   DAYYYKKQNGDIFYKHNNMVFKQDGKVIDADWVISIALYDYYKANLSSSTGKAKSMIQN
FT                   VISLKNKYKDLDLTDLSKADADNVINKDELAIAKEKATEEEQQRERAEEEKQRERKQIK
FT                   DRISNSQNSNVQVNQNSNINTHPTQAEIDEFRRMWYENQLKDLKEHEARNAANQNK"
FT   gene            complement(42429..42590)
FT                   /locus_tag="CLJU_c00420"
FT   CDS_pept        complement(42429..42590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13149"
FT                   /db_xref="GOA:D8GK31"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK31"
FT                   /protein_id="ADK13149.1"
FT                   /translation="MVMYVIMSFMVGFTGNKLFNKNNIGIQSSIKWGFIIGSILIMIHA
FT                   ILDKFVKL"
FT   gene            complement(42605..44992)
FT                   /locus_tag="CLJU_c00430"
FT   CDS_pept        complement(42605..44992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13150"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK32"
FT                   /protein_id="ADK13150.1"
FT                   /translation="MINFISKFSKPKTIKLSEYFEIIKPKYVTLQITPSISNRNYDTEI
FT                   IALTIANMYRLPYQRLQSDIKKSGLKITYQLPEKVSLIISIAADDCKFYLVVPEKYKKL
FT                   FVEKCCEVWKRSKVKQVDYILEPEGNKYELFYSKEDALSLKYNKKTNEPLSNILNVKDI
FT                   MEKGDKVDILYNFIPASQARWKGIYNQTIRKVKKDLPVDKEKLNLTFLSKYILIGSIKI
FT                   IDCIFDIFNKVLGEEKRSKKVHPEVAVTSISKLDNLSRFTHKKETTTVIDTQIVVCSKS
FT                   NDKLREHNNALAVVGSYQTLTQDNSLKYKKLKDKTKINIGSYKFSKISTNRMSTAECNN
FT                   LIQVPGRDLLQRHKISTKVDVLESHVPEELQKGNIELGSATYNSKSFNTFLPTEYNSAN
FT                   LALMLLAPQGAGKTNFIANLCRCANKVHESNIVIDYVKNCELSNAVKKAVNPKDVIELD
FT                   LTKEECFQAFAFNEVQYEGENEFNRFETANMKAEQTLALINSMNKDGLPLTGNMRRVLN
FT                   AAANIVYLHNKTGVGDVIRCLEKHTYRHELIDYVNKNLSEDGIKYFEDMVEALESIDKV
FT                   ETETDRKTKEVIRREVVGTKRNEIDGILDRVSLLKENIYCKYMFNMIPENNIDFVKAME
FT                   EGKTILIEMPESKFNNTMVKNVLTTFFTSKVMLATKLRGALHEKPSRCNIIYDEIYQAP
FT                   TAMEVITDVLSQLRKFGTKIIISAHYLDQLTPDLKSEIKGSGASYMLLQGCDKKVFNEL
FT                   ADEMKPFELDDLLNLKQYHSLNLIRTKAGYQKFITQLPKALF"
FT   gene            complement(45052..45375)
FT                   /locus_tag="CLJU_c00440"
FT   CDS_pept        complement(45052..45375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13151"
FT                   /db_xref="GOA:D8GK33"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK33"
FT                   /protein_id="ADK13151.1"
FT                   /translation="MLKTMSVNQFLVLASSENEGTIKSIKEFCETTGDFFKTMAKVAYY
FT                   LFHPKQLAWMMWSGLVAHSLEICLMLCLVSIMAWLIGWNKGKKIATGSILAYGIIQAIN
FT                   ASL"
FT   gene            complement(45391..45762)
FT                   /locus_tag="CLJU_c00450"
FT   CDS_pept        complement(45391..45762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13152"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK34"
FT                   /protein_id="ADK13152.1"
FT                   /translation="MLNALKRKEIYSIPEYLQQYQRTSKSNINEKYFKVASTTLALILY
FT                   SEKVMAASGSTTLEPGFWKLVGIIQKIVAGLALLYSYRVLAKMAAKGEGTWKEVGYGLL
FT                   IVGADYGLPSAFKFVTGLF"
FT   gene            complement(46280..46453)
FT                   /locus_tag="CLJU_c00460"
FT   CDS_pept        complement(46280..46453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13153"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK35"
FT                   /protein_id="ADK13153.1"
FT                   /translation="MLRITVSFKQTSRDLKLYTTVNSLEEKSDFIKDALEHYLKYLEVT
FT                   KSKENGRTDINF"
FT   gene            complement(46573..46773)
FT                   /locus_tag="CLJU_c00470"
FT   CDS_pept        complement(46573..46773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13154"
FT                   /db_xref="GOA:D8GK36"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK36"
FT                   /protein_id="ADK13154.1"
FT                   /translation="MVKNRLLEIRLKLGYKKQKDFAEFLGIKRVQYNKYENNKEQPTLE
FT                   TLYKISLKLGIKMEDIIYLDK"
FT   gene            47093..48508
FT                   /locus_tag="CLJU_c00480"
FT   CDS_pept        47093..48508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13155"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK37"
FT                   /protein_id="ADK13155.1"
FT                   /translation="MITARKVKLTITENREDGYNFIHNELREQNQALNMAMNHLYFNYV
FT                   AREKIKLADETHKIKLAEDQGYLDQKYTELKEVKTDKKKQNIRKSIQAAKKRLETLRKA
FT                   ENKQVAEKFKEIIAASEKTNLRDFITDNFNLTSDTKDRLTQKVSADFKNDIVDVLRGER
FT                   TLRRYKKGNPLYIRGRNLTFYIKDEEYYIKWMKSIVFKCVLGVKKQNSLELQKTLDKVI
FT                   EGKYKVCDSSIEFKQNSLILNLTLNIPVCNSFDKVEGRVVGVDLGMKIPAYVTLNDSDY
FT                   IRRAIGSIDDFLKVRTQMQSRRRNLQRALKSTKGGKGREKKLKALNQFEVKEKNFAKTY
FT                   NNFISSNIVKFASDNKAKQINMEFLSLSETQNKSVLRNWSYYQLQQMIEYKANRVGIKV
FT                   KYVDPYHTSQICSKCGHYEEGQREKQEVFICKNPECKNFNIEVNADYNASRNIAKSNKY
FT                   ITKKEESEYYKIN"
FT   gene            49101..49226
FT                   /locus_tag="CLJU_c00490"
FT   CDS_pept        49101..49226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13156"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK38"
FT                   /protein_id="ADK13156.1"
FT                   /translation="MDIFKYRKEVIRIINLKGKAYAVGANVVKCVDIFRPSKCII"
FT   gene            49780..50085
FT                   /locus_tag="CLJU_c00500"
FT   CDS_pept        49780..50085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13157"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK39"
FT                   /protein_id="ADK13157.1"
FT                   /translation="MAKRLTGGAGTGKKIMKNLDLFSYKFNKIEEDDYIFDVKFGNQTG
FT                   SFVINYNENNIIDEGSTLNIYGLDRPLGIYNDPSLRQVAEMLMNYYKSNKDENENN"
FT   gene            50432..50986
FT                   /locus_tag="CLJU_c00510"
FT   CDS_pept        50432..50986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13158"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK40"
FT                   /protein_id="ADK13158.1"
FT                   /translation="MNGQYKLFKIFEYQETLQVLNELFGKQQILNINSKLIGIRYDYSK
FT                   NQYVDILRKVNDLNIGQKIITSRAFIKMFRACIERRYFIKKLQIIESVPEDMQQFINDN
FT                   IQKINSESEFTHKIRLANFLISKLNWLRRIDGIDVKLLSFRIKGNNNIKIGVSIFNNGV
FT                   ISVDDDSILDELVELINKIIK"
FT   gene            50997..51749
FT                   /locus_tag="CLJU_c00520"
FT   CDS_pept        50997..51749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13159"
FT                   /db_xref="GOA:D8GK41"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK41"
FT                   /protein_id="ADK13159.1"
FT                   /translation="MNKAIKARNLIVTILKILLPVYSIILVCFFNIMPVTFMMNLLNIK
FT                   GKSNITPAIEVTATTVILSAIVSLIFNKISFKNSFLVQAYDNFMDDELTLPLGMYESEY
FT                   LNQKYKLYIKVESKYSSLFMRKFMESRDCLVLRVCLPNWVSYEIENKDDLGEDVVTEKS
FT                   NQIVDINISKYMGDVCAQKEISFPIILELMSNSLETRIGGQVIAKYYLVKKDGTYSKVY
FT                   SFIFRIIQFIVIFLKFDVKWVDKKISTK"
FT   gene            51770..52879
FT                   /locus_tag="CLJU_c00530"
FT   CDS_pept        51770..52879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13160"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK42"
FT                   /protein_id="ADK13160.1"
FT                   /translation="MDTFSIWEFNEIEKLETSQEKIENNKEIYENIEWDDEPLKIEIKQ
FT                   TDNGDEFNKIKTLNINGETIRYISFATSVDRPKNVTLTDKWYLPDGKLKPRNERVRTIN
FT                   SDIILFENDGKVYGVFFIGINGAKQIISKLFSKSVWGEVSKLELGIDDDMLFWMFKSFI
FT                   DFETKQLSDNVPICITAIRSYLAKTRDTLNTLRGKGEKISAILGTLAFLFNNDKLKSIR
FT                   PEIQYKGEVFLIELSLSGTYKLDQTEYEGQFISLKGNEKRDAIVIYLIIVLLPKLVDAY
FT                   KENIKSSEWSRELKIDFIKRLGVMIKENVDSELEEMEKIEIGHCDTNLDKKLVSDKDID
FT                   ADIEEFDKDIEEFDKDIEEFDKDIEEFDK"
FT   gene            53405..54418
FT                   /locus_tag="CLJU_c00540"
FT   CDS_pept        53405..54418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13161"
FT                   /db_xref="InterPro:IPR011204"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK43"
FT                   /protein_id="ADK13161.1"
FT                   /translation="MDKDKEPREGEILFYTTNDGNINLGVLFSDETVWLTQNQMAELFN
FT                   RDKSVISRHIKNIFAEGELNEKSVVAFFATTAADGKTYDVAYYNLDVIISVGYRVKSIQ
FT                   GTQFRIWATKTLREFIIKGFVLDDERLKNGANFGKDYFDELLERIREIRASERRFYQKI
FT                   TDIYSECSIDYDKDSETSKKFYATVQNKLHWAITGHTAAEIIRDRADAKKPHMGLTTWK
FT                   NAPKGKILKRDVSIGKNYLTKKELSELNTVVTMYLDYAELQASRHIPMKMKDWVNKLDA
FT                   FLSFNDYKILNDLGTISNKVAKELAEGEYKKFRIRQDREYESDFDKTVKKYLKNKQ"
FT   gene            55060..55266
FT                   /locus_tag="CLJU_c00550"
FT   CDS_pept        55060..55266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13162"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK44"
FT                   /protein_id="ADK13162.1"
FT                   /translation="MRKLAEGEILSLTGLLKLESDGLAVSRAMQSLIKDDELKKQAKSG
FT                   ILAAEGRIKGLEQFINENDVTRK"
FT   gene            55282..55575
FT                   /gene="cotF"
FT                   /locus_tag="CLJU_c00560"
FT   CDS_pept        55282..55575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cotF"
FT                   /locus_tag="CLJU_c00560"
FT                   /product="predicted spore coat protein F, CotF family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13163"
FT                   /db_xref="InterPro:IPR012851"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK45"
FT                   /protein_id="ADK13163.1"
FT                   /translation="MASILNNIVKNTTDINDEVISGSMLSSAKGAADAYLNATMTSTTP
FT                   ELRALYSSSLNQVVGGHSALTELVINRGWNNPYDSPTEQLSDVVNKAETTVE"
FT   gene            55827..56501
FT                   /locus_tag="CLJU_c00570"
FT   CDS_pept        55827..56501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00570"
FT                   /product="putative isoprenylcysteine carboxyl
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13164"
FT                   /db_xref="GOA:D8GK46"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK46"
FT                   /protein_id="ADK13164.1"
FT                   /translation="MEGNTKLSRKKAYFVPIIIMIVMGIVLFLPAGTLMFWEAWIYWLG
FT                   FSIITFFIAAYFLKKSPELLSRRMKYREKDTTKKTPAIFNLFFVGYIIPGIDFRFHWSS
FT                   VPVWIVIISNIIVLLGYIFIIFVFNQNSYASTIIQVEKEQQVITTGPYSIVRHPMYLGM
FT                   LLMLLFTPLALGSYWAVLPFLLSVPMNIFRIKNEEEVLLRDLPGYKEYCIKTPYRLIPL
FT                   IW"
FT   gene            56651..57577
FT                   /locus_tag="CLJU_c00580"
FT   CDS_pept        56651..57577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00580"
FT                   /product="putative DNA-binding protein with a predicted
FT                   acetyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13165"
FT                   /db_xref="GOA:D8GK47"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK47"
FT                   /protein_id="ADK13165.1"
FT                   /translation="MKHRNLNIISEVRNFSRFYTNILGLLNQDILDSSYSLTEARILFE
FT                   INKTKECTANILIDKLDIDKGYLSRILNRFKSDELIIKEKCSSDGRLNFLKLTENGKNI
FT                   LSSLSKKSDNQISKLTDHLDENEKENLVNSMRYIIKSLSYSKEVFNIRTYRVSDIEYII
FT                   EKHRELYKNEFGFSNIFGDYVEKYLIEFHRKYNSDLENIWIAEQNNKPVGVIAIAADKT
FT                   DPSLAQLRWFLVEPNMRNSGLGHILLDTAINFCKDKNYKHIFLWTADVLKTARYLYGNY
FT                   GFKLTESMDNTTWTNHLVKEERWDLYI"
FT   gene            complement(57690..58439)
FT                   /locus_tag="CLJU_c00590"
FT   CDS_pept        complement(57690..58439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00590"
FT                   /product="predicted transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13166"
FT                   /db_xref="GOA:D8GK48"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK48"
FT                   /protein_id="ADK13166.1"
FT                   /translation="MAHKPTERVLNILNLLSVKPKGLTLTEISEAIDVPKSTLYPIIQT
FT                   MLERNFLSLEKSSLKYSIGISTFCIGASYSRNKNMLDFIQKIMKNIVSTINETCQMGIL
FT                   DGYNVLYILKEDPIKDIDIRLISYVGKRIPAYCTALGKALLSEYNIEEIKTLYPDGLKP
FT                   ITKNTITDFSVLEEELKKIRETHVATEVEEVTEFLRCYAVPLTSKGKTTAAISISIPTF
FT                   RATEEKNKLAIELLLKAKEQIDAVNLN"
FT   gene            58896..59801
FT                   /locus_tag="CLJU_c00600"
FT   CDS_pept        58896..59801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00600"
FT                   /product="predicted pyruvate-dependent class I aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13167"
FT                   /db_xref="GOA:D8GK49"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK49"
FT                   /protein_id="ADK13167.1"
FT                   /translation="MKKARFITPVVTAFDTNGNLDIQVNKNIYDYLISAGIDGLLIMGS
FT                   SGEFYAMSTEQRKELIDLAISYVNKRTKLIIGTGCMTIEDTIELSNYAIDAGADDIIII
FT                   SPYYFSLTDESLEYYYGKVAESVKGNIYLYNYPDRTGHDLSPELTLNLLRKHSNIVGYK
FT                   DTVSEMGHTRKLIQTVQNEFPDFEVFSGFDENFVRNILSGGSGCISALSNLYPEIFVDW
FT                   VKAVNEKNMDKAAEIQNCVDKLAALYEISKCFIPIVKKAMMLKGLDIKDYCKTPLLKAN
FT                   EKQTNSIKKLIKEIDHIISK"
FT   gene            59867..61840
FT                   /locus_tag="CLJU_c00610"
FT   CDS_pept        59867..61840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00610"
FT                   /product="predicted dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13168"
FT                   /db_xref="GOA:D8GK50"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR017798"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK50"
FT                   /protein_id="ADK13168.1"
FT                   /translation="MSLKSIYGEEDSSLYEINTHAEGPKGSLPLTPQLLKDSPSGNIFG
FT                   MTLNAGMGWEPSKLLGGDVLILSNQGGIRDNDGTPIAVGLHTGHFELGLQMRAAAEEIK
FT                   KLGGVPYAAYVTDPCDGRSQGTTGMFDSLPYRNDSAIVCRRLIRSLPTRRAVMGVASCD
FT                   KGLPAMMMALVSMHDLPTIIVPGGATLKAIDGEDAGTIQTIGVRFANNELSLEDACRRG
FT                   CNACASAGGGCQFLGTAGTSQVIAEALGIALPHSALAPSGQPIWKEIARQSAKAVLDMA
FT                   DNGIATKNIITDEAIENAMVVHAAFGGSTNLLLHLPAIAHAANCKIPTVEDWARINKKV
FT                   PRLVSVLPIGPVNYPTVSAFLAGGVPEVMLHLRKLGLLHEDVLTVTGETLGDNLDWWEK
FT                   SERRAECRKRLLEVDKINPDEIIMNPSQAKERGLTSTVTFPVGNIAPEGSVVKSTAIDP
FT                   SVIGDDGVFRHTGKVKVFTSEKAAIKALKDAGKIKAGDIMIVMGGGPMGTGMEETYQLT
FT                   SALKHLSFGKHVSLITDARFSGVSTGACFGHVGPEALAGGPIGKLRDEDIIEIIVDTNK
FT                   LEGSINFIGTEDNKLSYEEAAKVLESRKPHPDLKPDADLPDDTRLWAALQSVSGGTWRG
FT                   SVYDVDKIIEVLEAGKKALTKK"
FT   gene            61887..63236
FT                   /locus_tag="CLJU_c00620"
FT   CDS_pept        61887..63236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00620"
FT                   /product="putative gluconate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13169"
FT                   /db_xref="GOA:D8GK51"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK51"
FT                   /protein_id="ADK13169.1"
FT                   /translation="MPLLMVGLGVLFLIILISKFKLNTFLSLLIVSFAVALGLGIPLGK
FT                   IVSSIENGMGGTLGHIALIFGLGAMLGRLVADSGGAHRIAMTLINKFGVKRIQWAVVVA
FT                   SFVVGIAMFFEVGLVLLIPIVFSIARELKIPPIYLGIPMLAALLVTHSFLPPHPGPTVI
FT                   AGAYGADIGTVLLYGIIVAIPCVIMAGPVFTKVAKKIIPSAFEKTGNIESLGEQKTFKI
FT                   EETPGFGISLLTAMFPVILMMISTIISMVQKTAGIKGNSFFTVVNFIGNPDTAMLISLI
FT                   VAVYTMGIGRKIPIKQVGASCSAAAASIGMMILIIGGGGAFKQVLIDGGVGKYIATLFS
FT                   GSSISPILLAWVVAAILRISLGSATVAALSTSGLVIPMLASCGHVNLALVTLATGCGSA
FT                   IASHVNDAGFWMVKEYFGFSMKETFSTWTLLSTILSVTGLICILILNMFV"
FT   gene            63436..64038
FT                   /locus_tag="CLJU_c00630"
FT   CDS_pept        63436..64038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13170"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK52"
FT                   /protein_id="ADK13170.1"
FT                   /translation="MYNNYRKYPCSDCINTQMYNVYPCPLYDPNYLRQFNDPYIPFDDE
FT                   IEDDSRLEASQLSRSNGSIQLKDYGPQPFVVNINKAAKQNNTFRTVLWTGKHLQVTLMS
FT                   INVGDDIGLEIHPNVDQFIRIEEGQGLVKMGKSKYNLNFQKKVYDDFAIMIPAGTWHNV
FT                   INTGDKALKVYSIYAPPQHPRNTVHITKADAQAAEKD"
FT   gene            64258..65142
FT                   /locus_tag="CLJU_c00640"
FT   CDS_pept        64258..65142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00640"
FT                   /product="predicted transcription regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13171"
FT                   /db_xref="GOA:D8GK53"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK53"
FT                   /protein_id="ADK13171.1"
FT                   /translation="METIKLLNNTLEYIENNLDMELNIEDISKVACSSRYHFQRMFYAL
FT                   TGVTVSQYIRNRRLTLAAEELASTDKKVIDVALKYGYESPEAFTKAFQRLHGISPSALK
FT                   RFNGKIKAFPKISFQISIKGECEMIYRIVEKEAFKVFGIGFMTTKVNDAAYREIPKFIS
FT                   KIFEDGTHDRINEILGNPKGTLLDGFHYDFKEDGTRKYMMGYEIPKTDMSEEFTILEIP
FT                   KLTWAVFEGHGTTPDNLIIQDIWRRIYSEWFPSSGFEQVEGPCIEKNLWNDKNQREYKC
FT                   EVWIPVKRKCINS"
FT   gene            complement(65215..66039)
FT                   /locus_tag="CLJU_c00650"
FT   CDS_pept        complement(65215..66039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00650"
FT                   /product="predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13172"
FT                   /db_xref="GOA:D8GK54"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK54"
FT                   /protein_id="ADK13172.1"
FT                   /translation="MLKYKWCICDMDGTLLNSKEIISKENESALKKLQQNGVEVIIASG
FT                   RIDLLMKSFIKQLNLEGNIICCNGGLIKNITTGEIVYSKTIDKNIVKEIILYCLKNDIG
FT                   FLVYTNNMVYSSKKNYKVENYESINKSAPPSLQIPIEYIDNSTVEYLEKVDVFKVLLIS
FT                   DTEDVKLLKDYFSKYKSLTAVSSLDGLLDIMASNICKGSALKILSKKFRMDLDKVIVFG
FT                   DNYNDLEMFECAGMPIAMGNAVEAIKMKAKYVTKSNNESGIAYAINNFILNK"
FT   gene            complement(66068..66904)
FT                   /locus_tag="CLJU_c00660"
FT   CDS_pept        complement(66068..66904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00660"
FT                   /product="ketose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13173"
FT                   /db_xref="GOA:D8GK55"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK55"
FT                   /protein_id="ADK13173.1"
FT                   /translation="MLVNMKPLLEDARLKKYAIGSFNVYNYETIKGVIQAIKNQKTPAV
FT                   IAFGEKYLKNMDVDSVYNLVNTLSKNIDVPFALHLDHCKSLENIYRAIRAGFTSVMYDG
FT                   SALPYEENIANTLKVVEVAHACNVSVEAELGSLASGLNSHEGKLDDEEIYTSPAKAQNF
FT                   VRITEIDALAVSIGTVHGMYKGIPNIRVDILKKIKEKVNIPFVLHGGSGTPEEKLRDCI
FT                   ANGICKINVNTEISMYTVEKIRQALNDGKNYHLSDISLMEINFVQDIVSKYIKIFS"
FT   gene            complement(66930..68363)
FT                   /locus_tag="CLJU_c00670"
FT   CDS_pept        complement(66930..68363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00670"
FT                   /product="hydroxyacid dehydrogenase/reductase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13174"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK56"
FT                   /protein_id="ADK13174.1"
FT                   /translation="MSDNKLLAKEAFNNIPEVSTEIVDKMLNKELKNLNKKIVVLDDDP
FT                   TGVQTVHDISVYTDWSLDSIESGFKEKNPMFFILTNSRGFTAAETEKAHKEISLNISKV
FT                   AKKLNKDYIIISRSDSTLRGHYPLETEILKQTVEANSDVKFDGEVLMPFFKEGGRFTIG
FT                   NVHYVQDGEYLIPAGETEFAKDRTFGYTKSHLGEYIEEKTKGTFKAKDTTYISLEDIRS
FT                   LNIEGITKQLLDVKNFNKVVVNAIDYVDVKIFATALVKAIKSGKNFMYRSAAALTKVLG
FT                   GVSDKNLLSRDELIKVDSKNGGLLIVGSHVKKTTEQLEELKKCPFIEFIEFNCHLVSDS
FT                   EKFEAEIQRIIEKTEKLIASGKTVAVYTSRKRIDLGENKKEEELKLSVKISDAVTSIVE
FT                   KLNVRPNYIVAKGGITSSDVGTKGLKVKRATVAGQIKPGIPVWTTGAESKFPGIAYVIF
FT                   PGNVGNKTTLREAVEILNK"
FT   gene            complement(68368..69261)
FT                   /locus_tag="CLJU_c00680"
FT   CDS_pept        complement(68368..69261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00680"
FT                   /product="predicted hydroxyacid dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13175"
FT                   /db_xref="GOA:D8GK57"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK57"
FT                   /protein_id="ADK13175.1"
FT                   /translation="MEKNIGFIGLGIMGRPMVLNLMKAGHKVTVYDINESAAQKLVHEG
FT                   AVGAKSPKETAENKDIIFTMLPNSKHVEEVVLGENGVIESAKKGSVIIDMSSISPVVSK
FT                   KIACEVNKKDIEMLDAPVSGGETGAIDGTLAIMVGGNEEVFDKVKDVLHDMGKTITLVG
FT                   DNGCGCTAKLANQIMVNLNIAAMSEALVFAAKAGIDIEKMYNAIRGGLAGSAVLDQKVP
FT                   RILDRNFVPGGKISINLKDITNVMETAHDIDVPLPLTGELLEIFHALKADGKENDDHGG
FT                   IVQFYEKIANVQVKRS"
FT   gene            complement(69572..69991)
FT                   /pseudo
FT                   /locus_tag="CLJU_c00690"
FT                   /note="fragment of a transcriptional regulator, RpiR
FT                   family"
FT   gene            complement(70003..70428)
FT                   /pseudo
FT                   /locus_tag="CLJU_c00700"
FT                   /note="fragment of a transcriptional regulator, RpiR
FT                   family"
FT   gene            complement(70572..71465)
FT                   /gene="psd"
FT                   /locus_tag="CLJU_c00710"
FT   CDS_pept        complement(70572..71465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /locus_tag="CLJU_c00710"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13176"
FT                   /db_xref="GOA:D8GK58"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033179"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK58"
FT                   /protein_id="ADK13176.1"
FT                   /translation="MIKYFNRKSKKYEIEKVAGGTYLNWTYSSPCGMKLLELIIKKKVF
FT                   SKLYGNFCNSKYSKKKISQFIKDFNIDINEFRENYKNFRCFNDFFSRSLKDTARPIDSN
FT                   KNILISPGDGRLIVYENIDLNKIVQIKGYTYSLFDLIDDPKIAAKFKNGTCLILRLCPT
FT                   DYHRFHFIDSGICESTHKIKGNYYSVNPIALKSIANLFCKNKREWSIFHSDNFGDVLYV
FT                   EVGATCVGSIIQTYLPKETIKKGDEKGYFKFGGSTVILFFEQNKVTIDKDLLKQSNLGY
FT                   ETKILMGETIGTKFTY"
FT   gene            71653..72231
FT                   /locus_tag="CLJU_c00720"
FT   CDS_pept        71653..72231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00720"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13177"
FT                   /db_xref="GOA:D8GK59"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK59"
FT                   /protein_id="ADK13177.1"
FT                   /translation="MSNTKRTIFESAIKVFSKNGYSGATMDAIAADAGVAKGTLYYHFK
FT                   SKEEIFKYIIEEGMNVIRKSIEEESQNETNPLNRIKIVCKVQWGLVYENRDFFKVVMSQ
FT                   LWGQEVRQLELREYIRKYIVYIQSYLDDAMEKGYIKTCNSLFLAYDLFGTICSVAIYEL
FT                   INEKNKDLNEMIDNLMYRILNGIKGEILS"
FT   gene            complement(72240..73805)
FT                   /gene="aarF"
FT                   /locus_tag="CLJU_c00730"
FT   CDS_pept        complement(72240..73805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aarF"
FT                   /locus_tag="CLJU_c00730"
FT                   /product="putative ubiquinone biosynthesis protein AarF"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13178"
FT                   /db_xref="GOA:D8GK60"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK60"
FT                   /protein_id="ADK13178.1"
FT                   /translation="MKVLAKYGFKFLRETKTSNKNKSPENLRKAFEELGPTFIKIGQIL
FT                   SSRPDILPSSYIKELSKLQDDVLPEKYEDIDIVFFNEFNKNINECFLYFERNPIASGSI
FT                   AQVHNATLKNGKKVIVKVQRPDIKQKMETDISILYKIMKLTKNKFKDALIDPEEALKEL
FT                   LSSTRKELDFNLEVDNMIRFKELNKNVKFCYVPYIIKDLCGSKVLTMEKIYGFKINNIE
FT                   RLKKEEYSLQDLGKKLALCFFKQVFTDGFFHADPHPGNLLIQDNKICFIDFGIMGSISP
FT                   RLKLLLNDAIMSIAYKDTDKLVSVIMSIGIKKELTDRNKLYEDVELFLSNYLFTSLKNI
FT                   KISVLITEIFKCAKNNNITLPRDLILLVKSLIIVEGLVAEIAPDIEILDIAIPFVKNNN
FT                   EFYFLKNFDLENILIDSGNFTKNFFKLPMKTVELIDSILNGRAKIQLKFNKIDDSLNQL
FT                   NKMVNRLSISLILCSMIISSSLILNSNTGPKIHAVPLLHVINFLFFIVIGITLIISIIK
FT                   SGKL"
FT   gene            complement(73876..74178)
FT                   /locus_tag="CLJU_c00740"
FT   CDS_pept        complement(73876..74178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13179"
FT                   /db_xref="InterPro:IPR008769"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK61"
FT                   /protein_id="ADK13179.1"
FT                   /translation="MINELKSLFLAGVGSAAYTYEKAVNLISEMVEKGKITVDEGKQLS
FT                   EELKKNALAKKDQIKPLTKNEVISILSNMNFASKEDIASINDRLTKLENKINNND"
FT   gene            74301..74377
FT                   /gene="trnR2"
FT                   /locus_tag="CLJU_c00750"
FT                   /note="tRNA-Arg-CCT"
FT   tRNA            74301..74377
FT                   /gene="trnR2"
FT                   /locus_tag="CLJU_c00750"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: AGG"
FT   gene            74528..74965
FT                   /gene="tadA"
FT                   /locus_tag="CLJU_c00760"
FT   CDS_pept        74528..74965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="CLJU_c00760"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13180"
FT                   /db_xref="GOA:D8GK62"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK62"
FT                   /protein_id="ADK13180.1"
FT                   /translation="MKDFMLEAIRQAKKGLKLGEVPVGAVIVKDNEIISSCHNLKETVG
FT                   IVTAHAEMLAIQNASEILSNWRLTGCSMYVTLEPCPMCAGAILQCRINKLYIGTFDPTM
FT                   GACGSVVNILQNRRLNRWVDIQWMYNEQCSEMLEKFFKSRR"
FT   gene            74969..75061
FT                   /gene="trnS3"
FT                   /locus_tag="CLJU_c00770"
FT                   /note="tRNA-Ser-CGA"
FT   tRNA            74969..75061
FT                   /gene="trnS3"
FT                   /locus_tag="CLJU_c00770"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCG"
FT   gene            complement(75164..75907)
FT                   /locus_tag="CLJU_c00780"
FT   CDS_pept        complement(75164..75907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00780"
FT                   /product="predicted transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13181"
FT                   /db_xref="GOA:D8GK63"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK63"
FT                   /protein_id="ADK13181.1"
FT                   /translation="MKKLLWGECQKLRRSKIVWITVFSTIMVAVMVFLGGQDLFSASQP
FT                   DIYNAGWYMDVAQPLATIFVLPAVIALFGSYMICREEQDDTIKSLRLIPVNEANLTAAK
FT                   MIVTFAFSIFLYLLLFAITFSVEAILHFSDLSIGMVLNFLKAYFLDGLGIFLAISPIIA
FT                   FVSRMKKGYWLALLFAEIYSFAGLFTSMSNTLKALYPITAVFAISGYYDTSTWQIVLSC
FT                   ISLLLCGGLATLILVDLNKTTAKMK"
FT   gene            complement(75918..76658)
FT                   /locus_tag="CLJU_c00790"
FT   CDS_pept        complement(75918..76658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00790"
FT                   /product="putative ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13182"
FT                   /db_xref="GOA:D8GK64"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK64"
FT                   /protein_id="ADK13182.1"
FT                   /translation="MLKLIQIEFLKLRRRKFVWIMMLSALIMPFLAFLLFKYAWKTGFD
FT                   EAIQFYKWSAFSYTVFIILPVVLGVLCTILMYDENQYDMLKQLWIVPVSKMGYFFSKFF
FT                   VVLIYSICFMLITAVASVLFSVLPGYVAFEWESVLYLFKKCLEIGVLTAFVMLPILAIA
FT                   AAQKGYILPVCITLVYAFSSVILMTVNMYLHPLCSMDVIIMRNKDIPGVAFTQAINIPL
FT                   AFLCICVWDIVAVLFANIALGRRR"
FT   gene            complement(76651..77574)
FT                   /locus_tag="CLJU_c00800"
FT   CDS_pept        complement(76651..77574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00800"
FT                   /product="predicted ABC transporter, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13183"
FT                   /db_xref="GOA:D8GK65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK65"
FT                   /protein_id="ADK13183.1"
FT                   /translation="MNDFVIETKQLTKIYGEQTAVSTVNLHVKKGQIYGLLGRNGAGKT
FT                   TIMKMILGLTPITSGEVDVFGQNIKGREKRIYPRIGAIIETPGFYPNLTGTENLEIFAK
FT                   LRGTAAPNAVKNALEVVGLPYKDKKLFGKYSLGMKQRLGIANAILHDPELLILDEPTNG
FT                   LDPIGIAEVRDFIKNLSVERGKTVLISSHILSEISLLADDIGIIDHGALLEESSMEELK
FT                   RKNGRYILLQVSDIPKASLILERQFHLKDYSVQDDHTLRLYATALDMGEINKALVMQNI
FT                   TVISSQLCNDTLEDYFRKITGGDGIA"
FT   gene            complement(77732..78655)
FT                   /locus_tag="CLJU_c00810"
FT   CDS_pept        complement(77732..78655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00810"
FT                   /product="predicted two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13184"
FT                   /db_xref="GOA:D8GK66"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK66"
FT                   /protein_id="ADK13184.1"
FT                   /translation="MNIIVYLLFALVFTLLIIAYLVSTLWRVRTQLTLIKDALEDIKNG
FT                   NLNRRVLATESDMTRQICYGINEIALSSQSRLIQQKQSEQAYKRIMASLSHDVKTPLAS
FT                   LVGYLEAIESKIVVGEEKDEYIHVASNKAQHLKHFVENLFEWVKLDSGEQIFHFEICDL
FT                   NELSRNIIADWIPILENSHFEYEFDIPETEYSMRIDATAYTRILNNLLQNIITHSEGDN
FT                   MALRIFENEQQAKIVITDNGKGISSDNLSLIFERMYQCDHSRAAKGNGLGLSIAKELVS
FT                   AHKGTITASSILGSGTTFTILLPKTL"
FT   gene            complement(78657..79358)
FT                   /locus_tag="CLJU_c00820"
FT   CDS_pept        complement(78657..79358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00820"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00820"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13185"
FT                   /db_xref="GOA:D8GK67"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK67"
FT                   /protein_id="ADK13185.1"
FT                   /translation="MNNVLIIDDDKELCVLMKKCVEQENLSAIIAHGGVEGLRLADENK
FT                   NSCSLVILDVMMPDIDGFQVLKKIRETSNMPVLMLTAKSDEDDKVSGLRLGADDYLTKP
FT                   FSINELMARVNSLIRRYTTLNPTFITDTDYIMLKGMVIDKANRMVSVNDIPVELTSKEF
FT                   DLLSFLASNKGRVFTKKQIYMQVWEEEYAYDDNNIMSFISKLRKKIEPDPEHLFYILTV
FT                   RGVGYRFNKEA"
FT   gene            complement(79351..79563)
FT                   /locus_tag="CLJU_c00830"
FT   CDS_pept        complement(79351..79563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00830"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13186"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK68"
FT                   /protein_id="ADK13186.1"
FT                   /translation="MNQKGRMIMDYISTPEAAKKWDTSERRVQKLCEENRILGVSKLGY
FT                   MWLIPKDAEKPIDGRTQRGKEFQHE"
FT   gene            79821..79910
FT                   /gene="trnS4"
FT                   /locus_tag="CLJU_c00840"
FT                   /note="tRNA-Ser-GGA"
FT   tRNA            79821..79910
FT                   /gene="trnS4"
FT                   /locus_tag="CLJU_c00840"
FT                   /product="tRNA-Ser"
FT                   /note="codon recognized: UCC"
FT   gene            80282..81943
FT                   /gene="dnaX"
FT                   /locus_tag="CLJU_c00850"
FT   CDS_pept        80282..81943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="CLJU_c00850"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00850"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13187"
FT                   /db_xref="GOA:D8GK69"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK69"
FT                   /protein_id="ADK13187.1"
FT                   /translation="MPYTALYREWRPKTFSDVVGQDHITVTLKNQILNHRIAHAYLFSG
FT                   TRGTGKTSTAKILAKAVNCLNLQDGEPCNECEMCKKINAGISIDVIEMDAASKRRLEDI
FT                   KDVIENVKYPPQEGKYKVYIMDEVHMLTQEAVNAFLKTLEEPPLNVIFILATTDPQKLP
FT                   VTILSRCQKFDFRRIKSSEIFNRLRCIVSEQGIFADDRSLNLIARICDGAMRDALSILD
FT                   QAISMGNGKVEYDDVVNMLGLVTNENLLRLTDSIIEKNVESSMRVIDDIVLSGKDIFNF
FT                   IKDLIIHLRNLLMVKVSNNPEDVLDMSEENINLLKDQAQKIRVEEIMRDIRILQDAQEQ
FT                   SKWTKQSRIYLELSAIKMCKIEYDTSKEVILARLNRLEEAFRQGKIKVSNEKIDAKVEK
FT                   ETVPKKIVDTYRESNTEEHKTKNNSSNDEVQTANKENIYSKITLDIVKKSWKDILESLK
FT                   SKHQMVLFAALTTGRVVKCEKGIITIEYGKEYAFHKQRLEKNENRKIVEQVFSEVLKEK
FT                   VIIRYIIEDEVEDVSVSKEKLLKDTFGEDIVEIFDE"
FT   gene            82025..82369
FT                   /locus_tag="CLJU_c00860"
FT   CDS_pept        82025..82369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00860"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13188"
FT                   /db_xref="GOA:D8GK70"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK70"
FT                   /protein_id="ADK13188.1"
FT                   /translation="MARGGIPNFGGGGNMNNLMKQAQKLQKQMETMQSELQNKEFSATA
FT                   GGGAVTVSVNGKKEIVDIKIKPEVVDPEDVEMLQDLILAACNEALKNAEKETASEMQKV
FT                   TGGLNIPGMF"
FT   gene            82418..83014
FT                   /gene="recR"
FT                   /locus_tag="CLJU_c00870"
FT   CDS_pept        82418..83014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="CLJU_c00870"
FT                   /product="predicted recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00870"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13189"
FT                   /db_xref="GOA:D8GK71"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK71"
FT                   /protein_id="ADK13189.1"
FT                   /translation="MDFYPAAIEKLIEEFAKLPGIGYKTAQRLTLYILNLPGDEVKEFA
FT                   KALVNARGTIRYCSVCGNFTDSDPCAICSNPNRDKSVICVVEQPKDIMAMERIKEYNGV
FT                   YHVLHGNISPMAGRGPNDIKLKELITRINGNVKEVIVATNPNVEGEATAMYISKILKHL
FT                   GVKVTRIAHGIPVGGNLEYADEITLSKALEGRVEI"
FT   gene            83119..83406
FT                   /locus_tag="CLJU_c00880"
FT   CDS_pept        83119..83406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00880"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13190"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK72"
FT                   /protein_id="ADK13190.1"
FT                   /translation="MNKYNIIKYLLAKNSKYTKNQKRLLNDINEAREELERCAIYFDTV
FT                   KDPHLVDYAIYMEEAAKSKYMYLLNEVKKNGIDLNYNSMFPNLKENKKSS"
FT   gene            83534..83806
FT                   /locus_tag="CLJU_c00890"
FT   CDS_pept        83534..83806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00890"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13191"
FT                   /db_xref="GOA:D8GK73"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK73"
FT                   /protein_id="ADK13191.1"
FT                   /translation="MLTSDMFQYIGYFLIAILGLYVLVKVFSWPLKILFKLIINAVLGV
FT                   VLLVIVNLIGKYFSFSIGINAITALIAGFFGIPGVIFLIIFKLFL"
FT   gene            83894..84586
FT                   /gene="sfsA"
FT                   /locus_tag="CLJU_c00900"
FT   CDS_pept        83894..84586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="CLJU_c00900"
FT                   /product="putative sugar fermentation stimulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00900"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13192"
FT                   /db_xref="GOA:D8GK74"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK74"
FT                   /protein_id="ADK13192.1"
FT                   /translation="MIFNKQIVKARFISRPNRFQAYVNIDGVQLMIHVPNTGRCREILI
FT                   PGATVILREENNPNRKTKYDLIAAYKGTRLINIDSQIPNRIVDEALKMNKISYFRDCKN
FT                   VEREKTFGNSRFDFKLLDKDNKEYYLEVKGVTFEENGVARFPDAPTERGRKHLLELVQV
FT                   KKSNIGAAVLFLIQMEGIKCFKPYDEIDKKFGEYLRYADKEGVKILAYDCFLGENFIIL
FT                   KDEIKVCL"
FT   gene            84720..85271
FT                   /locus_tag="CLJU_c00910"
FT   CDS_pept        84720..85271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00910"
FT                   /product="NADH pyrophosphatase"
FT                   /EC_number="3.6.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00910"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13193"
FT                   /db_xref="GOA:D8GK75"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK75"
FT                   /protein_id="ADK13193.1"
FT                   /translation="MKFKYCPMCGKELEEKYSWDEGGVPYCPKDDIMYFDTPRPCVIVA
FT                   VIKENKILLLKQSYIFKDSKVLLSGYVTNGETVEETVHREVFEEAGLKVKDLKYLGSEY
FT                   VKNNSKEIIMLTFMAKYDGGNIKKSAEVEWVNWGYIEDALCEMKEDEIGKRIVRKVLKE
FT                   LGYTEEKAYRCDNNNCQTDS"
FT   gene            85290..85973
FT                   /locus_tag="CLJU_c00920"
FT   CDS_pept        85290..85973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00920"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13194"
FT                   /db_xref="GOA:D8GK76"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK76"
FT                   /protein_id="ADK13194.1"
FT                   /translation="MAKYIPQVDGIERKHMIRVPEVIREASGIRIFGKRLKSFLFTTDV
FT                   AIIKNTDADAVIAVYPFTPQPLITHAIILSADIPVFCGVGSGISTAKRILNLALDAEFK
FT                   GAMGVVVNSPTSNEVIKQMRDSIDIPIIVTIVSEYEDVQKRIEAGATIINVSGAEETAK
FT                   IVKKVRSQYPNFPIIATGGPTEENMRETIRAGANAVAFTPPTSAEILRQIMIEHRKKCK
FT                   NRRPE"
FT   gene            86097..86831
FT                   /locus_tag="CLJU_c00930"
FT   CDS_pept        86097..86831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00930"
FT                   /product="conserved hypothetical protein containing a
FT                   ferredoxin domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00930"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13195"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK77"
FT                   /protein_id="ADK13195.1"
FT                   /translation="MADRFKEKFQLYNVDIDLAYIQSLEERKTKKYDFIIIGFPVHWKL
FT                   PPKIVTNFLNRLNNTKENVRVIVYSTQGASSSSASCFVAGCLKKKGYVPSIQISIKMPN
FT                   NFYFFIGKKYNESEIENLLISVDKKITNIVENFIKGRIVKESNSLIRLQFSKVLHSVFK
FT                   GRVPKLSRNISSTKDCIKCGLCLRNCPQGNITFENGHAVFHSKCILCLRCIHICPINAV
FT                   RYRGKKIDQTQKNIIQVLDLNK"
FT   gene            86951..87136
FT                   /locus_tag="CLJU_c00940"
FT   CDS_pept        86951..87136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00940"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13196"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK78"
FT                   /protein_id="ADK13196.1"
FT                   /translation="MISAQDKRIVAENCKEYESKNSILGLQVSYISGSCSNCVNFVNNK
FT                   CSKDLLYKIEQVISMN"
FT   gene            87163..87351
FT                   /locus_tag="CLJU_c00950"
FT   CDS_pept        87163..87351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00950"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13197"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK79"
FT                   /protein_id="ADK13197.1"
FT                   /translation="MGSIGQMVGVANSCPGYERKDISFNSGIGNSDTKSCTNCRNLQNG
FT                   ICIKDLYDKVLTSLDQT"
FT   gene            88034..89104
FT                   /locus_tag="CLJU_c00960"
FT   CDS_pept        88034..89104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00960"
FT                   /product="predicted aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00960"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13198"
FT                   /db_xref="GOA:D8GK80"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK80"
FT                   /protein_id="ADK13198.1"
FT                   /translation="MHKKLFIPGPVEVREDVLEKMATPMIGHRSKEASKLQRDISDKMR
FT                   KVFHTKEEILLSTSSGTGLLEGAIRCSTAKRAAVFSIGAFGKRWHQIAECNNVPADLYE
FT                   VEWGKAADVNEIDKVLATGKYDSLCITHNETSTGVMNPIEEIAEVVKKYPDIVWCVDTV
FT                   SSMGGTKIEVDKLGIDICLTSSQKALGLPPGMAICSFSKKAVERAKNVKFRGYYLDLLS
FT                   IYNYIQKKDYQYPSTPSLSHMFAMDYQLDRILEEGLENRYNRHLEMAKYVREWAKKYFE
FT                   LFADERYLSNTLTNIKNTRDIDVAELNKKLGERGFQISNGYGKLKGKAFRIAHMADCTL
FT                   DDIKELLENINEILGL"
FT   gene            89125..90051
FT                   /locus_tag="CLJU_c00970"
FT   CDS_pept        89125..90051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00970"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00970"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13199"
FT                   /db_xref="GOA:D8GK81"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK81"
FT                   /protein_id="ADK13199.1"
FT                   /translation="MIKVLVSDGMEKEALNKLIEDGYEVVDKHFEEDELKEKIKEFDVI
FT                   VVRSATKIRKPLIDEAKKGNLRLIIRGGVGVDNIDVKYATQNGITVRNTPNASTVSVAE
FT                   LTMGHIFAVSRYINIANVTMRDGKWEKKKYKGVELYGKTLGLIGFGRIAKEVAKRAAAM
FT                   GMRIIYTDILGMAKGYNNYEFCELNDLLKKADYISVHIPFNKEQGAVIGEKEFNIMKDG
FT                   VFVINCARGGVIDEKVLAKALNTGKVAGAALDVFENEPKPCEELLNNDRVSVTPHIGGS
FT                   TVEAQKRIGMEIVDIVEKCLDKNLVNA"
FT   gene            90063..91313
FT                   /locus_tag="CLJU_c00980"
FT   CDS_pept        90063..91313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00980"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00980"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13200"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK82"
FT                   /protein_id="ADK13200.1"
FT                   /translation="MATLKAFKAIRPREDVACKIAALPYDVMNSEEAREMAKDNAYSFL
FT                   HIDKAEIDLDTNIDPYDKKVYEKANENLQNMINNNLLIKDNKKNLYIYRLIRNGKAQTG
FT                   IVGCTSIDDYIDNKIKKHEFTRKDKEQDRINHVDTCDANTGPIFLTYRYNEKINDIVDK
FT                   WTNEKKPVYDFVAEDGVTNTVWVIDDDKVIDTICQLFNNIDSLYIADGHHRTASAVKVG
FT                   IKRRKENPDYKGDEEFNFFLSVLFPDSELSIMDYNRVVKDLNGLTRDEYMNKISEKFNV
FT                   KEYEGKDPYRPSKKHTYGMYLGGKWYEIEAKEGTYDPCDVVEKLDASVLQNNLLNPILG
FT                   IDDPRTNPRIDFVGGIRGLNELEKRVDKEREGVAFSMYPTTLDDLMGIADAGKVMPPKS
FT                   TWFEPKLRSGLFIHELK"
FT   gene            91632..92576
FT                   /locus_tag="CLJU_c00990"
FT   CDS_pept        91632..92576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c00990"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.128"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c00990"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13201"
FT                   /db_xref="GOA:D8GK83"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK83"
FT                   /protein_id="ADK13201.1"
FT                   /translation="MLKEQLVTISLVSGSNSEYIIRDNCGITLGRVFIIEISSKNKCCI
FT                   IRIKFYKWGESSYRLLKNSLSIFIEILFKNANLNKINILADEDINIAAFTDLGFELEGI
FT                   IANSIKSDSGYKNEILFGLELDKFKNISINRGLHIKGSKINLSVLTPENAESVLNYYIK
FT                   NKDYLSKFEPDREKNFYTLDIQKRILIESYREFLSGKSVNLGIYKDKTFIGKIQISNIV
FT                   MGVFKSAFVGYSIDKDEQGKGYMKEALKLTLEYAFNEMDLHRIEASTLVDNIRSQKVLL
FT                   SCGFKEIGLNEKYIFINGKWQDHLTFNKINPRE"
FT   gene            93015..94475
FT                   /gene="rrsB"
FT                   /locus_tag="CLJU_c01000"
FT   rRNA            93015..94475
FT                   /gene="rrsB"
FT                   /locus_tag="CLJU_c01000"
FT                   /product="16S ribosomal RNA"
FT   gene            94989..97699
FT                   /gene="rrlB"
FT                   /locus_tag="CLJU_c01010"
FT   rRNA            94989..97699
FT                   /gene="rrlB"
FT                   /locus_tag="CLJU_c01010"
FT                   /product="23S ribosomal RNA"
FT   gene            97907..98019
FT                   /gene="rrfB"
FT                   /locus_tag="CLJU_c01020"
FT   rRNA            97907..98019
FT                   /gene="rrfB"
FT                   /locus_tag="CLJU_c01020"
FT                   /product="5S ribosomal RNA"
FT   gene            98029..98104
FT                   /gene="trnK1"
FT                   /locus_tag="CLJU_c01030"
FT                   /note="tRNA-Lys-TTT"
FT   tRNA            98029..98104
FT                   /gene="trnK1"
FT                   /locus_tag="CLJU_c01030"
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   gene            complement(98167..98661)
FT                   /locus_tag="CLJU_c01040"
FT   CDS_pept        complement(98167..98661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01040"
FT                   /product="predicted HD superfamily hydrolase,
FT                   metal-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13202"
FT                   /db_xref="GOA:D8GK84"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK84"
FT                   /protein_id="ADK13202.1"
FT                   /translation="MSDLASYVTKKMILYFGNDIKRINHALKVHGFSKTIGRLEGLNDN
FT                   EMLILELASILHDIGIKESERKYNSSAGNYQEIEGPPVAKELLKEIDLDDTAIERICFL
FT                   IGNHHSYNKIDKIDLQILIESDFLVNAYEDNIKISDIEYMKNKYFKTSTGKELLNSIYI
FT                   K"
FT   gene            98780..99472
FT                   /locus_tag="CLJU_c01050"
FT   CDS_pept        98780..99472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01050"
FT                   /product="predicted response regulator"
FT                   /note="CheY-like and HTH domains"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13203"
FT                   /db_xref="GOA:D8GK85"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK85"
FT                   /protein_id="ADK13203.1"
FT                   /translation="MKSILLVEDDKSLNRGISFKLSKEGYKVFSSRTIEEAKIILAENS
FT                   VDLMILDVGLPDGNGFDLCGEVRKKNDLLIIFLTACDQEIDIVTGLDMGADDYIAKPFS
FT                   LMVLMSKINALLRRNSNKNQSKKIVSGDIVFSITDMKVLKNEEELFLSKTEIKLLKYLM
FT                   DNAGQIITKDQLLNKLWDIDNTFVDDNTIAVNIRRLREKIEDNPSKPKYIKNVRGMGYI
FT                   WIEGCVKI"
FT   gene            99445..100728
FT                   /locus_tag="CLJU_c01060"
FT   CDS_pept        99445..100728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01060"
FT                   /product="predicted sensory transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13204"
FT                   /db_xref="GOA:D8GK86"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK86"
FT                   /protein_id="ADK13204.1"
FT                   /translation="MDRRMCKDMIEYLKENPLLKKVFNIMIITILSISVITCFVNYYIT
FT                   EQVYKQNINSTLQLVGTLTRLNPENETEIVKTVLFKKYDAKNLEYGKSIAKKYGYGDEV
FT                   TAWNDDAFNKNVYNMIKINFILFIVILIESMLIFRSCSLYVMKRLEYILNSVDEAVNGK
FT                   LLTDMNSFNEGILSKIYSKMCDLSRILNLNIEKLYREKENIKYLVTDISHQIKTPISSI
FT                   KLFNSILIEDESISKNEKREFLNTIKEEVLKLEWLTGSLIKLSRLEAGMIELKKEKRSI
FT                   KYTIHKAIEGVYSKVLQKNIEINVENVYEFSIFHDVRWTKEAIVNVLENAIKYTDSNGK
FT                   INVSMTDMNFFIRIDIEDTGIGIPGEDFNKIFKRFFRGNCKIVQESEGSGIGLYLTRKI
FT                   LEEQGGSIMVDSKLGEGSKFSLFLQKCK"
FT   gene            100803..101477
FT                   /locus_tag="CLJU_c01070"
FT   CDS_pept        100803..101477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01070"
FT                   /product="predicted ABC transporter, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13205"
FT                   /db_xref="GOA:D8GK87"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK87"
FT                   /protein_id="ADK13205.1"
FT                   /translation="MKVLEVKSLKKYYGKDENLVKAVDNVSFFVDEGEFVVIIGTSGSG
FT                   KSTLLHMVGGLDKPTSGEVYIVGQNIFSMKDDKLAIFRRRNIGFVFQAYNLIPVLNVWE
FT                   NITLPIGLDGKEVDESYVKELMETLNIYNKKNSLPNALSGGQQQRTAICRALAAKPSII
FT                   LADEPTGNLDSKTAQEVMALLKMSVKKYHQTLIMITHDDKIAQMGDRVIRIEDGKIVQG
FT                   RE"
FT   gene            101480..103861
FT                   /locus_tag="CLJU_c01080"
FT   CDS_pept        101480..103861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01080"
FT                   /product="predicted ABC-type transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13206"
FT                   /db_xref="GOA:D8GK88"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK88"
FT                   /protein_id="ADK13206.1"
FT                   /translation="MNYISNLAKKNLKFSKTKNILIILTIALATCLITASGIMFYSIQS
FT                   SIINSAEEQMGNYHGVYINVNNKQIEMLENNRKIEKVGKCIPFKTIKNKDLSDSQMELF
FT                   YTDYAGADMTNVKLKQGNLPQKSNEIALESWVLDKLKVKSKIGENIHIKDENNKSMDFI
FT                   LSGILSDDKIRKQQNNVIGVVSKKLVTQNLYKIKTACYVRVKNHRNIMSTVFDIGHSIG
FT                   LKDENIKTNSLYISAVGGDPSLLISFLVIALIIVIATMVVIYNIFYVSVIERIKQFGLL
FT                   SAIGATKKQIRKVIFKEGFTLSIIAIPIGIIFAHVIYYIVRQLLISKYSIEIKSSPYII
FT                   IISALISLLAVVISLRKPEKLSSRISPVESMRYSGVEINSKKKERNSIKKISISKIAHL
FT                   NLWRNKKRTIMTMISLTMSGILFIVICTVLKSMNIYNLTKQDFKHEFSLTSTETEGNPL
FT                   NDEIINNIKNIKGVKNVSTEKYTGNISVNNLSYGLYGYDDYLLGKFKKYLIAGKISSEE
FT                   LKSKDEVLVATNYDKNDNRICKYKVGDKINLSIAVDKNGKQTESIKKQFTVAGIVSKNI
FT                   GSFGWKIDGYDLITHEDVFTRGEFKDKLVSANDNKMAGVYIDIDSSKFESIKSKIKSIS
FT                   QKDNRIFYDSNTDYKKELESQYMGMQIIAMSFIGIIALIGILNLINTMITSILTRKKEY
FT                   GMLQAVGLSDRELRKMLQIEGIYYSLGSSLMSIIFGTSLGYLCFKLFKRSGADYAEYKL
FT                   PLGSILVLILAFAIITILITYLIENKLKKESIVDRIRYSE"
FT   gene            104150..105181
FT                   /locus_tag="CLJU_c01090"
FT   CDS_pept        104150..105181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01090"
FT                   /product="predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13207"
FT                   /db_xref="GOA:D8GK89"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK89"
FT                   /protein_id="ADK13207.1"
FT                   /translation="MEDLDLFKEICETHAPSGREDWLYSIIEDNFNQFGDITISKLNNM
FT                   YIHKEGKTSRKLMIMSHADEIFLMVKEITKEGFIKFKGLGIDAKSLVAQEVIIHGKENV
FT                   SGVVALKYDYSDKQKSKVSMENLYIETGFCTEKLRSLIKVGDYITLDRKMVGLLNDNVS
FT                   CKSIDNRASIFAMYVCAEELKNVNPDLNVYFVCSCQEEVGHRGAKMASYEVKPDIGIAL
FT                   DVTFDGGTLGDSDRENKLGAGPVICIGPNIHTKIKNRIIQTADKYSIPYQIEVEPGNTG
FT                   TDAWDIQTAEGGIPTLLISIPIKYMHTSVEVVNLKDIKNTGRLLARFIQELKEDELEGL
FT                   FCF"
FT   gene            105172..106179
FT                   /locus_tag="CLJU_c01100"
FT   CDS_pept        105172..106179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01100"
FT                   /product="predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13208"
FT                   /db_xref="GOA:D8GK90"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK90"
FT                   /protein_id="ADK13208.1"
FT                   /translation="MLLEKLSNCIGPSGYEEEIRNVIKEELYTFTDNVTVDRMGNVIVH
FT                   SDNNDNSSPKIMIASHMDERGLIITAYNDDGTLKFSTLGKMEKGALPCKTVLIGNKKVH
FT                   GVIGIKPIHLQNKSERDRNISYDDMCIDIGASSKDECRKTVSLGDFVVFDNSFSNFGDN
FT                   LVKGKALDNRIGCSILLELLKEKYECNLYGVFYVQGNIDKRGIYTAAYNVKPDIMIDLD
FT                   TINSTDGEGVPEYLKTNELTGGPVIPFNMEESIFNRDIVKSIRNKADNMGIAYKKSIST
FT                   KDTSKLKPVRLPINNCKTAAVLIPCKHMDYNISMCSLMDYESTLTLVKSYLSDL"
FT   gene            106214..107173
FT                   /locus_tag="CLJU_c01110"
FT   CDS_pept        106214..107173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01110"
FT                   /product="predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13209"
FT                   /db_xref="GOA:D8GK91"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK91"
FT                   /protein_id="ADK13209.1"
FT                   /translation="MDKLLIKLINSFGVSGKEDEVREVIKERLNEINQDMYEDDIGNVI
FT                   VKLGSGETKIMLCTHMDSVGFIVNHIDDDGMIRVDNIGNFKKEDISHSFIRFDNGTLGK
FT                   IYTSHEGEFVDIGVNEREDALKKVNEGDMASLVGPYLSVGDNNVISPLLHNKVGCYILL
FT                   KLIEYVKVENAELDFVFASQGEIGGIGARIAANNINPDYCIIVGTENATNAEERKNNIN
FT                   IDEGPVIKIMDSSLIMHKDIKEMLENCAKRSEINLQYSISTGKSEGELVHKERIGIRTG
FT                   EIAVPCRYKYSTSEMVSINDIEDTIKLLKQLENFKEII"
FT   gene            complement(107289..107885)
FT                   /locus_tag="CLJU_c01120"
FT   CDS_pept        complement(107289..107885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01120"
FT                   /product="predicted Uracil DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13210"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK92"
FT                   /protein_id="ADK13210.1"
FT                   /translation="MNAKEELIEKIKKICDGYDETPTGGYIFGDGPIPCNILFIGEAPG
FT                   KTEVEQGKPFVGMAGKTFGSYLNSIGLQRDNIRITNTCFLRPIKINQGKNGRKTISNRP
FT                   PKTSEIELFKDILNREIELVNPKIIVTLGNTPLKRFTKFNSIGECHGKIYFNEDLKKDI
FT                   FPMYHPSALTYNRNDSFKLMYENDWKKLKNTLNSI"
FT   gene            108079..109224
FT                   /locus_tag="CLJU_c01130"
FT   CDS_pept        108079..109224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01130"
FT                   /product="predicted aminotransferase class V"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13211"
FT                   /db_xref="GOA:D8GK93"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="InterPro:IPR024169"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK93"
FT                   /protein_id="ADK13211.1"
FT                   /translation="MEAPYIMTPGPTEVRDNVRFARSERCTNPDLDIQFYDFYKDTCED
FT                   IAKFLNTKNQVRILSGEGILGLEAACASLTEEGDRVLVIDNGIYGEGFADFVKLYDGEV
FT                   VFFKGNRKREIDVDELKKFLDKDSKFKYATVVHCDTPSGMLNNISKICPMLKEKGILTV
FT                   VDSVSAMGGEKLEVDNWNIDIVVGGSQKCISAPPGLTILSISQDAFEVMRNRKKPIRSF
FT                   YCNLLAWENYYEKKWFPYTPPISDIVGLKVAVDNILKDKDILKRHREIGKSVRIAVKEA
FT                   GLSLYNENGYSNTVTAIEVPEGIDESKLRKYMVDNFNVLIAGSFGYLQGRVVRIGHMGE
FT                   NAKKDMVSYTLYALQKSLENFQFYCQCDMANCFLKNAKSLE"
FT   gene            109920..111380
FT                   /gene="rrsC"
FT                   /locus_tag="CLJU_c01140"
FT   rRNA            109920..111380
FT                   /gene="rrsC"
FT                   /locus_tag="CLJU_c01140"
FT                   /product="16S ribosomal RNA"
FT   gene            111994..114704
FT                   /gene="rrlC"
FT                   /locus_tag="CLJU_c01150"
FT   rRNA            111994..114704
FT                   /gene="rrlC"
FT                   /locus_tag="CLJU_c01150"
FT                   /product="23S ribosomal RNA"
FT   gene            114814..114926
FT                   /gene="rrfC"
FT                   /locus_tag="CLJU_c01160"
FT   rRNA            114814..114926
FT                   /gene="rrfC"
FT                   /locus_tag="CLJU_c01160"
FT                   /product="5S ribosomal RNA"
FT   gene            114940..115015
FT                   /gene="trnF1"
FT                   /locus_tag="CLJU_c01170"
FT                   /note="tRNA-Phe-GAA"
FT   tRNA            114940..115015
FT                   /gene="trnF1"
FT                   /locus_tag="CLJU_c01170"
FT                   /product="tRNA-Phe"
FT                   /note="codon recognized: UUC"
FT   gene            115121..115864
FT                   /locus_tag="CLJU_c01180"
FT   CDS_pept        115121..115864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01180"
FT                   /product="putative foldase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13212"
FT                   /db_xref="GOA:D8GK94"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK94"
FT                   /protein_id="ADK13212.1"
FT                   /translation="MQNNVLAIVNGMEIKESDLKEAINRFPQDKRNQLNTAEGKKYLLN
FT                   EMVFFELAYSYAKDENLEKDDEYLKMLESAKKEILTQIAISKVMNKVNVTDKESQDYYE
FT                   ANKDMYKKPERLKAKHILVDSIEKAKKISKEISEGMPFEEAAQKYSTCPSKAQGGSLGE
FT                   FARGQMVPEFENAAFSLDIDVVSEPVKTQFGYHLIKVEEKIEPSIASYDEVKNAIKNGL
FT                   LQERQKYEYSKFNKELRSKYKVEMK"
FT   gene            complement(115974..117008)
FT                   /locus_tag="CLJU_c01190"
FT   CDS_pept        complement(115974..117008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01190"
FT                   /product="predicted aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13213"
FT                   /db_xref="GOA:D8GK95"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR015443"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK95"
FT                   /protein_id="ADK13213.1"
FT                   /translation="MIEKSVFGSFKGNKIYKYTMTNKHGMKVSCISHGATLTEIIVPDK
FT                   LGNFSNVLLGFDNLDSYIKDRKMFLGAAIGPVAGRIANGSFKIKGISYNVPKNEGENTL
FT                   HGGTYGFNSLIWNSSTEDSEEATSVLFHRTISPDEDGFPGTLNVEVKYTLNNNNDLLIT
FT                   FSGLSNKDALFNPTVHSYFNLNNDITKLFSGHTLQINASHYAEINEALLPTGTLKEVSG
FT                   TPFDFQQPKNLEDAIKYLQTESGLNGFDHPFNVNGKNIATLINHDTCRRLDIESDRNAL
FT                   IVYTLNIKDDTWKVQNQKLVSNMGIALEPQTLPDAIHYKNFGDIILPANKRKCYNIKYH
FT                   FSLI"
FT   gene            complement(117244..118710)
FT                   /gene="araA"
FT                   /locus_tag="CLJU_c01200"
FT   CDS_pept        complement(117244..118710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="CLJU_c01200"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13214"
FT                   /db_xref="GOA:D8GK96"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK96"
FT                   /protein_id="ADK13214.1"
FT                   /translation="MLKNKEMEFWFIVGSQHLYGEEALSEVKEHSMEIADALNKSGKLP
FT                   YPIVFKSLATSASQITKLMKEVNYNDNVAGVITWMHTFSPAKMWIAGTKLLQKPLLHLA
FT                   TQFYEHIPWKTIDMDYMNLHQSAHGDREYGFINARLKKHNKIVVGHWKKENVQKQIADW
FT                   MNVAAGYILSQDIKVARFGDNMRNVAVTEGDKIEAQIQFGWTVDYFGIGDLVAEMNKVS
FT                   QKDIDDTYEEFKKIYIMDVGENDPKFYENQVKEQIKIEIGLRHFLEAGGYTAFTTNFED
FT                   LYGMKQLPGLAVQRLNAEGYGFAGEGDWKTAALSRLIKIMTNNKKTGFMEDYTYELSEG
FT                   NEEILGAHMLEVDPTFASDKPRVVVKPLGIGDREDPARLIFNGSTGKGTSMTMLDLGTH
FT                   YRLIISEVNAVEPAEDTPELPVAKMVWKPEPNFADGVKAWIYAGGGHHTVLTLGLTVEQ
FT                   VYDWARMVNLESIIIDHNTNLRDVIRETTK"
FT   gene            complement(118733..119434)
FT                   /gene="araD"
FT                   /locus_tag="CLJU_c01210"
FT   CDS_pept        complement(118733..119434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araD"
FT                   /locus_tag="CLJU_c01210"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13215"
FT                   /db_xref="GOA:D8GK97"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK97"
FT                   /protein_id="ADK13215.1"
FT                   /translation="MLEDLKEKVLEANLMLPKYHMVTFTWGNVSGIDRSQSLVVIKPSG
FT                   VEYTKMKASDMVVVDLNGKVIEGDLNPSSDTATHLVLYRNFPDILGIVHTHSPWAVSFA
FT                   QAGICIPAAGTTHGDYFYGDIPVTPKMTKDEIVTDYEKQTGDVIVRTFKDNSINPNDIP
FT                   GVLVNDHGPFTWGTDPKNAVHNAVVLEEVAKITYHSLQLNPHNIRMDQVLLDKHFKRKH
FT                   GKNAYYGQNNK"
FT   gene            complement(119493..121097)
FT                   /gene="araB"
FT                   /locus_tag="CLJU_c01220"
FT   CDS_pept        complement(119493..121097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="CLJU_c01220"
FT                   /product="ribulokinase"
FT                   /EC_number="2.7.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13216"
FT                   /db_xref="GOA:D8GK98"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="InterPro:IPR042029"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK98"
FT                   /protein_id="ADK13216.1"
FT                   /translation="MTINKDRVKEIQNGKTSLGIEFGSTRIKAVLIGNDFSPLASGSFE
FT                   WETSLRDGIWTYSLEEIWKGLQYSYQKLFAEIKEKYGVTLSKIGSIGFSAMMHGYMAFD
FT                   KQGNLLVPFRTWRNTMTEEAAKKLTESFHFNIPERWSIAHLYQAILHKEPHIEKLDFIT
FT                   TLAGYIHWELTGKKVLGICDASGMFPIDMKTHNYDKHMLETFNHLPEVEKYSLNVEKLL
FT                   PKVLLAGENAGVLTPEGANKLDVSGNLQSGIPLCPPEGDAGTGMVATNSVAPRTGNISA
FT                   GTSIFAMVVLENPLKNVHPEIDMVTTPTGDLVGMVHANNGYSDIDAWINIFHEFAEAIN
FT                   VNIPRDLLYMGLYTQAFLGDPDCGGILAYNYFAGENITGVPEGRPLIVRKPKSNFNLPN
FT                   FMKAHLFTSLGALKIGMDILLKDEGVKLDKLLGHGGLFKTPIVGQEAVAAAVNTPVSVM
FT                   ETAGEGGAWGIALLASYLNNKESNSTLAEFLSKKVFAGYVADEVKPEAKDVKGFEQFMK
FT                   RYKNGIPIEQAAVDYLI"
FT   gene            121475..122560
FT                   /locus_tag="CLJU_c01230"
FT   CDS_pept        121475..122560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01230"
FT                   /product="predicted transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13217"
FT                   /db_xref="GOA:D8GK99"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR033532"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GK99"
FT                   /protein_id="ADK13217.1"
FT                   /translation="MKHKYEKVKEEIISWAVNEKYKPHEKIPTESELMELFKVSRHTIR
FT                   RAISDLAAEKYLYRLQGSGIYVSDFKQNEIYLTNNKNVGVLTTYISNYIFPDIIRGIED
FT                   TLYDESYSLLLSSTKNNIMLESSNLKNLLAHKIDGLIVEPTKSAYQSPNMGYFNNLIEQ
FT                   DIPFIMINASYSQVKVPSLCVDDLKGGNIAAKYLITLGHKNIAGIFKVDDLQGVHRMNG
FT                   FITGCQESNVLLRQDKILTYLSEETNTLLPEKIKNVLKQEKRPTGIFCYNDEIAYMVLN
FT                   IAYDLKLKVPEDLSIIGFDDSPMATIMEPKLTSITHPKEKMGIDAAKLIIRLINNNNHF
FT                   SECDSILYEPEIVIRSSTASI"
FT   gene            122942..124474
FT                   /locus_tag="CLJU_c01240"
FT   CDS_pept        122942..124474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01240"
FT                   /product="alpha-L-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13218"
FT                   /db_xref="GOA:D8GKA0"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKA0"
FT                   /protein_id="ADK13218.1"
FT                   /translation="MKKVSYYYDNHFKIGDVNENLYSSFIEHLGRAVYSGIYEPGHEKA
FT                   DEDGFRTDAMEVIKDLKLGLVRYPGGNFVSNYDWKDGIGPKENRPKRMEFAWSSVETNQ
FT                   FGIDDFCRWAKKAGIEPMIAVNLGTGSVKSAAELVEYCNHPGGTYWSDLRIKNGSKEPY
FT                   NIKYWCLGNEMEGTWQAGHLSAEDYAKKACEAAKLMKWVDKDIKLVACGSSYEMLPTYM
FT                   DWDRIVLKELYPYVDYISTHNYNMNTNQGTSNFLASYKQLDDHIKNTERVLDYVKAKNK
FT                   EEKDIKICLDEWNVWNFQDIKLDSLDDLQGLTTFEVTSAEKWEEAPAILEEKYSLLDAL
FT                   TVGGLAITLINNADRVKIACLAQLINVIAPITTQRNGGVLKQSTYYPFSMVSNYGRGTV
FT                   LKPSVNGASYKCDFGELPLVEAATVYDKESDEIRVFALNCNQDEDTELDLQFNGFGDRK
FT                   ISKQFVLSGDDLELRNTFESPDNVTVKEKDLSNCDGTKVVLPKLSWNVLIIK"
FT   gene            124508..125887
FT                   /locus_tag="CLJU_c01250"
FT   CDS_pept        124508..125887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01250"
FT                   /product="putative cation symporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13219"
FT                   /db_xref="GOA:D8GKA1"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR018043"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKA1"
FT                   /protein_id="ADK13219.1"
FT                   /translation="MDMKVQDKDVFKENLKFSEKFGYGCGDLAINFTWASLGMFVVYFY
FT                   TDVVGMSAAIIGTIMLFSRCLDGVLDVIMGTIVDKTNSKYGKARPWILWGSIPFVVLTV
FT                   SIFMVPNISTFGKIVYIVISYNLLMIAFTAIAIPYGTLNSLVTQDQHQREVLNLFRMFL
FT                   AQIGVLIVTNLTMPLVNLFGGKQPGWALTYSVLGVVSLLLFVYVFKTQKERVKPIKKEK
FT                   IPLKISLKALCQNKYWFIATIFFIVYSIGYAINQGSTVYYAKYLLGNSSLVGGLTIAYL
FT                   APVLVGFLMISKVYDKYGKRNAMIIGSIISIGGYLITIINPYSLTVVMVSQIVKGFGQA
FT                   FLLGGVWALFPDTIEYGEWKTGIRNEGLLYSGGSLGQKMGIGFGTAITGWILAWGGYNG
FT                   AQAVQASSAVFSIKALFIHVPIIIYVAQIILLLCYGLDKEYPRIMKDLQLRKSKMSAEN
FT                   N"
FT   gene            126345..127331
FT                   /locus_tag="CLJU_c01260"
FT   CDS_pept        126345..127331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01260"
FT                   /product="predicted ABC-Type sugar transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13220"
FT                   /db_xref="GOA:D8GKA2"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKA2"
FT                   /protein_id="ADK13220.1"
FT                   /translation="MIKFKSIRKSMRSILLCGLVLVLSVGLMACGSTSTSSSGTSSKKK
FT                   TIAFIPPSLVSPFYTQAVTGAKQEAAKEGFNIKVLAPQTEDDFNGLLKIVEDVITQQVD
FT                   AIAICTTDDKTMAAVVKKANDAKIPVIVFNSLSPIKGADVYAYVGYDQKQAGAQAADYL
FT                   GTKLKDKQFNVGVLEGLPGVFTDNRKGGFVNEAKKYSNVKIVATQPADWQREKGMNVAT
FT                   NLYQANKAINMFYGLSDEMAIGAAQAFKSAGVKDGVTIGIDGNPATLDSIAQGETTATI
FT                   YTDPKQIGKESIIDCSKALKGEKMANKLDQTKTFVVDKSNVSTYKAK"
FT   gene            127423..128922
FT                   /locus_tag="CLJU_c01270"
FT   CDS_pept        127423..128922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01270"
FT                   /product="putative ABC-type sugar transporter, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13221"
FT                   /db_xref="GOA:D8GKA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKA3"
FT                   /protein_id="ADK13221.1"
FT                   /translation="MSETILKMENITKSFSGVTVLKNSGIEVKKGEVHILLGENGAGKS
FT                   TLMKILSGAYSKDSGDIILNGNKVEINSPKDAEKLGISIIYQEFNLVPYMTVAENIYLG
FT                   REPESKVPGKVNFKKMYNDAQKMIDYLNVDIPVDKPIKNLGIAQQQMVEIAKALSVHSD
FT                   IIIMDEPTAALTEKEIDNLFKIMRKIKSEGVSIIYISHRLEEFAQIGDRVTVMRDGETV
FT                   ETVNIKGTSIDELIKLMVGREIKEKFPKIKVDLGEEILRVKGLTKKGVFENINFSLRSG
FT                   EILGFSGLMGAGRTEVMRAIFGIDSFDSGEIYLKGKKVEINSPMKAIKNGIGFVTENRR
FT                   DEGLVLQMGVGQNITLASLGKYISNPIKLNLRKEVKEIKDYISKLSIKSSGYRQIAGTL
FT                   SGGNQQKIVIAKWLLSDSKVLIVDEPTRGIDVGAKIEIYNIMNDLVKSGVGIIMVSSEL
FT                   PEVLGMSDRILVMCRGKITGELNKDEATQEKIMHYATGGIE"
FT   gene            128919..129893
FT                   /locus_tag="CLJU_c01280"
FT   CDS_pept        128919..129893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01280"
FT                   /product="putative ABC-type sugar transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13222"
FT                   /db_xref="GOA:D8GKA4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKA4"
FT                   /protein_id="ADK13222.1"
FT                   /translation="MMNQLEDTEKKKKTSINDILDKLGVVIALVVLIVVMAVLSPDFLT
FT                   VKNVFNILQQIAQIGIISVGMTFVILLGGIDLSVGSIIAFTGLIMALCMKAGMSVVLAI
FT                   LVGIILGAAIGFLNGILISKVKLQPFIATLGTMTMARGLAYTITNGQPVYSFSAGFKSF
FT                   AGFIGVVPIPAIIMAVIFALGYYVLKYTKFGRYMYAIGGNRVASKLSGINVDKYEMLVY
FT                   TISGICCAIAAIILTARLDSAVPVAGDGNELDAIAAVAIGGTSMTGGEGGIVGTLIGAL
FT                   IMGVIANGMNLLDVQQGPQRFAKGAIIILAVGIDVIRKKRTSK"
FT   gene            130485..131945
FT                   /gene="rrsD"
FT                   /locus_tag="CLJU_c01290"
FT   rRNA            130485..131945
FT                   /gene="rrsD"
FT                   /locus_tag="CLJU_c01290"
FT                   /product="16S ribosomal RNA"
FT   gene            132593..135303
FT                   /gene="rrlD"
FT                   /locus_tag="CLJU_c01300"
FT   rRNA            132593..135303
FT                   /gene="rrlD"
FT                   /locus_tag="CLJU_c01300"
FT                   /product="23S ribosomal RNA"
FT   gene            135511..135623
FT                   /gene="rrfD"
FT                   /locus_tag="CLJU_c01310"
FT   rRNA            135511..135623
FT                   /gene="rrfD"
FT                   /locus_tag="CLJU_c01310"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(135894..136619)
FT                   /gene="npdA"
FT                   /locus_tag="CLJU_c01320"
FT   CDS_pept        complement(135894..136619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="npdA"
FT                   /locus_tag="CLJU_c01320"
FT                   /product="NAD-dependent deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13223"
FT                   /db_xref="GOA:D8GKA5"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKA5"
FT                   /protein_id="ADK13223.1"
FT                   /translation="MSYENLKSAVNSSTNIVFLGGAGVSTESQIPDFRSETGLYKTKNN
FT                   FSYPPEVMLSHSFFMSHTEDFFDFYRAKMIYKDAKPNDAHYALAELEKMGKLKAIVTQN
FT                   IDGLHQMAGSNNVLELHGSIHRNHCTKCGKSFDLDYVLNTPGLIPKCDKCNGTIKPDVI
FT                   LYEESLNMDTLNKSVEYIQQADMLIVGGTSLIVYPAAGLINYFKGKYLVLINKSSTSYD
FT                   NEANIVIHDSIGKVLKSIL"
FT   gene            136796..136869
FT                   /gene="trnC1"
FT                   /locus_tag="CLJU_c01330"
FT                   /note="tRNA-Cys-GCA"
FT   tRNA            136796..136869
FT                   /gene="trnC1"
FT                   /locus_tag="CLJU_c01330"
FT                   /product="tRNA-Cys"
FT                   /note="codon recognized: UGC"
FT   gene            137373..137810
FT                   /locus_tag="CLJU_c01340"
FT   CDS_pept        137373..137810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01340"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13224"
FT                   /db_xref="GOA:D8GKA6"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKA6"
FT                   /protein_id="ADK13224.1"
FT                   /translation="MKSKSAARYLIFSLIGFVILAAGAILAKLTRNDQGIIETLPYILI
FT                   GIGGGVFGQNLGTAFDIYTMKKNPEIAKQREIDEKDERNIAIRNKAKAKAYDLMILVFG
FT                   ALMMAFALMGVSWSVVLAIVIAYLFVVFSNIYFISKYDKDM"
FT   gene            complement(137935..138855)
FT                   /locus_tag="CLJU_c01350"
FT   CDS_pept        complement(137935..138855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01350"
FT                   /product="putative LD-carboxypeptidase A family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13225"
FT                   /db_xref="GOA:D8GKA7"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKA7"
FT                   /protein_id="ADK13225.1"
FT                   /translation="MILIGKRLKKGDTIGLVSPASAEKPEKIKGKIEFLKDFGFNVKEG
FT                   KHIYDKWGYLAGKDVDRASDIMDMFSDKSVDMILCTRGGYGSMRLLPLIDFNIIEENPK
FT                   IFAGFSDITTLLNNIYNKCHMITFHSPMCTSTFDDFTLKSFLDTLMCGYAPFTIKNPED
FT                   IPTRYFNGEYAAGTLIGGNLCLISSLLGTPYALNTENKILFIEDVGEEPYRIDRMLTQL
FT                   TLSGDLQKCSGFILGQFTNCELPHYERSLTLTEILEDRILSLKKPTLINFQSGHSYPRI
FT                   TLPIGSNVEVNFKEGEIHVLESVVK"
FT   gene            complement(138868..139809)
FT                   /locus_tag="CLJU_c01360"
FT   CDS_pept        complement(138868..139809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01360"
FT                   /product="putative Mg2+ transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13226"
FT                   /db_xref="GOA:D8GKA8"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKA8"
FT                   /protein_id="ADK13226.1"
FT                   /translation="MISIYKTIDESNNIQSVDTIEHGCWINVVAPSDEDLLLISKKSGV
FT                   SMDFLKAALDEEETSRIDTEDNNLLVIVDIPFTEMEVNSLTYDSYPLAIIHTESTLITV
FT                   CLKNSNILTDFINGKVKSFFTFKRSRFILQILYRIASYYLLYLRQIDKKSVMIEQRLHR
FT                   SMKNKEFIQLLSLQKSLVYFSTSLKANEMTLEKMLKLELLQKYPEDQDILEDVIIENKQ
FT                   AIEMTNIYSNILTGTMDAFASVISNNLNIVMKLLASVTIVMAIPNIIFGSFGMNLYGIP
FT                   FAKSPNGFWMVYVITASICLVCILFLKKKNLF"
FT   gene            140114..140326
FT                   /locus_tag="CLJU_c01370"
FT   CDS_pept        140114..140326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13227"
FT                   /db_xref="InterPro:IPR019700"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKA9"
FT                   /protein_id="ADK13227.1"
FT                   /translation="MKKKYCIICGKPLSDGIIIYGRGICKSCEERLIKLENDLDFYEYY
FT                   KERISKTIARFIIRGEITHCQNYHF"
FT   gene            140305..141753
FT                   /gene="speA"
FT                   /locus_tag="CLJU_c01380"
FT   CDS_pept        140305..141753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="CLJU_c01380"
FT                   /product="arginine decarboxylase"
FT                   /EC_number="4.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13228"
FT                   /db_xref="GOA:D8GKP5"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKP5"
FT                   /protein_id="ADK13228.1"
FT                   /translation="MSELPLLEGVLKYIKENNISFCMPGHKNGRGFYNTSIGREFISNI
FT                   LKFDITEVDGVDNLHNQKSIILDASKRLSKLYGSKKSYFLVNGSTSGNMIMLFSSFNEG
FT                   DKILVERNCHSSILNGIIMRKLIPIYLENIISEKINAPICVNLEHFLQALKRNKNIKGI
FT                   VVTYPNYYGICSNLKFIIKEAKKLNIKVLVDCAHGAHFGVNKNLPESAVTLGADMVVTS
FT                   SHKTLPSLTQTAYLHVNNEKYIDKVDFYYNAFLSTSPSYIALCSMDYARFYLEEYGSSD
FT                   YEKLIEIAEFYRDKINSIRGLQVIGRKDIIQFNSKERKAVPSVADIDLTRYTINLEPGY
FT                   SGNLLLNYLRKLNIQCEMSDNSNLVLILSPFNEKEEFERLYTVLKNCDLERIKCKKTNR
FT                   IKYGIPQSKMIPFQVIDVEKEMVDLNDSCGKISGASVIPYPPGVPVLSIGELIDKNVIQ
FT                   VIKYYIKNSMDLIGVKDNKIKVVK"
FT   gene            141771..142454
FT                   /gene="tmk"
FT                   /locus_tag="CLJU_c01390"
FT   CDS_pept        141771..142454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="CLJU_c01390"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13229"
FT                   /db_xref="GOA:D8GKP6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKP6"
FT                   /protein_id="ADK13229.1"
FT                   /translation="MSLQKGKLIVIEGCDGSGKATQTEKLYKRLLNENYNLKKIEYPNY
FT                   NSESSALVRMYLNGDFGKKPEDVSAYAASTFYAVDRFASYKMEWKKFYENGGIILADRY
FT                   TTANMIHQASKIDDLEEKNKFLKWLWNFEFDIFRLPVPDCVIFLDMPPEYSKKLMTKRN
FT                   NKFTGNAEKDIHERDYEYLVNSYKNAIHIVDKYNWNKISCIEGSEIKTVDKIHEDIYDL
FT                   IKKIL"
FT   gene            142585..142914
FT                   /locus_tag="CLJU_c01400"
FT   CDS_pept        142585..142914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13230"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKP7"
FT                   /protein_id="ADK13230.1"
FT                   /translation="MKLIIAIVQDDDATDLLEILTEGGFRVTKLATTGGFLRAGNTTLL
FT                   IGVEEEDVDKVIAHIEDVCKTRNQIITTPSSVASSTGVYMPYPVEVEVGGANIFVVDVD
FT                   KFVKI"
FT   gene            142931..143875
FT                   /locus_tag="CLJU_c01410"
FT   CDS_pept        142931..143875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01410"
FT                   /product="DNA polymerase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13231"
FT                   /db_xref="GOA:D8GKP8"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKP8"
FT                   /protein_id="ADK13231.1"
FT                   /translation="MEFCNIIGHENIKLQIKNSVTSNRFSHAHIFVGEDGIGKSLLAKE
FT                   IALDILGKKQMKQYVDIIEFKIAKGKKSVGIEEVKNIIEEINKKPYEGDKKVIILYNSD
FT                   KMTEAAQNALLKTIEEPPSGSFMLLLCEKLDGILDTIKSRCQVYKLNRLSQKEMETFLN
FT                   AKFPNLSTEELRSVLAFSDGIPGRAQKFISDISLSEMRNIILNIFKELCHENFSSCLKL
FT                   SDYIAKDNYEWEEVLTCILSYIRDVLVYKETGNRKFIINIDKFEDIKTIGEMFSFNKLN
FT                   DIINIVKDTREKLESNVNRTLVFNSMLVKMQEV"
FT   gene            143880..144785
FT                   /locus_tag="CLJU_c01420"
FT   CDS_pept        143880..144785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01420"
FT                   /product="predicted peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13232"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKP9"
FT                   /protein_id="ADK13232.1"
FT                   /translation="MVTVIGVRFKKAGKIYYFSPGNLNIKRENSVIVETARGIEFGECV
FT                   IEPKDIRESDIVSPLKSVLRIATEEDIQKYNENKEKEKKAFDICIEKIQQHELNMKLID
FT                   VEYTFDNNKVIFYFIADGRVDFRELVKDLASIFRTRIELRQIGVRDEAKMIGGLGPCGR
FT                   AMCCSTFLGDFVPVSIKMAKEQNLSLNPTKISGICGRLMCCLNYEQDTYEKIRQKLPKV
FT                   GSVVSTPDGRGEVIDNSVVKESIKIKIKVEDGDDIVKEVPISEIKVISGGFEGNIDENE
FT                   IKIDEETEDADMIKQLFKED"
FT   gene            144796..144999
FT                   /locus_tag="CLJU_c01430"
FT   CDS_pept        144796..144999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13233"
FT                   /db_xref="GOA:D8GKQ0"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKQ0"
FT                   /protein_id="ADK13233.1"
FT                   /translation="MKSVFKIPNIRTSEDVNKIRKVISSSEGVIACQINKEKGKVSIVY
FT                   DNYFITENKIIQCIEDLGYAVL"
FT   gene            145245..145418
FT                   /locus_tag="CLJU_c01440"
FT   CDS_pept        145245..145418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01440"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13234"
FT                   /db_xref="GOA:D8GKQ1"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKQ1"
FT                   /protein_id="ADK13234.1"
FT                   /translation="MAYKITEDCVSCGSCASECPADAISQGDSQFVIDPEKCIECGNCA
FT                   NVCPVGAPVEES"
FT   gene            145565..146359
FT                   /gene="motA1"
FT                   /locus_tag="CLJU_c01450"
FT   CDS_pept        145565..146359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA1"
FT                   /locus_tag="CLJU_c01450"
FT                   /product="chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13235"
FT                   /db_xref="GOA:D8GKQ2"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKQ2"
FT                   /protein_id="ADK13235.1"
FT                   /translation="MDISVVIFTIFGIAAVTAGFVMDGGNPTALFGGAAAVIVFGGTFG
FT                   AVALSFPLDVLKRVPKIFKVIFNPRKASLVDLILYFKDVSYKTRKNGLLSLEGEISNDP
FT                   NLDPFIKKGLQLVVDGVDPQAVRDILELELESTSERHKQGASVFESAGGYGPTMGIIGT
FT                   VMGMVHILGSLTDTASLGGKIGSAFLATLYGIGSANLLWLPLGNRLKQQDEKEVKEKTL
FT                   IIEAILYIQEGINPNTIAEKLKGFLNKQELAKYEGMDGKAEL"
FT   gene            146356..147207
FT                   /gene="motB1"
FT                   /locus_tag="CLJU_c01460"
FT   CDS_pept        146356..147207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB1"
FT                   /locus_tag="CLJU_c01460"
FT                   /product="predicted flagellar motor protein MotB"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13236"
FT                   /db_xref="GOA:D8GKQ3"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKQ3"
FT                   /protein_id="ADK13236.1"
FT                   /translation="MKKKNKKPDEGPSAERWMLSYADFMTLLMIFFVVMYAMSQVDQTK
FT                   YNKLSQSLSIAMGGGKTIIGADNTSSVKDSVKTVDKPTESDQSEEQVKMEANKLKQLKK
FT                   QVDSYLAANGLSQSVSSQIDERGLVVSLSNTLFFDTGKAEIKPEIQNTLMGIGKMINQM
FT                   GNSIRVEGHTDNVPISNNEYASNWQLSCARAANVTQFLQNKVGIKPEKLTSVGYGEYRS
FT                   VTDNSTDANRAKNRRVDIIIESNKFNSIERGNSTSSSTNSSQGTSQITTTDQQKVNQSQ
FT                   QH"
FT   gene            147382..148134
FT                   /locus_tag="CLJU_c01470"
FT   CDS_pept        147382..148134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01470"
FT                   /product="predicted methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13237"
FT                   /db_xref="GOA:D8GKQ4"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKQ4"
FT                   /protein_id="ADK13237.1"
FT                   /translation="MKLKLVRSDETLDDLQINGICIIQKKNSFRFGVDAVLLANFAKIK
FT                   PKMNIIDLCSGTGIVPFIIAGKTKAQHITGMEIQKDMVDMATRSVIFNGMEKKVEFIHR
FT                   DLVDFEFLKKLPKADVVTVNPPYKLKNSGITNDQYENAISRHEICCTLEDVIKAAKILL
FT                   KDNGKLYMIHRPDRLVDIMYTMRKYNIEPKLMTMVQPCVNKAPNMVLIEGQNNGKPFLK
FT                   WEVPICVHKLDGSYTDEIDRIYGRCLRR"
FT   gene            148141..148980
FT                   /locus_tag="CLJU_c01480"
FT   CDS_pept        148141..148980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01480"
FT                   /product="corrin/porphyrin methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13238"
FT                   /db_xref="GOA:D8GKQ5"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKQ5"
FT                   /protein_id="ADK13238.1"
FT                   /translation="MGKLFLVATPIGNLSDITLRALDTLKNVDLIAAEDTRQSLKLLNH
FT                   FNIKKPLISCHKYNENEKSKLLIQKLKDGKDIALVSDAGTPGISDPGSIMVKSCIEQGI
FT                   EFEVLPGATAVTTALVYSGLDTSRFTFIGFLPRENKDRRSILEGVKNRTETLIFYEAPH
FT                   RLTSTLEVLATVLGNRHIGICRELTKVHEEILRFTLEEAMNYYESNNAKGEFVLVVEGK
FT                   DEKELLREESEKWINLSIEKHIKMYMEDGLDKKEAIKKVAKDRKLSKSEVYKYSLNL"
FT   gene            149245..150282
FT                   /locus_tag="CLJU_c01490"
FT   CDS_pept        149245..150282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13239"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKQ6"
FT                   /protein_id="ADK13239.1"
FT                   /translation="MNKRTLSVAIALTLALSTGANVLAAPSASSSSTSLEQVKQQKQEL
FT                   EIKAEKMDNQVIQTMNDLENNKKSIASVSNSIKQTQANIDSVQASIESQQKVFNQRAKA
FT                   MYTNNMSGYLGAILNASNLNDFISRVDNVGKVMSFDKNVVGDLKSKKEQLASGKEKLNN
FT                   ENNKLLALKSENEKKLAKLNSDKESAKNVIASLDAQEKSLEITDQATLKAIASAASNVS
FT                   ASRGGTIISSDAVVAYASNFLGVPYVYGGTSPSGFDCSGLVQYVYANFGINLPRTSEEQ
FT                   QNVGTPVSRDELKPGDLVFFGSPAYHVGMYVGDGQFIEAPRTGLSVRIAALDNRSDFTG
FT                   GRRVK"
FT   gene            150729..151775
FT                   /locus_tag="CLJU_c01500"
FT   CDS_pept        150729..151775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13240"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKQ7"
FT                   /protein_id="ADK13240.1"
FT                   /translation="MNKRTLSVAIALTLALSTGANVLAAPSASSSSTSLEQVKQQKQEL
FT                   EVKAEKMDNQITQTMNDLENNKKSIASISNNIKQTQANIDSAQKNMENQQQVFNQRVKA
FT                   MYINGISSYLGVILNADNLNDFISRVDNVKKVMGFDKNVIGNLKDKKEQLANGKEKLNN
FT                   ENNKLLALKSENEKKLAKLNSDKESAKNVIASLDAQEKSLEVANQATLKAVASAASNVQ
FT                   QSASRGGSSIASSDAVVAYASNFLGVPYVWGGTSPSGFDCSGLVQYVYAHFGIDLPRTS
FT                   QEQQTVGTAVSRDELQPGDLVFFGSPAYHVGIYVGGGQFINAPKTGDVVKIASLDNRSD
FT                   FTGGRRVR"
FT   gene            complement(151968..152213)
FT                   /locus_tag="CLJU_c01510"
FT   CDS_pept        complement(151968..152213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01510"
FT                   /product="predicted regulators of stationary/sporulation
FT                   gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13241"
FT                   /db_xref="GOA:D8GKQ8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKQ8"
FT                   /protein_id="ADK13241.1"
FT                   /translation="MKSTGVVRRVDELGRIVIPIELRRTLDIAEKDALEIYVDGEQIIL
FT                   KKYEPACIFCGDARDVVNYRGKNICKSCLNELKEGK"
FT   gene            152756..154156
FT                   /locus_tag="CLJU_c01520"
FT   CDS_pept        152756..154156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01520"
FT                   /product="tRNA nucleotidyltransferase"
FT                   /EC_number="2.7.7.72"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13242"
FT                   /db_xref="GOA:D8GKQ9"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKQ9"
FT                   /protein_id="ADK13242.1"
FT                   /translation="MDYVKDFIKSTREVISKVGGEVYLVGGYIRDRLISITAQPKDIDF
FT                   IFNGNIEKFMEELENRQYKFFPIKQEIGIYRCMLGNNSIDISLMEGDSIEEDLKKRDFT
FT                   MNAIAIKLSGDKVKVIDPFYGRRSIDNRIIKSVTDMSLENDPIRILRGIRFCISYGMHF
FT                   NLDTEKCIEKLCYKIMDMPMERVFKEFMLILERDDYGKAFEVLDNYGILKNIIPYIEEL
FT                   KTIGKCAYHIEDVFTHMNLTYCVFKDILNGKVSVKGLNLHVFQDKIGDFKLREYMSLAC
FT                   FLHDIGKYEAYRKDGDKVSFWGHEMKGAAIARNFCRNMKFPKKAESYIENIVEGHMYPL
FT                   KIFKQNSKDKKNDFYKFFSKYDGYIIEILTAAYCDNYATRMLLDVENEKVRFKMFIEDM
FT                   LKEYELYCSINENKILNGNDVIQILNISGPEVKNALEDVIRLRYLGKIQTREEALNYLR
FT                   VKINNNYI"
FT   gene            complement(154356..155009)
FT                   /locus_tag="CLJU_c01530"
FT   CDS_pept        complement(154356..155009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13243"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKR0"
FT                   /protein_id="ADK13243.1"
FT                   /translation="MSKADQFLKCEKDKYGKIFVAINYAIDNISPFLDKDILNRRKYVS
FT                   KISTLKKYIDLIEAAQGELDTGGFLNKLKSDKYISLLEDYKNDNLESLFQLEKCSTCQC
FT                   LNCTSDCKFDSCLGCKSGSKIVNCDKKKINITRHDSFSLNLTNDKTGESDRYTVLAVLQ
FT                   DVQLDRKYIIIENTLSKEKFILYYYPGISEDSYGEISDAEEFDFIVSTFQSIEE"
FT   gene            complement(155018..155668)
FT                   /locus_tag="CLJU_c01540"
FT   CDS_pept        complement(155018..155668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01540"
FT                   /product="predicted transcriptional regulator"
FT                   /note="related to phage shock protein A"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13244"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKR1"
FT                   /protein_id="ADK13244.1"
FT                   /translation="MGVLKRVSNIFRAKVNNTLDDIENPIELLDQKLRDMDDSLNKAKL
FT                   SSAQILGNVHEIEKKMEESKRVSTEFDEKVKLAMSKGNEELAKKALARKLEADKSYSSL
FT                   EASYKDACQKAEAVKSKLKELEEEIHKTRVYRDEAAARFNNAEASKKVNEILSNVETGS
FT                   NKINIDDIERKIQKKESLAEGLGDLREEDSLEKEFKKLDEVDLDKELEKYKQN"
FT   gene            complement(155684..156199)
FT                   /locus_tag="CLJU_c01550"
FT   CDS_pept        complement(155684..156199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13245"
FT                   /db_xref="GOA:D8GKR2"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKR2"
FT                   /protein_id="ADK13245.1"
FT                   /translation="MFTPQGNILNINNNTAYARSSGGFKSSGFSHSTSSFSHSSSSKSS
FT                   GGSFKSGSFSSPNSTYKQKNSSNSSGGDFKSGSFSNTPNSSSKSSNQNTNQNNSGSGQN
FT                   YSSRSHRSFFPIPIPIPIPWGHSSSYYGYGGGHSLLANFFWGFVKFVILILILLFIIRK
FT                   IKKFKNRK"
FT   gene            156599..157192
FT                   /locus_tag="CLJU_c01560"
FT   CDS_pept        156599..157192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13246"
FT                   /db_xref="InterPro:IPR014975"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKR3"
FT                   /protein_id="ADK13246.1"
FT                   /translation="MKEHKFGMEYINKIAKNISDNTIVPYEDLPRYDLFLSQVTDYLND
FT                   KFQGEKYTNNIVQNYIKNEVISKPEDGKKRGYTKVHLTQLILLSYMRPILTTEEIKKVF
FT                   RLAFNEINDGEDDIISWEKAYKIFSDLHNNSLDDLMSKEHFNEQKFQDMVKDMDLKSDD
FT                   EERIGIFFVVMSLICQASAIKKLVQNIVNNYEGK"
FT   gene            complement(157325..157804)
FT                   /gene="ispF"
FT                   /locus_tag="CLJU_c01570"
FT   CDS_pept        complement(157325..157804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispF"
FT                   /locus_tag="CLJU_c01570"
FT                   /product="2-C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /EC_number="4.6.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13247"
FT                   /db_xref="GOA:D8GKR4"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKR4"
FT                   /protein_id="ADK13247.1"
FT                   /translation="MKIGLGYDVHKLVYNRPLILGGVNIPFEKGLMGHSDADVLLHAIM
FT                   DSLLGALCLGDIGKHFPDNDNKYKNICSLKLLSHVSALINEKGYTIGNIDSIIIAEKPK
FT                   LSSYIQDMRVNIAKTLNVTTAVISVKATTEEGLGFTGKGEGIAAQSICLLTANSK"
FT   gene            complement(157874..158050)
FT                   /locus_tag="CLJU_c01580"
FT   CDS_pept        complement(157874..158050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13248"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKR5"
FT                   /protein_id="ADK13248.1"
FT                   /translation="MKDNVIKVDFSRNRKKDPFSLLLLIKKTYKKFFYSMFKSYKTKDK
FT                   NNKNIIRSFKDIS"
FT   gene            158434..158631
FT                   /locus_tag="CLJU_c01590"
FT   CDS_pept        158434..158631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13249"
FT                   /db_xref="GOA:D8GKR6"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKR6"
FT                   /protein_id="ADK13249.1"
FT                   /translation="MEKSTTSSIYHIIRYAVPMAIIRRYFFNIAVIRYLYYILNFILDR
FT                   KLEEKDNLYYLKITCYPQNM"
FT   gene            158833..159786
FT                   /locus_tag="CLJU_c01600"
FT   CDS_pept        158833..159786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01600"
FT                   /product="predicted polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13250"
FT                   /db_xref="GOA:D8GKR7"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKR7"
FT                   /protein_id="ADK13250.1"
FT                   /translation="MTTRNNFSKILKNGGLMLLGLIVVFGLSYEGYNYFHGNKSKTNKV
FT                   ISADKKAGSEVSEKKTSKSNVKSSNKQDSDKNKNIRHNVSEDGMKYTYDAQKVKDILDN
FT                   KAPNDGKKIAFLTFDDGPSTTVTPIILNTLKNYNVKATFCLLGENVEKNEKSKELVKEI
FT                   LKEGHAIGNHTYTHSMRKLYPGNRLDVGTVMAEVEQDNTAIRNIVGQDFNTRVLRLPGG
FT                   YMSRAYYHDPNLNEFNARLKEKGMYSIDWNAYDFDAEGRRKNADQLLEHVKRSVGSQQK
FT                   VVILMHDTYGKEETARALPQIIEYLKDQGYEFKTIA"
FT   gene            159939..160856
FT                   /locus_tag="CLJU_c01610"
FT   CDS_pept        159939..160856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01610"
FT                   /product="putative polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13251"
FT                   /db_xref="GOA:D8GKR8"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKR8"
FT                   /protein_id="ADK13251.1"
FT                   /translation="MERSDNMKNKNIKGLIALVLLIFFIIGAHSVYKNKLVSSNDQKKV
FT                   DNKSNVKSDKKNQTNIKKVEHVKDREFTGKNIKYNSQSIPILYYHSIDYEKGNELRVPK
FT                   ERFREQMKYLKDNGYTTLTLNELYNFLAYNKPVPNKSVVITLDDGYKDNYENAFPVLKE
FT                   FGFKATVFMITSSINNEKDFLTSSELKQMDSYGMDIESHTVNHDKLDRLTYDKQIQTLK
FT                   DSKEFLEKLLNKKVKYIAYPYGKWNENAIKALKAEGYSMAFTTAETSYEKSIDFIKKFV
FT                   ICLKYINTLIRKSKILRIKNINLI"
FT   gene            161121..161441
FT                   /locus_tag="CLJU_c01620"
FT   CDS_pept        161121..161441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01620"
FT                   /product="predicted small multidrug resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13252"
FT                   /db_xref="GOA:D8GKR9"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKR9"
FT                   /protein_id="ADK13252.1"
FT                   /translation="MEWIYLVIAGFFEISWAIGLKYSQGFTKILPSILTVIGMIASFYF
FT                   LSLSLKRLPLGNAYAIWTGIGTVGTVVLGVILFKEPINVMRMSCIVFIVLGIVGLKLIS
FT                   ID"
FT   gene            161551..162258
FT                   /locus_tag="CLJU_c01630"
FT   CDS_pept        161551..162258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01630"
FT                   /product="B3/4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13253"
FT                   /db_xref="GOA:D8GKS0"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKS0"
FT                   /protein_id="ADK13253.1"
FT                   /translation="MKKFVIEDDFWSLFPGARIGIIVCHGIDNFIKDEDQYKNMISKSE
FT                   KEALKYLENVEFSSNEVIKVWREAFQKFKTKKGARSSIEALLKRVDKGTHIGTINPLVD
FT                   IYNSISLTYALPCGGEDMDKFAGDIRLTKAVGDESFITLGTDESALPYEGEIVYKDNEG
FT                   AICRCFNWRESVRTMLTENTRNAFLCIELVDERRVKDFENALKDLAKIVQDNLGGTCKI
FT                   SILDINNKEVLID"
FT   gene            162323..163048
FT                   /locus_tag="CLJU_c01640"
FT   CDS_pept        162323..163048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01640"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13254"
FT                   /db_xref="GOA:D8GKS1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKS1"
FT                   /protein_id="ADK13254.1"
FT                   /translation="MSHGYTKGEKKVMSGFSYKDIYMEDGRRVLEINVLPEKYCNFDCI
FT                   FCPIGRSKNKVDTKMSFDEIDSSLIELGNRIESTKAELVFINSKGEALVNDKIGDIIDF
FT                   IKDKGLPVRLLSNGYLLGRDEYMKIANKCDEVVGEIKIITEEGFQKVQRPIEGYTLAEY
FT                   ISNMVSFNKQYKGKFIFEITIIKGYNDDEESIEKIKNIIKAISPDKIIVARMEDEKFKK
FT                   KLGINDERFEEISSTLLNI"
FT   gene            163163..163651
FT                   /locus_tag="CLJU_c01650"
FT   CDS_pept        163163..163651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01650"
FT                   /product="putative antibiotic resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13255"
FT                   /db_xref="GOA:D8GKS2"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKS2"
FT                   /protein_id="ADK13255.1"
FT                   /translation="MFRDMRRKKQLLSKEETIEILKLCTSGVLGVIGDDDYPYTVPISY
FT                   VFKDGKLFMHGAKQGHKIDSIKRNDKVTFCVIEKDEVIQKTFTTHFRSVSIFGRARILT
FT                   NDSDRRYAIESLVEKYSPDYIKEGQQEIEREWNRVCLIEVKIEHMTGKAAIEIVNSNK"
FT   gene            complement(163830..165002)
FT                   /locus_tag="CLJU_c01660"
FT   CDS_pept        complement(163830..165002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01660"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13256"
FT                   /db_xref="GOA:D8GKS3"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKS3"
FT                   /protein_id="ADK13256.1"
FT                   /translation="MYIVGVDIGKNNHEATIIDDTGSIIGKSIKFANSHSGGNKLIEHI
FT                   KKYTGNSKVIFGLEATGHYWLSLYSFLLTKGYEINVINPIQSDSFRNLYIRKTKNDTKD
FT                   SFIIAEVIRFGKFTNTKLCDDKLLALRQLCRYKLSLTTEISELKCRIITVLDQIFPEYD
FT                   KLFSDIWGASSKAVLEKCQTPEGILELDINDLTKLLKTKSKGRLGFNKADEIQNAAKNT
FT                   FGIKIAKKAFKFQIKQLISQILFLEKQMKSLDSEIEFYYSKFDCHLTTIPGIGSVTAAI
FT                   ILSEIGDIKRFKNSSSLVAYAGIDPTVKQSGQFLSNNNKMSKRGSPYLRRALFLSASTC
FT                   VLHDSPLNEYYNKKRSEGKHHLVAIGATANKLTRIVFAVMRDNKDYVPIN"
FT   gene            165531..167027
FT                   /locus_tag="CLJU_c01670"
FT   CDS_pept        165531..167027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01670"
FT                   /product="putative cell wall hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13257"
FT                   /db_xref="GOA:D8GKS4"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKS4"
FT                   /protein_id="ADK13257.1"
FT                   /translation="MNKNVKTLIITAAFALVAFQFKVSADSSLGSPRINIDTNKEWTVK
FT                   FSSNLEPSTVNSTNIQVTDKNNVQVPVAVTLGNDPSTVLVSPKVSGYDPSEKYNLVIGE
FT                   GLKSVSGKNLSNPLSMQFTTSNKYSDGTSYTDLPKITSNKFEYEPLLSSEKQGFFIQCD
FT                   SSSDVQYRIFVNGQNDKDGNYTELTNGYTSEDSGKITALKTLSAGTNGQKYKAVIYVKR
FT                   TGATGAHKDGNTEYDNYFVDYFRCVDSIDAGSNEYANYDISLDDMVNTQLNSDSTPVFV
FT                   AANVMDNAATKNQIKYYADPNNFLDSYGKYQFLKLTYADGVTADSLNNFLKGKGIFDGK
FT                   GQAFLDAAKNNNISVAYLVSHAMLETGNGTSKLANGGATDSNGNYIYGVPVYNFFGINA
FT                   TDDNAVLNGTKTAYENGWTTVESAISGGAQWIGKWYINNPSTNQNTLYKMRWDPGNPGQ
FT                   HEYATDISWAYKQIPNIIKEMQDITAGSNLTLEFEIPKYK"
FT   gene            complement(167083..167268)
FT                   /locus_tag="CLJU_c01680"
FT   CDS_pept        complement(167083..167268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01680"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13258"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKS5"
FT                   /protein_id="ADK13258.1"
FT                   /translation="MKENTLNLAQRDIDEALSVIESLEKAIVSDSSQNQVLKDKFHLLY
FT                   DKVNELENILKSEGII"
FT   gene            complement(167281..167523)
FT                   /locus_tag="CLJU_c01690"
FT   CDS_pept        complement(167281..167523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKS6"
FT                   /protein_id="ADK13259.1"
FT                   /translation="MTIRDIMKYIESEYLVINDTPCEICGGEYLAENSNVSIVDGIPYD
FT                   ICNCVCSECGHEKTFQFCAPFVEDEDLSKIKNILN"
FT   gene            167704..168279
FT                   /locus_tag="CLJU_c01700"
FT   CDS_pept        167704..168279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01700"
FT                   /product="predicted spore maturation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01700"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13260"
FT                   /db_xref="GOA:D8GKS7"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKS7"
FT                   /protein_id="ADK13260.1"
FT                   /translation="MINIIWFFILAFGIGFGILSGRGEAVSKSIIASSDASVKLMISLL
FT                   GIMCLWCGVMKIAEKSGLMNKIASLMRPILKVLFKDASKDERAIGPIVMNLTANMMGLS
FT                   NAATPFGIKAMDQLSNLNKKKEEASDDMALFLVLNAACIQLVPTTVISIRAAMGSKNPA
FT                   ETIIPAIITTTISAVVGVVCCKILQRYF"
FT   gene            168305..168823
FT                   /locus_tag="CLJU_c01710"
FT   CDS_pept        168305..168823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01710"
FT                   /product="predicted spore maturation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13261"
FT                   /db_xref="GOA:D8GKS8"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKS8"
FT                   /protein_id="ADK13261.1"
FT                   /translation="MKYIIKAIIPIIIIFMVTYGQMKKVRVYECFVEGAKEGIDICIKI
FT                   FPYLLAMIIAVGVFRESKALDYFIGFVKPVVKFIGLPPEVVPLVLVKPLSGSGALGIFA
FT                   ETLSKFGPDSYIGRISSIIMGSTETIFYTLTVYFGAVGIKKIRHTLWAAVMADITAIIT
FT                   AVIVTRIMF"
FT   gene            168917..169495
FT                   /locus_tag="CLJU_c01720"
FT   CDS_pept        168917..169495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01720"
FT                   /product="predicted phage related DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13262"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKS9"
FT                   /protein_id="ADK13262.1"
FT                   /translation="MLRWKELYEECLSCSKCSLGDNRTNMVFGDGNPKAHIMFIGEAPG
FT                   ADEDRTGIPFVGRAGQLLTKALLALDLHRERDYYICNICKCRPKNNRTPYEEEEKACIP
FT                   YLRNQVALVRPKIIVCLGATAMGCILGKEWRITRDRGKWIERKGFYMTATFHPSAVLRD
FT                   ANKKAAFWEDLKSIKEKNEEIFQTKNVDT"
FT   gene            169845..171779
FT                   /gene="metS"
FT                   /locus_tag="CLJU_c01730"
FT   CDS_pept        169845..171779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metS"
FT                   /locus_tag="CLJU_c01730"
FT                   /product="methionyl-tRNA synthetase"
FT                   /EC_number="6.1.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13263"
FT                   /db_xref="GOA:D8GKT0"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKT0"
FT                   /protein_id="ADK13263.1"
FT                   /translation="MTKKTYYITTPIYYPSAKLHIGNTYTTVAADALARFKRLTGYDVM
FT                   LLTGTDEHGQKIQRLAEAKGVTPIEYVDEIVAGIKKLWDMMNISYDKFIRTTEDYHVKA
FT                   VQKIFKKLYDQGDIYKGSYEGLYCTPCESFWTETQAADGKCPDCGRPVEKTKEEAYFFK
FT                   MSKYAPKLIKYIEDHPDFIQPESRKNEMLNNFLRPGLQDLCVSRTSFNWGIPVTFDEKH
FT                   VIYVWIDALANYITALGYGSKNEELYNKYWPADVHLVGKDILRFHTIYWPIMLMALGLP
FT                   VPKKVFGHGWLLVDGGKMSKSKGNVVDPVVLVDNFGADAVRYYLLREIPFGSDGLFNNE
FT                   IFIKRINADLANDLGNLLSRTCAMVEKYFDGVVQEPTKKEQIDDELIKLALETPEKVEK
FT                   NMNDLRIPEALDNIWDLITRSNKYIDETTPWILAKDESKKDRLGTVLYNLLESLRIISI
FT                   CVSPYLPETSAKMYKQLNTNVVSWDSITSFNGTKAGTKISKGELLFPRIDVDKKIEELN
FT                   KLKEEKKAAQNSNEKSLKKQITIDDFDKIDLRVAKVLKCENIKGSNKLLKFQLQMGKEQ
FT                   RQVVSGIAKYYKPEELVGKYVVFVANLKPVKLKGEISEGMILSAASDDDSKLSILSLSD
FT                   EIPSGSTVR"
FT   gene            172062..172838
FT                   /locus_tag="CLJU_c01740"
FT   CDS_pept        172062..172838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01740"
FT                   /product="predicted deoxyribonuclease"
FT                   /EC_number="3.1.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13264"
FT                   /db_xref="GOA:D8GKT1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKT1"
FT                   /protein_id="ADK13264.1"
FT                   /translation="MELNIFDAHAHYDDEEFDEDRDKVIEELKKNNIVGVLNCGSSIEG
FT                   ARASVKLADKHDMFYAAVGVHPEYSDIFTDDILEELKILAKNKKVKAIGEIGLDYYYKE
FT                   NPPKEVQKAVFIKQMKLADELKLPVIIHDREAHEDTLNIVKQFKNVIGEIHCFSGSVEI
FT                   AREFLKLGYYIGFTGVVTFKNAKKAVEVAREVPFDRILVETDCPYMAPVPFRGKRNRSE
FT                   YIKFIIAKIAEIKGVEDSKISQLTIFNMKQLLNMVK"
FT   gene            173164..174204
FT                   /locus_tag="CLJU_c01750"
FT   CDS_pept        173164..174204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13265"
FT                   /db_xref="GOA:D8GKT2"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKT2"
FT                   /protein_id="ADK13265.1"
FT                   /translation="MVEKFKTYLKKYFPIGLRVEIIAVVILSVLIGVIFSTRKTIVVSV
FT                   DGRSKKITTFCSTYRKVLDNSGISIGPKDKVKPSLDSRVENNTTLKIKRVVKVKVEADN
FT                   KKLNLESAEDNVEDMLKAEKIGISKLDIVYPSRKHELKKGMNVVVTRVKTKDIKEDRPI
FT                   NYDTILKSDEQVENGTKKVVQEGQNGEKETVTRVVYQNGKEVSKKVISEIIKKQPVQKV
FT                   IAIGTLTNYTPSRGTNLNYVESLQMRATAYTADYASTGKNPGDPAFGITASGTVARRNN
FT                   GDYSSVAVDPRVIPLGTKLYIEGYGYAIAEDTGGAIKGNRLDLFFDSSSEVDNWGVRWV
FT                   NVYVIR"
FT   gene            174313..174876
FT                   /locus_tag="CLJU_c01760"
FT   CDS_pept        174313..174876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13266"
FT                   /db_xref="GOA:D8GKT3"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKT3"
FT                   /protein_id="ADK13266.1"
FT                   /translation="MIKEVIVVEGRDDITAVKRAVDAQLIAVGGFGINKKIIDKIKEAQ
FT                   KRQGVIVLTDPDFAGNKIRQIISKRVKGIKHAYISQKDGIKNGDIGVENASPETIIKAL
FT                   KNAKYEVKEKREEFEISDMVFFGLTGKSNSKAKRDMMGKELGIGYCNTSQFLNRLNDYG
FT                   ITKEEFKKAISKVNNIIDKEKYNE"
FT   gene            174869..175711
FT                   /gene="ksgA"
FT                   /locus_tag="CLJU_c01770"
FT   CDS_pept        174869..175711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="CLJU_c01770"
FT                   /product="dimethyladenosine transferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13267"
FT                   /db_xref="GOA:D8GKT4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKT4"
FT                   /protein_id="ADK13267.1"
FT                   /translation="MNDLSTADVVKKYGFKFSKSLGQNFLIDNTVLDDIVNSADISKED
FT                   FIIEIGPGVGTLTRELLKKAGKVCAIELDSDLIPILKEELKDFKNFELIHKDALKIDFN
FT                   KIIDDEKNVKIVANLPYYVTTPIITRLLNENYNFKTLTIMIQKEVGERISSEPNCKQYG
FT                   ALSILVQYYCDVEVIRKVSPLSFIPRPKVESIVIKLTKLDEPRVKVKDKKLFFKVVRCS
FT                   FNMRRKTLWNAVKTLKVPKEDMEAAFKKAEIDEKRRGETLSIEEFGRLSDCIYDICIH"
FT   gene            175810..177114
FT                   /locus_tag="CLJU_c01780"
FT   CDS_pept        175810..177114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13268"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKT5"
FT                   /protein_id="ADK13268.1"
FT                   /translation="MAQKKSYSRYFIILQEDEKGYSLASDKIASGYAKLEMKNDKCKIS
FT                   YYVQNLKKEKTPYYMMLICNKKDIKNIIKIGEMNIDDYGRADISYEYAANDVAGSGIAM
FT                   DKVSGAAIVRMVDDNIISVMSGFASTEIPEWKAFPVSQNKNKDLEETEVSEIEKSEKTE
FT                   TKSVFDQYEDIIEKAKEDEEEVKENIEIEEKDSYREEQEEEQEESEEVNKSESEEQNKE
FT                   VQVDAEVMEEEIIEDNSKSNDTGKNEDRNINSKEDRNNDSSIYVDKSRLRCHKKLNLNR
FT                   CQRECEKDNVSRSYPKGPEGKFFTQLMSGFKEIKDINKELKRCVWNKVPVSSMDDMYNI
FT                   TDYNKYSYIYYPMVQYYPYIKKYNYYLAGYKCDKNDRVKYLIYGIPGTKSRKDQPYGGK
FT                   SGFVTWIPLKDKDTMGHWLMFYDFRANTIVIPVRK"
FT   gene            177130..177714
FT                   /locus_tag="CLJU_c01790"
FT   CDS_pept        177130..177714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13269"
FT                   /db_xref="GOA:D8GKT6"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKT6"
FT                   /protein_id="ADK13269.1"
FT                   /translation="MRLIVIDKKKIGVTIIIIGLMIVLLGLEKNFDMRLKFTALIQNNM
FT                   ESLTQYKGLEGRLLYKLPSRWTCRNQDTFGDEILYHSDFKSDDNAINGFVEVWNLKGDL
FT                   KLFLQNSKSISEKQNLYKEYSIKQICMNGRKGYLLKYTITKEIGDSYKCIEYFTEEGKQ
FT                   FCRFSFFVKESNFKENMPTIFEVIVKTLEYN"
FT   gene            177904..178752
FT                   /locus_tag="CLJU_c01800"
FT   CDS_pept        177904..178752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13270"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKT7"
FT                   /protein_id="ADK13270.1"
FT                   /translation="MDKITKKRLNIFIISCILIPVTLLCGCSKLDQLKVKAGLKNSDFE
FT                   YMKQQGKVKQIIIQNTRDQGFKFVVTDQSTIKNLYDILSSAKKVSKKSSLDPDYVFEID
FT                   EGNNKVHKFSYIAGLDKKDLGNLYSKGQVYIVSNRIDNDMINNFWNTRMPPSDFKSVYY
FT                   GSIMDTLNKYFSEKDKTKKIGINLKDDIEAQRFILSTEQEEFKSDLTSKFKNANIGNND
FT                   EDNYDVWVTIKTEGYKSTLYKMTVTLFDRQNQSEKVYYVQDTYSSGGWNKSISENKPNG
FT                   F"
FT   gene            178816..179664
FT                   /locus_tag="CLJU_c01810"
FT   CDS_pept        178816..179664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01810"
FT                   /product="predicted nucleotide-binding protein"
FT                   /note="related to Mrp-family"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13271"
FT                   /db_xref="GOA:D8GKT8"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKT8"
FT                   /protein_id="ADK13271.1"
FT                   /translation="MSNCDGCSSKSKCSKEDKGGCKYILPKYGNVKHIIGIMSGKGGVG
FT                   KSTVTGIMASKLRNSGYKVGVLDGDITGPSMPRFFGINDKRADILQVGESEEIKFSPVE
FT                   SSSGIKVISLNLLTEEEEQPVIWRAPMITGVLKQMYSDTSWGELDYLLIDMPPGTGDVA
FT                   LTVMQEIPMEGVIIVSTPQDMVSMIVKKVVIMAEDLKVNILGVVENMSYVKCGKCGEKV
FT                   RLFSENSAKEQADYLGLELLAEMPINSDLVKNMEAKKAEEYISKSLEYNDLLNNFIKKL
FT                   K"
FT   gene            179771..179959
FT                   /locus_tag="CLJU_c01820"
FT   CDS_pept        179771..179959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01820"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01820"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13272"
FT                   /db_xref="GOA:D8GKT9"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKT9"
FT                   /protein_id="ADK13272.1"
FT                   /translation="MKAVVDKDTCIGCGLCPSICPEVFQMDDDEKAKAIEDNVPGETED
FT                   AAKDAEDSCPVCAIKVN"
FT   gene            complement(180061..180246)
FT                   /locus_tag="CLJU_c01830"
FT   CDS_pept        complement(180061..180246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01830"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13273"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKU0"
FT                   /protein_id="ADK13273.1"
FT                   /translation="MIGKIIDMNITDALVSFQDGTTANVGATHLPPDSKIGDRINIHPI
FT                   SEVTLNDKYKQHPVLF"
FT   gene            180482..182587
FT                   /gene="nrdD"
FT                   /locus_tag="CLJU_c01840"
FT   CDS_pept        180482..182587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="CLJU_c01840"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01840"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13274"
FT                   /db_xref="GOA:D8GKU1"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKU1"
FT                   /protein_id="ADK13274.1"
FT                   /translation="MLHVVKRDGRRVPFDSIKITNAIKGSCDEIGFDLKESEFIDLTQK
FT                   VTENIENLNLKEVNVEDIQNIVEEVLMKKGYVKIGLAYSNYRRERNDIREIKSDLMKAI
FT                   DKIGVQTDRDNANVGNNFSAKLLRIASESNKWHNLATMPKHLAKAHENGDIYYHDLDSY
FT                   NLTVNCLHIPTKEMLLDGFNTGYGNIRTPKRIESAAELSCILLQSAQNDMFGGQSHPDF
FT                   DNDMAIFVEPTRKEILKNLKQMGVGEEKIKDISEKKLRRSIEQAMQGIIYNLNTMHSRA
FT                   GSQVPFSSLNIGIPTSKDAALVCEVFLTEYEKGLGRGEQPIFPNIIFRVKKGVNKNQED
FT                   PYYYLFKIACRVASKRMNPTFMNLDADFNKAYYDKGVIPATMGCRTYVCSNVNGDPGVK
FT                   GRGNIAPVTINLPRLGILSKGNVSKFFGLLQGKLELARESLMHRYGILKRLRVKDLPFV
FT                   AGQKLMKGAENLKSEDSIEPILKQGTWAIGFIGLAETLIALTGKHHGEDESSRELGIKI
FT                   ITYIRNYTDKLIEETHLNWSCYATPAEGLSGKFIVHDKKIFGEIPGVTDKEYYTNSYHI
FT                   PVGYPISIKDKIDIEAPYHKLCNGGHISYIEVDDYPSEEVVKSIIDYAYDNTNISYIGI
FT                   NFHIRYCKECGTYMHGEDVCPKCGSNNIQGISRVTGYLSLDERFGEGKTAERRDRISQG
FT                   SSKHVYC"
FT   gene            182633..183142
FT                   /gene="nrdG"
FT                   /locus_tag="CLJU_c01850"
FT   CDS_pept        182633..183142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="CLJU_c01850"
FT                   /product="predicted anaerobic ribonucleoside-triphosphate
FT                   reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01850"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13275"
FT                   /db_xref="GOA:D8GKU2"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKU2"
FT                   /protein_id="ADK13275.1"
FT                   /translation="MGCKKIRLAGIAYESLVNGPGMRRVFFAQGCRHNCKGCFNPSTHD
FT                   FKGGQLKDIDKLVCDIKDNPMVSGVTFSGGDPFEQPEEFAYMADKIKELNLNIWCYTGY
FT                   TFESIVNGSDMAKKCLLNNVDVLVDGKFEENKKDTKLKFKGSSNQRIIDVKKSLDSNDV
FT                   IVLTFS"
FT   gene            183193..183558
FT                   /locus_tag="CLJU_c01860"
FT   CDS_pept        183193..183558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01860"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01860"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13276"
FT                   /db_xref="GOA:D8GKU3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKU3"
FT                   /protein_id="ADK13276.1"
FT                   /translation="MNNNSEIEVCSCTEIHKDCIECVRKSMLDEKTFMDLSALFKVLGD
FT                   YTRIKIIYALFKKELCVCDITEILQMSQSAISHQLRILKTARLVKFRREGKSVYYSLDD
FT                   EHINKLINAGLEHVKHN"
FT   gene            complement(184034..184666)
FT                   /locus_tag="CLJU_c01870"
FT   CDS_pept        complement(184034..184666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01870"
FT                   /product="predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01870"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13277"
FT                   /db_xref="GOA:D8GKU4"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKU4"
FT                   /protein_id="ADK13277.1"
FT                   /translation="MKIRWFGHSSFLFEDSKGRKLLTDPFDETVGYKTFKGDVDVVTIS
FT                   HNHFDHCYTEKINYKHIINKIGAFNLCDIPIYGIPSYHDKVKGAKRGENIIFIIEMDDY
FT                   RICHLGDVGYVLSPEEIKSLGSIDVLLIPIGGNFTIDGKEAAELAKSINSHIIIPMHYK
FT                   TSQLTFELDGLEKFLKYMKNTERIESNTLTLDNKPEDFNLVKILNFK"
FT   gene            184820..186631
FT                   /locus_tag="CLJU_c01880"
FT   CDS_pept        184820..186631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01880"
FT                   /product="putative N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01880"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13278"
FT                   /db_xref="GOA:D8GKU5"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR011081"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKU5"
FT                   /protein_id="ADK13278.1"
FT                   /translation="MKITRISMMILLSLIFVLIMFAKGNTVHAINYSGITIGNDVETNK
FT                   SWNIKFNMKLDQDTVNDSNIVVTDSTGNAVPISLQVEKDGMGVVVTPKSQYAYGKTYNL
FT                   IVKSGVKAVNGKNLSSEAKVQFGVKSNPSSNNKYTVTIDAGHGGTDAGNISEAGLKEKD
FT                   VDLSVALKTGKILEQNGVNVVYTRKDDNVTWNDSTNLQARFDIANNAKSNLFVSLHVNC
FT                   YTGSALVNGIETYYRASNDSAKNTANNIQSDLISYTGLSNRGIKEGTAQHKILMGTTAP
FT                   AVMVELGFMTNPKESQLIGSEDFQNKSASAIANGILKSLPSLQEENTVNVSSISNLSDS
FT                   IIVGSKYSLPTSVQATMSDGTSKKVNIVWNPNNVDTSKVGIFTYKGTVTGYSKTVTFTL
FT                   TVKAKQIEPVPVIPSEGAPVIVIDPGHGIGSDIGSNGNGFQEDDVTLSVGLKVGKILES
FT                   KGVKVIYTRTTDERKTTSLTVTESLQRRCDTANNAGATYMISIHTNAFDDPAAEGTETL
FT                   YYTGSVKGEKMAEAIQKSLSSALGTYSRGLKDGSWLYIAKHTTAPTVLTELGFLTNKND
FT                   AGILGTDGGRSKAAQAIASAILQVLGI"
FT   gene            187050..190157
FT                   /gene="ileS"
FT                   /locus_tag="CLJU_c01890"
FT   CDS_pept        187050..190157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="CLJU_c01890"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01890"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13279"
FT                   /db_xref="GOA:D8GKU6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKU6"
FT                   /protein_id="ADK13279.1"
FT                   /translation="MYKKIDSDKTFVQMEKDVLKLWQDKKVVEKSFKENEDGEYFTFYD
FT                   GPPTANGKPHIGHVLTRVMKDLIPRYKVMRGYKVLRKAGWDTHGLPVELEVEKSLGISG
FT                   KPQIEKYGVEDFIKKCKNSVFTYVSQWKEMSDRLGFWVDMDNPYVTYHNDYIESEWWAL
FT                   KKIWEKDLLYKGHKIVPYCPRCGTALSSHEVSQGYKDVKETSVYVKFKIKDQDKYMIAW
FT                   TTTPWTLPNNMALAVNKSYDYVEVLNQEQHLILAEAMLEKLEGEYEVLRKFKGEELVGL
FT                   DYEPIFNFASFEGKAHYVVHADYVTLTEGTGIVHTAPAFGEDDSITGKKYNIPMTNSVD
FT                   TQGRYKEEVIPWKGLFVKDADPKIIEYLKEKGMLYKAEKFTHSYPFCWRCDTPLLYYPR
FT                   DTWFIRMSQMRDKLVKNTNDTNWYPDNIRTGRFGNFVEGVIDWGLSRERYWGTPLPIWE
FT                   CECGHRECIGSIKELKEKGINVPDDIELHKPYIDRVKLKCPHCGKEMKRVSEVIDCWFD
FT                   SGSMPFAQHHYPFENKEVFEKNFPAQFISEAVDQTRGWFYTLMAISTVMFDRSPFENCV
FT                   VLGHVLDKHGLKMSKHKGNVLSPSTILENEGADAARWYFYTESAPWLPSRFYEEAVQDS
FT                   QRKFLGTLWNVYSFYVLYADLDNFNPMDYKDFVSENVMDKWIISRLNSLIKQTEDHLDN
FT                   YRITQAAQNIGNFVDELSNWYVRRNRSRFWSQKLTDDKIGAYLTLYKVLNTLCLVAAPF
FT                   VPFMTEEIYQNLVVNLDKNAVESVHLCKWPEYDSSAVDDKLEKDMEEAYKIVKLGRSAR
FT                   NSANIKNRQPLSEMLISVNTLPEYYGDIIKDELNIKNIVFNADLSKYVNFSIKPNLPVL
FT                   GKKYGKLIPKIKNEISSMNQMELAQKINDKETVKINISESEIELNSDNLLITMEGLEGF
FT                   AFAGEGSTGIVLETAITEELREEGNLREILSKVQNMRKESGFEVADKINLYISGNEKLE
FT                   AVVKKFDERIKKETLSMDVIYNANREYNNCNINGEKLDIAMEVVNK"
FT   gene            190314..191312
FT                   /locus_tag="CLJU_c01900"
FT   CDS_pept        190314..191312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01900"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01900"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13280"
FT                   /db_xref="GOA:D8GKU7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKU7"
FT                   /protein_id="ADK13280.1"
FT                   /translation="MAASIKDVAREAGVSIATVSRVLNDVDVVNEETKKKVLTAIEKLG
FT                   YRPNIVARSLKTQRTRTIGIIIPDISNQFYPEIVRGAEDVANIYDYNIMLCNTDLDIEK
FT                   EMEYLKVLKEKMVDGVLYMSNSLEPKILDLIKQLQLPMVLVETTNEKESIPSVTIDNEK
FT                   AAYEGVTYLIKNGNKNIAYIGENPDMANASAVRYKGYRKVLEENNLKLDKSKVYFGNVK
FT                   AKDGYKGMSEILSKTKVDSVFCTSDEVAMGAINALRDNNIRVPEDVDVMGFGNIYSASI
FT                   FYPKLTTVAQPTYDMGSVGMRMLIKLINKQELEKKNYVLSHKLIERDSCKK"
FT   gene            191420..192028
FT                   /locus_tag="CLJU_c01910"
FT   CDS_pept        191420..192028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01910"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13281"
FT                   /db_xref="GOA:D8GKU8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKU8"
FT                   /protein_id="ADK13281.1"
FT                   /translation="MVEKIIEIVIFVLDKTGYIGTFAAMALESACIPIPSEAILPFGGY
FT                   LSYTGRLSLPLVIIVGTFGGTIGSLGAYYIGKIGGRPLVEKYAEKLRLSRSHIEKSDYY
FT                   FSKYGEKIVFFSRLLPIIRTFISLPAGISKMEVKKFIIYTLLGSSIWSIILGYAGYKMG
FT                   EKWTIIRQWFHFADIALVVFIIIFVLYKLVYKKINRKNS"
FT   gene            192249..196334
FT                   /locus_tag="CLJU_c01920"
FT   CDS_pept        192249..196334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01920"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13282"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKU9"
FT                   /protein_id="ADK13282.1"
FT                   /translation="MEYREKIKEIFSYLLRLKKLNEKSVRNVYDYDKLYWEEEFSHMAG
FT                   CIVSKTVTSENWIEVNKKCGKLYQEFFNLYQESEKNGENFEIVFGHGLIVWNIDKEKIL
FT                   HPVLTTRMKIEFNKAKGSFILIPSGKTRLETSIFEGLKECNMSDIISLGDEVSRLNLDP
FT                   RNIEKSKSVFLNLISHINVKGKLSQSKVLKKKIDFEQFPVIYNSSVILVRKNSMKLWQV
FT                   EIANIIDEIDNGYEIPETIKALVDEDGSDYSGADKSEWKDVSDNLLFPLPANSEQKSIV
FT                   KKICENYGVVVQGPPGTGKSHTIVNLICHLLANGKKILVTSQTSRALKVLTEKIPEEIR
FT                   PLCISVLGNDINSLNDLNKAVRKITDNLSMDPEIMDEEVKSLEKELSFCRRNEELLYEK
FT                   LKKIREREKRSINYEGKEYDIVYIAKWVKDNKDKYSWMKDRIKIDQVMPLSDKEFNLLI
FT                   YLLGDLDKDKKCKFDSIKNIINKLPDFNEIYNKISEYKRLNGQYENYIKTVEGWHIPND
FT                   NKCNYEKVLELANICKSKITKLQEKNIWWNVFQDYHNSKISKQTFRDLLCKSSEYMLSL
FT                   SRINNQIRNCKIEIPENVSKNKFIEDFDILFDAFNEKGKVGKVFMIFHPECKYILEYCK
FT                   VNGALLKNTDQALIVKLYTQQERIFAALKTMWNNVMEDYGGETINSNLRESEFIAIEQN
FT                   LNYLDVIINWDMEYKREILRALGKISVPQNIDWHKKETYDYLIKCVNFIKNMNKYNEDK
FT                   AYIEILKKLIKTTEKLRDLYKAVDNLNIDEVKRILNEFEEIKCVKNKSLKIDELIGKMK
FT                   KVCPKTCINILDNWAYDKEKFNSWGQAWKWAKWNSLLQSTYDFNDDNIGDLIENEKNRE
FT                   KVLIKDIVSKKTWYNQIIKTKESEKRSLFSWAQAVKRIGKGRGKMVPQYRKIAQKEMEK
FT                   CKKVIPVWIMPLNRVIENIKLSKNMFDVIIFDESSQSDIFSLCALMRAKRAVIVGDDKQ
FT                   ISPETIGIDQNVVHDLIEKYLENIPQKEWFDLQVSLYDTALRVFPSRLMLKEHFRCVPE
FT                   IINFSNDLSYSGEIVPLRYPKICEKFYPAINTVKVNGGARDASKPINVKEAECLVDKVV
FT                   SCCRDKRYSNMSMGVISLLGEPQGHLIENMLREKIGVEEMINRKLICGDAYSFQGDERD
FT                   IMFLSMVISKDVKFAPLTKENDIRRFNVAASRARNQMWLFHSIDLEDLNEECVRYSLLN
FT                   YFLNYNKYSVKNKSMEYAFQSRFQKDVYGIIKNKGYKIVPEVKIGKYKIDFVVEDVRNR
FT                   VAIICDSELSQKNYSSKEIMEIQLDLERLGWIFYKIREGEFYYNPERVMEKLWSKLNNI
FT                   GIEQYKLEEIQNKNLQVV"
FT   gene            196472..197539
FT                   /gene="manC"
FT                   /locus_tag="CLJU_c01930"
FT   CDS_pept        196472..197539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manC"
FT                   /locus_tag="CLJU_c01930"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.22"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01930"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13283"
FT                   /db_xref="GOA:D8GKV0"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKV0"
FT                   /protein_id="ADK13283.1"
FT                   /translation="MLYALILAGGKGTRLFPLSRAKNPKQFLKIVNNKSFLRNTVDRIK
FT                   PLVDTNNIYVVTNEEYIDRVQAELPDISRNNIFAEPENKETATCIGFSAVKLLKKDPLA
FT                   TMIILPSDHYIESQKLFIDTINKAVEIAEKKKGLVTIGVKPIRPETGYGYIEMGEKINI
FT                   GVNAFKVERFLEKPNIEVAKDLILKGTYLWNSGMFVWKVDVFLREMQKYLPKMYKSMAL
FT                   IYKNLDTKQEEKVIQEQYKRIDGISVDFGIMQKTRKAYVIKCEFLWDDIGTFTALGRFL
FT                   KDVKGNNVKGNTVIESSESCTVFGGDKLIIVFGVKDLIVIDSEDVLLIMDKNRDQEVKY
FT                   LVDILKNKSNLKKYI"
FT   gene            complement(197612..197863)
FT                   /locus_tag="CLJU_c01940"
FT   CDS_pept        complement(197612..197863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01940"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13284"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKV1"
FT                   /protein_id="ADK13284.1"
FT                   /translation="MNYVYILKCSDGTLYTGYTNNLDKRISTHNKGKGAKYTRGRLPVK
FT                   LIYFEEYILKGEALHREFIIKKMSRQNKLNLIKNCQQL"
FT   gene            complement(197885..198499)
FT                   /locus_tag="CLJU_c01950"
FT   CDS_pept        complement(197885..198499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01950"
FT                   /product="predicted 3-methyladenine DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01950"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13285"
FT                   /db_xref="GOA:D8GKV2"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKV2"
FT                   /protein_id="ADK13285.1"
FT                   /translation="MSNKLDRDFYGRDTLSVAKSLLGKVLVHEINGKKLSGKIVETEAY
FT                   KGIIDKAAHAYGNRRTKRTEALYGPCGFSYVFIIYGMYYCFNVVTEREGIPEGVLIRAL
FT                   EPLTCLEDMSLNRYAKEYSLLNKRQIENLTNGPGKLCKALLIDKSQNRKDLCKSDLYIE
FT                   GNNIENISIKSSKRIGVDYAEEAADYLWRFYIKDNAYVSVK"
FT   gene            198613..199890
FT                   /locus_tag="CLJU_c01960"
FT   CDS_pept        198613..199890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01960"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13286"
FT                   /db_xref="GOA:D8GKV3"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKV3"
FT                   /protein_id="ADK13286.1"
FT                   /translation="MKILYYDCFSGISGDMNLGALIDAGVDKDYLTFELAKLNIDGYEI
FT                   NIKKDIKNGISGTKVDVVLKNNSVCAHHHRNLEYIENMISSSSLSSRVREISKGIFKKV
FT                   AQAEAKVHSKPINEVHFHEVGAVDSIVDIVGAAICFDYLDVDKVEASKVEVGSGFVKCA
FT                   HGILPVPAPATAEILKNVPIESKVNFEATTPTGAAILSYLCSNFTSDKNFKVTKIGYGI
FT                   GSKDNDDIPNVLRVFIGEPISYEKNNHKNCYWNKDEKTEYILNRRNMDKSSFKDEVGCI
FT                   KEEAQVIECNIDDMNPEKYQYIIDKLLQIGALDAYLTPIIMKKGRPAVKLSALYKDEAE
FT                   EEIRDIILTETTTLGFRKYKVERNMLYRDFTKVVTKYGQVNVKNAYYKGKKIKSKIEYE
FT                   DCKKLALKNKISIDEIYREVMSKTFK"
FT   gene            200222..201604
FT                   /locus_tag="CLJU_c01970"
FT   CDS_pept        200222..201604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01970"
FT                   /product="putative Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01970"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13287"
FT                   /db_xref="GOA:D8GKV4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKV4"
FT                   /protein_id="ADK13287.1"
FT                   /translation="MKVTGILEKATKNALAKAGVELLNRDPEESLDKLFALIKKTVKKD
FT                   EENLARVERVQELYETNQAIHKLVIGIIKNSNKKCMDKLFTNFFSNAVWYGMPKREQFF
FT                   QDTGIKTPFTILMSPSMRCNLRCIGCYASSYSKEDDIPKEEVDRIIGEARKLGIYYFII
FT                   LGGEPFINDYMLDIYKKYNDCIFTPFSNGTLFDEKLADKIKQLGNVIPMFSVEGFEEET
FT                   DKRRGKGIFKKVMHAMDLLKERGVLFGVSTATSRYNIDTVTSSEFIDMLVEKGAKMGWY
FT                   FLFMPVGKEPDVNVMLTPEQRIRLGEKIREIRNTKPYFTIDFFNDAPYVGGCIAGKYYC
FT                   HINSKEEVEPCIFAHFAVDNLKGKKLVDVFKSDFFKELRNRQPYNKNLLLPCMMIDNTN
FT                   EIREIAKKTGAKPTDEGARMMLEDLEFQKQLDKLSKEYKPYAEKAWKKDFNSEGNYKMS
FT                   KG"
FT   gene            201744..203009
FT                   /locus_tag="CLJU_c01980"
FT   CDS_pept        201744..203009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01980"
FT                   /product="predicted solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01980"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13288"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKV5"
FT                   /protein_id="ADK13288.1"
FT                   /translation="MKRYIRITLLLIMLVTLCLMVVSCNKKQDSENNERVLKGNIKIVT
FT                   DVEHGPQFELAAEAFEKLHKKVNINVITVKDTDNNVEAIFNGPQYEADITTINDSSIKH
FT                   IIIKNPEKFLDMTDSVKGYKDELLTNKIYNDTIKGKIYALPWDTYPKALLYRKDIFDKE
FT                   GIDVNTIKSWSDYIEAGRKISKDTGKIFIANSSEDNNDIYLLLSNQLGTSYFNQSGKSD
FT                   FKSQKWARVIEISKILYGEGLIQEISSKDEVINKAQLSKIVSFIADPTYAVTLMNKFPQ
FT                   SKGKWGVMKLPAFEDGGNRDVSLGGINLVINKNTSESNLSEEFVKFALTDGKLQMDLLN
FT                   KYGRFPVSTDAYNFVDLNKNITYFDSTIWNLFGSVEQGSFSINYTKNFPDIREKIRGVL
FT                   NQTNIKSENYKSIIEGLEAILK"
FT   gene            complement(203158..204276)
FT                   /locus_tag="CLJU_c01990"
FT   CDS_pept        complement(203158..204276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c01990"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c01990"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13289"
FT                   /db_xref="GOA:D8GKV6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKV6"
FT                   /protein_id="ADK13289.1"
FT                   /translation="MKIAIDGRGINWYKGTGIGTYTAKILKYMLKKHTENFYNIYWSGS
FT                   NYEKFLYKNTKILMSSKKHHRFFEEYYFPENLKKEAIDIYHIPQNGIGISKNITCKKVV
FT                   TIHDLIPYILPETVGKGYLSKFLKELPNIVELADGIITVSNCSKKDILKFFPIDESKIF
FT                   VTPLAADKKYKPLEKDKCQYNIKDKYNIKNSFILYIGGFSSRKNVSSLITAFSKIHKNL
FT                   DKNYDLVIIGSSKDELCKLRNLSTDLNIDNNIKFTGFVEENMLPIFYNACDVFIYPSLY
FT                   EGFGLPPLEAMSCGTPVITSRISSIPEIVEDGGILIDPFDLKSLMYSMEALLNDENIRN
FT                   ELSAKALKQSSKYSWEKSSEKTIEVYKKILDM"
FT   gene            204464..205471
FT                   /locus_tag="CLJU_c02000"
FT   CDS_pept        204464..205471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02000"
FT                   /product="predicted spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02000"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13290"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014255"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKV7"
FT                   /protein_id="ADK13290.1"
FT                   /translation="MDILEVKKYVEDAYDLHIEFIEKVKSIYKVHTKYNKYCLKVINYD
FT                   FGHFLFIISAIKHLQNKSFKSIPEIIKTKQGKDYVEIEGGHAYLCRWVDSRQCNFENPL
FT                   DVLVATSKLAELHKKSCNFKVLKNMNPRIGWFKWIDTFKTRESEILDFKKRILKKDHKE
FT                   EFDILYLNSMEKEISIAEKSIKDLKKTRYLDEMKQEILNNGFCHHDYANHNILIDTEGE
FT                   INIIDFDYCILDTHLHDLASLLIRRMKNGKWNMNNASFIVDAYSTINVVKTEHIPIMSA
FT                   FMEFPQGYWQLGIQYYWEKQPWGEEAFIKKLKRILGDTRERLEFIDEFKKSKYN"
FT   gene            205495..205704
FT                   /locus_tag="CLJU_c02010"
FT   CDS_pept        205495..205704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKV8"
FT                   /protein_id="ADK13291.1"
FT                   /translation="MSHKKSHKKSHNKNIDEFENKDLGYYESKVDSLKKTVKQLEKMNK
FT                   RKKEVMKLEKKRKKMLKEMKKMHR"
FT   gene            205742..206509
FT                   /locus_tag="CLJU_c02020"
FT   CDS_pept        205742..206509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02020"
FT                   /product="putative spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13292"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKV9"
FT                   /protein_id="ADK13292.1"
FT                   /translation="MYFEDVESCFVNYLESKKIFKVKEFDNTIKYKDISIDNIKEQMFI
FT                   ISEFHRRTLKYSGIMNKRLYNNIGKEVEQYRVYTKKLKKYLDRVEKLQNKTIFQEKLNQ
FT                   IGKKYLIRAESCMDNLDKNSYTDLIIRSMKRVEMCLRNTYFNNLRKKRDIEVIDIQGCC
FT                   YNMVEMDAVYFLNRIKRKGINADFYEIIMEFCKYEHLKSSSVQFILSMISYPNEVMKCC
FT                   SKYIYGTKNWTEEEYVLKLNKAMNEDGESLIKF"
FT   gene            206530..207552
FT                   /locus_tag="CLJU_c02030"
FT   CDS_pept        206530..207552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02030"
FT                   /product="predicted spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13293"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014255"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKW0"
FT                   /protein_id="ADK13293.1"
FT                   /translation="MVDRYGEKKYLTKYDLCTKLFDRFDLKVYDVVPVRSVYMISTDKG
FT                   EKILKKVDYTLDELKFIYNVLNYVRTKFPRIINFVKNKAGEIYTIWDGDMYCIMDTVNG
FT                   TECNFSNPIELNIAAEGLGEFHLASEGFKTGIYNKSNNGKLIDSFKRRIQEMEFFKNIA
FT                   NIHEKKTEFDEIFIKNWSYYIEEIEKSIILLQQSHYYKLCSEEDKVVVCHHDLAYHNIL
FT                   INENQAYFIDFDYAIIDLKVHDLCNFINKVIKNFAFDIDKTNSIINSYCNKNNLSRREL
FT                   EVLYAMLDFPNDFYTIARDYYSKRKEWEEEVFLDRLKRKTRYKEDRKEFLQEFRDKILN
FT                   "
FT   gene            complement(207659..208783)
FT                   /locus_tag="CLJU_c02040"
FT   CDS_pept        complement(207659..208783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02040"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13294"
FT                   /db_xref="GOA:D8GKW1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKW1"
FT                   /protein_id="ADK13294.1"
FT                   /translation="MKIGIDGRAAKWYRGTGIGTYTYQLLNCLNNIDNINNYLLFMPEG
FT                   FRDNINFKKNFRLDTLPQDNNHNFWQEVNVPNTIKDTNIQLYHVPQNGVGLPIHKNCKF
FT                   VITLHDVIPYRMPSTVSDRYLKVFSDYIPKAIPQCDGIITVSNFSKKDIMKAFDFPEDK
FT                   IYVTPLASEEIYKPLDKRISKYVAKRYYSITGDYILYVGGFSPRKNILGLIESFSKLVS
FT                   SYKSPLNLVIAGNKGISYSIYKNRAEELNISDKVIFPGFISMDHLPYIYNGAELFVYPS
FT                   FYEGFGLPPIEAMACGIPVIVSNTTSLPEVVENGALLVDPTDQTNLYESMLTVLSDNNL
FT                   RTKLISSGMKRASELSWGKTTQNTLDAYNKILRK"
FT   gene            208897..209898
FT                   /gene="cotS1"
FT                   /locus_tag="CLJU_c02050"
FT   CDS_pept        208897..209898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cotS1"
FT                   /locus_tag="CLJU_c02050"
FT                   /product="predicted spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13295"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014255"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKW2"
FT                   /protein_id="ADK13295.1"
FT                   /translation="MMREFEIERQFDVKIENIKPSKGVYLLKTDKGMKCLKKVNYGTQK
FT                   LLFVYGAKEHLIKNGFPYVDKYCNNVDGNPYALVNEDIYTLSEWISGRECDFKNRDDVI
FT                   NASKCLASLHVASKGYEPPENSKLKTDLGRWHHLMEKRVKALDKMRDMGRKKSNKGDFD
FT                   LNYTKEVQFYKDFGRKAIEVLNDSKYDELCDITEKEEGFCHHDFTYHNIVIDNNNKVNV
FT                   IDFDYCKREVRAYDISSFMGKVLKRSDWDIANAELIINSYNEVSPIKEEEYRVIFAFLL
FT                   FPQRFWRLANRYYYNEVNWPLKTYNNKLQELISEQGKYIDFIEKFKKIYNQK"
FT   gene            210031..210900
FT                   /locus_tag="CLJU_c02060"
FT   CDS_pept        210031..210900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02060"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13296"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKW3"
FT                   /protein_id="ADK13296.1"
FT                   /translation="MKIGDVVVRKSYDRDITFKIIDVKEEAEGKLYILKGINLRIIADS
FT                   AEDDLEPVSEDSLTESEKIFSRQVNRSIKDILASRGGFRQEYNITKFLSHKSGKELTFG
FT                   RPGKILHIDGDSEYLDVCLKVYKQLLLDVVGKNIPEKDQPGQVVELAREIKPDIVVITG
FT                   HDAIVKGTKDYTDLNNYKNSKYFVKTVSELRNYKSNYDDLVIFAGACQSCYEKILDSGA
FT                   NFASSPSRVLIHCLDPVFLCEKIAYTNIEKVVSIQEALENTITRTNGIGGLQTRGKYRE
FT                   GFPKSLYV"
FT   gene            211106..211345
FT                   /locus_tag="CLJU_c02070"
FT   CDS_pept        211106..211345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13297"
FT                   /db_xref="GOA:D8GKW4"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKW4"
FT                   /protein_id="ADK13297.1"
FT                   /translation="MIEGSNVLASIRKNIENHVGDKVTLKANGGRRKVFVNKGTIEKAY
FT                   PSIFVIRLESDTQRKVTYSYSDVLTKTVQLVFPV"
FT   gene            211740..213293
FT                   /locus_tag="CLJU_c02080"
FT   CDS_pept        211740..213293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13298"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKW5"
FT                   /protein_id="ADK13298.1"
FT                   /translation="MSIDFIKENIECEQLLAEDFSDTVIKAEYVIPDTNPDVKEILILN
FT                   AKPSITNKEVMQDKVFVEGKIEYTLLYLAEESENMGIYSVNYTGTFSNYVEVPGTEHMM
FT                   LCDSDCYVEHMNCTIANERKIAIEGIIKLKAEVYKKYEFEVIKDVTGSEDIQMLKNPAT
FT                   VDKIVGTVSGDLVAKTEIQISVDKPQIGSVLEYNINVHKKDIKVLEDRISVEAYVLIRM
FT                   LYRGKDTRDIVCIEKDVFVNKELPMQGVNPSMESHTDFNIDEVEHTMREDDLGENRIVE
FT                   LEVLVKSNTKVMYKEDMDIIEDAYSPSSLMQMEKEDYELNVMHGQNTTQSMVKSNIEIN
FT                   EGIKPTEVIMCYGDVCITDKKIVEDKVIVEGVLNAKILYKDSENQIRRSKEEIPFNCSV
FT                   DIPESKIDMQCIAKVSLESIEGEIEVDTIAIKAVIEVYARVNYITHKEFLVNIDTLEGE
FT                   FPDKKSSLTIYVVQQGDTLWKIAKKYYTTVENLVKLNSIEDPDVIKAGEKLIIPGRAVI
FT                   "
FT   gene            213692..214498
FT                   /gene="cphB"
FT                   /locus_tag="CLJU_c02090"
FT   CDS_pept        213692..214498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cphB"
FT                   /locus_tag="CLJU_c02090"
FT                   /product="cyanophycinase"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13299"
FT                   /db_xref="GOA:D8GKW6"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR011811"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKW6"
FT                   /protein_id="ADK13299.1"
FT                   /translation="MKEKVEEKLIIIGGAEDKKGDKKILKEVCGILEKSKDILVIATIA
FT                   SEIPEELGYEYQKIFEELGIKNIRILNIKDRKDAFNISNITVIEDASMIFFTGGDQLRI
FT                   TSLIGGTPLYSKIQELYKNGCTFVGTSAGASVMSDTMIVTGPDEESPKKCTLKMAPGLG
FT                   FIKGVIIDQHFAQRGRIGRLLVGIAENPQSLGIGIDEDTAIIVKENGEFTVVGSGAVYV
FT                   IDGSNITYSNVSEQHPDEVLSMFDVKLHVLKCGDNFNLLNKSAYNI"
FT   gene            214808..217432
FT                   /gene="cphA"
FT                   /locus_tag="CLJU_c02100"
FT   CDS_pept        214808..217432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cphA"
FT                   /locus_tag="CLJU_c02100"
FT                   /product="cyanophycin synthetase"
FT                   /EC_number="6.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13300"
FT                   /db_xref="GOA:D8GKW7"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKW7"
FT                   /protein_id="ADK13300.1"
FT                   /translation="MRIDNFRIFQGRNIFAHKKCIKMSVDLEGYSEIPTKDISGFNHKL
FT                   LKIIPELNEHRCGIDEEHGFRKRLEEGTYLAHVCEHIILSIENNLGVDACYGKAREISG
FT                   DKYYIIYEYLYKNTGVAAGKIAVNLINSLIKGTYYNFNEAIENLKKVLKREEIGSSTLA
FT                   VISEAKKRGIPVTRIGDNSIFQLGYGKHSKIIEATISYNTKAVAVDISCDKILTKEILK
FT                   NQCLPVAEGGIVRSPLELLIEAKEIGYPIVLKPCYGNQGKGVFINIKSEKEAINAYHIL
FT                   SKKYDNIMIEKNITGKDFRICVINGKVIAVSEKIPPYVVGDGVSTVVELIKNVNKDTAR
FT                   GDGHEKPLTTIKIDEELRSCVSKHSYKLDSILPKGKKLIIRENGNLSTGGKAVDCTDII
FT                   CQDNINICERAAKAIGLDVCGIDICCEDIGKPIDKSGGAILEVNAAPGIRMHHYPSQGK
FT                   SRNVASAIVDMMFDKYKPIPVVSVTGTNGKTTTTRLIAHILEKSGYNVGMTTTGGIYVN
FT                   NKCICKGDTTGYYSAKTILANRDVEAAVLETARGGIIKRGLAYDLADVAVITNITEDHL
FT                   GIDGIHTMKDLAYVKSLVGEAVKKDGYVVLNADDLVSISIINRIKSTIIMFSKNKDNPV
FT                   LRKNINSGGYGVYIKDNIMYVEKTEKIVPIAKVEDIRISLDGKLTYNVENAMAACAAAV
FT                   GLNIDYSIIRKGFKTFYGDFSFNPGRFNMYDLNGIKVVLDYGHNIEGYKAVIRGAKNLK
FT                   YNRLVGVIGVPGDRTDESVEKIGSIVGKNFDYVYIKEDKDRRGREIGAIAKILKVGVTK
FT                   SGFDMNKVEVILDEKEALEKAIDTAKQGDLIIIFFEEIDPLIKLLNQKLNKEKSNLNSL
FT                   AMI"
FT   gene            217537..218379
FT                   /gene="ispE"
FT                   /locus_tag="CLJU_c02110"
FT   CDS_pept        217537..218379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="CLJU_c02110"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13301"
FT                   /db_xref="GOA:D8GKW8"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKW8"
FT                   /protein_id="ADK13301.1"
FT                   /translation="MLVKAYAKINLSLDVVGKRKDGYHLLKMIMQNIDLYDVLKIDEIK
FT                   TGIQICSNNRYIPCDRRNLVYRAAKLFIDKYNIKNGISINIGKNIPVSAGLAGGSADAA
FT                   AILKTMRNIYTPEVSDKELSELGLNIGADVPYCIIGGTALCEGIGEKVTPLMPFRNHIL
FT                   ILIKPPFGVSTAEVYKSLDISKIKRHPNTEILIDAVNESKLEMLSKNMKNVLENVTLKK
FT                   YPVLRKIKTDLIDFGAVGSLMSGSGPSIFAFFDDMLKAQKCYDNMKTRYREVFITRTI"
FT   gene            218771..218965
FT                   /locus_tag="CLJU_c02120"
FT   CDS_pept        218771..218965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13302"
FT                   /db_xref="GOA:D8GKW9"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKW9"
FT                   /protein_id="ADK13302.1"
FT                   /translation="MRIVHLFDKYFFILMVIEGIILTFIESKKFKRNRLVKTAFKSRVI
FT                   GVILIVLSVVLYAFSIYSF"
FT   gene            218979..220436
FT                   /gene="gerA1"
FT                   /locus_tag="CLJU_c02130"
FT   CDS_pept        218979..220436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerA1"
FT                   /locus_tag="CLJU_c02130"
FT                   /product="predicted spore germination protein GerA"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13303"
FT                   /db_xref="GOA:D8GKX0"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKX0"
FT                   /protein_id="ADK13303.1"
FT                   /translation="MKEEIRSTVSSSVDENIKYLKDLFKDDSDVVFREFYIGSVKSAIV
FT                   YIDGMGDKMLLNDLLRGLMARSRYVKYVDNIKDRMMSVSDMKDLDDLKKGVDLVLSGDT
FT                   LMFLEGMKSFYIISTRLWPARGVTEPSGETVLRGSRDGFTETIRFNTALVRRRVRDTRF
FT                   KIVPKPLGVRSKTDVVIMYIDDIVNTKALKELEKRLDNIKIDAILDSGYVEQLIEDNKW
FT                   SLFPQVQSTEKPDVVAAALYEGRIAVLVDNSPFAIIVPATMPNLFQSPDDYYQRWIYGS
FT                   TIRIIRFMSIILSLILPALYVAVTSFHTGIIPTKLAYFIAASREGVPFPAFVEAIIMEV
FT                   SLALLLESIARLPKAIGATTGIVGGLIIGQAAVQAGIVSPIMIIIVAITAITSFTTPNY
FT                   EMTAAFRLIRFLLIIASAIAGLYGIMIGLILTLIHLVKLKSFGIPYLSPMVNENINDFK
FT                   DMYLRLPFSFFKRRPGYMKTQDKIRQR"
FT   gene            220511..222769
FT                   /gene="gerAB/AC"
FT                   /locus_tag="CLJU_c02140"
FT   CDS_pept        220511..222769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gerAB/AC"
FT                   /locus_tag="CLJU_c02140"
FT                   /product="predicted spore germination protein GerAB/AC"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13304"
FT                   /db_xref="GOA:D8GKX1"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKX1"
FT                   /protein_id="ADK13304.1"
FT                   /translation="MTQKNFITEFGMFSTIVITMIGVGSFSYPEEVVNYLGSNGWIGTI
FT                   VEGILVYFLIYIAYKVIKLNGYNKLCTILQNSFGKIFGSILALIFVAYNIFFISMGMRI
FT                   FIEVIKMYLLEKTPSEFLIIVMIFTGIYLIRNELGDLIKFNEISFWIMFVSIGLIFLFT
FT                   LNKTHFNNSIPNFINSDVYDYLKAFKNTIYSFIGIEIIYLVGPFAKNKGSIRKIALKSI
FT                   LFVTLFYVVTVILSLAIFSEEQTKTLLWPTITMIKSVDIRGAFIERWEGIAMAVWIMFY
FT                   FCNFSNVYYLSSDIVKDVFRLGDIKISSALIAPFIYLTAMYPENIAELYHIINTVMPVA
FT                   AAYSLILLPLIIFLFSKPKRNLNASKFICIFLVCTVLTGCWDKVEIERTQLVSVIGVDA
FT                   GEDIGKVKELKNVKSTDLLTSVNLKKIHVTFGTPDLSKLEPGKGGISGDKYVDVDGYSM
FT                   EDAVNTAMSKSSRTVKFSQTKLLVLGKGLMEYPDVVKEVIDYLQREPSLNRNMYIVLAS
FT                   GSSDKYIKIKTPMGKSTEDYILGLVEGDAKDNEVKTVTLNDFLVSMSENGNSIIPKVEM
FT                   DKDKKNIKIAGTAAIKNFKYEGDLNQVQTSNIQLLQGKLKNGKRMIYLEGHPVDIRIND
FT                   SNRRIKVSQEKGNLVFNIKLNIEGEIKNYYTNGKVLSVDKLSYIEQSFNKAISQECKDA
FT                   IKVTQRDLKIDPIGFKDYIKRYHPLMWRQVKDKWEDSYKDAVVNVNVDTKIRRIGVVK"
FT   gene            222854..223498
FT                   /gene="spoIIR"
FT                   /locus_tag="CLJU_c02150"
FT   CDS_pept        222854..223498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoIIR"
FT                   /locus_tag="CLJU_c02150"
FT                   /product="predicted stage II sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13305"
FT                   /db_xref="InterPro:IPR014202"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKX2"
FT                   /protein_id="ADK13305.1"
FT                   /translation="MKKFLLVFSICVLSIFTVCSYLCKVKSDNIQDDMASRIIRFHVIA
FT                   NSDSKSDQALKLKVRDEILKYIQPKLKDCKNIDESRKVLMENDKDVLKVARRVISEQGY
FT                   NYEVKSTLSKVNFPIKTYGNITLPQGRYEAYRVIIGKGRGQNWWCVMFPPLCFVDITKG
FT                   QVSYKKTEQEMKKVLTPEEYKMVNNNKFDISDKNNIKVRFKIIEVLNKLGI"
FT   gene            complement(223615..224853)
FT                   /gene="murG1"
FT                   /locus_tag="CLJU_c02160"
FT   CDS_pept        complement(223615..224853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murG1"
FT                   /locus_tag="CLJU_c02160"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase"
FT                   /EC_number="2.4.1.227"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13306"
FT                   /db_xref="GOA:D8GKX3"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKX3"
FT                   /protein_id="ADK13306.1"
FT                   /translation="MKVLILSISAGGGHGNAAEAIKSYIALKAPKSEVKIIDTIKYINP
FT                   IIDKVVIGSYLKSLKVSPYLYGKLYTYSEDDYTITNTISSKLIEAMTCKLIPLIREFKP
FT                   NILIATHSFSTEMLSVLKSKYSMNIPCMSIITDYYSHSSWLHPYIDAYVVSNEDMISKM
FT                   IFKGISKDTIYNLGIPVKPDFNMNYDRGDTLESLDLCESKFTVLVMGGSLGLGKIVDIY
FT                   KQLANINEDIQIIIITGKNKKLYAELSKIKDSSSKETRIIGFTDHVNKYMQACDLLLTK
FT                   PGGLTITEALICKIPLGIFSPIPGQEEKNAQFLLRHNLAVNLTDIEKCGENIEKLLHSK
FT                   DALKSMVENCSKFSKPYAGNDIFNLINWLVQNKSNKSSFTEEDKIYEKNSPKTFFKSAE
FT                   KYFLKTALKLFEL"
FT   gene            225350..226720
FT                   /gene="ypeB"
FT                   /locus_tag="CLJU_c02170"
FT   CDS_pept        225350..226720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ypeB"
FT                   /locus_tag="CLJU_c02170"
FT                   /product="predicted sporulation protein YpeB"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13307"
FT                   /db_xref="GOA:D8GKX4"
FT                   /db_xref="InterPro:IPR014239"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKX4"
FT                   /protein_id="ADK13307.1"
FT                   /translation="MKFSKKRIMYTAIVTLIVVFSSTFAVLMTLERNDYRNYLQGEYGK
FT                   SMYELIDAVQNIRTNLTKAAIVGSREQQIVVFDEIFRYSAIASDKLHSLPVSQSTISDT
FT                   SKFLTQVGDFCYSLGRSSTEGKQLSEKDYNDIERLKKQSNVLENQLELVSNNINQGKVK
FT                   WGEIRKKITGVFAQSNDVSISEQFKGIQKQVLQYPTLIYDGPFSDNTLQINPKIKLQKE
FT                   VSQGEAEKTARQVIGKDKIENMDVSSVNEKSNIGVYRFSAALKGRTKKDSRVVCEISKN
FT                   GGKVYYLINDKSINNSSMDVKKASEIGLKYLNNLGYKNMITTYSLRYNNVAVINYVYSQ
FT                   NGILVYPDQIKLKIALDNGEIIGVEAEKYLISHEENRKIETPKLSYGEAEKRVSKRLNV
FT                   TSKRLTIIPTETNKEILCYEFSGNYKGDYFKVYVNTSTGYEERIIQIIDTPNGKLAM"
FT   gene            226947..227363
FT                   /locus_tag="CLJU_c02180"
FT   CDS_pept        226947..227363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13308"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKX5"
FT                   /protein_id="ADK13308.1"
FT                   /translation="MKKKAIIYVSSKQTDEEEPIEVVTPGSFYKKNDSYYAVYKETELS
FT                   GMEGTTTTLKIKQDKFSLIRMGSTSTKMDFDKNKKNVSMYKTPYGTIELRIETNSLNIN
FT                   VDEQGGDIMINYKISTAGQALKNTKLKVNIKVNE"
FT   gene            227450..227755
FT                   /locus_tag="CLJU_c02190"
FT   CDS_pept        227450..227755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02190"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13309"
FT                   /db_xref="GOA:D8GKX6"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKX6"
FT                   /protein_id="ADK13309.1"
FT                   /translation="MKYFRNKEEVYTKIIKMLCEYKGFSRKDMFKILKNESCRYLFFLL
FT                   IKKYECCDMELLKKDFPSVNSKNVKRNIKRAEEKLLLDKKIREMYFEAEDIINKVK"
FT   gene            228016..229620
FT                   /gene="pyrG"
FT                   /locus_tag="CLJU_c02200"
FT   CDS_pept        228016..229620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="CLJU_c02200"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13310"
FT                   /db_xref="GOA:D8GKX7"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKX7"
FT                   /protein_id="ADK13310.1"
FT                   /translation="MNTKYIFVTGGVVSSLGKGITAASLGRLLKNRGLKVSIQKFDPYI
FT                   NVDPGTMSPYQHGEVFVTDDGAETDLDLGHYERFIDENLSKNNNVTTGKIYWSVISKER
FT                   KGEYLGSTVQVIPHITNEIKSRVYRVAKEQDIDVVITEIGGTVGDIESQPFLEAIRQIK
FT                   YDVGIENVCFIHVTLVPYLQKSGELKTKPTQHSVKELRGIGIQPDIIVCRSEASISNDL
FT                   KEKIALFCNVERDSVIQNLDAENLYEVPLMLHKEGLDELVCKKLKLECSEIDNSEWIKM
FT                   VDNIKKLSKDVNIALVGKYVELHDAYISVVEALNHGGYANDTNVNIKWINSEDVTSKNV
FT                   GEHLKDIDGVLIPGGFGDRGIEGKILAAGWARKNKIPFFGICLGMQCAVIEFARNVLGY
FT                   DGAHSSEIDPDTKYPVIDLMPDQKDIDEKGGTMRLGIYPCKLLKDSNCFKAYEEEVIYE
FT                   RHRHRYEFNNYYRKNLSQAGLVLSGTSPDSRLVEIVEIKDHPWFVGVQFHPELKSRPNR
FT                   PHPLFRDFIKASLNNKN"
FT   gene            229831..230175
FT                   /locus_tag="CLJU_c02210"
FT   CDS_pept        229831..230175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13311"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKX8"
FT                   /protein_id="ADK13311.1"
FT                   /translation="MVFETNISIAVISPEGKYCIKDFSLFDTNKINESFTSLKVSSINN
FT                   GVLSLKIKCGLCGSIHYYKYNINKVVKKNIIIGGCELLGFPIFCIGNRKSVEEKILRYT
FT                   RANKKIYAMI"
FT   gene            230357..231811
FT                   /locus_tag="CLJU_c02220"
FT   CDS_pept        230357..231811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02220"
FT                   /product="transcriptional termination factor rho"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13312"
FT                   /db_xref="GOA:D8GKX9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKX9"
FT                   /protein_id="ADK13312.1"
FT                   /translation="MDDKDIDNMTVLQLKQIAKTLEIKNISKYKKSQLIEEIKKVSPAH
FT                   IKKGGVILREKISPKDEVPNRHKEAEHTVRHSENKAQEDKNEEQKTNGNEKREKLKEMI
FT                   SESDSARGVLEIIENNNYGFLRGKNYLTGPDDIYVSPSQIRRFNLKTGDEVCGKVRIPK
FT                   EGEKFKALLYVEKVNGENPERAVGRKPFETLTPVYPNERIKLETNSADLSTRLMDIISP
FT                   IGKGQRGIIVAPPKAGKTTLLKKIAQSISKNHPGIQLIVVLIDERPEEVTDMQRSINGE
FT                   VIYSTFDEEPEHHTKVAYMVLERTKRMVEQGQDVVILLDSITRLSRAYNLTITPTGRTL
FT                   SGGLDPGALVMPKKFFGAARNIEEGGSLTILATALIETGSRMDDMIFEEFKGTGNMEIH
FT                   LDRKLQERRIFPAIDVYKSGTRRDDLLFKSQLEKEAAFNIRKVIYDENNTQNVTEQLIS
FT                   LLSKTRNNYEFMNIVSKMNMNKLGEK"
FT   gene            complement(231876..232088)
FT                   /gene="rpmE"
FT                   /locus_tag="CLJU_c02230"
FT   CDS_pept        complement(231876..232088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmE"
FT                   /locus_tag="CLJU_c02230"
FT                   /product="50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13313"
FT                   /db_xref="GOA:D8GKY0"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKY0"
FT                   /protein_id="ADK13313.1"
FT                   /translation="MKNGIHPEYYHDAVVKCACGNTFTTGSTQKELKVEICSKCHPFYT
FT                   GKQKAIDAGGRVDKFLKKFNLKIEE"
FT   gene            232261..233313
FT                   /locus_tag="CLJU_c02240"
FT   CDS_pept        232261..233313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02240"
FT                   /product="putative membrane protein, metal dependent"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13314"
FT                   /db_xref="GOA:D8GKY1"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKY1"
FT                   /protein_id="ADK13314.1"
FT                   /translation="MSRKTSVGGQAVIEGVMMRGSHGMATAVRKPDGEIVVNREDSISY
FT                   TKRNRFLGLPVIRGFVSLIEAMVMGISTLNYSASFFDDEEEPTKFDKCFRSIFKEKSDN
FT                   VLMGVTIFISLGIAVLLFFIFPTFAANIFKRFGVHGSVQLNMIEGIIRVIIFLGYIFLI
FT                   GNMSDISRIFQYHGAEHKTIFCYENEEELTPEKAKKFKRLHPRCGTNFLFLVMIVSIIL
FT                   FSLTGWGNILQRILYRVILLPLVSGVTYEIIRWMGRSNSYFSNVLAYPGLMLQKLTTRE
FT                   PDYSQLEVAIIALKYAEGIEKEIEESRYSESGEIKRVVELDNDGNEIVKNEHNEDCEEN
FT                   LMKAENSYEK"
FT   gene            233303..234166
FT                   /gene="hemK"
FT                   /locus_tag="CLJU_c02250"
FT   CDS_pept        233303..234166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="CLJU_c02250"
FT                   /product="predicted modification methylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13315"
FT                   /db_xref="GOA:D8GKY2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKY2"
FT                   /protein_id="ADK13315.1"
FT                   /translation="MKSRVSSIRELLKRGYEVLKNREIESYALDAQLLLGKVLNKDRLF
FT                   MLINGDYKVPEKETEEYYKYLKLREDKMPVKYILGHCEFMGIDFIVKPGVLIPRPDTET
FT                   LVEQALIQIKHNNFHNICDVCCGTGIIGISIAKLIEGMNVKCCDISSTACEVTAENIRR
FT                   FSLEEKVQVVKSNLMEYYIQNEVKFHMIVSNPPYIKESSIPTLMEDVKNYEPREALSGG
FT                   KDGLEFYRKITKESLRVLESNGIIMFEIGYDQRESVSDILAQNGFKNIMCIKDLAGKDR
FT                   VIKGVL"
FT   gene            234227..235300
FT                   /gene="prfA"
FT                   /locus_tag="CLJU_c02260"
FT   CDS_pept        234227..235300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="CLJU_c02260"
FT                   /product="peptide chain release factor 1 (RF-1)"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13316"
FT                   /db_xref="GOA:D8GKY3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKY3"
FT                   /protein_id="ADK13316.1"
FT                   /translation="MLERLNFIENKYEELSIKISDPQVMADQKEWQKLCKENAELEEIV
FT                   TKYREYKKAQQELEDNKEMLKEETDREMKEMEQEEIKRLTEVIEESENDLRVLLLPKDP
FT                   NDDKNVFVEIRAGAGGEEAALFAANLTRMYTRYAERQAWNIETMSINATDIGGFKEIVF
FT                   MVKGKGAYSRLKYESGTHRVQRVPDTESSGRIHTSTATVAVLPEVDDVDVVINPNDIRI
FT                   DVFRASGHGGQCVNTTDSAVRITHLPTGLVVSCQDEKSQLKNKEKGMKVLKSRLYERAE
FT                   KERSASIAEDRKSQVGTGDRSERIRTYNYPQGRVTDHRIGLTLYKLDSFLDGNIDEIID
FT                   ALITADQAEKMKEMGND"
FT   gene            235365..235991
FT                   /locus_tag="CLJU_c02270"
FT   CDS_pept        235365..235991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13317"
FT                   /db_xref="GOA:D8GKY4"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKY4"
FT                   /protein_id="ADK13317.1"
FT                   /translation="MNIDKAIRKQKKSYKIFMLSMCFIFCVMPTALILARKFNIFYIIY
FT                   LIVLEVLIFLAIVIRINNEFLKFNYDGYKLKLKIGIRRAKLSIICDKIVLVHVENYISK
FT                   YRDNSNFRIIILSTSKFRSDRMILVHKEFFKRHSYVAHQYNKMKILHPENTFYYTIIKR
FT                   GELNKYPLLDTIYKSCVYAHFTEETIERIKYYRENSENYIDNKKK"
FT   gene            236060..236782
FT                   /locus_tag="CLJU_c02280"
FT   CDS_pept        236060..236782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02280"
FT                   /product="predicted zinc transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13318"
FT                   /db_xref="GOA:D8GKY5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKY5"
FT                   /protein_id="ADK13318.1"
FT                   /translation="MNANITCIVIIGSIVSLVGTMIGASLGVIVREPSNKLLGAIIGFA
FT                   GGIMLSVVVFDLIPESMNKWNFVFTIIFVVLGAGLIAIIDSKVDIGSTNKHLKIAFMAS
FT                   LGLMIHNFPEGIIMGCGFAAGGTLGIKMSLIIAIHDIPEGIAVSAPLMASKVKISRILL
FT                   YAFITAFPTAIGTFAGVYIANISKNVLGACLSAASGIMLYVVCGEMIPESSKLWDGITS
FT                   TLGTLCGIVLGLVIVQAF"
FT   gene            236895..237947
FT                   /locus_tag="CLJU_c02290"
FT   CDS_pept        236895..237947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02290"
FT                   /product="putative translation factor"
FT                   /note="Sua5-like"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13319"
FT                   /db_xref="GOA:D8GKY6"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKY6"
FT                   /protein_id="ADK13319.1"
FT                   /translation="MNTKVKIVDKENLDMGIVEEAGKVIKEGGLVAFPTETVYGLGANA
FT                   LNPDAVKKIFEAKGRPQDNPLIVHISDIEDIKELVVDVPKIAKKLMKKFWPGPMTIILP
FT                   KSQVIPDITSASLPSIGIRMPSNIIARELIRTSKVPIAAPSANISGRPSPTDVERCIED
FT                   LNGKVDFILGGDMCEVGVESTIIDCTVNPACVLRPGGITLEALKEIDDSIYIDPAVMKK
FT                   PDKNLRPKAPGMKYRHYAPKAPLKIVKGDLKKTIEKINEMVQNYIGENKVVGILATDET
FT                   KDFYKNGLVISLGSRNNMISISKNLFETLRSFDDKNVDIIIAEAFDENGIGTAVMNRLN
FT                   KSAGFDIIMV"
FT   gene            238000..238458
FT                   /locus_tag="CLJU_c02300"
FT   CDS_pept        238000..238458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02300"
FT                   /product="protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13320"
FT                   /db_xref="GOA:D8GKY7"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKY7"
FT                   /protein_id="ADK13320.1"
FT                   /translation="MKNILFVCTGNTCRSCMAEAIFNYLCDIEHIKAISAGVAVVEDSV
FT                   TSKNSAAVVKQNINIDISSRKAVQINEDMIRKSMLVLTMTGYIRDIIKKNFPEFKNKVY
FT                   TLNEFVSLEQDITDPFGKDIEEYRYTYKQLKNGILLLINKLKGDRDIN"
FT   gene            238560..239009
FT                   /locus_tag="CLJU_c02310"
FT   CDS_pept        238560..239009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02310"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13321"
FT                   /db_xref="GOA:D8GKY8"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKY8"
FT                   /protein_id="ADK13321.1"
FT                   /translation="MKVALGSDHAGFPLKKEVMEHLQDKNIEFKDFGTFSESSCDYPDY
FT                   ALKVGEEVASKNYDFGILICGTGIGISIAANKVPGVRAALCSDTFSAHACREHNNANIL
FT                   TMGQRVVGIGLAIDIVDTFLSAKFQGDRHQRRIDKITEIEKKYSK"
FT   gene            239136..239765
FT                   /gene="upp"
FT                   /locus_tag="CLJU_c02320"
FT   CDS_pept        239136..239765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="CLJU_c02320"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13322"
FT                   /db_xref="GOA:D8GKY9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKY9"
FT                   /protein_id="ADK13322.1"
FT                   /translation="MSKVTQITHPLILHKLALIRDKHTGSKDFRELVEEVAMLMAYEVT
FT                   RNLQTEDVEIETPICKTTCKMLSGKKVAIIPILRAGLGMVGGMIKLIPAAKVGHIGLYR
FT                   DEATLKPVEYFCKLPQDIGEREVIVTDPMLATGGSASDAITILKKKGAKNIRLMCLIAA
FT                   PEGIKTVTETHPDVDVYIASIDEKLNENGYIVPGLGDAGDRLYGTK"
FT   gene            239910..240320
FT                   /locus_tag="CLJU_c02330"
FT   CDS_pept        239910..240320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02330"
FT                   /product="cytidine deaminase"
FT                   /EC_number="3.5.4.12"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13323"
FT                   /db_xref="GOA:D8GKZ0"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKZ0"
FT                   /protein_id="ADK13323.1"
FT                   /translation="MRKDWDNYFIDIAFKVAERSTCPRLHVGAVLVKNRRIKGTGYNGS
FT                   PRGLEHCEDVGCYMKNNHCVRTIHAEVNCLLEVAPDDRESSTLYVTHMPCPECQKLIIT
FT                   CGIKRVVYCEEYTPEINWFEKTSGIELICIKR"
FT   gene            240370..241398
FT                   /locus_tag="CLJU_c02340"
FT   CDS_pept        240370..241398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02340"
FT                   /product="putative undecaprenyl-phosphate
FT                   alpha-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13324"
FT                   /db_xref="GOA:D8GKZ1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKZ1"
FT                   /protein_id="ADK13324.1"
FT                   /translation="MNNLYLFAIVSIMFSVILTPFIKKLAVKLDIMDVPKDNRRIHNKP
FT                   IPLIGGLAIYFSFIITLFLKTGKLTESETGLILGATIIVIGGLLDDKFDIKPWCKLLFQ
FT                   LAAAGVLIIYGIKIEIITNPFDGAYQFINIGVISIPLTIIWVIGITNALNLIDGLDGLA
FT                   AGIAFISSITIFIIALLNNRYEAAVLTSILSGAILGFLPYNFNPASIFMGDTGAQLLGF
FT                   LLAAISMEGAIKSAAAFSVAVPILALGIPIYDTLFAMIRRKINGRPIMQADRGHLHHRL
FT                   LDMGLTQKQVVMIMYSISAVLGSISIIAMEINAQRSYFLLIIVMVILVLMAWKAGFFKH
FT                   RE"
FT   gene            241416..242570
FT                   /gene="epsC"
FT                   /locus_tag="CLJU_c02350"
FT   CDS_pept        241416..242570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epsC"
FT                   /locus_tag="CLJU_c02350"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /EC_number="5.1.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13325"
FT                   /db_xref="GOA:D8GKZ2"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKZ2"
FT                   /protein_id="ADK13325.1"
FT                   /translation="MNKIKCVTIFGTRPEAIKMAPLVKELEKRKEIDNKICVTAQHREM
FT                   LDQVLQLFNIVPDFDLNIMKTKQTLTGITNRVLQGLEEIFEDEKPDLVLVHGDTTTTFA
FT                   GALAAFYKKIKVGHVEAGLRTYDKYFPFPEEMNRKLTGAIADLHFAPTTGSKSNLLKEG
FT                   VSENQIFVTGNTVIDAMRFTVEKDYKFSNDELNTINYDNKKVIMVTAHRRENWGKGIEN
FT                   ICNALKRIIDENKDTEIVYLVHLNPVVKDMVYKILGNVSRVHLLPPLDTKETHNLMNKC
FT                   FMVMTDSGGLQEEAPHLGKPVLVLRNVTERPEAVEAGTVRLVGTDEEKIIKLANELIRN
FT                   PKEYDVMSKAINPYGDGKAAYRITEAILQYFDLAKGTYSEFKSN"
FT   gene            242961..243326
FT                   /gene="atpI"
FT                   /locus_tag="CLJU_c02360"
FT   CDS_pept        242961..243326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="CLJU_c02360"
FT                   /product="F1Fo ATPase, subunit I"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13326"
FT                   /db_xref="GOA:D8GKZ3"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKZ3"
FT                   /protein_id="ADK13326.1"
FT                   /translation="MMNKHILDMVKKVSVINLLFGMILACLVQLFFKSYGLFILLGVSI
FT                   AIFNFFINTIVGALISERFRNSSASLYIISFIIRVVMAAGIGYWVFICSKYNVVAYLIG
FT                   YTSHLLGIYIYSLIENN"
FT   gene            243373..244038
FT                   /gene="atpB"
FT                   /locus_tag="CLJU_c02370"
FT   CDS_pept        243373..244038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="CLJU_c02370"
FT                   /product="F1Fo ATPase, subunit A"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13327"
FT                   /db_xref="GOA:D8GKZ4"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKZ4"
FT                   /protein_id="ADK13327.1"
FT                   /translation="MFLIHLGAFQIPITSSVIVQWAIIIILAILAKFFTSSMKKIPDKK
FT                   QSVIEIIVEAVRNLVTENMGKEYVSFIPYVGTLAIYILVMNIAPVMIGVRAPTEDLSVA
FT                   VGLALITFVLVQFNSIKKNGLVRYFGAYTKPVVPLLPINIIERLVLPVSLSLRLFGNLT
FT                   AGAVIIGMVYKGLGSMAWFSQLLIPIPLHAFFDLFDGSIQMIVFVMLTIMNIKVIAED"
FT   gene            244081..244326
FT                   /gene="atpE"
FT                   /locus_tag="CLJU_c02380"
FT   CDS_pept        244081..244326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="CLJU_c02380"
FT                   /product="F1F0 ATPase, subunit C"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13328"
FT                   /db_xref="GOA:D8GKZ5"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKZ5"
FT                   /protein_id="ADK13328.1"
FT                   /translation="MNLDAHSFISGMAAIGAGLAAIGCLGGGIGVGNAAGKAVEGVSRQ
FT                   PEASGKILSTFFVSAALSEVTAIYSLLIALILVFKV"
FT   gene            244385..244864
FT                   /gene="atpF"
FT                   /locus_tag="CLJU_c02390"
FT   CDS_pept        244385..244864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="CLJU_c02390"
FT                   /product="F1Fo ATPase, subunit B"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13329"
FT                   /db_xref="GOA:D8GKZ6"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKZ6"
FT                   /protein_id="ADK13329.1"
FT                   /translation="MQIDWTTVVITIINFIILYFILKHFFFKPVNNTITNRQQEIDNKI
FT                   RTADENEKKSKQLVTQHQELLKNSKQEGKAIVEDYKNKADKVSENIVNDAQKEAQLILD
FT                   RAKVEAEREREKAKDDIKNQVVDLALLVSSKALEGSINEQQHRKLIEDFIAKVGI"
FT   gene            244867..245412
FT                   /gene="atpH"
FT                   /locus_tag="CLJU_c02400"
FT   CDS_pept        244867..245412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="CLJU_c02400"
FT                   /product="F1Fo ATPase, subunit delta"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13330"
FT                   /db_xref="GOA:D8GKZ7"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR020781"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKZ7"
FT                   /protein_id="ADK13330.1"
FT                   /translation="MHEYLDRRYALALYKIGEEKGKVKEYLEELRQVVAAIKGNSKFLE
FT                   IMEHPEVSTSEKKKMFTEIFKDKVNEDILSFLLVLIEKDRINEIDGKLREMENIYLESN
FT                   NTVKAKVKTVIALNDDERNTLIEKLEKKFNKKVLIEEEIDPSIIGGVYVEVNNEVIDGS
FT                   IRSKLSEMKKIMLKGEQR"
FT   gene            245417..246931
FT                   /gene="atpA"
FT                   /locus_tag="CLJU_c02410"
FT   CDS_pept        245417..246931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="CLJU_c02410"
FT                   /product="F1Fo ATPase, subunit alpha"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13331"
FT                   /db_xref="GOA:D8GKZ8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKZ8"
FT                   /protein_id="ADK13331.1"
FT                   /translation="MNIKPEEITSIIKDEIQKYEKKIETVDSGTIIQIGDGIARVYGLN
FT                   QCMANELLEFPNDVYGMALNLEQDNVGCVLLGSQKGIKEGDTVKRTGRVVEVPVGEAIV
FT                   GRVVNSLGQPIDGKGPIKTSETRPVDLVAPGVITRQSVKEPLQTGLKAIDSMIPIGKGQ
FT                   RELIIGDRQTGKTAIAMDTIINQKGKDVICIYVAIGQKQSTVAHIVNDLTEAGAMDYSI
FT                   IVSASASESAPLQYIAPYAGCSMGEYFMNKGKDVLIVYDDLSKHAVAYREMSLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAAKLSDKLGGGSLTALPIIETMAGDVTAYIPTNVISITDG
FT                   QIFLESELFYAGQRPAINAGISVSRVGGNAQIKAMKQVAGTLRLDLAQYRELASFAQFG
FT                   SDLDKESMKRLEKGKRLTEILKQPQYKPMPVENQVMILFAAGREYIMDVPVEKVVEFEG
FT                   EFLDYMSTHHKEIGDEIKNKKIISDELSDKLGNAIEEFKKIFLAEA"
FT   gene            246954..247805
FT                   /gene="atpG"
FT                   /locus_tag="CLJU_c02420"
FT   CDS_pept        246954..247805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="CLJU_c02420"
FT                   /product="F1Fo ATPase, subunit gamma"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13332"
FT                   /db_xref="GOA:D8GKZ9"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D8GKZ9"
FT                   /protein_id="ADK13332.1"
FT                   /translation="MAGAGLVTIKRRIRSITSTQKITNAMGLIATSKLRKVRKKLEANN
FT                   KYCELFSSLMNEFVLGAEGRNIYIHGNKSNKKLYIALNSDTGLCGGFNGSVVNEADAAM
FT                   SKNKENCLLISVGQKGRTYFKRLKYSTEAEYVDISDVPTINEADTIVYKALDLYRSGEV
FT                   GEVNIVYTKFISTVRQKVVVEKLLPLEADKKEKTNYLVKFEPSIDEMMDEVVLLHLKQK
FT                   VLNCMINSKVSEQASRMTAMDGATKNANDLLDKLNLKYNRERQSAITQEITEIVGGAEA
FT                   LK"
FT   gene            247818..249212
FT                   /gene="atpD"
FT                   /locus_tag="CLJU_c02430"
FT   CDS_pept        247818..249212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="CLJU_c02430"
FT                   /product="F1Fo ATPase, subunit beta"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13333"
FT                   /db_xref="GOA:D8GL00"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL00"
FT                   /protein_id="ADK13333.1"
FT                   /translation="MPNIGKVVQVIGPVVDIKFDTENLPNIYNAIDIKSGDKKIITEVA
FT                   QHLGDDVVRTISMESTDGLMRGMDAEDTGSPISVPVGEPVLGRLFNMLGQPIDENGEVK
FT                   AEQYYPIHRQAPSFEDQSVKPEMFETGIKVIDLLAPYQRGGKIGLFGGAGVGKTVLIQE
FT                   LINNIAKEHGGLSVFTGVGERTREGNDLYYEMQESGVIKKTALVFGQMNEPPGARMRVA
FT                   LTGLTMAEYFRDKGQDVLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATEMGALQ
FT                   ERITSTKQGSITSVQAVYVPADDLTDPAPSTTFTHLDATTVLSRSISEIGIYPAVDPLA
FT                   STSRILDPRIVGEDHYKVASDVKHILERYSELQDIIAILGVDELSEDDRLVVIRARRIQ
FT                   RFLSQPFSVAEQFTGYQGKYVQIKETIRGFKEILEGKYDDLPETAFLFKGSIDEVVEAA
FT                   KNMGKN"
FT   gene            249279..249677
FT                   /gene="atpC"
FT                   /locus_tag="CLJU_c02440"
FT   CDS_pept        249279..249677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="CLJU_c02440"
FT                   /product="F1Fo ATPase, subunit epsilon"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13334"
FT                   /db_xref="GOA:D8GL01"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL01"
FT                   /protein_id="ADK13334.1"
FT                   /translation="MSEVLKLTILTPDREFYEGEVVEVITESIQGDIAILPDHMPLVTT
FT                   LKPANTEIVQKDGKKLKAFTSTGVLEVINNELKILCDSCEWPDEIDIDRAKAAKERAEK
FT                   RLVSQKDGVDVKRAEMALARALARINLK"
FT   gene            250017..250754
FT                   /locus_tag="CLJU_c02450"
FT   CDS_pept        250017..250754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13335"
FT                   /db_xref="InterPro:IPR036209"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL02"
FT                   /protein_id="ADK13335.1"
FT                   /translation="MKKLKMLSCLLVLVFSFQYYVCASGDNLGVRSTLFQKSVSNLKET
FT                   DIFKNILEKTNSTPVECGIMATFNTSSGKEKVVDEIFKVLMRYSECNKKVWRNNKIYCI
FT                   EFNGYYAEGYVEGVENENYNIITVNITRKSSQYKLQDLKSMVDRSLGDRKEKCKYFEYV
FT                   KAKTQKQDVSSVNSEVKNILKCYGTSDIKTIALEEGYSSTAYTHKYEPIQSGTGLIDFN
FT                   YAVVKYDTGTYIIMGTPEIMVTY"
FT   gene            250849..252108
FT                   /gene="murA1"
FT                   /locus_tag="CLJU_c02460"
FT   CDS_pept        250849..252108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA1"
FT                   /locus_tag="CLJU_c02460"
FT                   /product="UDP-N-acetylglucosamine 1-carboxyvinyltransferase
FT                   1"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13336"
FT                   /db_xref="GOA:D8GL03"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL03"
FT                   /protein_id="ADK13336.1"
FT                   /translation="MSKIVVKGGNKLHGEVNISTAKNSVLPIIAACILSGDKCVIEKVP
FT                   MLEDVFVISDILRSISADINIDKDTNKVIIDSSNIKDCNPCSELVKKMRASFLIMGPMI
FT                   ARFGKFRLCLPGGCNIGTRPIDLHLKGLSALGAEVNVGHGYVEASAKKLIGDKIYLDFP
FT                   SVGATENIMMASVMAEGETIIENAAEEPEIRDLAKFLNSMGANIIGAGSGTIRILGVKS
FT                   LKGSTHRPIFDRIESGTFMVAAAITRSKIKINGANEEYLKPIIAKLTEVGVHISSQGSS
FT                   LIVDGRDELRPVDIKTMPYPGFPTDMQSQMTGLLCTVMGTSIITETIFENRFMHVAEMK
FT                   RMGANIKIDGRSAVIEGVKKLTGAEVKATDLRAGASLILCGLAAEGETEIADIYHVDRG
FT                   YVDIEKKLKALGADIKRINE"
FT   gene            252293..253339
FT                   /locus_tag="CLJU_c02470"
FT   CDS_pept        252293..253339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02470"
FT                   /product="predicted stage II sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13337"
FT                   /db_xref="GOA:D8GL04"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL04"
FT                   /protein_id="ADK13337.1"
FT                   /translation="MKNDVLDFLKKFIILVFMGTLFIIVLSLFIVGTGNSKCDNLPQFL
FT                   INSKNIILKKQDTNSEKIKVYITKEDKVKEMDLEQYVTGVVAAEMPAEFSEEALKAQAV
FT                   ASRTFAAAHMEVYGGKKYKSNTGADVCDTVKCQVFVNKEDRIKNWPKSDGDKYWSKIVD
FT                   AVQATSGQVLTYKNKLVMEPYYFAVSAGKTENSEDVFGEAEGYLKSVESPGEESARKYK
FT                   TSVKMSYVDFINKVNSSYANSGLSSENLSNQIAIKSKNESGSVKEIKLGAVTISGTKFR
FT                   AIMGLNSANFSIDFKDGVYIQCIGYGHGVGMSQWGANYMGKNGQNYKNILSHYYEGTSL
FT                   EDVNLFKK"
FT   gene            253491..254207
FT                   /locus_tag="CLJU_c02480"
FT   CDS_pept        253491..254207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02480"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13338"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL05"
FT                   /protein_id="ADK13338.1"
FT                   /translation="MNKKSFNKAINFLKKESFYVILFICLCIAVTAAVITARNNKNQSA
FT                   QLQKSQAVEQKKIRETAKANEKPSSNYNNALQVKKDNKSKSNISNNEASKGVSNSVSTS
FT                   FQKPVEGNIARGYSEDPVYWDSTATYRPNLGYDIQTPLGKPVFAAMDGKVESVNTATQD
FT                   GVEVIIDHQNGLKTVYSNLDPNVKVSAGQTIKKGAVIGVVGKSTLRSAYEKYGDHLHFA
FT                   VLKGKEFVDPGKYIKY"
FT   gene            254430..254684
FT                   /locus_tag="CLJU_c02490"
FT   CDS_pept        254430..254684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02490"
FT                   /product="stage III sporulation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13339"
FT                   /db_xref="GOA:D8GL06"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014208"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL06"
FT                   /protein_id="ADK13339.1"
FT                   /translation="MKDYIEERVLEVAKYIIGSKATIRKTAKVFGVSKSTIHKDMTERL
FT                   PKINPQIAQEAKSILDYNKAERHIRGGKATKMKYKAIEG"
FT   gene            254782..255813
FT                   /locus_tag="CLJU_c02500"
FT   CDS_pept        254782..255813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02500"
FT                   /product="MreB/Mbl protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13340"
FT                   /db_xref="GOA:D8GL07"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL07"
FT                   /protein_id="ADK13340.1"
FT                   /translation="MFFSIGTDMGIDLGTATVLVYIKGRGVILKEPSVVAIDKIKNRVL
FT                   AVGEEAWQMIGRTPGNIVAIRPLKDGVISDYDVTEKMLKYFISKACGKNRISSPRIVVC
FT                   VPCEATEVEKRAVIDAAKNAGAKKVFLIEEPLAAAIGAGIDITKASGNMVIDIGGGTTD
FT                   VAVISLGGIVVRSSIKVAGDKFDEAIMKYVRKEHKLMIGERTSEDLKIKIGSAFDRDEE
FT                   VSMEIRGRDLITGLPKNITVSSAEMRIALKETVNSIADTTRAVLEKTPPELSADIADKG
FT                   IFMTGGGALLNGLSNLIQKVTNVPVYVAEEPVSCVALGTGKVLEYLDKMEVVFSGDDIT
FT                   LID"
FT   gene            complement(255905..256453)
FT                   /locus_tag="CLJU_c02520"
FT   CDS_pept        complement(255905..256453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13342"
FT                   /db_xref="GOA:D8GL08"
FT                   /db_xref="InterPro:IPR009665"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL08"
FT                   /protein_id="ADK13342.1"
FT                   /translation="MNKAKTNYKDPLAYYKLAYFLKNYINNDTIIVCIGTDRYIGDCLG
FT                   PLVGTLLKCKHFPLPVYGTISDPIHALNIESKLNKINLLHPHKNIIGIDACLGDLETIG
FT                   DIQVRDFPVHPGKGVGKSLPDVGNSSIIGIVDSNSSEDLFNNSSSNIRLNLVLSMAEVI
FT                   LYSLIHSYYLYYNNIFIDI"
FT   gene            256441..256596
FT                   /locus_tag="CLJU_c02510"
FT   CDS_pept        256441..256596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13341"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL09"
FT                   /protein_id="ADK13341.1"
FT                   /translation="MLYSIYSPSFMYVLVKNTIYNLYDEFIQIIKVKLSEYDFERNIEK
FT                   YGERYI"
FT   gene            256703..256778
FT                   /gene="trnT1"
FT                   /locus_tag="CLJU_c02530"
FT                   /note="tRNA-Thr-TGT"
FT   tRNA            256703..256778
FT                   /gene="trnT1"
FT                   /locus_tag="CLJU_c02530"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACA"
FT   gene            256784..256868
FT                   /gene="trnY1"
FT                   /locus_tag="CLJU_c02540"
FT                   /note="tRNA-Tyr-GTA"
FT   tRNA            256784..256868
FT                   /gene="trnY1"
FT                   /locus_tag="CLJU_c02540"
FT                   /product="tRNA-Tyr"
FT                   /note="codon recognized: UAC"
FT   gene            256878..256953
FT                   /gene="trnV1"
FT                   /locus_tag="CLJU_c02550"
FT                   /note="tRNA-Val-TAC"
FT   tRNA            256878..256953
FT                   /gene="trnV1"
FT                   /locus_tag="CLJU_c02550"
FT                   /product="tRNA-Val"
FT                   /note="codon recognized: GUA"
FT   gene            256975..257050
FT                   /gene="trnT2"
FT                   /locus_tag="CLJU_c02560"
FT                   /note="tRNA-Thr-TGT"
FT   tRNA            256975..257050
FT                   /gene="trnT2"
FT                   /locus_tag="CLJU_c02560"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACA"
FT   gene            257056..257140
FT                   /gene="trnY2"
FT                   /locus_tag="CLJU_c02570"
FT                   /note="tRNA-Tyr-GTA"
FT   tRNA            257056..257140
FT                   /gene="trnY2"
FT                   /locus_tag="CLJU_c02570"
FT                   /product="tRNA-Tyr"
FT                   /note="codon recognized: UAC"
FT   gene            257490..258665
FT                   /gene="metK1"
FT                   /locus_tag="CLJU_c02580"
FT   CDS_pept        257490..258665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK1"
FT                   /locus_tag="CLJU_c02580"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13343"
FT                   /db_xref="GOA:D8GL10"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL10"
FT                   /protein_id="ADK13343.1"
FT                   /translation="MRKLFTSESVTEGHPDKMCDQISDAILDAILEQDPYGRVACETAT
FT                   TTGMVLVMGEISTNCYIDISKIVRNTVREIGYTRAKYGFDCQTCSVISSIDEQSSDIAM
FT                   GVDKALEAKEGEMEAIEAIGAGDQGMMFGFATNETPEYMPMPISLAHKLAKRLAQVRKD
FT                   KVLDYLRPDGKTQVTIEYEDNKPVRVDTIVVSTQHDEMVTRKQIETDIINNVIRPVVPR
FT                   EFLDYKTKYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYGRHGGGAFSGKDPTKVDR
FT                   SAAYAARWVAKNLVAAGIADKLEIQLAYAIGVAKPVSITVDTFGTGNIPEEKIVDIVNK
FT                   VFDLRPAAIIKDLNLRRPIYRQVAAYGHFGRTDIDVPWERLDKVEEIKKYM"
FT   gene            258796..261033
FT                   /gene="recD"
FT                   /locus_tag="CLJU_c02590"
FT   CDS_pept        258796..261033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="CLJU_c02590"
FT                   /product="exodeoxyribonuclease V alpha chain"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13344"
FT                   /db_xref="GOA:D8GL11"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL11"
FT                   /protein_id="ADK13344.1"
FT                   /translation="MQELQGIVESIIFQNKDNGYVVAKIRENKDEVTIVGCIPNIIEGQ
FT                   NLKAVGEWVLHPQFGNQFKVQASEEIIPSTTIGIERYLASGIISGIGPVTAKKIVEKFG
FT                   ENTLQILDNNIGRLKEIEGIGAKKIALIEESYSKQNEVRNIMIFLQTYGITPSQCVKIH
FT                   KKFGADSISIVKENPYTLTEEISGIGFKTADKIARSLGIENNSPFRIQSGIRYLVNKFC
FT                   SLGNTYMPIDNLIKEGVDILHITQKELEENIYESSVNGKIKLEKWEDKVCVFSMTYYYC
FT                   ELSVTRKILMLAFTKYKDMDFNIDKEIEDFEKENNMNFAVSQKEAIRGAIENGVEIITG
FT                   GPGTGKTTIINCIIRLFEKAKLKVLMGAPTGRAAKRMSESTKRESKTIHRLLEMGVGSD
FT                   EEALFFSRGEQSPLQCDVVIIDEASMIDIVLMNNLLKAVSMGTRLIIVGDAEQLPSVGP
FT                   GNVLRDFIDSKCIKVVRLKEIFRQSKESMIIVNAHKINSGEMPILNKKNKDFYFIKCQD
FT                   PSDILDTLVGLIDKRLPSFNSSWNKIEDIQILSPMRKGVLGVSNLNKKLQQVLNPKSPN
FT                   KREKKFRDMTFRVGDKVMQIKNNYTLKWQGISEENKESGMGVFNGDFGYIEDIDEEKNR
FT                   VVVVFDEEKRVVYDSMYLDELDLSYAITIHKSQGSEFPVIIIPMFMGPPLLMNRNLLYT
FT                   AITRAKQMVILVGSLKALNFMINNNKSFERYSLLKYRIMDIMESETNATVE"
FT   gene            261017..262039
FT                   /locus_tag="CLJU_c02600"
FT   CDS_pept        261017..262039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13345"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL12"
FT                   /protein_id="ADK13345.1"
FT                   /translation="MLLWNESCLINERKKISENIVKWSGTKDIFLNCISVPYNSTEIFL
FT                   EIIEKYIRQNENIIYITNEKMGNVDIIKNIKKYTHFTDYCYVKGCKSNSNCKLQICNFE
FT                   NASKLEDKFELVIYDDISSFSLYNKYEICKLISKLTHEDSKVIIYSIESIVENSKKVFL
FT                   PAKNEGLIIEPRSILTRLNMNKEMPFLVYDYLKWSISIGKKIIIYVPSKYKIDKVASYM
FT                   HKYCKNLAHDVVCFAKGESNKKLIYKFLQTKNSILITNCFEETALNAKNSELIVYFADD
FT                   VNFTYKEFVYLCGSVGRGEKDLKEEVILVSNIETEEIEKAKSITSNFNREAWNMGLLKI
FT                   "
FT   gene            262012..262692
FT                   /locus_tag="CLJU_c02610"
FT   CDS_pept        262012..262692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02610"
FT                   /product="putative amidophosphoribosyltransferase ComFC"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13346"
FT                   /db_xref="GOA:D8GL13"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL13"
FT                   /protein_id="ADK13346.1"
FT                   /translation="MEHGITKNLKFLLDCVLGLIYCGDERCILCKKDIYNDRNICEACE
FT                   SNIKVCKDSFEIGYDDKKIQCYSSAYYSGAMMELIIKLKYKSSFKAGDVIAKCMRNIIA
FT                   NNHIDFDVFTYVPMTKKALKKRGYNQAEYLANSLGSYTNKPVICCLDKIKETKDQIGLD
FT                   KTERWSNMSESFQVCNKKIIKNKKILLIDDVLTTGATAFGCCSELLKNGAKKINVLTGA
FT                   KSRV"
FT   gene            263125..263652
FT                   /locus_tag="CLJU_c02620"
FT   CDS_pept        263125..263652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02620"
FT                   /product="predicted ribosome-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13347"
FT                   /db_xref="GOA:D8GL14"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL14"
FT                   /protein_id="ADK13347.1"
FT                   /translation="MKITVKGKNIVVTDALKNAVEKKLCKLEKYFNPDVVAHATLSVQK
FT                   TRQIIEVTIPFGGVILRGEEGNSDMYASIDLVVDKLERQIRKQKTKLLRRNNSESLRFQ
FT                   CIPDESEKDEQEQKIVRTKKFAIKPMSSEEAVLQMELLGHSFFVYQDAENGEVNVVYKR
FT                   RDGNYGLIEPEF"
FT   gene            263833..266346
FT                   /gene="secA"
FT                   /locus_tag="CLJU_c02630"
FT   CDS_pept        263833..266346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="CLJU_c02630"
FT                   /product="protein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13348"
FT                   /db_xref="GOA:D8GL15"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL15"
FT                   /protein_id="ADK13348.1"
FT                   /translation="MKLFQKIFGSYSEREVKRVIPIVDKIDSLDSKMQGLTSGELRAKT
FT                   DEFKDRLSKGESLDEILPEAFAVVREVGYRTIGLKQYREQLIGGVVLHQGRISEMKTGE
FT                   GKTLVATAPAYLNALTGKGVHIVTVNDYLAKRDRDTMAPIYEALGLKVGVILHDLDQTQ
FT                   RQEAYNCDITYGTNSEFGFDYLRDNMVIYKEERVQRGLNFVIVDEVDSILIDEARTPLI
FT                   ISGEGEKSTEFYNIADSFAKSLQKEDYEVDEKANSVILTDTGVKKAENFFQLANYADPE
FT                   NMEIQHYVVQSLKANYIMRRDKDYMVKNGEVLIVDEFTGRMMEGRRYSDGLHQAIEAKE
FT                   NVKVERESKTLATITYQNYFRMFNKLSGMTGTALTEENEFREIYGLDVIVIPTHKPIAR
FT                   TDYPDVVYKSAKGKFKAIADEIYETYKKGQPVLVGTVSIEKSELLSDMLKKRGVPHQVL
FT                   NAKFHEMEAEIISHAGEKGTITIATNMAGRGTDIKLGKDVVALGGLKIIGTERHESRRI
FT                   DNQLRGRSGRQGDPGTSRFYVSLEDDLMRIFGSDRLQGIVEKLGLKEDEAIESRMVTNA
FT                   IEGAQKKVEGNNFDIRKTLLQYDDVINKQREIIYKQRSQVLEGEDLREYMVDMIKSLVS
FT                   SIVDSHISGIEEDFEDEVEKLIKYMEEVYVQKDSIKKEDIINLSNEEIKQKYIDIGQKI
FT                   YEEKEEECTPEQMREIERVILLRVVDTKWMDHIDDMEHLKRAIGLRAYRQQEPAQAYQF
FT                   EGSEMFEEMIYNIKLDTVKYLLHVQIEKAPERERVAKNVVTNQGEETAMKKKPIKKEKT
FT                   VGRNDPCPCGSGKKYKNCCGKLANN"
FT   gene            266485..267474
FT                   /gene="prfB"
FT                   /locus_tag="CLJU_c02640"
FT   CDS_pept        266485..267474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfB"
FT                   /locus_tag="CLJU_c02640"
FT                   /product="peptide chain release factor B"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13349"
FT                   /db_xref="GOA:D8GL16"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL16"
FT                   /protein_id="ADK13349.1"
FT                   /translation="MKMQEPNFWDHLERAQEVTSEEKFLNEKLDMYNKLESRINDAEIL
FT                   AHIAEEEEDVSDCKDILSEVEDIENIIDKLKIEILLSGEYDKNNAILNLHVGVGGTDAQ
FT                   DWTEMLLRMYTRWAEKSGYKVETLDILPADDAGIKSVSLRIIGEFAYGYLKAEKGIHRL
FT                   VRISPFNANGKRQTSFASVEVLPELTKDQDIDIRPEDLRVDTYRSSGAGGQHVNKTESA
FT                   VRITHIPTGIVVQCQNERSQHYNRETAMLMLKSKLVELKERAHKEKIEDLAGELKDMGW
FT                   GSQIRSYVFHPYTLVKDHRTGVENGNVSSVMDGEIDNFILAYLRQQAK"
FT   gene            267554..268792
FT                   /locus_tag="CLJU_c02650"
FT   CDS_pept        267554..268792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02650"
FT                   /product="predicted transporter protein, MFS family"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13350"
FT                   /db_xref="GOA:D8GL17"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR022324"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL17"
FT                   /protein_id="ADK13350.1"
FT                   /translation="MSFKSTVGDVFSSLKHRDFRYFLSGQLLSLMGTMIQNTALSWYVY
FT                   KITNSPFLLGLISVFQYAPVLLITLIAGVIAERYPKRKIILMTQFSYMIQSFILTFVIY
FT                   IGYSKYWILAILAVINGIITSLDMPTRQSFFIELVGKKDLPNAISLNSTVFNISRIVGP
FT                   AFAGIIMNKLGVFQCFLVNTISFIPVIYGVFQIKAKGNPTLRTKNFNLIQDLKGGIMYT
FT                   INKKILLSVMFMMAIVCTFAFNSNVIIPVFAKQVMNGGAKEYSIFLSLSGAGSFLGAIF
FT                   MAGIGRGLRSKHFLIINSFILAILQIVTLFTSSYLLVGMLFVCIGFFGLTFLNKANATL
FT                   QFNTEDEYRGRVMSIYALLNIGSTPFGSAFVGAVMEKFGGKFGFFSCGLMMFLFTIITV
FT                   FFVELKNRKPRYN"
FT   gene            268952..270298
FT                   /gene="gdh"
FT                   /locus_tag="CLJU_c02660"
FT   CDS_pept        268952..270298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdh"
FT                   /locus_tag="CLJU_c02660"
FT                   /product="NADP-specific glutamate dehydrogenase"
FT                   /EC_number="1.4.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13351"
FT                   /db_xref="GOA:D8GL18"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL18"
FT                   /protein_id="ADK13351.1"
FT                   /translation="MDGKEYVQKVLSTVQKRNLGEEEFLDAVKEVLTSLVPVFDRRPDF
FT                   IKAGLLERLTEPERAISFRVPWVDDNGEVQVNRGFRIQFNSAIGPYKGGLRFHPSVNQS
FT                   IVKFLGFEQIFKNSLTGLPIGGAKGGSDFDPKGKSDNEVMRFCQAFMSELYKYIGSNRD
FT                   VPAGDIGVGGREIGYLYGYYNKLKGVSEQGTLTGKGLTYGGSLARTEATGYGLVYFTEE
FT                   MLKDHNLSFKDKKVVVSGSGNVAIYAIEKATELGAKVITCSDSNGYILDENGINLDVVK
FT                   EIKEVRRGRIKEYLKSVPTAKYVPDFREIWNVKCDIALPCATQGEINEKSAKALVENGV
FT                   IAVSEGANMPSTLDAINVFLSNKILFGPSKAANAGGVACSAIEMSQNSIRYSWTFEEVN
FT                   NKIKNIMINIYNNSKNAAKEYGNEGNIVVGANIAGFLKVAEAMMAQGII"
FT   gene            complement(270391..271731)
FT                   /locus_tag="CLJU_c02670"
FT   CDS_pept        complement(270391..271731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02670"
FT                   /product="putative protein containing aminopeptidase
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13352"
FT                   /db_xref="GOA:D8GL19"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL19"
FT                   /protein_id="ADK13352.1"
FT                   /translation="MKKFMFILPLTIFCIICSLSFQYYYFIHPLNSLKVKNTISYLSSD
FT                   NFKGRLTGTLENYETAAFIKHYFKLENLSSYNKDYLQSFNVVYPEKIDAAPYLIVKDKN
FT                   GFIVKQYKYAADYKEDMLNFKNSIVSFKKGDVISPLGNSFQVQTSNQYFLFYTPKNNSL
FT                   DFRSSFISNSRGSMYIMIKEQTAREIKNYLNLGCEISCFIPFHNKLTSAYNVIGYIKGK
FT                   NPALPPLVLSAHFDHLGSDLSGTIYSGALDNASGTSFLLGLIKYINSIGKPERNIVIAA
FT                   FNAEEFGCLGSKNFAQQYKDTLRGGKVINFDMLGSDKNVPLSIMAGKWDSKNSPFVKEI
FT                   AQLCTSSKINFKYAFENSSDHQYFRAYNIDALTLSDADTSKIHTPMDKSQYINTKSIDR
FT                   CFNVVSKEIDSYAFNNNPFILYSKYLLVISFCGILIMVNLYLHQFYK"
FT   gene            271893..274058
FT                   /gene="tex"
FT                   /locus_tag="CLJU_c02680"
FT   CDS_pept        271893..274058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tex"
FT                   /locus_tag="CLJU_c02680"
FT                   /product="transcriptional accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13353"
FT                   /db_xref="GOA:D8GL20"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL20"
FT                   /protein_id="ADK13353.1"
FT                   /translation="MDNIIDTLAEELSVNKKYINSVIELLDSGNTVPFIARYRKELTGS
FT                   MSDVTLRKLAERLTYLRNLKSRKEDVIRIIEEQGKLTEGLKNSIEHSSTLTEVEDIYRP
FT                   YKPKKRTRATIAQEKGLKPISEAILAGNFQDDIEKYAEKFINEEKGVESVEDALAGAVD
FT                   IISEVISDEAKYRKWIRKFVWENGIIETKGESKEPTPYEMYYDYREAVKSIPPHRILAI
FT                   NRGEKEKVLSVKISCDMKNIEIYLKNQSLKGNNITDTYIEKSVEDSLKRLIYPSIEREI
FT                   RSQLTDMGEEGAIKIFKANLKALLMQSPIKGKNVLGYDPGFRNGCKIAVLDDTGKLLDT
FT                   AIVYATAPQNDVEGSIKKLKELVYKYDVNVVSLGNGTASRESEELIGKLIKEVKEEKGK
FT                   DLYYVIVSEAGASIYSASELAAKEYPDINVSLRGAISIGRRLQDPLAELVKIDPKSIGV
FT                   GQYQHDVAPKKLDESLKGIVEDCVNSVGVDLNIATPSLLSYISGINTAIASNIVAYREE
FT                   NGKFKNRKELLKVKRLGAKAFEQCAGFLRVMESGEPLDNTSVHPESYDAAKELLKIIGY
FT                   NMEDLKNGELSGIDNRVDKIGIDVLSEKLNVGEPTLKDIIKEIKKPGRDPREELPKPIL
FT                   KTGIIDINQLKPGMVLTGTVRNVADFGAFVDIGVHQDGLVHISQLSDKFVKHPLDVVQV
FT                   GDIVQVTVLEVDEKRKRISLSMKSSDS"
FT   gene            274606..275232
FT                   /locus_tag="CLJU_c02690"
FT   CDS_pept        274606..275232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02690"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13354"
FT                   /db_xref="GOA:D8GL21"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL21"
FT                   /protein_id="ADK13354.1"
FT                   /translation="MRSNKLNRLVKISLLGVIGFLLMFIEVAIPVFPSFLQIDISDLPA
FT                   LIGTFALGPGAGVAIELLKNILHGIFDGKTAFIGEFANFAVGSVLVFTAGYLYNRHKTK
FT                   KTAAVSLGAATIAMSVFAAVLNYFVLLPLYEKVLNFPISAMVAAAGKVNGSITDINTLI
FT                   LFAIVPFNLLKGLLLTALTLVLYKSVSPVLKQEQSKSRGLAEHNN"
FT   gene            275347..277185
FT                   /locus_tag="CLJU_c02700"
FT   CDS_pept        275347..277185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02700"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13355"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL22"
FT                   /protein_id="ADK13355.1"
FT                   /translation="MPGIWNVNSSYNVDNKRISTKLSFEVGEKFSARILDLKKSTGEIL
FT                   LKLLDGWQFSAEIENPVDFLPNKLVRLEVQGFENGKLKLKIVNSQDGEQVGGKDSIDSF
FT                   IRESGDLNLSSDDYQLVKSMLKHEIPLTKSNISNIKTTLDFIDKIKSEPNEENEFIDKY
FT                   LDSRGISPESTEGKFTTSTLKNFFSQLKQISGDDLLTFLENNMELSEDNIKSFNNVFKK
FT                   DGTIYNEIKFLGETLSGQKSTNVQPQSQVEGTKDNLKVISEKAQTEVYRSENSDSKAEN
FT                   IATKDNIASTQSEKDTVSRTGTERAGVENKTVLNSEGLDANKLNEILNKIKNSVGEEKT
FT                   QSPNVEQSSNVKEDISSKGIEQQTSIDKDMSSKNIEQKTGTDKGISSKDIENLEQKDTS
FT                   NTVSKFSEKEGSKVESPHHNNFIKQNGMDDIVSQIKEQINIKTSEMKDIIRTVLDQKGD
FT                   GKNQLSGNIVQVLNNNMNDFKVFNTVSNSYYYMDVPINLNQQDYQCKLMIKDDRQKGKK
FT                   IDSTNVKIVTSVSTENMGTVDAYLSVKNRSMDIDIKCSKEWLNLFKKTEKRVLESLSDI
FT                   GYNVYVRFDEKKEEMNISTCREFFQDSDIGVINTKA"
FT   gene            277260..277526
FT                   /locus_tag="CLJU_c02710"
FT   CDS_pept        277260..277526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13356"
FT                   /db_xref="GOA:D8GL23"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL23"
FT                   /protein_id="ADK13356.1"
FT                   /translation="MDKKKKAAALKYEYNYEAPIVTAAGIGQIADNILNKAKESGVPIV
FT                   YDKELANLLSNVDIGDNVPFELYDAVAKVIAYVIDIDKNISRR"
FT   gene            277531..278217
FT                   /locus_tag="CLJU_c02720"
FT   CDS_pept        277531..278217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02720"
FT                   /product="predicted phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13357"
FT                   /db_xref="GOA:D8GL24"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014578"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL24"
FT                   /protein_id="ADK13357.1"
FT                   /translation="MALFAISDLHLDLTGSKPMDVFGNNWANHDEKIKKNWNSKITSED
FT                   KVLISGDISWSMNMEGGACDLEWVHQLSGTKLMIKGNHDYWWNSITKLNNMYEDMGFIQ
FT                   NNFFTYKDYGICGTRGWNCPESDNFSAHDEKIYKRELLRMKNSLDCAVKSGYKKFIVMI
FT                   HYPPISEKFMSSGFTDIFREYGVEKVIYGHLHGESLSKAVTGNLNGVEYILASADYIKF
FT                   NPIRIM"
FT   gene            complement(278261..279064)
FT                   /locus_tag="CLJU_c02730"
FT   CDS_pept        complement(278261..279064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13358"
FT                   /db_xref="InterPro:IPR018708"
FT                   /db_xref="UniProtKB/TrEMBL:D8GL25"
FT                   /protein_id="ADK13358.1"
FT                   /translation="MSKKTSLGLESLNEDDGLSEEEKQKLLLYNKKVVCPVCDNNFNAR
FT                   AIKKSSYRILKKDSDFFIRYSIINPYFYDVWVCDECGYAAMKSDFEHLSDYDANIIREN
FT                   ISPKWKSKNYPEVYDIDLAITRYKLSLLNYYIINARSSKKAMNSLKIAWMYRLKEDEIK
FT                   EMEFLNQALENLQNAYYNEPSPIYGMDKFTTMYLIGELMRRTGKEEDSITWFSEVTSST
FT                   IASQKIKNLARDQKDLIKNVITEDNNPTDDSGDNKKHGLFSKFHK"
FT   gene            279252..280040
FT                   /locus_tag="CLJU_c02740"
FT   CDS_pept        279252..280040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02740"
FT                   /product="predicted GTP pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13359"
FT                   /db_xref="GOA:D8GLG3"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLG3"
FT                   /protein_id="ADK13359.1"
FT                   /translation="MAIGEWKTFLIPYSQAVEELKVKFKSIRKEYRKRNEYSPIEFVTG
FT                   RVKEISSILEKANKFNIPLDRIGYEMEDIAGIRVMCQFVDDIEKVVEIIRNRKDMSIMY
FT                   EKDYVSNVKESGYRSYHVIIKYPVNMAEGEKEILAEFQIRTLAMNFWATIEHSLNYKYK
FT                   QDIPGGIKLKLKSAADAAFQLDQQMLEIKDEIKDAQKLFEVKSSLVSDIMNNILTMSSM
FT                   GKLSESTRYQVQLNSLIEEGEVSELVSLLRSTEKLLQMYK"
FT   gene            complement(280119..282551)
FT                   /gene="leuS"
FT                   /locus_tag="CLJU_c02750"
FT   CDS_pept        complement(280119..282551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuS"
FT                   /locus_tag="CLJU_c02750"
FT                   /product="leucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13360"
FT                   /db_xref="GOA:D8GLG4"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002302"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR025709"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLG4"
FT                   /protein_id="ADK13360.1"
FT                   /translation="MYSIETDKKWQAKWEETSLYKFDDNNLDKKLYVLEMFSYPSGSKL
FT                   HAGHWFNYAPVDSWARLKKMQGYNVFQPMGFDSFGLPAENYAIKTGIHPSDSTEKNIAT
FT                   MEKQLKSMGAMFNWENEVITCRPEYYKWNQWLFLQLYKHGLAYRKNAPVNWCPSCKTVL
FT                   ANEQVQDGFCERCGTEATKKDLTQWFFKITDYSEELLQCLDKLDWPEKTKAMQRHWIGK
FT                   STGTNVTFKVADSDIEFSVFTTRVDTLFGVTYVVLSPENTLVDKLTKEEYKDEVEKYKE
FT                   SAKKQSEIERQSITREKTGVFSGSYAINPINGRKVPIWIGDYVLNTYGTGAVMAVPAHD
FT                   ERDFAFATKYKLPIERVIEGGDSLPYVEHGKMINSGEFNGLTTKEGKEAVTKKLESMGL
FT                   GSGKVNYRLRDWLISRQRYWGTPIPIVYCEKCGIVPVPEDQLPVELPYNVEFSPDGKSP
FT                   LLKSEEFMNTTCPCCGGPAKREADTLDTFVCSSWYYLRYVDNKNSEKPFDKAKIDKMLP
FT                   VDMYVGGPEHACMHLLYARFITKALRDMGFLDFDEPFLSLRHQGIILGPDGQKMSKSKG
FT                   NTISPDDCIQEYGSDVFRMYLMFGFDYSEGGAWNDDGIKSISKFVDRIERTISSVKEII
FT                   ESGDTGKTSMDAAEKELNYTRNFSIKSVSEDANKFQFNTSIARIMEFTNALSKYIQQKD
FT                   KNISLLKDTVIDFVKIIAPFAPHFAEEQWESLGKSYSIFNEKWPDFEPNALIRDEAEIA
FT                   IQINGKIKAKINVSTNLKEDQIKELSLSNEHIKSLLDGKDIKKVIVVKGRLVNIVAK"
FT   gene            complement(282981..283055)
FT                   /gene="trnQ1"
FT                   /locus_tag="CLJU_c02760"
FT                   /note="tRNA-Gln-CTG"
FT   tRNA            complement(282981..283055)
FT                   /gene="trnQ1"
FT                   /locus_tag="CLJU_c02760"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAG"
FT   gene            complement(283132..283650)
FT                   /locus_tag="CLJU_c02770"
FT   CDS_pept        complement(283132..283650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02770"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13361"
FT                   /db_xref="GOA:D8GLG5"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLG5"
FT                   /protein_id="ADK13361.1"
FT                   /translation="MTKAQNKTSNITKGGFLTTLGVILVYLSGIVPVNKASLLALASFI
FT                   IPLSVLVTGYKNAITIYAATSLLSLLICGFKITVLSYIVFFGLYGLIKYLVEKLRKLPL
FT                   EIILKLAFFNICLLVLFLLYSLFFPGLLKIKISPYLIVLGTEIAFVIYDYLLTLFINYV
FT                   NRYILKIIK"
FT   gene            complement(283682..284263)
FT                   /locus_tag="CLJU_c02780"
FT   CDS_pept        complement(283682..284263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02780"
FT                   /product="conserved hypothetical protein"
FT                   /note="related to molecular chaperone DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13362"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLG6"
FT                   /protein_id="ADK13362.1"
FT                   /translation="MKNPYEVLEINENASKDEIKKAYRTLAKKYHPDQYGNNPLKDLAE
FT                   DKMRDINEAYDYLMKNEGTNTYNNGSGNTYTGSNSSTYQSIENDIYNGNLSSAESKLMG
FT                   INTRDAEWHYLMGILNTRKGWYDQASTNLSTACSLDPNNFKYQEALNKLRGMNNSYRQP
FT                   YYDNRRRDPDICNICATLYCLDCLCGGGNC"
FT   gene            complement(284247..285125)
FT                   /locus_tag="CLJU_c02790"
FT   CDS_pept        complement(284247..285125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13363"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLG7"
FT                   /protein_id="ADK13363.1"
FT                   /translation="MFGYVTPYKMELKIKDYEKFKAYYCGLCRSIKYNIGNVPRISLNY
FT                   DMTFLALLLDSLGTGEQTYVKKRCILHPLQEKIFLKDNDSLKYAAFCNIYLSYFKLLDD
FT                   TVDDHSLKSKIFSICLKTYFSKTDENYKKVFIHIKENLSNLYELEKKTNNKSIDMISHP
FT                   FAHLTGFILSSFKYEKFKEELYFLGYNLGKWIYIIDALDDLHDDMSKGKFNVLNKCFNV
FT                   ENLSYERFSKKIEGRIDFILGTCAAQCMNTFEKLPIKKNKELLHNILQYGLLDKMDKVF
FT                   KRGVYKDEKSI"
FT   gene            complement(285134..285664)
FT                   /locus_tag="CLJU_c02800"
FT   CDS_pept        complement(285134..285664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02800"
FT                   /product="putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13364"
FT                   /db_xref="InterPro:IPR008173"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLG8"
FT                   /protein_id="ADK13364.1"
FT                   /translation="MEECETRIIKIDPDHIRLKLKQMKAINVKMENQTNYIYDFKDGRL
FT                   IKNKGYARIRVVEDLLHNSNHFYMTTKKLLSQEKYKVMEENETEILDAEAGKRIFRSLG
FT                   LNLLQAIKKYRESYRYKNSLIEIDINDTSFCPFPYIEIETKSDSELNELVELLGYSIKD
FT                   TTSKTIYEILNEK"
FT   gene            complement(285792..286724)
FT                   /gene="fba"
FT                   /locus_tag="CLJU_c02810"
FT   CDS_pept        complement(285792..286724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="CLJU_c02810"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13365"
FT                   /db_xref="GOA:D8GLG9"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011289"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLG9"
FT                   /protein_id="ADK13365.1"
FT                   /translation="MALVTTKNMFKKAYEGKYSIGAFNINNMEIIQGVVNGAKAKNSAV
FT                   ILQCSAGAIKYAGPKYLKAMVDAAIEETGIDLALHLDHGPDFETVKLCVENGFTSVMFD
FT                   GSHFDYEENVAKTQEVAKYAHDHGVVVEAELGVLAGIEDDVSAAEHIYTDPDQAEDFVN
FT                   RTGIDSLAIAIGTSHGAFKFPPNFKPKLRFDILEKVQEKLPNFPIVLHGASAVDQEAVA
FT                   TCNKYGGNLAGAKGIPIDMLRKASSMAVCKINMDTDLRLAMTAAVRKTFGDKPEVFDPR
FT                   KYLGAGRDEIQKVVEYKIDNVLGSANSLK"
FT   gene            complement(287064..287444)
FT                   /locus_tag="CLJU_c02820"
FT   CDS_pept        complement(287064..287444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02820"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13366"
FT                   /db_xref="InterPro:IPR025373"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLH0"
FT                   /protein_id="ADK13366.1"
FT                   /translation="MKSSITSFTIFILMMLSILFSIQYLNTICSKLESSNIKIEKSIES
FT                   NSWNEARKNYENFMIQWEKYSPKVSIFSNHNEIDNINSELWKLMQHITYRNGEESLASI
FT                   NVIKNLLHHILKMEQLNIQNLF"
FT   gene            complement(287441..288136)
FT                   /locus_tag="CLJU_c02830"
FT   CDS_pept        complement(287441..288136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02830"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13367"
FT                   /db_xref="GOA:D8GLH1"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLH1"
FT                   /protein_id="ADK13367.1"
FT                   /translation="MFIVLFRTIILYLLVVISMRLMGKKQIGEMEPFELAVAIMISELA
FT                   SLPMQDTRISIIHGIIPIITLLTLQTLLALLQLKSEKIRLFFSGKPTILIDKGKLDLKK
FT                   LKDEKFNINDLMEELRMQGYYNLSDVEYAILETSGQLSVIPKTELTPVTKTDLKIKPSQ
FT                   DVLPITLIMDGKINFKNLIIAKKDEAWLKQMMKKNSIVSTKNILVALLDSKGKFYYQLK
FT                   EKNTQDVIK"
FT   gene            288331..290025
FT                   /locus_tag="CLJU_c02840"
FT   CDS_pept        288331..290025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02840"
FT                   /product="Conserved hypothetical protein containing an
FT                   uridine kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02840"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13368"
FT                   /db_xref="GOA:D8GLH2"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLH2"
FT                   /protein_id="ADK13368.1"
FT                   /translation="MMYKDICEAQEKDRKDILNLKVGQKDILVKKGTSLYKIFRDNYPV
FT                   QDIPVVLAKVNEEYFELTNLLEKSGTFKIVDIRDKLGNKTYARTLQFVLIKSVYDLFKG
FT                   AKVTIEHSLSKGIFGEIHKDTPLCEEDIKKIKKKMKEIIKQDIPIKKVGMTKERAIEIF
FT                   RNYGMEDKVRLLNYVNTDEVKLYELDGRYDYFYGSMAFSTGVLKVFDLMYYEPGFILRY
FT                   PVESDPYNLPKFVEYKKLSKIFYETEKWGNILEVGDVGSLNHKVENKEIAYMIRVAEAL
FT                   HEKKIAYISDMISERKNVKVVLIAGPSSSGKTTFSKRLSIQLRVNGIIPVPISLDDYFV
FT                   DRDHTPKDENGNYDFESIYALDLKLFNDDLEALMRGEEIEVPTFDFKTGCRKWVGNKLR
FT                   LPEKGVIVIEGIHGLNELLTSAISKENKFKIYISALTQLNLDNHNRIATTDVRIIRRIV
FT                   RDSLFRGYSAEDTLKMWPSIKNGEEKNIFVFQENADVMFNSTLVYELCVLKDYALKELD
FT                   DINNSSPVYYEALRLKSFLHFFKSVDVNFVPDNSILREFIGGSCFYS"
FT   gene            290201..290947
FT                   /locus_tag="CLJU_c02850"
FT   CDS_pept        290201..290947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02850"
FT                   /product="PurE related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02850"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13369"
FT                   /db_xref="GOA:D8GLH3"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLH3"
FT                   /protein_id="ADK13369.1"
FT                   /translation="MDESELRNLLKNIKDNKIGVEEGIEKLKDLPFKDLGYAMVDNHRE
FT                   IRVGYPEVIYCEGKTVDQVKGIVEFMLTKDNNILGTRASKEMYKAVKEICPYAKYNELG
FT                   RTITIVKNSKEKTESYIAIVTAGTSDIPVAEEAFETVNIFGNKVEKIFDVGVAGIHRMF
FT                   NKLDIIRKAKVIIVIAGMEGALASVIGGLVDKPVIAVPTSVGYGASFGGIAALLSMLNS
FT                   CASGVSVVNINNGFGAGYIASIINKL"
FT   gene            complement(291031..291315)
FT                   /locus_tag="CLJU_c02860"
FT   CDS_pept        complement(291031..291315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02860"
FT                   /product="SpoIIAA: Anti-anti-sigma regulatory factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02860"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13370"
FT                   /db_xref="GOA:D8GLH4"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLH4"
FT                   /protein_id="ADK13370.1"
FT                   /translation="MKDLNIEIPENFAVDEADDLRQKLNSLIDKGEKNFSLDFSKCTFI
FT                   DSTGLGVLVSIYKKCKNINGSFKLYSVRNADVMKIFNMTRLDKVFEINS"
FT   gene            complement(291327..293315)
FT                   /locus_tag="CLJU_c02870"
FT   CDS_pept        complement(291327..293315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02870"
FT                   /product="predicted chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02870"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13371"
FT                   /db_xref="GOA:D8GLH5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLH5"
FT                   /protein_id="ADK13371.1"
FT                   /translation="MKKSLKNKLSLMFFVFITVPLIILGTFSYIRTSSLLQNTVKNQLE
FT                   STSSQTVQSINEKIDSVDEYIKILSSDERMAKIASGDTTYNNEVYTYLQKIQKENSSVI
FT                   ESLVITNASAKGIISNSSENYNVDYSDRDYVKDALEGSKNTNKKTVLISKVTGKPVIGI
FT                   AHPLKIDNKIVGTLIGIIPFKGVSNVKLGNFGYAYMINKDGLIISHPKTDKIFKENILN
FT                   STNNQLKSLINEAKSSGTSEGYYSYNGSRKFGKFVSNNNWIIAVEADYSTYMSPAASIR
FT                   NFTIIIAILALLITIFLSYRFSMRDIINPIKQLESLMTKAGEGNLTVRAKINTEDELQT
FT                   LGEYFNKMIEHQHNTIHNVRDASENLAASSEELASSNEEISSTTEQMTGTIEKVAQDAE
FT                   TQNSSIVEVSEVLVQLSSLVQISQNRALTAKKNSKHTMDTAEEGRNKIENTVDAIENIR
FT                   KSSTATETTLKVLQELSKKVSGIIDTINSISSQTNLLALNAAIEAARAGEHGKGFTVVA
FT                   EEVRKLSEETNTGANEISSLVSKMVNEITKAVKNMNSSKDAVESGVVIAKDADKSFVSI
FT                   IDAVNQISNNVNEIVDVTKDEVATSDKIVNLINTVATITENTAASSEEVAASAEEQNSA
FT                   IENVAASAEESSALAVSLNNLVEKFTI"
FT   gene            complement(293452..293835)
FT                   /locus_tag="CLJU_c02880"
FT   CDS_pept        complement(293452..293835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02880"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13372"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLH6"
FT                   /protein_id="ADK13372.1"
FT                   /translation="MKSNEFILYGLSKHKQIIDKITAELNASKYNFDIKLILTEALTNA
FT                   FKHGNNMSMDKPIYLKYVYDDSNVQFEIKDCGTGFKDTIINKQLDNENILEDEGRGLFL
FT                   IKNLSDHIELKQNTLIIEKSLAS"
FT   gene            complement(293852..295360)
FT                   /locus_tag="CLJU_c02890"
FT   CDS_pept        complement(293852..295360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02890"
FT                   /product="putative protein phosphatase with a PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02890"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13373"
FT                   /db_xref="GOA:D8GLH7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLH7"
FT                   /protein_id="ADK13373.1"
FT                   /translation="MNYKSGESELYHKETLYLDSLKCFTKHKANKGNYNLWILEGVLKG
FT                   ITDIIKVFDSNGRILFFNEAGCKFYKKTKDEVKGKKCFEILNMKENCKNCGVEEALRTK
FT                   KLIRIEKYFPEHNKFMDCTYNPVMDNLGKVAFVVEQQKDITKKKILANTIRESEERYRK
FT                   IINLSPEAIIITVDSKIVLANHKACNLVGTDYDKIIGENIYKYISKEFIKIAHKRAKQI
FT                   LEGKKSKSIYDYKIIRYSNTLIDVEISASYLMYKGSPAIQAIIRNISDMKRRLNEASKL
FT                   QRKYIEDTSPIPEKLKLESLYMPAKTVSGDFFRLYKVNEDLVLGIIGDVSGKGITAALN
FT                   VLAFFVLFREAILISRDPLEIVKILNKKIADYLSDNHCIAACCFSLDFKKNEARVAGAG
FT                   ISQFMFQKSNCNPQEFIVRGPFLGMFQNAVFDENVIFFKEGDRFYFPTDGLDFIFNDNE
FT                   IRKNYLKSHTLTEFITYLKAKLNNIINETGALKDDSTIIALEIK"
FT   gene            295783..296151
FT                   /locus_tag="CLJU_c02900"
FT   CDS_pept        295783..296151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02900"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13374"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLH8"
FT                   /protein_id="ADK13374.1"
FT                   /translation="MSHRKIIEDYYCDVNNLAELLSKLTNSYRLLIGGAGELNSIAGVH
FT                   KGEVKDSLKRVYKLGNVIDKVVDTLKDSTEVYSEYCKITTEVIKAKMQIKYVETEIDEE
FT                   LFLNNLDDMDEDDDTKGD"
FT   gene            complement(296205..296726)
FT                   /gene="pssA"
FT                   /locus_tag="CLJU_c02910"
FT   CDS_pept        complement(296205..296726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="CLJU_c02910"
FT                   /product="phosphatidylserine synthase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02910"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13375"
FT                   /db_xref="GOA:D8GLH9"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLH9"
FT                   /protein_id="ADK13375.1"
FT                   /translation="MAKIARSSVPNAFTFANLSCGVMSLMMSFQENYLWAGIFILLACL
FT                   ADRYDGRVARFLKVSSELGKQLDSLADLVSFGVAPSVLTFNIYNFSTFGLLGYMLVLLL
FT                   PICGAYRLARFNITDFDGQFFGIPITFAGMFMALYCLITFRHPVPAELTILLIVILSYL
FT                   MICKYRFKKF"
FT   gene            297214..297774
FT                   /locus_tag="CLJU_c02920"
FT   CDS_pept        297214..297774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02920"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02920"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13376"
FT                   /db_xref="GOA:D8GLI0"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLI0"
FT                   /protein_id="ADK13376.1"
FT                   /translation="MDSIRSYIQSYGKFSDIIFILIYTIRPVVIILPASLMSIIAGSIF
FT                   NSYIALLLSMIGCFGSATLAFFLSRFLGRSFVNKILKGKALTLNDNIEKYGFRIMTAMR
FT                   LSFVFPYDPLSYAAGLTKIKYRDFIFGTLVGILPEMVTYSLIGGNLTKPFSFKFILPII
FT                   VLFIIACISIYMHKKKSKDTNNL"
FT   gene            297898..298326
FT                   /locus_tag="CLJU_c02930"
FT   CDS_pept        297898..298326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02930"
FT                   /product="conserved hypothetical protein containing CBS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02930"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13377"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLI1"
FT                   /protein_id="ADK13377.1"
FT                   /translation="MKVKDIMTKSVISLNDDDTVEKAAQIMQQNNIGAVPVCKNGKVIG
FT                   IVTDRDIAIRSASQSGGTESKFVRDIMSANPVTGSPDMNLEDASRIMSDKQIRRLPIVE
FT                   NKNVVGMVSLGDLAVNPKSNTQAGDALSSISENNYSAF"
FT   gene            298464..299360
FT                   /locus_tag="CLJU_c02940"
FT   CDS_pept        298464..299360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02940"
FT                   /product="putative kinase"
FT                   /note="possibly involved in cell signalling processes"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02940"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13378"
FT                   /db_xref="GOA:D8GLI2"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLI2"
FT                   /protein_id="ADK13378.1"
FT                   /translation="MNKVKFIYNPYSGENTIISNIDKVIMIHQKYGYEIVPFRISFEFD
FT                   IKKAFEDIDETYKYILIAGGDGTVDNVVNCMKRLNIDMPIAILPVGTANDFAKFIGMPQ
FT                   NIKKACQQIVNSVPKKLDLGKVNDKYFINVASTGLFTDVSQKTDVNLKNTMGKLAYYVK
FT                   GLEQLPNLRKIKVKVKSENAIFDGDMYLMLIFNGQMAGNFKFAYKAQIQDGLLDVIIIK
FT                   AGMIKDIISLFIKMLRGDHLEDTSGLIYFKSNKIEVYCDEDIVTDIDGERGPDFPLVIE
FT                   CIKGGIEVLGLKDEIKL"
FT   gene            299439..300140
FT                   /locus_tag="CLJU_c02950"
FT   CDS_pept        299439..300140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02950"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02950"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13379"
FT                   /db_xref="GOA:D8GLI3"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLI3"
FT                   /protein_id="ADK13379.1"
FT                   /translation="MAFYVYVFLLLIMLIMLFRGAILIRFLSYKIKVVAFIIIGAMLLR
FT                   YTSIFIMYFSSSMKYLYLLKVPFFLNLLSVPIIVITVLYIFVRKDNVKFYYIFIITAVL
FT                   CAAYAIVMYKCEAVLQNLEEYKFILGYTLVLSNQYIYWGYLVFNTLVIFFVLGFVNKTN
FT                   ANKLGIYMVLLAACITISELIAWLMGIRVLAENVLGDVGWIVVFIYALSKVKKTADRIN
FT                   YKVPNKVSGKK"
FT   gene            complement(300525..302369)
FT                   /locus_tag="CLJU_c02960"
FT   CDS_pept        complement(300525..302369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02960"
FT                   /product="predicted radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02960"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13380"
FT                   /db_xref="GOA:D8GLI4"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013704"
FT                   /db_xref="InterPro:IPR022946"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR024560"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLI4"
FT                   /protein_id="ADK13380.1"
FT                   /translation="MNLNTSFLPICKNDMNAKNINQLDFVLITGDAYVDHPSFGSAIIS
FT                   RVLEKEGFKVGIIAQPNWKNVNDFMKLGKPKLAFLINSGNIDSMVNHYTASKKKRHDDL
FT                   YSPGGKSGYRPDRAVIVYCNRAREAYKDVPIVIGGIEASLRRFAHYDYWSDNVRRSILL
FT                   DSKADLLIYGMGEKTIVQVANLLKYGMGIHKITDVRGTVYPCKDKSLIKDYVEVPSFEK
FT                   VTQEKNAYAESYKLEYYEQDALRGKTLIQKHGDHYIVQNPPQFPLTEEEMDIVYDLPYM
FT                   RTYHPIYEKFGGIPAIKEVSFSITSHRGCYGGCSFCALTFHQGRTIQNRSQKSIIDEAK
FT                   LLTTLDDFKGYIHDVGGPTANFRHKACKIQEKAGVCKNRQCLFPSPCKNLIIDHSEYLN
FT                   LLRKIRKIPGIKKVFIRSGIRYDYLINDKNTDFFEDLCKYHISGQLKVAPEHISDRVLN
FT                   QMGKPKMDVYNKFVKKYFEINKKINKKQYLVPYLMSSHPGSDLNAAIELAEYIKSMGYT
FT                   PEQVQDFYPTPGSLSTTMYYTGINPLSGEKVYVPKSQKEKNEQRALLQFSVPKNYNLVK
FT                   EALIKCGREDLIGSGPHCLIPKNPPRRRHHKSSHKSSK"
FT   gene            303063..304325
FT                   /locus_tag="CLJU_c02970"
FT   CDS_pept        303063..304325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02970"
FT                   /product="putative magnesium binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02970"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13381"
FT                   /db_xref="GOA:D8GLI5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLI5"
FT                   /protein_id="ADK13381.1"
FT                   /translation="MKKLSSFLLSKVLYKKVYNEFDEYVGKLWDVYVSSDHGMPRAIGY
FT                   KIKKGKEILNCECRNINFYDDNDKVIIKGEGIREIILQSYSYLLSKHLLDRQIVDINGK
FT                   KLVRVNDLRIAEMAGEYRVVAVDTGVLALGRRLGIEKIIKKFYDLFNKKPEDSLIIWDN
FT                   VESLEMINNNLKLSVPYKKLSKLHPADLADILEDMDVNYRKKVFESLDEDLAADTLEEI
FT                   DPEVQLDILENLSQSKRDEVLYNMPNDEIADILDEVDKDTAEKILINMEKNDADEVRSL
FT                   MEYKEETVGSIMNKDFICFNINITVKDTIEFLKEINPEDEVSHYIYIINDQKQLEGVVS
FT                   LKDLILSDFEDTLKAIMIKDVVSINHKENIDEAIEMCSKYNLISLPVIDDEEKLCGIVI
FT                   MNDLVEDILIPNWRKRLRKVG"
FT   gene            304444..305133
FT                   /locus_tag="CLJU_c02980"
FT   CDS_pept        304444..305133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02980"
FT                   /product="spore cortex-lytic enzyme precursor"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02980"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13382"
FT                   /db_xref="GOA:D8GLI6"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR014224"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLI6"
FT                   /protein_id="ADK13382.1"
FT                   /translation="MGKKIMRFKRELVLILAIVFTYASTSLFLLPYNNAVKAVAYYYGS
FT                   RGNMVIQIQQKLRSWGYYNGSVDGVYGYQTYTAVKYFQSKNGLKSDGIVGDATLAALAI
FT                   NTGSNTGGNSQNVTLIARLINGEARGEPYEGQVAVGAVILNRTRDPRFPSTVAGVIYQP
FT                   GAFTAVVDGQIHSNMQQSSINAARDALNGWDPSGGAIYYFNPSTATSSWIWSRPLIKII
FT                   GKHRFCR"
FT   gene            305369..305719
FT                   /locus_tag="CLJU_c02990"
FT   CDS_pept        305369..305719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c02990"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c02990"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13383"
FT                   /db_xref="InterPro:IPR017016"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLI7"
FT                   /protein_id="ADK13383.1"
FT                   /translation="MIIENFISKEKVDQIKYVYFYRLLKGKIAISYSHKDVEEVQAYGI
FT                   EIERQDILDGKLINVQRDSVQNISPERYKVHNLLKLLYDNKVSPIHLVDVIGDYVDEYS
FT                   MDFDNQKNYAAY"
FT   gene            305846..306250
FT                   /gene="acpS"
FT                   /locus_tag="CLJU_c03000"
FT   CDS_pept        305846..306250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpS"
FT                   /locus_tag="CLJU_c03000"
FT                   /product="phosphopantetheinyl transferase"
FT                   /EC_number="2.7.8.7"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03000"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13384"
FT                   /db_xref="GOA:D8GLI8"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLI8"
FT                   /protein_id="ADK13384.1"
FT                   /translation="MIFGVGVDIVEIRRIEQAVSKHSNFIDRIFSKNEVEYLKNKNLRP
FT                   EFIAGRFAAKEAIVKALGTGFSGFDFRDIEVDRTALGKPIVVLKGKAKLIANKCGNYKI
FT                   HLSISHGVDNAIAYAVMEVDGVEDSDCKNS"
FT   gene            306303..307721
FT                   /locus_tag="CLJU_c03010"
FT   CDS_pept        306303..307721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03010"
FT                   /product="putative sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13385"
FT                   /db_xref="GOA:D8GLI9"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLI9"
FT                   /protein_id="ADK13385.1"
FT                   /translation="MENAALKVVKNIDLKKCESFCVICTKGNNGGDGFAVARHLYNLNK
FT                   KVHVFLVGKESGMSEDCSVNYNILKNLKINLDIVDSEESLVKLKKCIKESDVTIDALFG
FT                   TGISRNILGIQDSVITLINEYGSYIISVDIPSGLNGDTGNVMGNCVRANKTITFQLYKM
FT                   GFLKYGSDKFTGEVIVEDIGIPSLAVEKFSGSEFIMDQDFIKGKLKIRDKYSHKGDYGR
FT                   VLIIAGSKGFTGAAYICTQGAVRSGAGLVTLGCYKDIQPILSEKLVEGMTIDLEENFKL
FT                   EKTIEKSDAIAIGPGMGANDSTLNLVKKVITTFKKTVVIDADGINVLSRNLNILKQKKC
FT                   DVILTPHLGEMARITGLGIEYISENRIKVAKDFAKEYNIIVLLKGYNTVITDGNSVAIN
FT                   STGNSAMASGGMGDCLTGIIASFSAQKQGPFEAASIAAFIHGYVGEELSKDMYSVNASH
FT                   VLHQLPFSIKKLTE"
FT   gene            307817..308425
FT                   /locus_tag="CLJU_c03020"
FT   CDS_pept        307817..308425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13386"
FT                   /db_xref="InterPro:IPR014584"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLJ0"
FT                   /protein_id="ADK13386.1"
FT                   /translation="MRKRLLILGIMFFILSVIFSSCGKDPQNTEKIIYYLKNLNSYSCN
FT                   VNILIKNDKQQINYNGRQFYDSRYGERFDLDNNRIIIYKDNKIYVKDIKRGNSYNIDKN
FT                   FQSLFKFSFIKEYISLLYTNEKIENSFKKVGNEEYQVINLDIPGNNKNMYKAQLYVNIK
FT                   DNVPAYVIIYDSKYKKRIEIKYTDFKSNVELKEDMFKIN"
FT   gene            309428..309754
FT                   /locus_tag="CLJU_c03030"
FT   CDS_pept        309428..309754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03030"
FT                   /product="putative CopG-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13387"
FT                   /db_xref="GOA:D8GLJ1"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLJ1"
FT                   /protein_id="ADK13387.1"
FT                   /translation="MYMSNSKRLVVNLSETLYNEFNKALKEDCKKRSEFIREVIILYIN
FT                   EKKRLNRISEMEKGYREMAQLNLEFAEMGFASDIKELKEYEAKLSESDLSDDNSSEKRR
FT                   YILC"
FT   gene            309714..310064
FT                   /locus_tag="CLJU_c03040"
FT   CDS_pept        309714..310064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03040"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13388"
FT                   /db_xref="GOA:D8GLJ2"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLJ2"
FT                   /protein_id="ADK13388.1"
FT                   /translation="MTTVVKRGDIFYADLSPVVGSEQGGVRPVIILQNDVGNKYSPTVI
FT                   VAAITSQINKAKLPTHVEISSEAYGLNKDSVVLLEQIRTLDKRRLKEKIGHMTDVDMKK
FT                   VDGALLVSVGLQ"
FT   gene            310240..311064
FT                   /gene="tktA1"
FT                   /locus_tag="CLJU_c03050"
FT   CDS_pept        310240..311064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA1"
FT                   /locus_tag="CLJU_c03050"
FT                   /product="transketolase, subunit A"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13389"
FT                   /db_xref="GOA:D8GLJ3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLJ3"
FT                   /protein_id="ADK13389.1"
FT                   /translation="MKKDIEELKKIAVTIRKDIIKMLTESSSGHPGGSLSAVEVLTTLY
FT                   FYEMNINPEQPRDLDRDRFVLSKGHAAPALYSTLARKGYFDVDELKSLRKIGSMLQGHP
FT                   NMNEVPGIDMSTGSLGQGISAAVGMALAGKMDKKDYRVYTLLGDGELEEGEVWEAAMAA
FT                   GHYKLDNLTAFVDANGLQIDGPCEEVMSAYPIGDKFKAFKWNVIEVNGHSFEELIDAIE
FT                   KAKTVKNKPTMIVCKTIKGKGVSFMENEVGWHGSAPNIEQCEKALAELGGEE"
FT   gene            311064..312005
FT                   /gene="tktB1"
FT                   /locus_tag="CLJU_c03060"
FT   CDS_pept        311064..312005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktB1"
FT                   /locus_tag="CLJU_c03060"
FT                   /product="transketolase, subunit B"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13390"
FT                   /db_xref="GOA:D8GLJ4"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLJ4"
FT                   /protein_id="ADK13390.1"
FT                   /translation="MSNKIATREAYGKALVELGAENKKVVVLDADLSKSTKTAKFKDAY
FT                   PDRFMDMGIAEGNMMAVAAGLSTCDKIPFVSTFAMFATGRAFEQVRNSICYPKLNVKIC
FT                   ATHAGITVGEDGASHQSVEDISLMRSIPNMTVICPSDAVEAEAAVKAVAEMDGPCYVRL
FT                   GRSGVSVINDNADYKFEIGKAVQLREGKDAVIIATGIMVDAALEAYNNLAEEGIKVSVL
FT                   NIHTIKPIDKEAVINAARQTGAVITAEEHSVIGGLGSAVCEVLSENLPTPVVRVGIKDT
FT                   FGQSGKPAELLKAYKLTAEDIVKAVKKCMALK"
FT   gene            312192..312878
FT                   /gene="ftsE"
FT                   /locus_tag="CLJU_c03070"
FT   CDS_pept        312192..312878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="CLJU_c03070"
FT                   /product="predicted ATPase involved in cell division"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13391"
FT                   /db_xref="GOA:D8GLJ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005286"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLJ5"
FT                   /protein_id="ADK13391.1"
FT                   /translation="MIQFKNVSKVYNNNIFALSNINLKIEKGEFVFLVGPSGAGKTTFV
FT                   KALLKEVQPTSGDIIVNNLNITKLKRSKIPLYRRKLGVVFQDFRLIPTLNVYENVAFAM
FT                   RVIEAHPKEIRKKVPVVLSLVGLANKYKSFPHELSGGEQQRISLARAIVNNPSILIADE
FT                   PTGNLDPDTSMDIMETINDINEAGTTVLMATHASDIVDSMRKRVIALEKGIIVRDEQRG
FT                   AYGYED"
FT   gene            312868..313758
FT                   /locus_tag="CLJU_c03080"
FT   CDS_pept        312868..313758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03080"
FT                   /product="putative cell division protein"
FT                   /note="ftsX-related"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13392"
FT                   /db_xref="GOA:D8GLJ6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR004513"
FT                   /db_xref="InterPro:IPR040690"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLJ6"
FT                   /protein_id="ADK13392.1"
FT                   /translation="MRISTVSFSIKDAFRNLNRNKTISIASAATVAATLFIFGIYLLAM
FT                   MNIKQGILEVQSKVEVKIYLQDNITRIQKRNIEDKINTTDGVVDVSYETKSQALDKFRN
FT                   QLGQENKSLVEGLEKDNPIPSAYIVKVSDPQVVSRVVKNVQGMPGIYSVQDAREIVDKI
FT                   IAITRTIKWVGTIIFIILIGVSLFLIGNTIKITVYSRRKEIGIMKYIGATDWFIRWPFI
FT                   IEGIIIGIAGGIVSDIILYYLYKIVYVKAASTLVIMQLISPTYVITSILGIFILVGIII
FT                   GAAGSALSIRKFLEV"
FT   gene            313932..315107
FT                   /locus_tag="CLJU_c03090"
FT   CDS_pept        313932..315107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03090"
FT                   /product="predicted protease"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13393"
FT                   /db_xref="GOA:D8GLJ7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLJ7"
FT                   /protein_id="ADK13393.1"
FT                   /translation="MNSKRKWIGWTIAIVLITNILTMFGTTSFITSAQGNTVGNFGKLF
FT                   EIRSQLYKYYDGPINDATLVEGAIKGMTSSLNDPYTVFMNKKEFQDFNVQTQGNYSGVG
FT                   IQVAAKDSNIVVMDVFDNSPSKKAGIMKNDVIEKVNGTSVSGKDLDKAVSLMKGQENTE
FT                   VTLTLYRESKGNFDVKVKRQKIDIATVKGEMLQDNVGYIQVSMFDENTAKNFKDQLNKL
FT                   RSQGMKSLIIDLRDNPGGLLDQCVDMVSNFVPSGKVIVSTVDKYNNKKEYKSKGGDFTN
FT                   LPLTVLTNGNSASASEIFSGAIRDYKIGTLVGEKTYGKGVVQTILDTGSGTALKVTISK
FT                   YYTPNGENIHKKGIKPNIEVVYPEELKKAAYDRNKDPQFSKALEIAKSKIK"
FT   gene            315211..316512
FT                   /locus_tag="CLJU_c03100"
FT   CDS_pept        315211..316512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13394"
FT                   /db_xref="GOA:D8GLJ8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLJ8"
FT                   /protein_id="ADK13394.1"
FT                   /translation="MILLYTLKSIAFALTEPYLIIILAVLALVLYRKNKQITVMQKMII
FT                   GERVNSPFELTMSQIVIGIFAGVVITTIMSYLGIVFDESSSVDLVFLASIIFMFFNPRF
FT                   ICFSYSGAVLGFLSLTMAILSSKFNLPNLNFLKIDVVALMSMVAVIHFVEGILIIFDGK
FT                   TGSIPVFTSKGGSIIGGFALRRYWIVPVAIFFMIHDKSAIASSWQVSLPGWWPIVKTSI
FT                   PFNILKNAVLTLMPFYAVVGYNSVTFTKSVKEKSRISGVIVMLYGIILFGIAQLAVLNV
FT                   VLKFFVVIFAPLAHEGIIILQRYLENRGAPKYISSSEGIMVLAVAPNSPASEMGIKTGD
FT                   LLVEVNGEKIESEDRITEIVKEYSNFIWFKVKNVSGALEQVSYNKMNKDKRLGIVFVPR
FT                   KVPKDSMVVKFDKSRFSQMLNDMKNKDKDKDKDD"
FT   gene            316516..318498
FT                   /gene="uvrB"
FT                   /locus_tag="CLJU_c03110"
FT   CDS_pept        316516..318498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="CLJU_c03110"
FT                   /product="excinuclease ABC, subunit B"
FT                   /note="helicase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13395"
FT                   /db_xref="GOA:D8GLJ9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLJ9"
FT                   /protein_id="ADK13395.1"
FT                   /translation="MGVFKIHSKFKPTGDQPKAIDSIADGVLKGNKFQTLLGVTGSGKT
FT                   FTMANIIEKVQKPTLVLAHNKTLAAQLCSEFRDFFPDNSVEYFVSYYDYYQPEAYIPQT
FT                   DTYIEKDASINDEIDKLRHSATSALLERKDVIVVASVSCIYGLGNPEEYKKLTLSLRPG
FT                   MIKNRDEVLKKLVEIQYERNDINFVRGTFRVKGDIVDIFPAASTDHAIRVEFFGDEIDK
FT                   IREFDVLTGDTIGFRKHANIFPASHFATSREKMELAIEKIEEELEHRLKELTSQDKLLE
FT                   AQRLKQRTNFDIEMMREVGYCSGIENYSRIMDGRAKGSPPQTLIDYFPDDFLLFIDESH
FT                   VTLPQVKAMYAGDRSRKDSLVEYGFRLPSAYDNRPLKFQEFEKKINQVVFVSATPADYE
FT                   LEHSENVAEQILRPTGLLDPEIIVKPIKGQIDDLYNSIQKTISRGYRILVTTLTKKMAE
FT                   DLTDYFKDMNVKARYLHSSIATIDRMKIIRDLRKGEFDVLVGINLLREGLDIPEVALVA
FT                   ILDADKEGFLRSERSLIQTIGRAARNSESKVIMYADVITKSMDKAISETKRRRKIQIEY
FT                   NKKNGIVPKTINKAIREVIESTMVLEEKEEYNSLEEAVKADNEKIDELIEAHERQMKTA
FT                   AKELRFEEAAKLRDAILKLKKQKNK"
FT   gene            318536..321358
FT                   /gene="uvrA1"
FT                   /locus_tag="CLJU_c03120"
FT   CDS_pept        318536..321358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA1"
FT                   /locus_tag="CLJU_c03120"
FT                   /product="excinuclease ABC, subunit A"
FT                   /note="ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13396"
FT                   /db_xref="GOA:D8GLK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLK0"
FT                   /protein_id="ADK13396.1"
FT                   /translation="MKDSIVIKGAKVHNLKNISLTIPRDKLIVFTGLSGSGKSSLAFDT
FT                   LYAEGQRRYVESLSAYARQFLGQMDKPDVEYIEGLSPAISIDQKTTSRNPRSTVGTVTE
FT                   IYDYLRLLYARIGVPHCPKCGKEITQQTVDQMVDKIMEMPERTKIQILSPVIKGKKGEH
FT                   IKVLESIVKNGFVRARIDGEIVDLQDEEIKLEKNKKHTIEIVVDRLIIKSEIRSRLADS
FT                   IETSLKLSDGILIVNILGGEDILFSEKFACPECGISIGEITPRTFSFNSPFGKCDTCDG
FT                   LGTLLEIDENLVIPDRKKSILEGAITAWGEGSLKEGSWTFSILKALSSTFKFKLDTPIE
FT                   KLDPKVVDILLYGLRGGKIRVKYRKENRMMEFNHSYEGIVNTLKRRYMETNSDYIKKEI
FT                   ENYMSDNPCPKCKGARLKPEVLAITVGEKNIFELCNMSIKDELKFFKEIQLSEKDKIIS
FT                   DQVLKEISGRLQFLIDVGLDYLTLSRTAGTLSGGESQRIRLATQIGSSLVGVLYILDEP
FT                   SIGLHQRDNDRLISTLKHLRDIGNTLIVVEHDEDTMRQSDFIVDIGPGAGEHGGEVVAA
FT                   GPISDIIKCDRSITGQYLSGKKKIEIPEHRRECSGKYIKVIGASENNLKNIDVSFPLGI
FT                   FTCVTGVSGSGKSTLVNEILYKALHKELNNSKDRPGHYKNILGTENVDKIINIDQSPIG
FT                   RTPRSNPATYTGVFDIIREVFASTSESKMRGYKPGRFSFNVKGGRCEACSGDGIIKIEM
FT                   QFLSDVYVPCEVCKGKRYNRETLQVKYKNRNIDDVLNMTVEEALKFFENIPRIKNKLQT
FT                   LMDVGLGYIKLGQPSTQLSGGEAQRIKLAHELSKRSTGKTMYILDEPTTGLHIDDVSKL
FT                   INILQRIVDVGNTIVVIEHNLDVIKCADYIIDLGPEGGEKGGNILCMGTPEQISENKGS
FT                   YTGQYLKKML"
FT   gene            321428..321868
FT                   /locus_tag="CLJU_c03130"
FT   CDS_pept        321428..321868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03130"
FT                   /product="conserved hypothetical protein with a FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13397"
FT                   /db_xref="GOA:D8GLK1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLK1"
FT                   /protein_id="ADK13397.1"
FT                   /translation="MDLSKLSIVFKIVIIGIVYIIIFWALRIMYKDVKNGSKRGRNVNR
FT                   KSFGLEVVNPGENANLRKGAVIPVRREITIGRKGDNQLMLEDPYTSGHHARIYIKNGKE
FT                   CILEDMGSTNGTLLNGKKLRGKHYLASGDEIKIGNTSFKVIG"
FT   gene            321921..323123
FT                   /locus_tag="CLJU_c03140"
FT   CDS_pept        321921..323123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03140"
FT                   /product="predicted cell division protein"
FT                   /note="ftsW-related"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13398"
FT                   /db_xref="GOA:D8GLK2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLK2"
FT                   /protein_id="ADK13398.1"
FT                   /translation="MDTTRDEKKLLRYTYLLCFVCFLNLAIIKQPFDKGAMIMALVTCL
FT                   LIGYSYFVIRKFFSDGDKYIFIFSSILSVIGMVMIYRIDTAASIKQIIWFAVGVTGFIL
FT                   IVVLMPDTSGFSKYKYIYLVVTLIFMAMGTFSGTEINGSKNWVSLGGIQFQPSEFGKLF
FT                   LVAYLAAELKDYKNFKNLIIPCAVVMLSLVFMVIQRDLGSALIFFGISVTMLYIATSKF
FT                   RYVAICFLLSAAGSIVSYRLFNHVRIRVMIWKNPWPYANNQSYQIVQSMFSIASGGLTG
FT                   TGLGLGHPEYVPINTTDFIFAVLCEELGILIGFAIIILYFLLFYRCMRAAVYGNDKFSR
FT                   LLAVGYSAMIASQVLVIVGGVMNAIPLTGITLPLVSRGGSSMLITFFSLGIIQKISEEG
FT                   R"
FT   gene            323128..324555
FT                   /locus_tag="CLJU_c03150"
FT   CDS_pept        323128..324555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03150"
FT                   /product="predicted peptidoglycan synthetase"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13399"
FT                   /db_xref="GOA:D8GLK3"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLK3"
FT                   /protein_id="ADK13399.1"
FT                   /translation="MNNIVNNIKKVMMVFLICFIALISYMTYFEMIVGPKIENSPYNRR
FT                   LWIKRNEVLRGTIYDRNGNALTKSDPINSETQKREYTGGAMFAHVLGYVDQKYGITGLE
FT                   KKYDEQLMSSNIQDSIKSLIQNKGKSQKKVGNSLKTTLDLETQKMAYDLLDGNKGAVVA
FT                   LNPKTGEVIALVSRPSFDPNDLANTWQQLNQDKTKPLLNRATAGLYPPGSTFKTVTAVS
FT                   GLENISGIQNRYFQDNGELPLGGGYSLHNFEGEVLGSINFKQAYTHSSNAYFGSLGIEL
FT                   GNDRLKQTAEKFFFNKEIPTDGIPVEPSKFPMLKSYEKGSIAQSAIGQSSDLASPLQMA
FT                   VVTSTIANGGVMMKPHLVSDVLTSTGEEVKSIQAEQVGQIISSNTANTMKDLMRSVVES
FT                   GTGTNASVEGVEVAGKTGTADNQTEGPGSPPHSWFIGFAPYDDPQIAVAVIVENGGQGG
FT                   KLAASIASQVIRTALRK"
FT   gene            324698..325306
FT                   /locus_tag="CLJU_c03160"
FT   CDS_pept        324698..325306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13400"
FT                   /db_xref="GOA:D8GLK4"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLK4"
FT                   /protein_id="ADK13400.1"
FT                   /translation="MKGKTHAEMGIVTFLSVYNVLPGKFNYIGLLIVAFSSILPDVDHP
FT                   KSIINKYILPFRNKTSKIMVYSSLGIGLLWYDYLYTNAPIIKAIGISFIIIAVSSHRNG
FT                   LTHSLMGMILFSFIIGYLGNMYNVHYLVYYFMIGYGMHLLCDMVTNRGVPLFYPFKNKK
FT                   FKLPLTYNTNSKIGCVIEDFLMIFGLLFTIYKLPIIFCK"
FT   gene            325324..327192
FT                   /gene="uvrC"
FT                   /locus_tag="CLJU_c03170"
FT   CDS_pept        325324..327192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="CLJU_c03170"
FT                   /product="excinuclease ABC, subunit C"
FT                   /note="nuclease subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13401"
FT                   /db_xref="GOA:D8GLK5"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLK5"
FT                   /protein_id="ADK13401.1"
FT                   /translation="MFDFEYQLKVLPDKPGVYLMKNSLGEVIYVGKAKILKNRVRQYFQ
FT                   NSKNHSEKVKAMVKHIAEFEYIVTDSEMEALILECNLIKKYRPRYNILLKDDKGYPLIK
FT                   ITVNEDFPRIISARNMVKDGCKYFGPYISPSAVYETMEIIKKIFPIRTCRLSIKEGEMK
FT                   GRPCLNYYIGLCKAPCTGYITKEEYGKIVSGVMDFLSGKNRDISKKLKEDMEIASEKLE
FT                   FEKAAELRDKILAVQKIIEKQKITTGGFEDEDFINMYSDNVDSCVQVFFSRSGKIIGRE
FT                   HFILENTQDLPKGEIVSNFIEGFYGGTAYIAKTIYVPEADEIELLQNWLSMKKDARVYI
FT                   KIPQKGEKRATLNMVEENAKTTLKNFKLKLIQDKKMYNTALEELTEALDMEDIPHRIEA
FT                   YDISNIQGVDSVGTMVVFENGRAKNSDYRRFKINSVKGANDYDSMREILTRRFKHGFDE
FT                   IERIKKRNLKFSAGKFCAFPDLILMDGGKGQVNAALEVLKKFNIDIPVCGMVKDDRHRT
FT                   RGLIYKNEEVLISPHSNVIKLIARIQDEVHRFAITYHRSLRNKRVLHSVLEDIPNVGNK
FT                   RRKELLKKFESIENIKKATMNELMDTPSIDRRTAESIISYFKKNEN"
FT   gene            327397..328311
FT                   /gene="murB"
FT                   /locus_tag="CLJU_c03180"
FT   CDS_pept        327397..328311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="CLJU_c03180"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13402"
FT                   /db_xref="GOA:D8GLK6"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLK6"
FT                   /protein_id="ADK13402.1"
FT                   /translation="MNKFKDFATNLEKILDKEDIKIDEPMKEHTSFRVGGPVDILVTPK
FT                   KFQEVVDVITLCKEHNIPYYIMGNGSNLLVKDGGIRGIMIKLIKLNEVKVEDNKIITES
FT                   GVSLKDISTTALNNKLSGFEFACGIPGSVGGAVTMNAGAYNGEISHVVESAKVIDNEGK
FT                   IKVLDRKQLELEYRSSSILKYKYTVLEVTFNLEHGDYEKIKNRVEDLNRRRNEKQPLEY
FT                   PSAGSTFKRPEGYFAAKLIEDSGLKGKSVGGAQVSEKHSGFIINKGSATAKDILDLIAI
FT                   VQHKVKEKFNVDLYTEVRVIGEE"
FT   gene            328433..329317
FT                   /locus_tag="CLJU_c03190"
FT   CDS_pept        328433..329317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03190"
FT                   /product="conserved hypothetical protein"
FT                   /note="predicted to be ATP binding"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13403"
FT                   /db_xref="GOA:D8GLK7"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLK7"
FT                   /protein_id="ADK13403.1"
FT                   /translation="MRFVIVTGLSGAGKTQAIRSLEDLGYFCVDNLPPTLIPKFAEACY
FT                   KTDGKIDKIALVIDIRGGQFFNDIFESLNYLKEQGYKYEILFLDASEEVLIKRFKESRR
FT                   KHPLAPDGRILNGIIMERNKLRELKDRADNIIDTSNLVTRELREEITKIYSEEGQMETE
FT                   LMITVLSFGFKYGIPVDSDLVFDVRFLPNPFYIPELKEYSGKDTSVMKYIMSFKETNEF
FT                   INKLESMLEFLIPNYLKEGKRQLIISIGCTGGRHRSVFIANAIYNRLKNNGHKVNIDHR
FT                   DIEEDVNKGGKKL"
FT   gene            329314..330642
FT                   /locus_tag="CLJU_c03200"
FT   CDS_pept        329314..330642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13404"
FT                   /db_xref="GOA:D8GLK8"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLK8"
FT                   /protein_id="ADK13404.1"
FT                   /translation="MKIVDWLRPGIKVKRWVMLGAMGVLFIIFGVIEFVNRRFYSLYYI
FT                   SFYVFLIISGIFVVYISITQGMRSIIALINKGYLSVSLDSRKLENLIYEKRLLVKGPKI
FT                   VAIGGGTGLSTMLRGLKYYTSNITAIVTVADDGGGSGDLREDLGMLPPGDIRNCIMALA
FT                   DTEPLMEDLLQYRFKDGRLKNQSFGNLFLAAMDGISGNFEEAVHKMSSVLAVTGKVMPV
FT                   TLDNLTLKARLKDGSIVEGESNIPQKAIERNSPIDKIFIEPRGARALKEAVEAIKEADA
FT                   VILGPGSLYTSVIPNLLVGDIASALQNTNAVKLYVSNIMTQPGETDGFSVEDHISAIFN
FT                   HVGAPIIDYVIINVGKINTELEGKYKEEESHLVKINEDLVASMGVKVIEGDFISIKNGL
FT                   IRHNSEKLASILIETIMDKKLLFDRKKIIEYFYLSERLKENRR"
FT   gene            330656..331606
FT                   /locus_tag="CLJU_c03210"
FT   CDS_pept        330656..331606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13405"
FT                   /db_xref="GOA:D8GLK9"
FT                   /db_xref="InterPro:IPR003802"
FT                   /db_xref="InterPro:IPR018478"
FT                   /db_xref="InterPro:IPR023054"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR039518"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLK9"
FT                   /protein_id="ADK13405.1"
FT                   /translation="MSFSLKVKNEVCRYSNIDEEEAIAELSAIMKVSGTLMLGGKRQFS
FT                   FKIITENAAIARFIFKILKDIFHIHTRILVKKSNSLKKNNVYVIMITEDADVRSILKKV
FT                   GLLKEEEDVFSLDYSITEDIKENEKLKKAYIRGAFLGGGSISNPEKTYHLEFVTHDSDY
FT                   ALDLSKLINGYGLNSKVIQRKSSFIVYIKEGEQIVDLLNIIGAHSSLLELENIRIMKEM
FT                   RNNVNRLVNCETANLSKTVNAAVRQMESIKLIQKEIGLNRLPENLRDIAELRLNYPDES
FT                   LKELGEMLNPKVGKSGVNHRLRRIEKIADELRKER"
FT   gene            331618..331968
FT                   /pseudo
FT                   /locus_tag="CLJU_c03220"
FT                   /note="fragment of a predicted transcriptional regulator
FT                   containing CBS domain"
FT   gene            332133..332921
FT                   /pseudo
FT                   /locus_tag="CLJU_c03230"
FT                   /note="fragment of a predicted transcriptional regulator
FT                   containing CBS domain"
FT   gene            332928..336404
FT                   /gene="dnaE"
FT                   /locus_tag="CLJU_c03240"
FT   CDS_pept        332928..336404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="CLJU_c03240"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13406"
FT                   /db_xref="GOA:D8GLL0"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLL0"
FT                   /protein_id="ADK13406.1"
FT                   /translation="MDKGKHRWVSLHQHTEYSLLDSSAKIPELIARAKELGMDSMAITD
FT                   HGVMYGCVEFYKEARAQGIKPIIGCEIYVSQGDMTIKQNNGKNENYHLVLLVKNEEGYQ
FT                   NLMKIVSTASIKGFYYKPRVDHNYLKNHSEGLIALSACMSGEVQSNILKGNIDKAEETA
FT                   LFYKSAFKDGFYLEIQYHGIEAQLKINEQLISMSKKLNIPLVATNDVHYIKKEDYRAHD
FT                   ILLCIQTGKTVDEENRMRYPSDEFYLKSPDEMYDMFSNVPESLENTIKIADQCNFDYEF
FT                   HKSKLPKFPLPEDTDPYEYMKDLCYKGLYKRYNDVTDELKSRLEYELGIIKKMGYVDYF
FT                   LIVWDFIRFARKNGIMTGPGRGSGAGSIVAYTLEITKIDPIKYKLIFERFLNPERVSMP
FT                   DIDSDFCYERRGEVIDYVVEKYGKDSVSQIITFGTMAAKMCIRDVGRAMNYSYGEVDRI
FT                   AKMIPSIPNITIDKALDMNPEFKEAYDSESRTKELIDIARALEGLPRHTSTHAAGVVIA
FT                   SEPLVNYVPLQKNEDNIVTQFTMNTLEELGLLKMDFLGLRTLTVLRDAVEMIKEDKGIE
FT                   IDLDTIDYDDKAVYNMIGEGKTVGVFQLESPGFSSFMKELKPDSLEDIIAGISLYRPGP
FT                   MSEIPKYIKNKNNPEGIEYVTPQLEHILSVTYGCMVYQEQVMQIVRDLAGYSMGRSDLV
FT                   RRAMSKKKHHVMEEERHNFVYGIVDEKGEIQVPGCVRNGISEKIANDIFDSMMDFASYA
FT                   FNKSHAAAYAVVAFRTAYLMYYYPTEFTAAMLNSVKGDSEKVAYYIRFAKSIGIEIMPP
FT                   SINESCTKFTVEDGNIRFGLSAIKNVGENVIDSIVRSRSKHGKFKDIVDFCNSIDLDSI
FT                   NKRVVESLIKAGAFDCFGVLRSQLIAVHEKVIDSVINSRKKNIEGQVSLFSQIEDSSVR
FT                   IKYPSIEEFKKLDMLAMEKEMTGLYLSGHPLDEYARTLELQADTKISDIVGRKTLEDNF
FT                   VEEAKVNDGDRVIVGGILSEVSKKITKNNDMMAFAKLEDLYGIMEIIVFPKVFQRVRSL
FT                   IEDDYMIIAKGRVSVREDEQPKLLCEVIEPLVRIDTEKLYILIEDQDILKEALERIRPV
FT                   FVNFKGNIPVYLCTKKERKKFRLDRELWIKSDLELMSFLRKSFGDNNVKII"
FT   gene            336620..337576
FT                   /gene="pfk"
FT                   /locus_tag="CLJU_c03250"
FT   CDS_pept        336620..337576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfk"
FT                   /locus_tag="CLJU_c03250"
FT                   /product="6-phosphofructokinase"
FT                   /EC_number="2.7.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13407"
FT                   /db_xref="GOA:D8GLL1"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012828"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLL1"
FT                   /protein_id="ADK13407.1"
FT                   /translation="MKTIAVLTSGGDAPGMNAAIRAVVRTALDKNLNVMGIKRGYSGLM
FT                   NGEIVPMQRSSVADIIQRGGTILKTARSKEFKTEEGRERAVNILKTFRIDGLVVIGGDG
FT                   SFRGAHELSKLGIATIGLPGTIDNDLAYTDFTIGFDTAVNTVLDAINKLRDTSTSHERV
FT                   SIVEVMGRNCGDIALYSGLAGGAENIILPEKGYDEQELCRSILEAKMKGKMHNLILLAE
FT                   GIGGAEALAEKVENITGIETRATKLGHIQRGGSPTCSDRILASRFGYRAVELLEQGKSS
FT                   RVVGIRNGKVVDLDIDEALSEPRRFDEKLYEIAYALA"
FT   gene            337607..339364
FT                   /gene="pyk"
FT                   /locus_tag="CLJU_c03260"
FT   CDS_pept        337607..339364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="CLJU_c03260"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13408"
FT                   /db_xref="GOA:D8GLL2"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLL2"
FT                   /protein_id="ADK13408.1"
FT                   /translation="MQKTKMIFTIGPASGSEEVLSELIEAGMNVSRHNFSHGDHEEHEK
FT                   RINMVKKLREKYNKPIAIMLDTKGPEIRTGNFKEDKAELKEGQQFTVYCGEDILGDETK
FT                   CSITYAELSNDVKKGDSILIDDGLVGLEVESVEANKINCTVKNSGAVGNHKGVNVPGVS
FT                   ISIPAITEKDKDDLKFGCYMEVDMVAASFIRKAADVMAIRKVLEANGGQDIQIFSKIES
FT                   QEGVDNIDEIIKFSDGIMVARGDMGVEIPIEKVPMIQKFIIEKCNKAGKPVITATQMLD
FT                   SMIRNPRPTRAEASDIANAIFDGTDAIMLSGESANGKYPVEAAKTMARIAKRAEEQINY
FT                   DSLLEKKREAHIQNVPNAISLAACTTASELKASAIITATQSGNTARMVSKYRPGCHVIA
FT                   VTPSGKVARGLALNWGVFPILAKKVESTDEMIDNSVEISLKSGYVKKGDLVIIAAGIPV
FT                   SYSGTTNMLKVHIVGDILAQGRGSGTRPGYGTAKIVSSPKEADEVVEKDDILVVKDLDK
FT                   GYINILDRVAGIISEKGGLTSHLAIECLTREIPIICNAGGATEILKTGTFITMDVIRGI
FT                   VYNGRVNIM"
FT   gene            339636..341066
FT                   /locus_tag="CLJU_c03270"
FT   CDS_pept        339636..341066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03270"
FT                   /product="rRNA (uracil-5-)-methyltransferase"
FT                   /EC_number="2.1.1.35"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13409"
FT                   /db_xref="GOA:D8GLL3"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLL3"
FT                   /protein_id="ADK13409.1"
FT                   /translation="MSEKIEKNKEYIIEIDGMGYQGEGVGKVDGFTIFIQGAIQGEKVK
FT                   VKVIKVNKNFAFGKLLEVLEPSPYRANPLCSIYKRCGGCQLQHMSYEGQLDFKKKRVKD
FT                   CLERIGKFEVEEQDRIFKDNVLEKSSEDTSVKLYNTLGMTNPYRYRNKVQLPVGKCNQK
FT                   INIGFYAKASHEIIDMESCLIQDETSDKIVKFMRDWIEKYNIEPYDEKTGRGTIKHIMT
FT                   RKGFATGEIMLVIVTFTENLPHKKELVELMCKNISGVKSIVHNINNNKTNVILGKKCVN
FT                   LWGQDTIRDAIGNFKFNISPLSFFQVNPIQTEVLYSKALEYAGLSGNEVVFDAYCGTGT
FT                   ISLFLSQKSKKVYGVEIIDEAIKNARINAEQNGVNNVEFITGKSEVVIPELISKGIKAD
FT                   VVVVDPPRKGCDMGLLKAIADMEPRTVVYVSCDPATLARDLAVLRELGYMTKEVQPVDM
FT                   FAQTAHVETVVLMSRKEK"
FT   gene            341366..341626
FT                   /locus_tag="CLJU_c03280"
FT   CDS_pept        341366..341626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13410"
FT                   /db_xref="GOA:D8GLL4"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLL4"
FT                   /protein_id="ADK13410.1"
FT                   /translation="MEQLGIKSPMGKEKWVNKCTIDVILSNEKYIGIIRIFNSRNSEVH
FT                   YLVEDNNPAIISDEKFKAVQIEKTRRSNVTTAENGTKRKDR"
FT   gene            341601..341705
FT                   /locus_tag="CLJU_c03290"
FT   CDS_pept        341601..341705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13411"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLL5"
FT                   /protein_id="ADK13411.1"
FT                   /translation="MAPSEKIGKGLKSLEIKGFPRAGVKTLTLGFFIG"
FT   gene            341961..342185
FT                   /locus_tag="CLJU_c03300"
FT   CDS_pept        341961..342185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13412"
FT                   /db_xref="GOA:D8GLL6"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLL6"
FT                   /protein_id="ADK13412.1"
FT                   /translation="MVLNNIEKDIKMKCLENDTTQMGLAEKIGKTGQYINRIVKKNDGV
FT                   LNKTFVQIMEGLGYDIELIYVKREDKEDE"
FT   gene            342226..344931
FT                   /locus_tag="CLJU_c03310"
FT   CDS_pept        342226..344931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03310"
FT                   /product="restriction-modification system"
FT                   /note="modification (methylase) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13413"
FT                   /db_xref="GOA:D8GLL7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLL7"
FT                   /protein_id="ADK13413.1"
FT                   /translation="MRSKIEANEYKDFILGFIFYKYLSEKEVAFFRKERLTDADIEKVT
FT                   EDDVKYASHVRENLGYFIAYENLFSTWLKKGNDFDISNVRDALSAFDRNIDDVYRKVFE
FT                   KIFNTLQTGLSKLGETAQAQTKAVKSLLKLIRKIPMDGKQDYDVLGFIYEYLISMFAAN
FT                   AGKKAGEFYTPHEVSVLMSEIIAEHLKNRKQIKIYDPTSGSGSLLINIGNSAAKFIDGE
FT                   NKIDYYAQELKENTYNLTRMNLVMRGISPANINVRNGDTLEDDWPFFEDTDKDKTYKFI
FT                   PVDAVVSNPPYSQKWDPSDKEFDPRYKYYGVAPKSKADYAFLLHDLYHLKDDGIMTIVL
FT                   PHGVLFRGGEEGKIREKLIEKNRIDAIIGLPPNIFFGTGIPTIIMVLKRIRPTSDVLII
FT                   DASKGFEKVGKNNKLRACDIKKIADTVKSRESIEKYSTLVSKETIRENGYNLNIPRYVN
FT                   SLEPAESWDIHATMFGGIPVKEVDQLFEYWEAFPELKDAIFRKISNEYLAVKCDDIKAA
FT                   ITSHESLKIYKQAFSNEFGNFYEELKNDLIEEILDVSAEHEKEKVSKDIFIRIENVKLA
FT                   DKYKAYQILSDNWDVISTDLEMIQSEGFEVINQVDPNMILKKKEANDDEVPEVQDGWKG
FT                   HILPFDLVQREILTEDLEELQAIEKRLTEITSLYGEIIDSLDEEERESSVLNEANDAFV
FT                   AKEVKSFVAEALSDVENDEIKALRGYLSLSKKKEKLDYVNKCDIVSWNLMEQGSDGAYK
FT                   KGSVISRISELQRMYEFPKDSFEQKVMTVLSLMEEESQAKKDLKQKSEALHIKTKETIE
FT                   NLDEDESLRLLELKWIKPLVDSLFAIPDEIIGELINKVIHLHDKYCTTFSDIEHDIENT
FT                   SAKLSNMIDKLVGSVADIEGLEELKKILGV"
FT   gene            344934..346187
FT                   /locus_tag="CLJU_c03320"
FT   CDS_pept        344934..346187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03320"
FT                   /product="type I restriction enzyme, specificity subunit"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13414"
FT                   /db_xref="GOA:D8GLL8"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLL8"
FT                   /protein_id="ADK13414.1"
FT                   /translation="MAEKKKKPEIRFKGFTDAWEQRKFSGIFIYLQNNSLSRTDLNYEQ
FT                   GSVKNVHYGDVLIKFGEVLDVEKTEIPFISNNEFNTSSTSLLRNGDIVIADAAEDETVG
FT                   KCSEIKGIGCISIVSGLHTIPCRPIKTFETGYLGYYMNSSAYHDQLLPLIQGTKISSIS
FT                   KSALQNTEIIYPDSEKEQLKIGQFFQNLDSLITLHQRKYDKLIIVKKSMLEKMFPIDGS
FT                   GSNVPEIRFGGFTDDWKFRKLGDCFSERSESMPDGELISVTINDGIKKFSELGRHDTSN
FT                   DDKSKYKKVCVGDIAYNSMRMWQGASGYSPYEGIVSPAYTVLAPNNGIDSKCISYLFKR
FT                   PDMIHTFQVNSQGITSDNWNLKYQALSEIEILIPNDIQEQKYIAEYFTGLDNLITLHQR
FT                   KLEKLRNIRFSCTEKMFV"
FT   gene            346199..350155
FT                   /locus_tag="CLJU_c03330"
FT   CDS_pept        346199..350155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03330"
FT                   /product="type I restriction enzyme, endonuclease subunit"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13415"
FT                   /db_xref="GOA:D8GLL9"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022625"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLL9"
FT                   /protein_id="ADK13415.1"
FT                   /translation="MYFDKETDFEEAVIKALIECGWESEVIRHPSEKDLIKNWANILFN
FT                   NNRQRDRLNECPLTDGEMQQIMEQIKLLQSPIKLNGFINGKSVSIKRDNPDDKEHFGKE
FT                   VSLKIYDRQEIAYGESRYQIVQQPHFPTKSPILNNRRGDLMLLINGMPVIHIELKKSGI
FT                   PVSEAYNQIEKYSHEGVFRGLFSLIQVFVAMQPEETVYFANPGEGVKFNKAFYFHWANF
FT                   NNQPINKWDEVISKLLNIPMAHMIIGFYTIADTDEGVLKVMRSYQYYAAIGIADKVAKK
FT                   NWKDNNQLGGHVWHTTGSGKTMTSFKSAQLIASSHDADKVIFLVDRKELGIQSLKEYRS
FT                   FANESESVQATENTNILISKLKSDDLDNTLIVTSIQKLSNISEEAQELNEADLKIIQSK
FT                   RIAIIIDECHRSTFGEMLTNIKNTFKHSIIFGFTGTPIQDVNIKKDSTTPTIFGDEIHR
FT                   YTLADGIRDKNVLGFDPYMVKIYDDSDLRQAVALHKAKAATVEEVMGDPKKEKMFYKYM
FT                   DSSQVKMYGEQVDGKWVAGIEDFIPNEQYQTAEYRNGVIADIKKKWTIYSRGRKFHAIF
FT                   ATSNIPEAVVYYRLMKAEMPNLSITAMFDPSIDNEGGGSLEKEDGIVEILEDYKAKFSQ
FT                   SFTIKSYDKFRKDVSLRLAHKKPYERITPDEQIDILIVVNQMLTGFDSKWVNTLYLDKV
FT                   MEYENLIQAFSRTNRLFNVADKPFGIIKYYRHPNTMEKNIEAAVKAYSGDIPTGLFVDK
FT                   LPNNLRQMNSLFDEIQILFKNASISNFERLPDESSVKAKFAKQFKQFSTHLEAATIQGF
FT                   IWSQKTYSDENGTSIVMHLDEMTYLILLARYMELAKGGGGGRSGDVPYEIDTHITEYDT
FT                   EKIDADYMNSRFEKFLKLIESEYDAESLDKTLKELHKSFSMLSQEEQKYAIIFIRDIQA
FT                   GNIHVIPGKSFRNYISQMMKKAENDRIKRVVNRLGCYEKLLREMLQRKVTKETIEAHGK
FT                   FDELKATVDNQKARTFFILVEQDNYQESRLAMYIEQYLRNFLLSGGEDPYSNVEYSEVI
FT                   REKNESEYNASVGVVLTEEKMKGKSIVSSVKSATLNNWYSESKALACMLETDCFAYVEN
FT                   KLCIYDNKYIQRNQNGRMFLTNYAKEHEEECFLQFIIDNETGKLHYITLPAAMASKSFN
FT                   YYDEINEDLLTQYGLVNEISHEMLVAINGLDFGDALTKLMSKNICNYSVRLLRDTTGLD
FT                   NRTISNMEKGNNLTKINVISACLGIQIPFRVSNKMLQLAELSLNFDLPGKKGEENGIYD
FT                   SVLHLKWATDYEDVYEELKEQNYEYLLHRPKKIK"
FT   gene            350565..351053
FT                   /locus_tag="CLJU_c03340"
FT   CDS_pept        350565..351053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03340"
FT                   /product="putative protein with a sigma-70 r4 domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13416"
FT                   /db_xref="GOA:D8GLM0"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLM0"
FT                   /protein_id="ADK13416.1"
FT                   /translation="MRNFKTSKKNRTNYIYYSADGQAIKIKPNEDEATTTIIVTLHSWD
FT                   DAEFNADKRERYHVPVYMDAYCNENEDVAADRNPYLVDTASDPLESIIQSIEETEHKEK
FT                   IGRLRAAIGTLKPQQKELIKKVFFEKRTNVSIADEEGVTEAAIRNRLKKIYEKLRKKI"
FT   gene            351169..351375
FT                   /locus_tag="CLJU_c03350"
FT   CDS_pept        351169..351375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLM1"
FT                   /protein_id="ADK13417.1"
FT                   /translation="MSLKHKVCINISHPSGNSTPVIDSGTKQIRKRLLNFLFGEKVNVL
FT                   VLTPGDSVETVEIRELKGGEIRE"
FT   gene            351407..351709
FT                   /locus_tag="CLJU_c03360"
FT   CDS_pept        351407..351709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13418"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLM2"
FT                   /protein_id="ADK13418.1"
FT                   /translation="MRSLADSIQAVCDAMVESEPKDADKKPTSVKGSEPKKTAKSVNKK
FT                   IKLEDVRAVLAEKSQAGMTAKVREIIQKYGAAKLSEVDPKHYADILKDAEGLIDG"
FT   gene            351702..352865
FT                   /locus_tag="CLJU_c03370"
FT   CDS_pept        351702..352865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03370"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13419"
FT                   /db_xref="InterPro:IPR021229"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLM3"
FT                   /protein_id="ADK13419.1"
FT                   /translation="MGSHAILSASGSHRWLNCLPSARLELEFEDKESTAAAEGTAAHAL
FT                   CEHKLRKALRMRSKRPVSSYDTDEMEEHSDAYVDFVIEQLEIAKQNCKDPLVLIEQRLD
FT                   FSCYVPQGFGTGDCIIIADEELHIIDFKYGMGVLVDAVDNPQMKLYALGALEIFDSLYD
FT                   IKEVSMTIFQPRRENISTWTISVEELKDWAENELKPKAQMAINGEGEYLPGEWCTFCKA
FT                   SVKCRARAEAKLELARAEFMLPPLLTDMEIEEIIHKIPDLTKWANEIMAYATDAAINHG
FT                   KQWSGFKVVEGRSNRKYKDEDAVADAAKTNGYKDIYHQRLITITEMQKLMGKKQFEKIL
FT                   GCLIYKPPGKPTLVPITDKRTAMDTSNANNEFNEIMEDEDYDKSKQN"
FT   gene            352843..353391
FT                   /locus_tag="CLJU_c03380"
FT   CDS_pept        352843..353391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03380"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13420"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022595"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLM4"
FT                   /protein_id="ADK13420.1"
FT                   /translation="MINQNKTKVITGVNTRLSYFHGWEPVSINGSAEKYSVSVLIPKSD
FT                   KETINAINAAIDAAIEEGISKFGGKKPNKAAIKLPLRDGDAERDDEAYKGHYFVNANSI
FT                   TAPQIVDKAVKPILDRNEVYSGCYARVSLNFYAFNSNGNKGVACGLGNIQKIKDGEPLG
FT                   GRTNAADDFTTVEDDDFLA"
FT   gene            353469..355418
FT                   /locus_tag="CLJU_c03390"
FT   CDS_pept        353469..355418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03390"
FT                   /product="phage related DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13421"
FT                   /db_xref="GOA:D8GLM5"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLM5"
FT                   /protein_id="ADK13421.1"
FT                   /translation="MKFISIDIETFSSVNLQKSGVYRYAESEDFDILLFGYSVDGGEVK
FT                   VIDLARGEKIPIEIINALTDDSVIKWAFNAQFERICLSKWLGMKAGTYLSPKSWQCTMI
FT                   WAATLGLPLSLEGVGAVLGFKKQKLSQGKNLIKYFCIPCSPTKSNGGRTRNLPHHDIEK
FT                   WKMFTFYNKRDVETEMAIQNKLSKFPVSKTEWQNYHLDQIINDGGINLDMDFVRQAISC
FT                   DEKFKAENIKKAKELTGLENPNSPAQLKDWLLKQGMKTDSLSKAVVSELLQDSDGEIHE
FT                   ALSIRQQLAKSSVKKYTSMENVVCSDSRARGLIQFYGANRTGRYSGRLIQVQNLPQNHL
FT                   PDLKQARSLVKSGNFTALDLLYDSIPSVLSELIRTAFIPRYGSRFIVADFSAIEARVIA
FT                   WLAGERWRIDVFAGGGDIYCASASQMFNVPVKKNGINGHLRQKGKIAELALGYGGSVGA
FT                   LKAMGAIQMGLVEDELKPIVDAWRNSNPNITSLWWRIDRAVKTVVKTKQPIEIYGIGIF
FT                   YQSGILFIKLPSGRRLAYVKPLIGENRFGGESVTYEGVGGTKKWERIESYGPKFVENIV
FT                   QAISRDILAEAMLKLATHEFQIVMHVHDEVVIEAPNKVSSVEEICRIMSETPAWAKGLI
FT                   LNADGYECEFYKKE"
FT   gene            355534..356307
FT                   /locus_tag="CLJU_c03400"
FT   CDS_pept        355534..356307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03400"
FT                   /product="putative prophage antirepressor"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13422"
FT                   /db_xref="GOA:D8GLM6"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="InterPro:IPR005039"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLM6"
FT                   /protein_id="ADK13422.1"
FT                   /translation="MSEIQIFKNPEFGTVRTIEENGKIIFCGTDIASSLGYTNPQKAIK
FT                   DHCREDGVTFRSVIDNIGRTQQAKFIDEGNLYRLITHSKLPAADRFEGWVFDEVLPTIR
FT                   KHGAYITTQKMEEIMNDPDSWIKLLTALKAEREEKECLKVQATEDKPKVVFADAVSVSD
FT                   GTMLIGELAKILKGNGLDIGQNRLFERLRQEGYLIKRKGTDYNAPTQMAMELGLFKVKE
FT                   TAITHSDGHVTISKTTKVTGKGQQYFINKYLMEGK"
FT   gene            356309..356743
FT                   /locus_tag="CLJU_c03410"
FT   CDS_pept        356309..356743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13423"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLM7"
FT                   /protein_id="ADK13423.1"
FT                   /translation="MGVNKFNSEGYYDPTPYVAITNVIKGLKTEKNSVFKPLVYICSPY
FT                   LGNIEINVKKARTFCRFALEMNCIPLAPHLLFPQFMNDDIPQERELAMFMNMVLLGKCN
FT                   ELWVFGNTISNGMAQEIEKAKKRRQLIRYFNEKLQEVGSL"
FT   gene            356740..359103
FT                   /locus_tag="CLJU_c03420"
FT   CDS_pept        356740..359103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03420"
FT                   /product="phage-related protein"
FT                   /note="putative virulence associated"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13424"
FT                   /db_xref="InterPro:IPR007936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLM8"
FT                   /protein_id="ADK13424.1"
FT                   /translation="MKIAVGNSRMDKKWKNTDISWKNFCSRVKTTQKTTETIEEYRKLK
FT                   RGQQDDIKDVGGFVGGHLKEGRRKKNHVLCRSILTLDMDYATADIWDQIIMLFDFKCCM
FT                   YSTHKHTSENPRLRLIIPLAREISEEEYAAVARMVAKEIGIDLFDDTTYEAERLMYWPS
FT                   TSSNGVFVYKENDGALLDPDLYLAKYDNWQDTTTWPVSSRQSEIIKRSLKEQADPLLKE
FT                   GVIGTFCRTYSIRDVIEKFLNDVYALSTIEGRYDYIPADSCAGVIIYDNKFAYSHHATD
FT                   PASGLLLNAFDLVRIHKFGSLDDKSAVNTVASKLPSYMAMCDFATKDTEVKAEFAKERQ
FT                   AQAEEEFSEDDWQTALELDKQGKVKGTLDNIVLILRNDDGLKSLAFNCHRDGIDAKGGL
FT                   PWKQIKYGWNDSDNSSLKVYLSSKYGIYAPTKTKDAVLAVAAERAYHPIKEYLDNLPKW
FT                   DGVARVENLLIDYFGAADSTYTKAVIRKTMVAAVARIYQPGTKFDSVLILNGPQGIGKS
FT                   TFFAKLAGEWFSDSLTITDMKDKAGPEKLQGYWMLELGELAGMRKTDVEIVKSFISRVD
FT                   DKYRASYGVNVENHPRQCIIVGSTNAENGFLRDISGNRRFWPVRISGNSTKKSWQITTE
FT                   EVQQILAEAIFLYKQGEKLYLEGDDAILASGEQADAMETDEREGLVRTYLDILLPEDWG
FT                   TMSLYERRNFLGGSEFGGGTRVGTIKRNLVCNMEIWCECFGKDASSMKTADSYTIGAIM
FT                   RKISDWSKYCGNKNGTSNFPIYGKQRAYSRVKER"
FT   gene            359324..359605
FT                   /locus_tag="CLJU_c03430"
FT   CDS_pept        359324..359605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03430"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13425"
FT                   /db_xref="GOA:D8GLM9"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR014883"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLM9"
FT                   /protein_id="ADK13425.1"
FT                   /translation="MLEKYIENKLVTAVKKMGGICPKFVSPGFDGVPDRLVFLPHGKFA
FT                   FVELKAKGKKMRPLQVNRKMQLEQLGFLVYCIDDASKIGGILNEIQSS"
FT   gene            359586..360947
FT                   /locus_tag="CLJU_c03440"
FT   CDS_pept        359586..360947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03440"
FT                   /product="predicted phage related DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13426"
FT                   /db_xref="GOA:D8GLN0"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLN0"
FT                   /protein_id="ADK13426.1"
FT                   /translation="MKYNPHDYQNFVTKFILANPISAVLLDMGLGKSVITLTAMFDLCL
FT                   DSFEISKVLVIAPLRVARDTWPLEIKKWDHLKGLTYSVAVGSEAQRKSALMQKVNIYLI
FT                   NRENVDWLINESGIPFDYDMVVIDELSSFKSYSAKRFKSLLKVRPKVKRIVGLTGTPSS
FT                   NGLMDLWAEFRLLDMGKRLGRFITHYRNNFFDPDKRNQQMVFSYKPKAGAEDAIYRLIS
FT                   DITISMKSTDYLKMPECVINEVIVTLSEKERKAYDGMKQDLVLSLKGEEIDAVNAAALS
FT                   NKLCQMANGAVYGEDKRVFTIHDKKLDALEDLIESANGKPVLVAYWFNHDLERIKKRFK
FT                   VREIKTSKDIKNWNNGEIEVAVIHPASAGHGLNLQAGGSTLIWFGLTWSLELYQQTNAR
FT                   LWRQGQNETVVIHHIITKGTIDEDIMRALRRKEKVQSDLIAAVKAKLKEGKTYE"
FT   gene            360940..361161
FT                   /locus_tag="CLJU_c03450"
FT   CDS_pept        360940..361161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13427"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLN1"
FT                   /protein_id="ADK13427.1"
FT                   /translation="MNKNCFANKNNRCKILNYIQCTNNSCSFFKTEEEQEESINRANAR
FT                   IASLDKAIQKSIADTYYNGKMPWLEGDK"
FT   gene            361163..361591
FT                   /locus_tag="CLJU_c03460"
FT   CDS_pept        361163..361591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13428"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLN2"
FT                   /protein_id="ADK13428.1"
FT                   /translation="MTAKQYLSQAYRIDQRINSKLEQIVSLRALATKATSTLSDTPPSG
FT                   TRNVHSMEDTIAKMVDLENEINADIDTLVDLKRKFVFIIKKISNPEYQTLLELRYLCFK
FT                   TWEQIAVEMGYDLRYIHKLHGKALENCEINLKEDTKRH"
FT   gene            361706..362083
FT                   /locus_tag="CLJU_c03470"
FT   CDS_pept        361706..362083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03470"
FT                   /product="putative phage-related protein"
FT                   /note="similar to HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13429"
FT                   /db_xref="GOA:D8GLN3"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLN3"
FT                   /protein_id="ADK13429.1"
FT                   /translation="MPRKPAKPCSYPGCPELTSERYCNKHQKEIESKYNKTSRPFKKLY
FT                   NSRWRKLRKQFLKEHPLCEECKREGIVTAAEVVDHVIPHKGNEKLFWDESNWQSLCKHH
FT                   HDVKTAKEDGRFGNKNEVYSY"
FT   gene            362360..363604
FT                   /locus_tag="CLJU_c03480"
FT   CDS_pept        362360..363604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03480"
FT                   /product="predicted methylase with a ParB-like nuclease
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13430"
FT                   /db_xref="GOA:D8GLN4"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLN4"
FT                   /protein_id="ADK13430.1"
FT                   /translation="MEIQKVSVEKLNPAKYNPRKDLKPGDPEYEKLKRSIETFGYVEPV
FT                   IWNKKTGNIVGGHQRFKVLKQEGAKEIECVVVDISSDEEKALNVALNKVSGEWDMPKLA
FT                   DILDELDKSMFDISLTGFDAAEIEDLFSKVHDKDVSDDNFDADKALEEIEEPITRAGDL
FT                   WILGKHRLICGDSTKTSDVEKLMNGKKANLCVTDPPYNVNYSAGKENERVIKNDSMDDK
FT                   SFHEFLLSAFKNIYSVLDDGAGAYIFHADTEGLNFRKAFKEAGFHLSSVCVWVKQSLVL
FT                   GRSDYQFQHEPVLYGWKPTGKHRWYSDRKQTTVWNFDRPSKSPDHPTMKPVPLIAYPIK
FT                   NSSMTNCIVFEPFAGSGSTLIACEQTDRICYAIELDEKYCDVIVKRYIEAAGDEGVFLI
FT                   RDGKKIDYKNVLKVE"
FT   gene            363673..363984
FT                   /locus_tag="CLJU_c03490"
FT   CDS_pept        363673..363984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13431"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLN5"
FT                   /protein_id="ADK13431.1"
FT                   /translation="MRALFGRKVLNLKELEEFTKEAKKDGMRGTAYEVIKEIELSDAEF
FT                   KQFAKELWKDQTWISEEDGGCNEKGELRCIRVKNIKTNKSILVDSEGYTYPRYTAIEK"
FT   gene            364224..364940
FT                   /locus_tag="CLJU_c03500"
FT   CDS_pept        364224..364940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13432"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLN6"
FT                   /protein_id="ADK13432.1"
FT                   /translation="MDRKETVKILGEHFGVKPEYMGVPSFAYQIKSPQGIITVDKEGEI
FT                   KNSEGIEVELEELLNDFQEESVKAETEHSEIIFSIAGHTGITLRNLINMISSKQTLIKK
FT                   ALGIETDIVTKEFVEGINNIRISSIEDFKTAVLDIGEEKCPGINFNFEKETLEFKFIKD
FT                   FENAEIAVQFVEALNESSKKFKHSSPKERQTDNEKYTFRTWLLRLGFIGERYKQARKEL
FT                   LKNLGGNSAFRGKINE"
FT   gene            365099..365365
FT                   /locus_tag="CLJU_c03510"
FT   CDS_pept        365099..365365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13433"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLN7"
FT                   /protein_id="ADK13433.1"
FT                   /translation="MKKIKILVTELKNLGVKNIMNIEEIEKIINVYLEKKVMILQNDNF
FT                   NIEYDVERKKFKIETSFSNQEITEKWLYQVNKIYEFITELNLD"
FT   gene            365413..365883
FT                   /locus_tag="CLJU_c03520"
FT   CDS_pept        365413..365883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03520"
FT                   /product="predicted phage terminase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13434"
FT                   /db_xref="InterPro:IPR006448"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLN8"
FT                   /protein_id="ADK13434.1"
FT                   /translation="MATRGRKPKPTALKVLEGNPGKRPLNINEPKPEKKAPKCPSWLEP
FT                   EAKKEWRRMTKTLEKIGVLTKVDAAAFAGYCQAYARWKEAEEFLTKHGTIFKTPSGYIQ
FT                   QVPQVSIAQTYLKIMKDFCSEFGLTPSSRTRIRVGTETGKNDDPMEDILRMV"
FT   gene            365886..367436
FT                   /locus_tag="CLJU_c03530"
FT   CDS_pept        365886..367436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03530"
FT                   /product="phage terminase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13435"
FT                   /db_xref="InterPro:IPR005021"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLN9"
FT                   /protein_id="ADK13435.1"
FT                   /translation="MFDEKKAEKVVKFINNLKHTKGVWHGVSFDLLPWQDKIIKDIFGT
FT                   VKDNGYRKYNTAYVEIPKKNGKSEIAAAIALYLTCADNEWGAEVYGCAADRQQASIVFD
FT                   VAVDMVDQCPALKKRIKPVISQKRLVYMPLGSFYQVLSSEAFSKHGLNVHGVIFDELHA
FT                   QPNRELYDVMTKGSGDARMQPLFFLITTAGTDRNSICYEVHQKAEDILRGKKIDKTFYP
FT                   VIYGIKDEDDWSLEENWYKANPSLEHTIPIEKVRDAFNSAKENPAEENIFRQLRLNQWV
FT                   KQSVRWMPMDVWNECSFEVNIEKLKGRECYGGLDLSSTNDITAFVLVFPPITEDDKYYV
FT                   LPFFWIPEDNLKLRVKRDHVPYDVWKKQGFLETTEGNVIHYAFIENFIDKLGTQFNIKE
FT                   IAFDRWGAVQMVQNLDGLGFTVVPFGQGYKDMSPPTKELMKITLEQKIAHGGHPVLSWM
FT                   MDNIFVRTDPAGNIKPDKEKSTEKIDGAVALIMALDRAIRHESKESVYEKRGMRSLLD"
FT   gene            367448..368728
FT                   /locus_tag="CLJU_c03540"
FT   CDS_pept        367448..368728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03540"
FT                   /product="predicted phage portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13436"
FT                   /db_xref="InterPro:IPR006427"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLP0"
FT                   /protein_id="ADK13436.1"
FT                   /translation="MKFIDRCKLFLTPQNALFEVLQKYSQDFLAGEDVPTADNKMIDAN
FT                   TAMSFTAVFACNRVLSETLASCPIFLYEKDSKGNRVQVTDAPEYQLMHYTPNPEMTPGQ
FT                   FKETGMSNMNLGGNFIAQKVFNLHGDLLELRPILWNRVRIDIDKNTGRLLYFIDGKTEP
FT                   KTRDEILHIPGLTLDGYIGVTPLTYAALTIDIGLSQDKFERNFYLNRASTSGIFQYPNE
FT                   LGDEAFKRLKKDIKKNYTGLSNAGVPMILEGGGQFKEVTMKLTDAQFLESKRFRIEDVC
FT                   RIFRIPLHLVQDLTRSTNNNIEHQSLEFIVYTMLPWFKRWEENLNLQLLSTESKRKNRY
FT                   FEFKVDALLRGDAQTRASAYAQGRQWGWLSVNDIRRLENMDPIENGDIYLQPLNMSEAG
FT                   TDDIENKNKELAAQIYEMISKGGEKHE"
FT   gene            368721..369560
FT                   /locus_tag="CLJU_c03550"
FT   CDS_pept        368721..369560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03550"
FT                   /product="phage related protease"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13437"
FT                   /db_xref="GOA:D8GLP1"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLP1"
FT                   /protein_id="ADK13437.1"
FT                   /translation="MSKGKKFWTFNAKENSDEGELLLYGDISDSTWWGDEITPKNFKEE
FT                   LDSLGDIKTLNVYINSGGGDVFAGQAIYSMLKRHSATVNVYVDGLAASIASIIAMAGDS
FT                   VKMPKNAMLMVHNPWSYAMGNAKDFRKLADDLDKVRESMISVYEDKTGMEKESIVELLD
FT                   AETWMTAEEAVEFGFADEIEEEKQVAASLNNRIFAINGLKVDITKYKNLQVNKIQFKEP
FT                   MLHENQANKPKENHVHIEEVKEKDINDNKIPTAKDEKQIPIDLYKKLNEIHERRFNI"
FT   gene            369557..370840
FT                   /locus_tag="CLJU_c03560"
FT   CDS_pept        369557..370840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03560"
FT                   /product="phage related protein"
FT                   /note="similar to phage major capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13438"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLP2"
FT                   /protein_id="ADK13438.1"
FT                   /translation="MSLKEILKQKLDSQAAIVQGAIDSARAMTEEEQKLYDSLEVEIKN
FT                   LEKTIEAEDKLKEREKLNKTPINEPIYAKPKDTNEKKWKGGMGEFLQAVAKASSPVGIM
FT                   DNRLIYQNSASGLNESVSSEGGFMLENDFIQDMFDVMMSESQVANRIRMIPIGANTNRL
FT                   RTLGIDETSRANGSRWGGVQAYWIAEAETVTKSKPKFREIDMALQKLLALCYVTDDLLQ
FT                   DATALEAIVKQAYADEMSFKIDDAIINGSGVGMPLGVLNSDALVTVAKEKDQAVGTIKY
FT                   ENILKMWSSVPARLRANAVWYINQEIEPQLYTMALNIGTGGAPVFLPSGGASSSQYSTL
FT                   LNRPIIPIEQCSVLGKKGDIILADPTQYIGIDKKAPTADVSIHVRFLYDEQVFRFIYKF
FT                   NGAPYRNKPITPYKGANALSPFVTLGDR"
FT   gene            371006..371488
FT                   /locus_tag="CLJU_c03570"
FT   CDS_pept        371006..371488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13439"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR021671"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLP3"
FT                   /protein_id="ADK13439.1"
FT                   /translation="MPLTQNSRAPKQMGDFGEGLVNYVLIKKGYEVAYVDHVGADLISE
FT                   KDGNRYAISVKTRNFKKGSNESRMYSFSDDHIKKIEFFSNQFNLEPVIAFVLITEDDKT
FT                   LEAFIIKVKDILEGRVLNKIKDGYSIRFSSKNKLDLINSQYVDYSCWKDEVIGNRF"
FT   gene            371472..371621
FT                   /locus_tag="CLJU_c03580"
FT   CDS_pept        371472..371621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13440"
FT                   /db_xref="GOA:D8GLP4"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLP4"
FT                   /protein_id="ADK13440.1"
FT                   /translation="MEIDSNKIIVNALIVNVIIFVILFISINFKKAALVLSLLFKEEIY
FT                   HGNN"
FT   gene            371608..372060
FT                   /locus_tag="CLJU_c03590"
FT   CDS_pept        371608..372060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13441"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLP5"
FT                   /protein_id="ADK13441.1"
FT                   /translation="MAIIEKYKLVQAFEPRTTNASITSNYVILKDAVTATVVVNLAQTV
FT                   GHTTQISLYQAQDIEGTAAKPLANDVPILANEDVSASDTLVRQADGVSYTVANTAKNKQ
FT                   VIFHVDPAKLDVNNEFCCLNVRIGASSQATNFASGEFILENKYAED"
FT   gene            372128..372700
FT                   /locus_tag="CLJU_c03600"
FT   CDS_pept        372128..372700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03600"
FT                   /product="phage conserved hypothetical protein"
FT                   /note="related to DNA packaging"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13442"
FT                   /db_xref="InterPro:IPR011738"
FT                   /db_xref="InterPro:IPR021146"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLP6"
FT                   /protein_id="ADK13442.1"
FT                   /translation="MALKIITPPAVEPITLEEAKQHLRVTGSDDDIILLSMIRQAREFC
FT                   EDFQNRKYITQTLEMVLDSFPNDNYISFKNCSPVQSVESVKYYDSGGREYIFDSSNYIV
FT                   DTDSFVNRIVLGYCKLWPTIALQTANAVRVRFTAGFGDKPENVPETVKWAMVLHMRLLY
FT                   DDYKPDERTKIEEARNSLLSMNRVIPV"
FT   gene            372697..373023
FT                   /locus_tag="CLJU_c03610"
FT   CDS_pept        372697..373023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03610"
FT                   /product="putative phage head-tail adaptor"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13443"
FT                   /db_xref="InterPro:IPR008767"
FT                   /db_xref="InterPro:IPR038666"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLP7"
FT                   /protein_id="ADK13443.1"
FT                   /translation="MRTEELKNKIIFQKLTATTNENGFEVEVWEDYSTVWAAVSNLIGR
FT                   EYFAAAAVQAEKTVKFTIRYLQGITDDMRILFQDKQYNITFIDNIKYRNKYIEIKALEV
FT                   ENSG"
FT   gene            373016..373396
FT                   /locus_tag="CLJU_c03620"
FT   CDS_pept        373016..373396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03620"
FT                   /product="putative phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13444"
FT                   /db_xref="InterPro:IPR010064"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLP8"
FT                   /protein_id="ADK13444.1"
FT                   /translation="MANIELTGVDEILNKLQQIGSNVGRLENKALKNAAEPVLEDAKTN
FT                   VPVRTGKLKKGLKITNVKKKEGIKYILVGVDKGDNSEIFYGKFIEFGTSKRAAHPFLQP
FT                   AYEKNIDDIKGIIAETLKGGLK"
FT   gene            373393..373716
FT                   /locus_tag="CLJU_c03630"
FT   CDS_pept        373393..373716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13445"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLP9"
FT                   /protein_id="ADK13445.1"
FT                   /translation="MINKLVVEALKPLNVPVSFQKYKGKENTYITFFNYLEQGEQYADN
FT                   EEKAIGYYIQIDVWSKDDYTELVEKVKNNMKAAGFMRTSAADLFEDDTKIYHKVLRFSY
FT                   LSD"
FT   gene            373734..374564
FT                   /locus_tag="CLJU_c03640"
FT   CDS_pept        373734..374564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03640"
FT                   /product="phage protein"
FT                   /note="similar to phage major tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13446"
FT                   /db_xref="InterPro:IPR006490"
FT                   /db_xref="InterPro:IPR006724"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLQ0"
FT                   /protein_id="ADK13446.1"
FT                   /translation="MSEIVNSAPIGVENLVYAILTDEIASIYGTPALISPAINVKISPK
FT                   SNSDTLYADNKAVETATSLGEIDVEIETQDLPLEVQAALLGHTIDSATKVMCSDVQDSA
FT                   PYVAVGFKIKKANAKYRYVWLLKGKFSEPEEEHSSQEDKTKFQTPKIKGTFVTRTDGKW
FT                   KYTADEDSGFTGGAAWFGSVYKPVIIPAAPTNPVQDDTANTFGWTNVSGYDNASDYEYS
FT                   TDGGVTWLAVTENPQNVGNSAYDAGKVQVRVKADAEAGRSAGLVLSSTLAYTAG"
FT   gene            374611..374895
FT                   /locus_tag="CLJU_c03650"
FT   CDS_pept        374611..374895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03650"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13447"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLQ1"
FT                   /protein_id="ADK13447.1"
FT                   /translation="MEIVLNNKTYVMPKVKTRMLRKAIEINENIDFSNMKTKDLDGLVD
FT                   FIVELYGNKFTRDNFYDGLDADKLIETLNNSINGIVGNLGNKLKEFPNK"
FT   gene            375097..377862
FT                   /locus_tag="CLJU_c03660"
FT   CDS_pept        375097..377862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03660"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13448"
FT                   /db_xref="GOA:D8GLQ2"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLQ2"
FT                   /protein_id="ADK13448.1"
FT                   /translation="MAEELGSLAVKIGLDSSGFQNGISSINRNLRVLDSEFKANTAALG
FT                   ENAKGLEGLKLKSESLTKQLELQKQKVGTLEQAYTKSAETKGKDTKATQDLEIKLNKAK
FT                   QALSQMENELSKANKEIELQISKWGTLGKSFDTLGNKIKPIGQSISGVGQKLTLGITTP
FT                   LIGIGTAAVKTGMDFEAQMSRVSAISGATGSDFKKLNDLALKLGADTAFSAGQAAEGME
FT                   NLASAGFNTNEIMEAMPGMLDLAAAGGVEISEASDVAASALRGFGLEAGQSGHVADVLA
FT                   QAASATNAGISDMGSALKYAAPPAHALGLNIEEVSAAIGIMSNAGIKGETAGTTLRGAL
FT                   TRLASPSKEAAVLMEQLGFHAFDNQGKMFSLSQIVANLQNSMKGLSDEEKQNAIATIFG
FT                   QETMSGMLTLIQAGPKQLDDLTNSFKASDGAAKKMAGTMQNNLKGSIEQMKGSLETAGI
FT                   KIEQSLAPHIKVIADGITELANKFSELSPAEQQFALVMAGIAIVIGPALVSIGNLIAAI
FT                   GNISKAFGTVSTAIANLGGMSKILGTIFNPWVIGIGIAVLAGYEIYKHWDTIKQGANDL
FT                   WLKLTTVFQGIKTSITNTWENVKTATLTAWENLKSTISSGLNSIKSFLEPALNFYKTIF
FT                   KNTWDIIKNVVLGAVLIILDVVTGNFTKLKSDIENIWNNIKTALTNIWETIKNTAISAW
FT                   TKLKETVINLCNNIKETVLNIWNSILTWFSELPGKLYSYGSSMFTRMRDGVNSTIGSVR
FT                   NSIESGINNALNYLASLPGRAWSYGADFVNGIVNGIRSAVGRVEDAVSALAAKIRSYLH
FT                   FSVPDEGPLTDYEKWMPDFMAGLAEGINKSKHIVAEAVNGLSLDMKVNSNIGEIAVPYN
FT                   NLKENENLNNRNGIILHIENFNNYTEKDIEQLAYELEFYRQKISMGKGGV"
FT   gene            377864..378571
FT                   /locus_tag="CLJU_c03670"
FT   CDS_pept        377864..378571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03670"
FT                   /product="phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13449"
FT                   /db_xref="InterPro:IPR006520"
FT                   /db_xref="InterPro:IPR008841"
FT                   /db_xref="InterPro:IPR038675"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLQ3"
FT                   /protein_id="ADK13449.1"
FT                   /translation="MLSFNFAGRNSYDDYGILISQRPNIPSPKRRVNIINIPGRNSNLR
FT                   FDEKTYDDITLTVECSVKDGENLADKIDDIAVWLFEAGESDLTFSFQPDKKYIAQVVNS
FT                   IDFKQVYKYFSEFPIIFNCRPFKYAVENNIETINASGAKVTNPGTIESDPVISIYGSGD
FT                   IVFKINGQQISLKGIAEKVIVNSVIQDCYDDVGNNLNGIMSGEFLKMKPGENIIEWSGN
FT                   VTKVELLPNWQWL"
FT   gene            378650..379477
FT                   /locus_tag="CLJU_c03680"
FT   CDS_pept        378650..379477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13450"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLQ4"
FT                   /protein_id="ADK13450.1"
FT                   /translation="MKPTNYEDLIMKRAMDIFAEEGLKFFGINKKVKELGPTELVVLET
FT                   KNMFMDYTFLMEDDTFIHFEFQTTNKGKADLRRFRAYEALLSHQTGKDAVTYVVYSGNI
FT                   KNPANTLKIGINEYKVNSISMADKDGDKIYNDIVEKIKSGNDITKQDIISLTFTPIMGG
FT                   KIGTVDKIINAINVVKDINNDYKYDVESILYAFASKFLSGKDLERVKEELRMTELGKSL
FT                   INEGMEKGKDEGKKEKTIEIVKRAIKKGMDNETIKELTDLDIDEIELIRKVLK"
FT   gene            379586..381439
FT                   /locus_tag="CLJU_c03690"
FT   CDS_pept        379586..381439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03690"
FT                   /product="putative phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13451"
FT                   /db_xref="InterPro:IPR007119"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLQ5"
FT                   /protein_id="ADK13451.1"
FT                   /translation="MICIYDKKTTKGNFDNNGLGILSEAISCYITEELNGDYSLELEYS
FT                   ANSKKSKYIVEWNIIKADGQLFRIYKVEKSSDGKNVIKVWAKHIFYDLSYYFIESMKAE
FT                   NCSVKTALEKSLVGDLITIYTADSDIITANTIEVEEKNPVEAIFSIINIWGCGELKRDN
FT                   FDIKILKSIGKDAGVLIAQGKNIAGLKFNIDTTSVVTKLYPVGKNCIKLTEKYISVPNW
FT                   NSDAYPPFPIIKKVEFKDAEDEVTLRALAKEAASVIGLSRVNIDVDFIELSKTKEYEKY
FT                   KHLQTVNIGDSIIVRHKDFNIDVKVPVIKITKDILNCVNIKIELGQPKDSILNQLDTAN
FT                   IKTTLDELGNKVSESFSSMLYYANPAALTVGTASIEPVYLGITAVADTNLSMNFTMYCT
FT                   ATSSCTITIEIQLDNKDIPFTPKQKLQQGDNVIGIPLGIPQVQQGAHYVAVFLKVDTGT
FT                   VNIPMFNLQCMIDGRNLQGGLSAEHPHAECFEKQKLVNINGLYLSKVKSNYVKTELQNP
FT                   LTSVLGVHKTADTAAISSGKQMSTNHEISIKKLGEILYLTPQYKYKYSIDDNVLILDDG
FT                   LYFKTVYEGTAVDESIDAGKMYSFQLLDSSRFASIEKLEVK"
FT   gene            381441..382568
FT                   /locus_tag="CLJU_c03700"
FT   CDS_pept        381441..382568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03700"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13452"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLQ6"
FT                   /protein_id="ADK13452.1"
FT                   /translation="MGVYSTNIISPKGNSGMTSISTHNDDTTVEFPDIGFDFFYNGINC
FT                   RTTINSSGNSWIGFTGSSEQLKINRRDAGADNIYYAKETVNDKPTFRIRWEGHQSYSTW
FT                   GTLNLVWELILFNDNAMVLVIEKIPNTGTNSFENPALGTTALTLEGNKSYAFIPQQDQG
FT                   KSYTVQEGSYIQTDIKYLIVDGTDIKHWDTTSSNYVKVSELPLTSDKFKIYGDDIYHKE
FT                   RTGIIAASPILKIWSPSAELPTPRITQVIKPKPVIVNMKDDILFSEAYIKDIMNSVVTV
FT                   DNTGSGIIVFIVSIDSGISWKAWNGSSWTLVDITNMQDVKSKGMSASVFQGITEAQWAT
FT                   LGVSNKKMKFAWYMEVAASTDVLKLKQIRVNYNTN"
FT   gene            382751..383677
FT                   /locus_tag="CLJU_c03710"
FT   CDS_pept        382751..383677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03710"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13453"
FT                   /db_xref="GOA:D8GLQ7"
FT                   /db_xref="InterPro:IPR007427"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLQ7"
FT                   /protein_id="ADK13453.1"
FT                   /translation="MGIISIILIIIGLCLFEVVSSIDNAVINAEVLSTMSEKAKKWFLL
FT                   YGILFAVFIVRGLLPWVIVWATNRSLGPIGALTATFSNDPHIIESIEYSTPILMLGGGV
FT                   FLVFLFLHWLFIEDKHLGLATEEFFLKNGTWFYAVVSVILVGIVAVALKYNPVLALSAV
FT                   IGSSAFFITDGFKKNAEENEKKLLNNTSEMSDISKILYLEIIDTTFSIDGVLGAFAFTM
FT                   SIPLIILGNGLGAIVVRKITMGSIEKIKKYIYLKNGAMYSILCLGIVMVLEGFHVEVPE
FT                   YISPLLTILIIIFFFFKSKIYAEKNLS"
FT   gene            383803..385155
FT                   /locus_tag="CLJU_c03720"
FT   CDS_pept        383803..385155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03720"
FT                   /product="putative phage related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13454"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLQ8"
FT                   /protein_id="ADK13454.1"
FT                   /translation="MSYKQSLAYSKDLIKGTKIEVLKKKLIMPFTGIATVKLYDSLTGK
FT                   QTYEAKSENRISAVFGNMAYLDGFYYPMLDNMQEKVLNDVYVTYPFRIMVLTTGDIAED
FT                   PYDYWTWGSIIGYADSLYPYSGSDNLRGSVNSSETTRSTSTRHYVIDFPTNAANGTFKS
FT                   IYWTGGNGIDSSAQSPRINSMYTKKTLETGGSGNYLPDYNLCTDETNLYVLKINSTTLY
FT                   VYDKVTCVKKSDIILPASARAVDYDGTNFWILISDGSFKKLDKNFAVVESYPKSAAIPG
FT                   DLVSGVHYYDIAVNDAYVYITYNGCTDSSGSNSNYKSCIAKYNKDGTFADKTQIYAGSS
FT                   GGITLTKIPGNKLWTIINYGTCLQLNNDAAVYGTSDFSSTDYESIVWDEDTSTMFTYSD
FT                   RSYGELKQQYIVPASAHTLLPEAITKTPTNTMKIQYDFTCDYVYPLDMPAH"
FT   gene            385220..385648
FT                   /locus_tag="CLJU_c03730"
FT   CDS_pept        385220..385648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13455"
FT                   /db_xref="GOA:D8GLQ9"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLQ9"
FT                   /protein_id="ADK13455.1"
FT                   /translation="MEDKNCKDCVQIENLKNKIEGLEKDLKESEKKVYDITLKLQDRVG
FT                   ALERQGDKNEERVSMIFNILNEIKDSVKVIADKIDDFERHPPGSALIETLKIDMKELSA
FT                   RIKVVEDKPAKKWDDTTKTIMLVVITQIAIFIISKILK"
FT   gene            385663..386352
FT                   /locus_tag="CLJU_c03740"
FT   CDS_pept        385663..386352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03740"
FT                   /product="predicted phage related amidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13456"
FT                   /db_xref="GOA:D8GLR0"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLR0"
FT                   /protein_id="ADK13456.1"
FT                   /translation="MLPIIKKLIKFNFSSGNNIKYIVVHDTANTDRGADAEAHYRYFNG
FT                   GDRQSSAHYFVDDKEIVQLVQDYNASWHCGDGRGRYGITNHNSIGVEICVNCDCNYEKA
FT                   VSNAVDLVKFLMQKYSISIDRVVRHYDASRKICPESMSHNNWERWWNFKSRLSSSASSQ
FT                   VKNNSNLTYGTVTASVLNVRSGAGTNYKVIGQLERGQRVRLDIKVGNWWSIYFGDHGGF
FT                   VCADYIE"
FT   gene            386368..386628
FT                   /locus_tag="CLJU_c03750"
FT   CDS_pept        386368..386628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13457"
FT                   /db_xref="GOA:D8GLR1"
FT                   /db_xref="InterPro:IPR006485"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLR1"
FT                   /protein_id="ADK13457.1"
FT                   /translation="MENNNQTQTDNKNTKAVNDSGQKQNRFKSKAAWVAVAALLLFILK
FT                   TYGLLATIGLTEESYKELTTLIFAVLTAFGIFNDPTNKESL"
FT   gene            386894..388543
FT                   /locus_tag="CLJU_c03760"
FT   CDS_pept        386894..388543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03760"
FT                   /product="DNA integration/recombination/invertion protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13458"
FT                   /db_xref="GOA:D8GLR2"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLR2"
FT                   /protein_id="ADK13458.1"
FT                   /translation="MKEGFILKKIISIAARNLSFPDSGQFLRKTRVCAYCRVSTGSLKQ
FT                   SESLETQISYYERHIKNKSGWEYAGVFADEGISGTGMLKRTEFNRMIRACELGKVDLIM
FT                   TKSISRFARNSADCIDVVRHLKNIGVGVYFERENINTLGADSELVLSILSSIAQDESRN
FT                   ISENVKWGIQKRFREGKFYITTKRFLGYDLNNEKQLTVNSEEGKIVKRIYREYLNGRSL
FT                   KEIKSGLEKDNIKTVTGNRVWNESAIKYILQNEKYCGDAVLQKTITVDYLTGKRKKNKG
FT                   EAPKYEVKEHHEAIISKEDFLKVQNIRKIKALKYGNLPENRDKYQNRYAFSGKIICGNC
FT                   GAFFSRRTWNSKAKSKQIVWQCRTYINEGKSSCCMKAVDDITLKAVFVRVFNRIYEAKE
FT                   DFFKRFADNIEKVLKRNEKCEDILRVDREIENISGKIKELVRKQIKGELEESTFDKRYR
FT                   NLKDTLQEFKNRRNSLSYNDEKYKKLLERNKRIKKFIEDRDGIITEFDDDIFENLIEKI
FT                   VAITPTHLEFHFKNGMVVEEEFIKKKGIKGLQ"
FT   gene            388559..390160
FT                   /locus_tag="CLJU_c03770"
FT   CDS_pept        388559..390160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03770"
FT                   /product="putative recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13459"
FT                   /db_xref="GOA:D8GLR3"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLR3"
FT                   /protein_id="ADK13459.1"
FT                   /translation="MPKVSVIPAKQVQVINGIKDKKKKRVCAYCRVSTDTDEQLTSYEA
FT                   QVTYYESYIRGKPEYEFAGIFADEGITGTNTKHRTEFKRMIDEALAGKFDMIITKSISR
FT                   FARNTLDCLKYVRLLRDKGIGVYFEKENIDTLDSKGEVLLTILSSLAQDESRNISENSR
FT                   WGIVRRFQQGKVRVNHKRFLGYDKDENGELIIDEEQAKIVRRIYKEYLEGKGIRAIGKD
FT                   LERDNILTGAGGRKWHDSTIQKILRNEKYSGDALLQKTITTDFLTHKRVKNKGEVQQYY
FT                   VEDSHPAIISKEMFRMVQEEIKRRASLIGYSEKTKSRYTNKYAFSGRIVCGNCGSKFRR
FT                   KRWGPGEKYKKYVWLCANHIDNGLKACSMKAVSEEKLKAAFVRSINKIIENKEAFIKTM
FT                   MENISRVSESKEDRSELKIINESLEELKEQMMNLVRLNVRSSLDNQIYDEEYERLEEEI
FT                   KQLKEKKAGFDNTELIKKEGIQEVKEIERILRDRQDIIKDFDRELFMQIVDKVKVISLV
FT                   EVEFIYKSGVVVKEIL"
FT   gene            390386..391339
FT                   /locus_tag="CLJU_c03780"
FT   CDS_pept        390386..391339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03780"
FT                   /product="putative patatin-like phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13460"
FT                   /db_xref="GOA:D8GLR4"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLR4"
FT                   /protein_id="ADK13460.1"
FT                   /translation="MYKGIGLVLTGGGGKGAYHIGVWKALREYGIDKNITAISGTSVGI
FT                   LNGILFAQGNYNVAETVWKNISKDKILKLDMKKIILKLLEIGLIKGEMAALTIIFREFY
FT                   GNGIFSREGLVKIIDDNINLGYISNCYLDIFAAAYNINTLKIDYLKINGKDDKTIKKIL
FT                   LASSALPIIFDNEEIDGQYYIDGGVKDNVPIKPLYDRGIRNFIVVHLARNSLYNSGSFK
FT                   DANIIEIVPSNSQGDLLTGTLDFSKESAERRIGQGYNDTIKILKPMYEMGIVQSKIGIQ
FT                   LQKFKKDEVNFTYEMVNLFDKREKIKDELNKLLKNH"
FT   gene            391351..393348
FT                   /locus_tag="CLJU_c03790"
FT   CDS_pept        391351..393348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13461"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLR5"
FT                   /protein_id="ADK13461.1"
FT                   /translation="MELSVTLQENEYLTKGKKQEIDKQIDEIIKNHKNNAFEINRLVFD
FT                   SVTALTASDSRANELSEQGVLKRFWGELTGENQKLQSEIDRNLSTAQYCSQQILQKLAE
FT                   QNLMNFELITTVNNKLNSLTIEVEGEINEIYETLVTFFKQTRSNIIQLETRVEILEKNV
FT                   NLLKWLNTIEYLMLDGVEYSELNKIEKIVCIANDFYSITKGKWTTSDLVLIKSALSEIG
FT                   LSTKEKISYKEFIEYVSENKNLFSKLVDEDITDLVNIDTDQMPIISGLVKEKLLESSER
FT                   YIVNTVKSQLKVNGICVNDKKLRYSITENYIEETEFININSQVNLFDFIIELLFNIKIF
FT                   KCSCDNFQAINVKNKIINNKKFENIDSSNKTNLNEIKLYAGDKFGAIIDENDELFIWGN
FT                   TNMSDYDLIGNMPRNNNEKWIDVAIGKCVSSNDCCCGVTIDNKIIFWPNRLGITKWHEK
FT                   YLKLMDIVQVSTGQGPFNLIALDKSGQVYCYSSCDGGKSLVPYNLGKAVKVLSDGSDFY
FT                   VLCENGRVYNWKFYKGGKVKFDVSHWRDIKDIAVDRGSIIALDKRGNVFVFSNNRQIYN
FT                   IPKDLKDIIAISMGEYHAIVLDKRGNVHVWGSDNVDILKQVLIVPKDVKNIVKIAAGSE
FT                   IMMALDVSGKVHMWGNNEYINCCVPSKFCI"
FT   gene            393634..394959
FT                   /locus_tag="CLJU_c03800"
FT   CDS_pept        393634..394959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13462"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLR6"
FT                   /protein_id="ADK13462.1"
FT                   /translation="MMPCVCCFFDNEHQKLLKEKCLKESSFIEKLIKYKEYYIDEFIKL
FT                   HSIKDCNCYYSRKYKNETEYVKFCNDLLSDYKGKISLFEKLFDGLIDTYKAYTKGNISD
FT                   AYKRLNDYINNYCTNYSDSNSVQFSQVPLFRGRPIGDYDIKNIHEYYHISFNKRKLARS
FT                   QRFSIAGKPMLYLSRSIPTDIQELGNEFNNINFALYVPKYSWFYNRAMYNITNSIANNL
FT                   NNSIYPLMNGGSKIEYDNSQFVFSKNKADTIIGDSILFQILTFPVDTKNQVIEEYILPQ
FT                   MFTDNLQKEGYAGLIYQTTKKIIQLDEELKGKELDYNYCFFVPDDGKNEYNEKLLECFY
FT                   TVCIGDCKENVTINDVGSLINNCKAILKNNKNYILDEYSMLNNNIERHIKLMRKIDISD
FT                   KTYYDTEEGNVEVRLLYRLMKKIKEVIEDPKKFGIIKYEELK"
FT   gene            complement(395191..396978)
FT                   /locus_tag="CLJU_c03810"
FT   CDS_pept        complement(395191..396978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03810"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13463"
FT                   /db_xref="GOA:D8GLR7"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010524"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLR7"
FT                   /protein_id="ADK13463.1"
FT                   /translation="MSSKIRILAIAPYSSMEPLLIKVSKDYPNIDLTITVGDLKKGVEI
FT                   AQNNFHGNYDVIISRGGTAKLLQQSVSLPVIEINTSVYDILRTLKLSDADTKKVAVVGF
FT                   PNITKDLLSLMELLPYEIDIFTINSADEDISILQNLKDTGYHAILCDMITYTTARKFGM
FT                   NAFLITSGIESIRDAFDTSVFYCNNYTNMRSENHFLRQLIHGRDAKTVVFTNDGKLFYS
FT                   TLLDDDTDILDTLHKKIDEVLPTGKRHFLHRQNNLLYSIQGQRILSDEFEYIAFYFSVS
FT                   KPPLSGNKCGINYSSSKEVEKDYFNSAYSIVGSIDKLNSTIDQVNQNFYPVMISGEEGT
FT                   GKKQIAKAIYLNSPAVKQPFIEIDCTLLSDKIWDYILNNHNSPLCDSGNTIFIKNVNGL
FT                   SQQQQKELLIAMTDMEICKRNRVLLSCISSSSGTLDSNMMAFINHLHCFIITLPALRDD
FT                   PARIDSILKLYLNKLNISTGKQILGITPDAIQMLCGFSWPYNYTQFTRVIQNLTIITKG
FT                   QYISSDEVKEVLSKEKTIFSTSFNSKYSAKLLDLSRPLSEIDKNIALKVIEVCNGNQTK
FT                   AAESLKISRTTLWRLIKSK"
FT   gene            397240..398511
FT                   /locus_tag="CLJU_c03820"
FT   CDS_pept        397240..398511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03820"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13464"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLR8"
FT                   /protein_id="ADK13464.1"
FT                   /translation="MVKLLIIADDFTGALDTGVQFTLSGAVTYVIVDSQINYTKIESNV
FT                   EVLVIDAETRHLDKAEAYQKVFSIVRQATEIGISYIYKKTDSALRGNIGAELTAAMLAS
FT                   KSKHIHFIPAFPKMGRTTVNGVHYINGIPVAQSIFGQDPFEPVCYSDIKEIINSQSELP
FT                   VHIMSADISESCESTEGIIVYDSSCDQDIKNIAEKLNKKDEMHLIAGCAGLASILSQIL
FT                   QLGSERPRIPEIKPNMFVACGSVNPVSVAQCNDAKCKGIPYFRLTPEQKLNTDWAENCD
FT                   ADEFIQNLYDSSENNHMVILDTNDMEGTESTTAYAQKKGISTEQMRTHIISSMGKILKR
FT                   LIDKGCDSTIFIMGGDSLIGFAREAGIKGIFPVCEMDCGVVLSQLNYNGKMLNVISKSG
FT                   GFGKETIFSDLSKMLLRLNEGRKL"
FT   gene            398513..399673
FT                   /locus_tag="CLJU_c03830"
FT   CDS_pept        398513..399673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03830"
FT                   /product="putative iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03830"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13465"
FT                   /db_xref="GOA:D8GLR9"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLR9"
FT                   /protein_id="ADK13465.1"
FT                   /translation="MLEKYNLKMPHVVYSGENSLENIKTIILENKVNKLAVFTDKGIES
FT                   AGLLDYPMNFVNATGVEVSILDDLPPEPTYSQAQKLVDEFKASKADFIMAVGGGSVMDT
FT                   AKLASILATDDYGVHELLDEPKLAKKCIKTLMIPTTAGTGAEATPNAIVAVPEKELKIG
FT                   IVNEEMIADYVILDAIMIKKLPRKIAAATGVDALAHAIECFTGNKANPFSDIFALEALD
FT                   MILNNIVKACDDAEAMSAKNKMQIASFYAGVAITASGTTAVHALSYPLGGKYHIAHGVS
FT                   NAILLVPVMRFNEPVCRAKFAEAYDRCVHGEKTCTTVEEKSEFMIKQFEKIVKHLDIPT
FT                   SLSTFDVPASDLDILVDAGMQVTRLLDNNMRKVTKEDACELYKQIL"
FT   gene            399723..400622
FT                   /locus_tag="CLJU_c03840"
FT   CDS_pept        399723..400622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03840"
FT                   /product="predicted dihydrodipicolinate synthese family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03840"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13466"
FT                   /db_xref="GOA:D8GLS0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLS0"
FT                   /protein_id="ADK13466.1"
FT                   /translation="MKQVEIKGIISAMITPMNEDESINAAALREQVNRQIENGVHAIFC
FT                   FGTNGEGYILNKEEKKLVLKTVIEETNGRVPVYAGTGCVSTKETIEQSKMAMDLGADAL
FT                   SIITPSFAVASQNELYDHYKTVAEAVDMPIILYNIPARTGNALAPATVGKLSQIPNIIG
FT                   AKDSSGNFTNILGYISATEKNNFSVLSGNDQLILWALKAGGVGGIAGCANVYPHTMASI
FT                   YNSYMEGNWEKAKEYQDSIASFRGCFKYGNPNTVVKTAVSLLGYNVGKCRAPFNQLPEE
FT                   GIEALKKVLKENADKGMR"
FT   gene            400646..401647
FT                   /gene="pdxA"
FT                   /locus_tag="CLJU_c03850"
FT   CDS_pept        400646..401647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="CLJU_c03850"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03850"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13467"
FT                   /db_xref="GOA:D8GLS1"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLS1"
FT                   /protein_id="ADK13467.1"
FT                   /translation="MLKKLVIGITMGDASGIGPEIIVKALSHRNVYDICAPVVIGDPKF
FT                   LKKAIEITNSDVSLNLINDIKDAEFSYGKIDCFNIDIIPEDLTIGKMSPVAGDAAFQFV
FT                   KKAVELAKENKIQAICTAPLNKEAMQKGGHKFAGHTEILAELTNTKDYSMMLSSPKLKV
FT                   IHLTTHVGLVKAVEMINPERTYRVIKLANDVLTRAGYKNPKIAVSGINPHAGENGLFGN
FT                   GEEEEKLIPGIKRAQEEGIEVSGPYPPDTVFFRAVNGDFDIVVACYHDQGHIPIKVLGM
FT                   SDGINVTVGLNGGVIRTSVDHGTAFDIAGKNIADEKSMLAAIKSAVELVPKN"
FT   gene            401745..402695
FT                   /locus_tag="CLJU_c03860"
FT   CDS_pept        401745..402695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03860"
FT                   /product="putative D-isomer specific 2-hydroxyacid
FT                   dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03860"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13468"
FT                   /db_xref="GOA:D8GLS2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLS2"
FT                   /protein_id="ADK13468.1"
FT                   /translation="MKVISTSPSFAKYSKEPIEYLSKNGIEVSYLPADIAEDEFIEKIH
FT                   DVDALIVAFTQINENVLKNAPNLKIVCKHGVGVDNIDLEATKKRNVYVTNVPNANKHAV
FT                   ADFAFGLILASARQIPQANDLTKKGEWPRTFGTDVHGKTLGIVGLGNIGKEVAFRAKGF
FT                   SMNVFAYDPYPDEKFAAENGITFVTIDKLLKQSDFVSIHIPLLDSTKNLIDYKKLKMMK
FT                   KSSYLVNASRGGIVVEEDLYKALKEGVISGAALDVFTEEPLKSHPLFELPNFIASPHIA
FT                   GYTAGATDALGMTCVENIVSVLVNKEKPKFIVNKL"
FT   gene            402731..404044
FT                   /locus_tag="CLJU_c03870"
FT   CDS_pept        402731..404044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03870"
FT                   /product="predicted transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03870"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13469"
FT                   /db_xref="GOA:D8GLS3"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLS3"
FT                   /protein_id="ADK13469.1"
FT                   /translation="MENRKSTLKNSMGRKTNIRWIVAAMMWAAIAINYIDRTVLSTGAT
FT                   HISKEFSLSSGEMGILMSAFFWSYALLQIPAGWVADRIGQKKTLGFAVGWWSIMTAVTG
FT                   LAVGFKSLLGFRVALGAGEAGAYPSNAGITSKWFPKKERATVSGLFDSGSKFGGAIAMP
FT                   LIAWLIVTFDWKLTFAFIGLLGVIWTIIWLLFFKETPAEHKGVNKLELDYINQDNNENV
FT                   KAENVDSKSSIKWYQLLKYKNIWAMCIGFFMINYNSYFFITWLPTYLVKERGMSLLKMG
FT                   FAASLPLLCAMVAEIIAGWLSDKVYSKKLLSLTATRKVFLIVGLLMASCIGVAAFTKSP
FT                   ALAVALLCIAKSGNTVAASQVWALPGDVAPKNMTSVVAGMQNTVSNMGGVVGPIITGFI
FT                   VGATGSFVPALLFSAVLIVIAIFNYLFLLGKVERIEVQ"
FT   gene            404518..404883
FT                   /locus_tag="CLJU_c03880"
FT   CDS_pept        404518..404883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03880"
FT                   /product="hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03880"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13470"
FT                   /db_xref="GOA:D8GLS4"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLS4"
FT                   /protein_id="ADK13470.1"
FT                   /translation="MIAFFSFAGILVGGGSLFFNNFYIILLGTTFFMAGYMNFSAILPG
FT                   SVTKLSTKEIRGTVTGIYNTVQFIGSFVGGTLTGILWGINSHFPAVFIIIVSIVGCIFV
FT                   RKLETIDKHTSTDKIKL"
FT   gene            405019..405279
FT                   /locus_tag="CLJU_c03890"
FT   CDS_pept        405019..405279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03890"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13471"
FT                   /db_xref="InterPro:IPR005370"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLS5"
FT                   /protein_id="ADK13471.1"
FT                   /translation="MKNIGVEKGLSRMADYLNAQGYSVQILGEDLENNVSKCKNLDAIV
FT                   TAGYNTDMMGFSDTSTKVPVINADGLTQEEVKNMIQQKTTR"
FT   gene            405545..405748
FT                   /locus_tag="CLJU_c03900"
FT   CDS_pept        405545..405748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03900"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13472"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLS6"
FT                   /protein_id="ADK13472.1"
FT                   /translation="MDIVSLKRQHSEEMKKVTEAYENYKSKYNTSNKITNNIEGFKQDT
FT                   IQIFKALSDRIDREEKELYPLL"
FT   gene            405925..406323
FT                   /locus_tag="CLJU_c03910"
FT   CDS_pept        405925..406323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03910"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13473"
FT                   /db_xref="GOA:D8GLS7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLS7"
FT                   /protein_id="ADK13473.1"
FT                   /translation="MYKGPSINLAMIHGGEVYNKVPDYCKMSLDIRTLPEQNIDDIVLQ
FT                   IKNKVDCKIIISDTGDPVKTDINSPYVKKLKNVASQFLDRDCILFGQHGSADTRFYSKD
FT                   NILAVEFGSSGVNCHGNDEYVFTYCFKI"
FT   gene            406525..408237
FT                   /locus_tag="CLJU_c03920"
FT   CDS_pept        406525..408237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03920"
FT                   /product="predicted methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03920"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13474"
FT                   /db_xref="GOA:D8GLS8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLS8"
FT                   /protein_id="ADK13474.1"
FT                   /translation="MTFFKNMRVRIKLILCFLIISILIVIVGIIGIKSLGVVNANSEEM
FT                   YNNRLQSVYMLTDMKQNLTQAESDILQLVYVKDNFKKDDLEKDIQQNKAESDKYISSYE
FT                   KLSMNDEEKQIWSTFKSQLSQYRTLRENVVESVNTANNDKVVTQYEQLIGYKTEMFSNL
FT                   EKLISINNDSAKASNVENHLVYITSNRSMIILMIIGALIAIGLGLFISRDINNPLMETL
FT                   DFAENLSKFDLTHEYQVTRKDEFGKTSEALIKAQKNIKELIKVIMDNSQDMSASSEELS
FT                   STSEELSSKVQEIDNAVTNITAQIEDASASSQQISASIQEIDSSINELSGKAIEGSNNA
FT                   NNAKEKSTKGKKDGKEIMDQVQNLYTEKRNNMLQAIEDGKVVKNIRVMAETISGIAEQT
FT                   NLLALNASIEAARAGEQGKGFEVVAQEVGKLAEESQNAVASIQDTILKVQDASKKLSEN
FT                   GSDLLRFINEEIYGKIEQLRGIIDYYSEDSNFVSKMSEEIASMSEELTATVAQVSDAIQ
FT                   NVASTSQKSSENAQNIKIGVSETTKAIDQVALSAQSQAEFSQKLSEMVQKFKI"
FT   gene            408344..408673
FT                   /locus_tag="CLJU_c03930"
FT   CDS_pept        408344..408673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03930"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13475"
FT                   /db_xref="InterPro:IPR024617"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLS9"
FT                   /protein_id="ADK13475.1"
FT                   /translation="MKRNKIFVSGYAKLPGGITATEVYTEIAMTAVLDRVTGKIYEIEC
FT                   TLVTNTAREYIKKLLAGRNIKDIDDMVKDIADNYFGIAKKAIIASLTNCYERYILITKS
FT                   GNEDK"
FT   gene            408900..409838
FT                   /locus_tag="CLJU_c03940"
FT   CDS_pept        408900..409838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03940"
FT                   /product="Hypothetical Membrane Spanning Protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03940"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13476"
FT                   /db_xref="GOA:D8GLT0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLT0"
FT                   /protein_id="ADK13476.1"
FT                   /translation="MGYVFIILAAVIFSTMEIVGKLAVGLNPLQLNFLRFLIGGLILFP
FT                   PTIKAMRNKKMKFKKDDLYYFLGTGFLCVVLSMSLFQLAITFTKASTVAIIFSTNPVFT
FT                   VMFAYLFLKEDLNRGTIISIILSLVGIVCILNPFGTVSDVKGIVLSILAAVTFSLYSVV
FT                   GKLRSEKYGSITLNCVSFLVGDIIMLVIILLSNLPVVSSIINPKGGLSFMSHIPIIYGI
FT                   SAANIIPVIFLGIVVTGLGYMFYFMAMDETSATTASIVFFIKPALAPIFALIALSEKIP
FT                   MNTVIGICFILIGSYFSFTAKGGTRVEEVES"
FT   gene            410170..411882
FT                   /locus_tag="CLJU_c03950"
FT   CDS_pept        410170..411882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03950"
FT                   /product="predicted methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03950"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13477"
FT                   /db_xref="GOA:D8GLT1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLT1"
FT                   /protein_id="ADK13477.1"
FT                   /translation="MRWFNDLKIKQKQVIGFFMVTLFVVIVGIIGLVNMHNINKGANEM
FT                   YSVDLENVKNLDKFDADIMHQRLETIDLVESRDKDKVQDTIKNIAPYQNKDNSILNNYK
FT                   NSDLTLQEKNLVSKLESQLIDWRNICNKIIELMGQGKYDDAMNVNKEAATYRNKLTSTI
FT                   EQLTQTEVQKANDKNNSNMSIYNESLYMIMIITLIGIVVAFFLGNRIASSISKEANSIL
FT                   KFTDAISQGDLSKSIQALSKDEMGTIAGELGKANKNIRNLVLEITQSTENISASSEELS
FT                   ATTEEISSMMTSVNESTSQIAGGSEDLSRITEEISASCEKMEQNTHKLTQKANEATKSS
FT                   TEIKKRAVDIKEKAAQSIEEGNDIYNKRRDDIIKAIEKGKVVSEVKIMAASIGDIAEQT
FT                   NLLALNAAIEAASAGEHGKGFAVVADEVRKLAEESSEAVENINRMVLAVEDAFNNLSDS
FT                   GKEILNYISNSVKPNYQILMDTGLQYEKDAEFMNQMSEEIAVASKQMSDIVSEVNGGIQ
FT                   SAAATAQESAAGSEEISSSVNEVTKAISDISGSSQSQAELAEKLTDIVSQFKI"
FT   gene            411970..412908
FT                   /locus_tag="CLJU_c03960"
FT   CDS_pept        411970..412908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03960"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03960"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13478"
FT                   /db_xref="GOA:D8GLT2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLT2"
FT                   /protein_id="ADK13478.1"
FT                   /translation="MVSIIIPIYNEEQQVYSNVVKVMSILLENNIEHQFVLVNDGSTDN
FT                   SSKEMNRLCRDYNNISIIELSRNFGKEAALCAALEHVSGDACVILDCDLQHPPELIPEM
FT                   VRLWKEQGYDVVEGIKLERGKEPLFRKFAASAFYDLFNKVSGINLNSASDFKLLDRKVI
FT                   EAWKSMHESITFFRGMSAWVGYNRIQIPFEVQARTSGKSKWSLGNLVKLGIYSVTSYTS
FT                   LPLYIVAWLGIIMMLVDCILFVQTLYMKFNGKAFTGFTTVIILILGIGSCIMISLGIIG
FT                   IYISKIYDEVKRRPRYLIAKKQGKEFYYKNK"
FT   gene            412932..415988
FT                   /locus_tag="CLJU_c03970"
FT   CDS_pept        412932..415988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03970"
FT                   /product="Predicted membrane protein with a
FT                   6-pyruvoyl-tetrahydropterin synthase domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03970"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13479"
FT                   /db_xref="GOA:D8GLT3"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR017543"
FT                   /db_xref="InterPro:IPR018776"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLT3"
FT                   /protein_id="ADK13479.1"
FT                   /translation="MKFQGYKYKFKINISHSVLINNRRGNLHSHTFEISLFIKIINDDF
FT                   ALYDDVEKIVQEFLNIYDEKELNLIEPFDKIEPTIENVGDFLYVRLKEILKNNNMILVR
FT                   LEISETPARVYVVNYDENDIKEPGYEEEFKNYKKRMTRIIINNILNTTAKQLTDDLKSS
FT                   SNTIVEGTWIQEDDKKEKVIEKKNTIKIEESKKTPNAIRHNDKMRKSNHVFLETAGAIS
FT                   VLLIGTIVLLLCIAKTGGYPWGADTYGHIFKGDLLYKSIKEGNIYPLFTQFWYNGVQPF
FT                   RYWGPLSYYVLAACEFISGGNPINGYVIFIGYSFFIGGLGWLMWGIHQRRILLSLVFGI
FT                   LWFFLPENIRVLFVAGNIPRVIIAALIPYLFYFVWKFVKDDDRSSIIPIALFMCAIIMC
FT                   HLMIGAMIGIASFIFLSLYSIMNKKIERSFHVILTMLLSFAICGIWIYPALKGGLVSMD
FT                   SGATSSQMMELLATPFTISLNPFLRLFGIVDREYFYYGLSILIISILGIFVSNKKSVPG
FT                   FITSIVIFLGTTTAFVPMLEKMPFSQLLWMVRFTPIAYALFIISLLNWTKCKKYFMIIM
FT                   VVLIAADSSLSFNLSLYPQIKSAEVDNILSSAKNITKQRIALLDNSTFGAYPSFYICSE
FT                   DKKTSYSYGWAWQGAATAQNIVLLNTALEKGYYNYMFDRSLEMGCDTAVVAKAPMKKNK
FT                   RDFSIINSAAKLSQYTLYKETSEGYVFHRKTSENFGVVTKYSGLCIGRSASDIPLQYPS
FT                   FEIGSSWNIEDYTLDELSKYKVIYLSDFRYNSRSKAENMVSKLSSMGIKVIIDMNRIPS
FT                   DTITNRMVFLGVTAQPITFSTKIPDMFFNNKKYESVNFKDEYKIWNTVYLDNVPQVTGF
FT                   SWVNGKKVPFLGSGKGKNKNITFLGFNLMFHGMENDDSKVLTIMDTIMRTKSSILPKRT
FT                   LIPIDLKYGQNSITINSPKNNVNTTVAFLDAYKSNSGEIYSKQNLLNVNKGETKIRVTY
FT                   PYLFQGIAVSVIGLMGFAFFIIYIYKRVV"
FT   gene            415990..416613
FT                   /locus_tag="CLJU_c03980"
FT   CDS_pept        415990..416613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03980"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03980"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13480"
FT                   /db_xref="GOA:D8GLT4"
FT                   /db_xref="InterPro:IPR026409"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLT4"
FT                   /protein_id="ADK13480.1"
FT                   /translation="MKKIITIISVLLISVMFLYPLKVYAADSGVTLDGYFDDWIDKPSQ
FT                   KLYYWQGAVHTVKWYSDDKDLYLYIKMATVGGQQLNNYTITYSDNNGIQGNLTIQVDRP
FT                   SKGRISIYNYSMDYRPFSTDGYVVRGSNSDGKTSDQGEFRIPLTIFQKDSKDQMITLNL
FT                   GFPNLGNQGVAFQVGSTYPYMGVSIGILIVASGFFIYRRKRKIE"
FT   gene            416610..417206
FT                   /locus_tag="CLJU_c03990"
FT   CDS_pept        416610..417206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c03990"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c03990"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13481"
FT                   /db_xref="GOA:D8GLT5"
FT                   /db_xref="InterPro:IPR017541"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLT5"
FT                   /protein_id="ADK13481.1"
FT                   /translation="MKILICFLLIVWIYLITVFTRAKLYFFKFVAGSVGLFFFMMVILQ
FT                   PYLVNVLSRSVAAASGIMGDVTGCYQAFYQYSLILIQSGGSAISMYIDYECSGVIEILA
FT                   FTALLWFFPLYNTLEKIMYNIIGVVWIFLANIIRIFIICVLVYYYGNNIFYFAHTIFGR
FT                   IVFYALSIILYFYVFTRSQIKRQKVGNVLYGDDIK"
FT   gene            417187..418557
FT                   /locus_tag="CLJU_c04000"
FT   CDS_pept        417187..418557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04000"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04000"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13482"
FT                   /db_xref="GOA:D8GLT6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR017542"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLT6"
FT                   /protein_id="ADK13482.1"
FT                   /translation="MEMILSKTFKEMIFWMAWIIIPFIMEIVPSIVGFFILIRKKMSLK
FT                   KECFSGKLPEITVIVPVYNSAQTLESCIKSIYESNYPTELIDVMLVNNMSSDNSFEIFT
FT                   KSQKEFEGLSMRYLNAKQGKSKALNMALFNSGGKYIIHIDSDGILETNAIRNMVVRFEQ
FT                   NTHIHCMTGAILTDAKYIENTKTPFLKLVRRCEFFEYAQAFLAGRNFESELNSIYTLSG
FT                   AFSAFRKSTILKTQLYNSETVCEDTQITFQVRHLLKKKVYLCENALFFVEPIDNFNKLY
FT                   TQRQRWQRGEMEVSHMFLKDKLYSAGGFFSNFMIRILMYDHTFAFPRMIWYFALIFLLF
FT                   MDYPLYLVLGSVFVIYLLYVLSAFLFYLNVRVYLAEYKDIRKYYSAKVYLIVLMPLFNF
FT                   MIFWIRFAGIINSIKLESKWRTLNLKEEYRAFCNISKSDFKRVFKIIDQVRRIVNNP"
FT   gene            418614..419837
FT                   /locus_tag="CLJU_c04010"
FT   CDS_pept        418614..419837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04010"
FT                   /product="GGDEF domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13483"
FT                   /db_xref="GOA:D8GLT7"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLT7"
FT                   /protein_id="ADK13483.1"
FT                   /translation="MMKKRASENYLIKILLIFIITAAFISALWLDVFYEIGNHKKNIID
FT                   AFSREQYSITNQLSDRLQESLNDYVQNKGFTLHSAEEKVISEIIKKEINSQNKYVFFYN
FT                   SKNILFERNYLTTEQYKGKGLKDSFNLWEYNGGSNLDEVKSLMNSGISGKGEIVKDSKK
FT                   GKEMVSWCFFKVLNEKYVIGMSTSEDYLFRETLFNQHIVRLYILAGIATMAIIILSVAF
FT                   SLYLYFMFKKVKNLKNQLKNKNIQVQNFVSTISQLEKSARKATICDPLTGVYNRKFFYT
FT                   ILPKMNEELFLPIAAIRVNIEGIKNINNVLGRGKGDEVLVELAEILLESCNESDIVSRI
FT                   SDNKFVLIMINTDREAAFRKVDEIGEKIKNSFIGAICSISFGISVKTSETQNLFRILKS
FT                   AEKNIRQL"
FT   gene            419879..420370
FT                   /locus_tag="CLJU_c04020"
FT   CDS_pept        419879..420370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04020"
FT                   /product="6-pyruvoyl-tetrahydropterin synthase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13484"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR017543"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLT8"
FT                   /protein_id="ADK13484.1"
FT                   /translation="MKYNQYRFKFYLNASHSIYLKGILGEEHPHTWEITLDTVKLEDNF
FT                   IIFNDIEKNIEKYLQKFQDKYINNITPFNTLNPTLENICAYFKECFESLLMENKWLLLS
FT                   IEISETPTRSYIIDVSDEINYNNISYIKGKEKYNSNNGISIVNQEIDRITKLVIDKNKS
FT                   "
FT   gene            complement(420413..420733)
FT                   /locus_tag="CLJU_c04030"
FT   CDS_pept        complement(420413..420733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13485"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLT9"
FT                   /protein_id="ADK13485.1"
FT                   /translation="MSMIKRVGISSKTSKDSVEVVSNLTTDNIFQITNKEIEDVDNMVV
FT                   NINQAADEINRRTVKGTNSSEKSLNLLEEILSKTTRLKEISDTLEYSSDNLQEMVGAFK
FT                   IS"
FT   gene            421064..422293
FT                   /locus_tag="CLJU_c04040"
FT   CDS_pept        421064..422293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04040"
FT                   /product="predicted ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13486"
FT                   /db_xref="GOA:D8GLU0"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLU0"
FT                   /protein_id="ADK13486.1"
FT                   /translation="MNGVNGADTVFVLISAALVMIMTPALALFYAGMVRGKNTLNSTLH
FT                   SFSALAVISIQWILIGYTLCFGTDIGGIIGGFNFAGLKGVGFAPNADYAATIPQQVYML
FT                   FQLMFAIITPALISGSIAERMKFMPWVAFVLLWTTLVYDPIAHWVWGTGGWLKNLGALD
FT                   FAGGNVVHISSGISGLVAALMLGKRKNVGKPSNLPMTCLGAAILWFGWYGFNAGSALAI
FT                   NDVAVNAFITTNTSAAASAISWSICELLYRKKVTSLGVASGIVAGLVAITPAAGFVSPL
FT                   ASILIGLIGGAICYTTVTFVKSKFGYDDALDAFGCHGVGGIWGGIATGIFAWKAINSAG
FT                   ASGLIHGNPKLVLIQLTAVVASVVYSAIVTFIIIKVIKAVSGIRVTDKDEQIGLDVTEH
FT                   GEEAYGGMNI"
FT   gene            422422..422796
FT                   /locus_tag="CLJU_c04050"
FT   CDS_pept        422422..422796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04050"
FT                   /product="predicted nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13487"
FT                   /db_xref="GOA:D8GLU1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLU1"
FT                   /protein_id="ADK13487.1"
FT                   /translation="MGDKLTKVDIITSGGRFEELKKALGDIGISGMTVTNVLGCGMQKG
FT                   HKEYYRGLTMDINLLPKVKVEIIVCEVPVEKVVETAKKVLHTGEMGDGKIFVYNVENVI
FT                   RISTGDEGKAALQYNKDDKR"
FT   gene            422985..424115
FT                   /locus_tag="CLJU_c04060"
FT   CDS_pept        422985..424115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04060"
FT                   /product="predicted methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13488"
FT                   /db_xref="GOA:D8GLU2"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLU2"
FT                   /protein_id="ADK13488.1"
FT                   /translation="MDYTLIATSTFGLESVVAKELKNLGYDDLKLENGKVTFPGDEMDI
FT                   VTCNLWLRTADRVLIKMSEFKAESFEELFQGTLAVDWGSIMPENAFMHVTGKSIKSKLH
FT                   SVPDCQSIVKKAVIESMKKKYNREKFSEDGVEYKIEVAILKDIVTLTVDTSGEGLHKRG
FT                   YRKNSGGAPMKETLAAALVLLSKWEPSRVLVDPMCGSGTIVIEAAMIGKNIAPGLNRSF
FT                   VSEKWGIIPHDLWDDLRKHARNSINNKEFKILASDIDGWVIKTAKDNAKKAGVADQIEF
FT                   QKIPVQSFSSKKKYGFIISNPPYGERLGDVKEVEKLYEDMGSVFSKLENWSYFIITAHE
FT                   GFEKHFGKKSDKNRKLYNGKLKCYYYQYFGEKPKYN"
FT   gene            complement(424154..424792)
FT                   /locus_tag="CLJU_c04070"
FT   CDS_pept        complement(424154..424792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04070"
FT                   /product="predicted transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13489"
FT                   /db_xref="GOA:D8GLU3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLU3"
FT                   /protein_id="ADK13489.1"
FT                   /translation="MPNKTFFNLPKERQKEIIEISIKEFSNHDFDSSSLNRIITNLKIA
FT                   KGSFYRYFSNKTDLYIFLINYTLNKQLAYITNFKPEEEHLDAITLSKKLVIHVLEFDFM
FT                   YYNYASFLFHACKSEQFKSYLPTNRKEFIAIIDIFQDKKLIRRDLDKNIMIFYIFRNMV
FT                   LLRDFIVERLNIPEVEFSKGYATYKKHEKSINEITETYCDLLLNGIKQK"
FT   gene            424982..426256
FT                   /locus_tag="CLJU_c04080"
FT   CDS_pept        424982..426256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04080"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13490"
FT                   /db_xref="GOA:D8GLU4"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLU4"
FT                   /protein_id="ADK13490.1"
FT                   /translation="MSNKVLNVIREKVPNVVVRKKVPIICLVVVVIIALTTYFTAFSKN
FT                   KEKEPIAKSYPVKTVEIKSGSFPMTLQYEGLTGGSEVRKLSFKSSAKISKIYVSKGQHV
FT                   KKGEKLADLDKTDLNFAAQAAKSQMDTASAQYSKAVNGAQQEDINKAQIAVQNAQDNNN
FT                   YYKDLYNKYLKLNQAGAISNQQLNDTKLQVDSTQNALDSAEQSLQQLQNGSRPEDKQAT
FT                   LDQLNEAKADYDSKESLLNDATMTADMDGYVVDVLGKEGEMQQAGNPVILFRSENQVIT
FT                   VGLSDDDVKKVKVGTKAQVNIGDDKAQGEIVNIVQMADSKSGTYSAEIKLSTAIDASKY
FT                   YVGETSTVYIDMGQTNSISVPISSVLNDGEDYVYVVENGHAVKKNITLGDTDEDKVSVD
FT                   GLKDGDELVVQGMKNLKSGYKVTVK"
FT   gene            426271..429327
FT                   /locus_tag="CLJU_c04090"
FT   CDS_pept        426271..429327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04090"
FT                   /product="predicted transporter protein"
FT                   /note="similar to cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13491"
FT                   /db_xref="GOA:D8GLU5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLU5"
FT                   /protein_id="ADK13491.1"
FT                   /translation="MGLIKAAIKNKKIVLFLVAIIIVSGFYCYSGISKQETPDVASPAA
FT                   MITTVYPGASPSDIEKLVTKKVEQKAEEVDGCDYVQSYSESNASIVILYLNNDADEDKS
FT                   WRDLRDKIKDLKSDLPSGCNDSEINTNLTETAGSIISISGNNYSYQQLGDYADDIKKEL
FT                   RDTEGVSRIDVKGKQDRQVKVDIDWNKINKYQISVADVCSVLKAQNVDIPSGSLNLVTG
FT                   KIKVNTPGMFSSLHDIENTVVGVSSSTGEMVRIKDIAKVYMDYDDDSTYKFTDNAQNAV
FT                   LLAVYFQKNKNIIPIGNDIKKKLDTIKKGTPSDLKIDEVTFQPKDVSDSVSFFMKNLRD
FT                   GIILVIITVLIGMGFRNAMVVSAVIPISICMTFAIMYALGIKVEQMSTTALIIALGILV
FT                   DDAIVIGDVIQVGIDDGLPRNEAAFNGIKKLFVPVFTSTLIIVGAFLPLLSISGVVGKF
FT                   LKSLPQVVIICVICSYLCALFVTPAMSSLFFRKSKESKRQNPIRMMFENLLKYGLKHKK
FT                   TIIGAALAVFAVALILIKTLGMQLFPYVDKNMIYIDVSNEKVADIKSTSKLVNQIEGIL
FT                   KRQKEVTAYTSAIGGGMPKFYVTLPTVAPADDTAQIMVKVDLKKTNRFKTRQELVEYVQ
FT                   NQIDNNISGGTATVKQLEEAMPIGAPIRLRLTGDDLDQIQQASEKIQQQLKNIPGTMNV
FT                   RDDAAKKTYEYEVDIDENRASQLGLLKSDVLQQINIALKGYKASTYRKNGNEYDIMVKT
FT                   NISSVGDLKNLYIESSVTKNKIPLYEVASVKLNSEIDKITHYKEDRTVTIYSDVKSGYN
FT                   SVNIEKELQQKIDGMSIDPVKVIYDGEKAQISKYFTSLGVAGVLILVIIYVLLFIQFKS
FT                   FVQPLVIMCSLPLSLIGVSIGLHAFGMNLSLTAFMGIISLIGVVIRNAILLIEYINNGR
FT                   EDGLSVDDACMFAVSQRFRPIILSSTATITALIPLAFSGSALFGPMSVAMMCGLLTATF
FT                   LTFVVVPVVYSMVNTKLEKKIKSKEVITD"
FT   gene            429730..430224
FT                   /locus_tag="CLJU_c04100"
FT   CDS_pept        429730..430224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13492"
FT                   /db_xref="GOA:D8GLU6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLU6"
FT                   /protein_id="ADK13492.1"
FT                   /translation="MDVVANLDECTNVKLPFEDDYFEEFYASHLIEHIKNALPMMQELH
FT                   RIAKPNAKATFRCPYGSSDEAFEDPTHVRQYFLNSFGYFGQPFYWRADYGYRGDWKVKR
FT                   LILTVDKNKYEGVEPYKILEEVNKFRNIVKEMVVELIAIKPIRKPNKDLQDRVNVEFNL
FT                   V"
FT   gene            complement(430497..431987)
FT                   /locus_tag="CLJU_c04110"
FT   CDS_pept        complement(430497..431987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04110"
FT                   /product="predicted ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13493"
FT                   /db_xref="GOA:D8GLU7"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028619"
FT                   /db_xref="UniProtKB/TrEMBL:D8GLU7"
FT                   /protein_id="ADK13493.1"
FT                   /translation="MISIVNIKVYEVKKIMDKLEFKDFALSEDILKSIEKLGYKNPSQV
FT                   QEKVIPLIFKNKDIIVKSQTGSGKTAAFAIPICEKIELEEKNPQVLVLAPTRELALQIK
FT                   EDFYDIGRFKRINCTAIFGKEPITTQIKELKQRTHVIVGTPGRTLDHIEKDTLSLKKIQ
FT                   YLIIDEADEMLNMGFIDQVKAVLDKLPKNRVTLLFSATIPQEILKLCAAYMNNPINVEI
FT                   DAEDPVINRINQIYYQIEAYKKFDLLNKLVYTQRPESSMIFCRTKKNVEDLVLQMKGKG
FT                   YSCSGLHGGMLQSERIDVMKRFKRGEFIFLVCTDVAARGIDVENITHIINYDIPMEKES
FT                   YVHRIGRTGRAGKSGTAITFVTPKEYRFLEEIEKFFNLTIEKGTIPSKEEVEKGKDIYK
FT                   EKLKAAPKIKKDKSTKLNKDITKIYISAGKKKKIRPGDIAGTISSIDGINPEDVGIIEI
FT                   QDNFSYVDILSGKGHIVLDGLKHKTIKGKSVRVEIAQK"
FT   gene            432073..433290
FT                   /locus_tag="CLJU_c04120"
FT   CDS_pept        432073..433290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04120"
FT                   /product="putative deoxyguanosinetriphosphate
FT                   triphosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13494"
FT                   /db_xref="GOA:D8GM84"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM84"
FT                   /protein_id="ADK13494.1"
FT                   /translation="MERKKFLDVATTENNEKWKQSISRENKLYERNHELRSEFSRDYNR
FT                   ILHSTSYRRLKHKTQVFFATDNDHICTRIEHVNHVSAVSYTIANYLGLNTQLTTAVAIG
FT                   HDLGHTPFGHEGEKILGDFSKAQLGNEFWHEKNSLRFVDKIETLPNPAGKQSNLDLTYA
FT                   VRDGIVCHCGEVRAEAIFPRDQVVDLNDIQKTLQISSYTWEGCVVKIADKISYLGRDIE
FT                   DAFKLGILKRSQLKELYNITKDTVGIHSIREINNTVLMHNFIVDLCQNSSPDNGIVLSS
FT                   KYLTFINLVNKFNYENIYNHERLNNFKNYVKLVLDTILNTLMRYYDGEKTLDKIKDFKR
FT                   IYPSLHEGFSGWLKKYCIQFKGKWRDNEKIYDLKNYRDYIQAIIDYTSGMTDNFAIRVF
FT                   NEMLRF"
FT   gene            433492..434493
FT                   /locus_tag="CLJU_c04130"
FT   CDS_pept        433492..434493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04130"
FT                   /product="predicted Ca2+/Na+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13495"
FT                   /db_xref="GOA:D8GM85"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM85"
FT                   /protein_id="ADK13495.1"
FT                   /translation="MILSGITMLLSALLIYFSCEFFVNSIEWVGKAFNISKNAVGTVLA
FT                   AFGTALPESIVTLIAVVFGANSSQKDIGVGSALGGPLVLSTIAYAVVGVSIIMFSSKRK
FT                   IGKHIKINARKLGRDQIWFMCIFVFKVALGFVAFSIKHWLGFLFLAVYVLYSYGELKAG
FT                   AEETEEKLEPLKISPKNTHPTKIMILGQTIVSLVFIFAGSQIFVHNLGSLSSFLGVPPH
FT                   IIALILSPVATELPETLNAVIWVRQGKENLALANISGSMMIQATVPSALGIIFTPWMFD
FT                   KSLALSAFITFIAILFLWITLRKSHLSAWRLSLNALLYVVFIVGILFIKSCI"
FT   gene            434484..434618
FT                   /locus_tag="CLJU_c04140"
FT   CDS_pept        434484..434618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13496"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM86"
FT                   /protein_id="ADK13496.1"
FT                   /translation="MYIDYFVFLVGKLNIKLKKLIGRMKKFILKVIEDNLLTYSIFKL"
FT   gene            434766..435194
FT                   /locus_tag="CLJU_c04150"
FT   CDS_pept        434766..435194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04150"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13497"
FT                   /db_xref="GOA:D8GM87"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM87"
FT                   /protein_id="ADK13497.1"
FT                   /translation="MDMIDRQIVKCLQKNGRISIKKLSEIVCLTPPAVAERIRKLEEAD
FT                   VIMGYRAVINPQKMGMNIEALINITLKAGKRKEFIDFVRKSKCIVKCYHVTGGFSMTVK
FT                   VIVKETSELETLVGKIQQYGNTQTLIILSTIIEHKGIV"
FT   gene            complement(435246..436475)
FT                   /gene="maeB"
FT                   /locus_tag="CLJU_c04160"
FT   CDS_pept        complement(435246..436475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maeB"
FT                   /locus_tag="CLJU_c04160"
FT                   /product="NADP-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13498"
FT                   /db_xref="GOA:D8GM88"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM88"
FT                   /protein_id="ADK13498.1"
FT                   /translation="MNNLKEEALKFHKEHEGKIALKSKVSVKTREDLGLAYTPGVAEPC
FT                   LEINRDYNTLYDYTSKGNYVAVVTNGSAVLGLGNIGAAAGLPVMEGKSILFKTFAGVDA
FT                   FPICVDSKDPDKIVETVKLIESTFGGINLEDIKAPECFEIEDKLKKVCNIPVFHDDQHG
FT                   TAVVTLAAMINALKIVNKKFEDLKVIINGAGAAGTAIAKLLVSRGVKNIIVCDRKGAIS
FT                   KDRENLSAAKKDLAEVTNPSMIKGALKDVLKEADVFIGVSAPGVITPEMIKTMAKDPLI
FT                   FAMANPKPEIYPDEAKAAGAKVVGTGRSDFPNQINNVLAFPGIFRGALDVRASKINEEM
FT                   KIAAACAIADIITEKELNEDYVIPDAFDSRIAPKVAYYVAKAAIESGVARRTDITPEMV
FT                   EEHTKKLVQS"
FT   gene            complement(436581..437990)
FT                   /gene="aspA1"
FT                   /locus_tag="CLJU_c04170"
FT   CDS_pept        complement(436581..437990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA1"
FT                   /locus_tag="CLJU_c04170"
FT                   /product="aspartate ammonia-lyase"
FT                   /EC_number="4.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13499"
FT                   /db_xref="GOA:D8GM89"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM89"
FT                   /protein_id="ADK13499.1"
FT                   /translation="MDFRIESDSIGSKEVPTEAYYGVQTLRAAENFNITGYKLNTELVK
FT                   SLVQIKKAAAIANYKAGLLNENIEKAIIEASDKILGGDLQDQFILDPIQGGAGTSANMN
FT                   ANEVIANEAIQILGGKKGDYSIVHPNDHVNMGQSTNDVFPTAGKITALKLLLKAIEQLK
FT                   KLDMNLDMKAKEFNNIIKMGRTQLQDAVPIRLGQEFKAYSSVIKRDISRLEAAKKELEV
FT                   LNLGGTAIGTGINADNKYMNTVVPILSDIIGIQLEQADDLIDATQNLDGFVSVSGAIKT
FT                   CAVNLSKMANDLRLMSSGPRTGLEEINLPPKQNGSSIMPGKVNPVIPEVMTQVAFNIIG
FT                   NDVTITMAAEAGQLELNAFEPVIFFNLFESIETLTNGVKTFTENCISGITANTNRCKKL
FT                   VDNSVGIVTAITPYVGYEKAASIAKSAIKTGKPVKEIILQNGILKESELDRILDPISMT
FT                   EPRELKKYEFA"
FT   gene            438250..439677
FT                   /locus_tag="CLJU_c04180"
FT   CDS_pept        438250..439677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04180"
FT                   /product="predicted amino acid ABC transporter"
FT                   /note="permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13500"
FT                   /db_xref="GOA:D8GM90"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM90"
FT                   /protein_id="ADK13500.1"
FT                   /translation="MKSDHKGLSAVQLTMMALGTVIGGSFFLGSAVAIHASGPSIIIAY
FT                   ILGGILVYFILSALSEMTVSDPAPGSFATYAGKAFGRGTEFMVGWVYWTGMVLAMSSEA
FT                   AAVSILIRRWFPKVSISLIGSIVIICITLLNLLGASKLSKLESALASFKIAAILCFVII
FT                   GILLVTGLIGGVSQVKLGQLGREPFFAGGIKSIAGSMLIIMFAYAGFEIIGLAASETKD
FT                   PKKVIPKAIRYTVLSLVGLYIVSAAVIIFLIPTAAISENVSPMVAALNNWGMGWAGNVM
FT                   NIIMITAILSTMLAAMFGLGRMIRSLADRGHAPALLRDKKDVPYRGMMLSGFSMLLGLI
FT                   IGLLFPKVYLFLVSSGGFALLFTYAIIVASHIRFRKRNLQELKKKAYPYGSLITLISLV
FT                   VIIASMPFISGQTSGLVAGIIIIAVYLFIYLGVEVYKRTRKAINENNKLSVKKQIVDLL
FT                   TEFSEEITNHKKDKKGE"
FT   gene            440048..441196
FT                   /locus_tag="CLJU_c04190"
FT   CDS_pept        440048..441196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04190"
FT                   /product="predicted methyl-accepting transducer"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13501"
FT                   /db_xref="GOA:D8GM91"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM91"
FT                   /protein_id="ADK13501.1"
FT                   /translation="MIKVNQIDSVKEFAKVQANLVSGGVVYGIIEGDTMKWVQSSDSFS
FT                   LDVFHVGKKFDSNSTSLTAIREKRVLSQKVPRSAYGMRLSITSIPIVDEHDKAVGVFSM
FT                   AFPRLHPVAKAFENFAPMLAEMFSEGVFLCLTDLEKFVSIQSSKQFNINSIKIGDEFES
FT                   DFISKKVISTGKSKVEKIDAVKYGTPVMMLGYPLIDEDSNEIVGSFVIAMPKETEAELR
FT                   NMSGNLTESITGISSAIEELAASASQIHSNEQELNNDISQITELSEEINKISSFIEDIA
FT                   NETKMLGLNAAIEAARAGQAGSGFGVVANQIRKLSEQAKSTVPKIKKLTDSIKEKVDGS
FT                   SKKSKGSLASSQEQAAATEEITASIEEITTMSEKLSEIALKL"
FT   gene            441606..442115
FT                   /locus_tag="CLJU_c04200"
FT   CDS_pept        441606..442115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04200"
FT                   /product="predicted sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13502"
FT                   /db_xref="GOA:D8GM92"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM92"
FT                   /protein_id="ADK13502.1"
FT                   /translation="MIIQRDEFANYIKQYERLIITICLSFTKNYFDAEDLAQQTFLAAY
FT                   KDYEKFQGENFKAWLTKIAVNKCKDYMKSPARKINSLTDQEYECLEDKKSCIEDTVIEN
FT                   DTSQKIHDLCNKLKEPYRTVAINYFCKDIKLSHMAESTGQKLKTLQTRLYRSKKLLKVL
FT                   WKEEFM"
FT   gene            442112..442561
FT                   /locus_tag="CLJU_c04210"
FT   CDS_pept        442112..442561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13503"
FT                   /db_xref="GOA:D8GM93"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM93"
FT                   /protein_id="ADK13503.1"
FT                   /translation="MSEILFDENGHLTKKSIKCLKDGSLKSEESIMILDHVSECEKCSA
FT                   YIADGFDDTELVKAPSGFCDEVENKIKKRKSSEFIFYSLRVSIAACMALMIVFSNTLNF
FT                   IVNTKKVVGIAPPNLSIVNSINTNMSNFSQKIINMEGFNNENEKR"
FT   gene            442542..443066
FT                   /locus_tag="CLJU_c04220"
FT   CDS_pept        442542..443066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04220"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13504"
FT                   /db_xref="GOA:D8GM94"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM94"
FT                   /protein_id="ADK13504.1"
FT                   /translation="MRMKKGKISTFIFSLLPGAGHMYMGFMKMGISFMSAFFFVIFIAG
FT                   WLNIGPLLFVLPLIWFYSFFDCVNKRYSSDEEFLNLEDNYLFSLDKLLKVDQKVFTKQR
FT                   LFVGIVCLFLGLYLIWDNVMNTLWGHIPNEVYEMLSDVTRTAPRIIIGIAIIAAGIKLI
FT                   KGKKREMDEDV"
FT   gene            443053..443364
FT                   /locus_tag="CLJU_c04230"
FT   CDS_pept        443053..443364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04230"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13505"
FT                   /db_xref="GOA:D8GM95"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM95"
FT                   /protein_id="ADK13505.1"
FT                   /translation="MKMFKGRRVGTLTAGIVLVMFGTMFLLNRMLPNINYYLIVSLWPI
FT                   ILVLLGIEIIAGYIINNEEKMKYDAGAIILVILLSVFSMGMAGAQFIILHFPQCKIIF"
FT   gene            443474..444745
FT                   /locus_tag="CLJU_c04240"
FT   CDS_pept        443474..444745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13506"
FT                   /db_xref="GOA:D8GM96"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM96"
FT                   /protein_id="ADK13506.1"
FT                   /translation="MLMTDVKRYKAETWDIMQFMFEKFNDHQLHCVIELDSHIDENCLK
FT                   KAVYMSTWEFPLVICKFVEKKSSPYWQSCKFTTDDIVRIIETEKVHEEIEKCIVLKTDT
FT                   FKGPQLRINIIRSSTRDCLCIIINHMLCDAAGFKDYLYMLSSIYSNLKDNPGYTPNFQM
FT                   SSRSAKQVLDNFSDLDKVKIFFSSSQVSKYNGGIYFPLEGDNNNPFVVIHKITKDRVRF
FT                   IKKYAKESKTTINDIVIASYIRALQKELHCSHIALPCPVDLRRYIPEKKAQGICNLTSN
FT                   MVCDIGKDIGENYKETLLKVKKSMEHEKKSFSCLNGPMMLEIIFSLLPYKFAKSLVCKL
FT                   FHNPPIAMTNIGIIDKEKLSFYGAGVKDAYMNGSIKYNPYFQVALTTFDDEFTFSVNFC
FT                   GTQKDRQKIQSFLQTLDDELPKLI"
FT   gene            444778..445428
FT                   /locus_tag="CLJU_c04250"
FT   CDS_pept        444778..445428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04250"
FT                   /product="predicted phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13507"
FT                   /db_xref="GOA:D8GM97"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM97"
FT                   /protein_id="ADK13507.1"
FT                   /translation="MKYKYILFDLDGTITESKEGITKSVQYALKKFGIIVESLDLLEKF
FT                   IGPPLKYSFSEYFGFDENKSLEAVQYYREYFEKKGIMENKVYDHIEDLLKQLKELKLKL
FT                   IIATSKPTKFSNIILNNFNLTPYFDAIVGSNMNGTRCTKGEVIKHVLEKYRINSDEAVM
FT                   IGDRKYDMIGARQNNMDSIGVTYGYGSLEELKNENPTYIADSVMDILNKVTQQ"
FT   gene            complement(445578..446285)
FT                   /locus_tag="CLJU_c04260"
FT   CDS_pept        complement(445578..446285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13508"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM98"
FT                   /protein_id="ADK13508.1"
FT                   /translation="MAKHRRSDHSKSSREFVDKNESENIETQEMELDETSKHNMDGSEC
FT                   HDESKNDCYHKCITICGKKGPKGDPGCPGPKGDKGDPGCTGSKGDKGDPGCPGPKGDKG
FT                   DKGDPGSKGDKGDPGCPGPKGDKGDKGDPGSKGDKGDPGCPGPKGDKGNPGCPGPKGDK
FT                   GDKGCPGDRGPKGDPGCPGPRGHDGDPGCPGPRGPKGDPCCPGLDEIEIKKLKEILAIL
FT                   DIKKIKQLQDKIE"
FT   gene            complement(446509..447888)
FT                   /locus_tag="CLJU_c04270"
FT   CDS_pept        complement(446509..447888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13509"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:D8GM99"
FT                   /protein_id="ADK13509.1"
FT                   /translation="MADQVQPCSCTSYTNICCCGAQNGISVVQPQCQTLSDGRVVNNPA
FT                   YDPLLTKSFWTYKFITDCNKDTRSISNFVIPICQSISSQSVEVFEKIDGCGQFQSINFT
FT                   LSLTDPNFGNAPSGFQWLKIEVSERYQKGVSVEYRIELVGNFPTDTQPIKIKAANNILT
FT                   FDCDCLLLPKCNDQGVLSVIKTCNHTITNNQVTLNYTVNVTNTGNAALNNVQYLDTVFI
FT                   SSALVLGTITVNPSTLSINTTVLGEVIISGNLGTISPGDTIPVTYTIPITSITVPRTYT
FT                   VNNTVRASATGTESTDTCSTEFSAVELGVVKCCNINENSASFTVTISSIDLSPNTTVNV
FT                   IDNFFIPSGITLQFNDFGGFTAKFTSSEESVPLSTNIVGPINITLSDNNLQIPAGGSIN
FT                   RTVRFTVISSSLFGTATIENTVNSIVLSEPNSQVFLGAGHLPVKSDIDITLNLTCRQPC
FT                   S"
FT   gene            complement(447985..449358)
FT                   /locus_tag="CLJU_c04280"
FT   CDS_pept        complement(447985..449358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13510"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMA0"
FT                   /protein_id="ADK13510.1"
FT                   /translation="MADSSQPYNKIPYKNIYSCKYSNGISIIQPEYQVLPDGSTVNNPA
FT                   YVSSLASSFWTYKFIIDCDMQMDGSIKSIGIPICHLIKSENIKVYERLDCNTVFNPVPF
FT                   TLIKNDPSFYYAPKGFKWLKIENLKRYYRGVCVEYILEIFGNYVSSRQSLKIKTTYNII
FT                   KFTEDSILVPTCNSKGNLTVKKSCFTSIINNKAILKYKVNILNTGNTALNNVIYNDKIY
FT                   IPTSFILGKIHINTSNLSIDRNIPGQILINGRFDIIKPGQMLTVIYSIPVENITKPKKY
FT                   KIGSNVVVSAMYTSAHSVCSSNIDVVKLSSENHCSIINQNKVSFILTIWNTRYSPDTEV
FT                   TIINYLFIPSGITLQFNNFGMYTATFGNKYDIVPINTNITGPQNIILTCRNLKILQDGC
FT                   TYKAITFKVISSTIAGKITITNTLKSITLANPNSQVLIDIKNLSSTSNIDILPSVKCQ"
FT   gene            complement(449720..450571)
FT                   /locus_tag="CLJU_c04290"
FT   CDS_pept        complement(449720..450571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04290"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13511"
FT                   /db_xref="GOA:D8GMA1"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMA1"
FT                   /protein_id="ADK13511.1"
FT                   /translation="MIKNTTQKVKRGHLKSDFEIFHLKDKRDIKFQFHYHNFNKIVIFI
FT                   SGNVTYLIEGKSYKLKPWDILLVNSNDIHKAIIDSNETYERIIMWLNSDFLVRYNHNCN
FT                   LLSCFELASKQRFNLLRLESTWLADVKKILFQIEDTFKNKELGYSVLRVSYFLQFIVYI
FT                   NRLFLKQKNISESNDIKYDKSMDNILDYINKNLSKNLSVDALSSKFYVSKYYLMHKFKE
FT                   QTGYTLHNYILQKRLIMANLLITNGENASDACAKSGFGDYSNFVRAFKKMFGLSPKKYY
FT                   KS"
FT   gene            450708..451589
FT                   /gene="dapA1"
FT                   /locus_tag="CLJU_c04300"
FT   CDS_pept        450708..451589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA1"
FT                   /locus_tag="CLJU_c04300"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13512"
FT                   /db_xref="GOA:D8GMA2"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMA2"
FT                   /protein_id="ADK13512.1"
FT                   /translation="MSLFTGSAVAIVTPFKDGTVNFDKLKELLEWHIKSGTKAIVICGT
FT                   SGEATTMTEKEKKDTIKFTVDTVSGRIPVIAGTGSNCTAQAVDMSVWAESIGVDGLLVI
FT                   TPYYNKTTQKGIIEHFKVINDRVKTPIIVYNVPGRTGLNILPKTLKKLCEFKNISGIKE
FT                   ASGNISQIAEMKALCGERIDIYSGNDDQVIPILSLGGCGVISVMANIVPCDMEKMCELF
FT                   FKGDIKAALKLQLDLYSLIKAMFIETNPIPVKTAMNILGKNVGNLRLPLTTMTDENLKI
FT                   LENELKNYGLLG"
FT   gene            451623..452891
FT                   /locus_tag="CLJU_c04310"
FT   CDS_pept        451623..452891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04310"
FT                   /product="predicted Na+/H+-dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13513"
FT                   /db_xref="GOA:D8GMA3"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMA3"
FT                   /protein_id="ADK13513.1"
FT                   /translation="MKSFFKNYKFSIILLGSIILGAIIGVLLGSKALVLKPFGDLFLNL
FT                   MFMVIIPLVFFSVTSAIANMKGMKRLGKIMASTFVVFICTALAASVIGFIGALIVNPAR
FT                   GIDYSALKKIVTAGGGAADKVKQVGLLQQIVNTLTVSDFVSLFSKSNMLQLIVFSVLFG
FT                   ISTSALGEKAEPVAKFLEAASNVMMKMVKIIMYYAPIGLGCYFAAVIGSLGPQILQGYL
FT                   RVFILYIVISVIYYFGFFTFYAFLASGKIGIKTFWKNAVAPTITALATCSSAASIPVNL
FT                   ECTKKMGVPEDIVETVIPLGANIHKDGSVIGGVMKITFLFGLFGRSMTSPSAILSIIFV
FT                   SFLVGAVMAAIPSGGMIGEMLILSVYGLPTELLPIIAVISVIIDAPATVLNSTGNTVAS
FT                   MVISRLVEGKLTFEKKYGIMEDK"
FT   gene            453160..453405
FT                   /locus_tag="CLJU_c04320"
FT   CDS_pept        453160..453405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13514"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMA4"
FT                   /protein_id="ADK13514.1"
FT                   /translation="MKYKIGHEIQFTQSFWLPVEGGKKLKVLKGDKAVVVKKIDDNSGE
FT                   ILYMTGEASGKSQVINIQVDDEIDGDYIARQIMEEL"
FT   gene            complement(454071..455351)
FT                   /locus_tag="CLJU_c04330"
FT   CDS_pept        complement(454071..455351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04330"
FT                   /product="predicted stage V sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13515"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMA5"
FT                   /protein_id="ADK13515.1"
FT                   /translation="MIFLEYTGTDLEKWCDIIEDTSKKSGLDFYPQEFEIVSYTDMIGY
FT                   EAYLGMPARYPHWSFGKSYDRTKSLYKYNLTGLPYEMVINSNPCLAYLMKDNTLLLQIL
FT                   TMAHVYGHNDFFKNNRLFKEGTKASYTLEMFKNDADMIREYINDPSIGYEGVEKILNAA
FT                   HSIRFQTNRTIGAKKTEEESKEDLIDFIINHSQLEEWQKNVLYVVKKETAYFIPQVETK
FT                   IMNEGWASYWHYKTLNRLDLSPSLHIEFIKRHNDIITPIMGGINPYYIGFKIFEDLDKR
FT                   YGENKIFEVRALERDASFIRRYLTKELCYELNLFEYAKQRSDYVIKEIPDEKGWIEIRN
FT                   TLCNNCGMGSIPNIVVDDILKKDNTLVLKHIYDGRELNSNYMEATLKCIYELWGYPVKL
FT                   NTKISKEDIEVCCSEPTTITYKTLRCD"
FT   gene            complement(455348..456544)
FT                   /locus_tag="CLJU_c04340"
FT   CDS_pept        complement(455348..456544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04340"
FT                   /product="putative sporulation protein, YhbH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13516"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMA6"
FT                   /protein_id="ADK13516.1"
FT                   /translation="MAIFREFDPRDHHDRSLEDRRRHKQLVEKSIKDNLADIISEESII
FT                   GQSKDKKIKIPIKGIKEYHFIYGDNSPQVGSGNGSQKRGDKIGRSLEKNGGKGGAGNEE
FT                   GEDMYETEITLEELMNYLLEDMELPLMDKKKFSELLSKKSLKKSGYQRNGINPRLAKKR
FT                   TVIEKLKRQQNSKRAIREASKDPLFQNETISKDIDSRFPFRQEDLRYFRIKEKKKRELN
FT                   AAVICVMDTSGSMDSTRKFLARSFFFILYQFVKAKYNNVEIKFISHSTKAKVVTENEFF
FT                   HKVESGGTYISSGLNKALEVIEENYNPAYWNVYTFYVSDGDNWDEDNERALKAAKDLCE
FT                   VCNLFSYAEIIPSYFGSNIKNIFRRGIDKNNFSTVTINEKQDLWISLKKILKKELEGR"
FT   gene            complement(456549..458471)
FT                   /gene="prkA"
FT                   /locus_tag="CLJU_c04350"
FT   CDS_pept        complement(456549..458471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prkA"
FT                   /locus_tag="CLJU_c04350"
FT                   /product="predicted serine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13517"
FT                   /db_xref="GOA:D8GMA7"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMA7"
FT                   /protein_id="ADK13517.1"
FT                   /translation="MNFKDIIEKDREIRKKHEFKGTFLEYLEIVKKNPKIVKLSHRRMY
FT                   DIIMNKGYEVLKPEENPRIKKLYGNEPIRRYNFFKDDFFGIDKVIMKLVNYFHSAAMMG
FT                   EESRQVLYLVGPVGAGKSSLVESIKKALETSEPIYALEGCPMREEPLHLIPKHLKGSFE
FT                   KALGVEIEGDLCPVCKYRLKHDYGGEYEKFPVTTTDFSIRSRKGIGVVPPVDPNNQDTS
FT                   VLTGSIDISKMDMYPEDDPRIFSLNGAFNVGNRGLVEFIEVFKNDVEYLHTIITATQEK
FT                   SVPSPGKGSMIYFDGIILAHSNESEWNKFKSDHTNEAILDRIVKIEVPYCMELNEEIKI
FT                   YKKILGKSQFNAHIAPHTIEIAAMFAILSRLSPSNKVDPMTKLKIYNGEDIVEKGTTKK
FT                   IDFSELKEEAGSREGMTGISTRFIVKALDSALSNSEYNCINPLSVMESLTKAVKDLDTA
FT                   EDDKQRYLTFIKDTIRKEYNKVLEKEITRAFIHSFKEQAESLFDNYLDHAEAYVNKNKI
FT                   KDQSTGEELEPDETFMRSIEEHIGISENSAKGFRTDVTSYMFYVIRNGGKISYTSYEPL
FT                   KEAIEKKLTASVKELSRVITKSKVRGKEQNEKYNSMVEEMKADGYCDHCCDVILKYAAN
FT                   NLWKD"
FT   gene            complement(458689..459180)
FT                   /locus_tag="CLJU_c04360"
FT   CDS_pept        complement(458689..459180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04360"
FT                   /product="predicted transcriptional regulator, marR family"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13518"
FT                   /db_xref="GOA:D8GMA8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMA8"
FT                   /protein_id="ADK13518.1"
FT                   /translation="MITIPTQKNLPPRNDELILEQSDKIINLFKSIHKIIGHKFREIAG
FT                   QYGFTVPQLAVIVHLYKKPGMTLNELSNHLLLAKSTVSGIIDRLVNQGIVTREIPENNR
FT                   RIVKLSISEKFKKSNDIVNIRQVFISNCISDTIRNMDNETVDQFIHALEHYKSLLEDLK
FT                   "
FT   gene            complement(459137..460714)
FT                   /locus_tag="CLJU_c04370"
FT   CDS_pept        complement(459137..460714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04370"
FT                   /product="predicted transporter protein"
FT                   /note="related to drug resistance transporter EmrB"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13519"
FT                   /db_xref="GOA:D8GMA9"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMA9"
FT                   /protein_id="ADK13519.1"
FT                   /translation="MEENNNESIYSWLALIVVVIGTFMSILDSSIVNIAIPKMMAVFGV
FT                   SMDDSKWILTSYTLALGAIIPLTGYLQEVFGSKKIYMFALAMFTLGSMLCGFAWNNTSM
FT                   IVFRIIQALGGGMIMPVGMSIIYEIFPRDKIGLALGIWGIASMAAPSIGPTLGGYIIQN
FT                   MNWRLIFNINVPIGILGVILAGILLKDSQKITFKSFDVIGFLSSTIGVVSILYVLGEWT
FT                   SIDWSKVQYPLLLTLGCLSLILFVVNELTHPQPLLDLTVFKLFDFSVCQIIICVLTMAL
FT                   MGGVYVLPLFLQNIRGYTAMETGLIMLPAALVVGILMPVSGNLFDKIGAKPLVIPGLII
FT                   LALSSYHLSVLINMNSSREMITLILCIRSIGLGFTMMPINTAGMNVVPQNLIGKASALS
FT                   STIRQIASSLSVTIMSAIIQSKTNYNYLKLSEQINVYNKPANDTINILTKSYMQEGLPQ
FT                   GTAKASALSTLSKLFQGQATIDAMAYAVAITSVIVIVTIVLTLMMKSKKTVKGDDHNTN
FT                   TKELAATK"
FT   gene            complement(460727..461380)
FT                   /locus_tag="CLJU_c04380"
FT   CDS_pept        complement(460727..461380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04380"
FT                   /product="putative secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13520"
FT                   /db_xref="GOA:D8GMB0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMB0"
FT                   /protein_id="ADK13520.1"
FT                   /translation="MKQKRKILIVGILVVIAAALSSIGFYYWYENTYYVSTDDARVDAD
FT                   LVNVTPQISGKLLELNVDEGDIVIKNQILARQEMSDLSDSKVDQSLIRSPINGIIIKKQ
FT                   GTIGEIWSPGQTLATLIDPNKLYITADIEETKLGKIRVGQPVSITIDEYGSQKFTGKVK
FT                   SVGEAAQSALSIIPTTTSGTFTKVVQRIPIKISLDKFNNKILPGTNAVVKIRIK"
FT   gene            complement(461401..462369)
FT                   /locus_tag="CLJU_c04390"
FT   CDS_pept        complement(461401..462369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04390"
FT                   /product="secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13521"
FT                   /db_xref="GOA:D8GMB1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMB1"
FT                   /protein_id="ADK13521.1"
FT                   /translation="MKKAILFSLATVIFLTGCGSTNTTSKNIKNINQNTNDQFLMGGKI
FT                   STNEQANITSKISAKVSEISVDLGSKTNEGDVLIKLDTKDLQGQVDQAQAALNTANANL
FT                   TNAQNITRPEQIAEAQSSVSSASQSYETVKKNYDRVQALVNAGAATQQELDSANQQLAT
FT                   ADSQYKTAQEQLAMLENGPTKSSIDVYKAQVDQAQAALKTAQTALSNAIITAPISGVVN
FT                   TRNVNVGDTVSPGATLLSIINSSNLYVNAYAPLDIVSQIKEGQEVAVKVSEIPDKQFKG
FT                   RIAVINSNLNSESRDILVKVSLTDKDSQLKPGMFAEIGLEK"
FT   gene            462827..463876
FT                   /gene="carA1"
FT                   /locus_tag="CLJU_c04400"
FT   CDS_pept        462827..463876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA1"
FT                   /locus_tag="CLJU_c04400"
FT                   /product="carbamoyl-phosphate synthase small chain"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13522"
FT                   /db_xref="GOA:D8GMB2"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMB2"
FT                   /protein_id="ADK13522.1"
FT                   /translation="MKAKLILENGSIFEGEAFGYLKDTIGEVVFNTGMTGYQEILTDPS
FT                   YYGQIVTMTYPLIGNYGINLEDMESSSPKVKGFIVREVCSYSSNFRSELELSDYLRTNK
FT                   ILGLSGIDTRALTKMLRTSGTMKGIITIENLDFAAVKDKIKSFSNKNAVSEVSTKGKYA
FT                   IGEGKRNVAIMDFGIKKTMVKAFVDRGCKVTVFPSNTKAEEVLQIDPDLIFLSNGPGDP
FT                   DDLTCEIENIKKLIGKKPIIGICLGHQLLALALGGSTAKLKFGHRGCNHPVKDLVSGKV
FT                   HITSQNHGYYVNRLPEDMEITHVSLNDGTIEGMKHKSLPIFSIQFHPEACPGPEDNNYI
FT                   FDEFMKYAL"
FT   gene            463921..467127
FT                   /gene="carB1"
FT                   /locus_tag="CLJU_c04410"
FT   CDS_pept        463921..467127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB1"
FT                   /locus_tag="CLJU_c04410"
FT                   /product="carbamoyl-phosphate synthase large chain"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13523"
FT                   /db_xref="GOA:D8GMB3"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMB3"
FT                   /protein_id="ADK13523.1"
FT                   /translation="MPLNKNIRKVLVIGSGPIIIGQAAEFDYSGTQACESLREEGLEVV
FT                   LINSNPATIMTDREVADKVYIEPLTVEFVEKVIKKERPDSLLAGMGGQTALNLTVELYE
FT                   KKILEKYNVNIIGTSIEAIKKGEDRELFRDTMNKINQPVVESEIITDMESGKKFANRIG
FT                   YPVIVRPAYTLGGTGGGIAENEEQLETILESGLELSSIGQVLLERSIKGWKEIEYEVMR
FT                   DSFGNCITVCNMENIDPVGIHTGDSIVVAPSQTLSDKEYQMLRTASLDIINAVGIEGGC
FT                   NVQLALNPKSFEYAVIEINPRVSRSSALASKATGYPIAKVAAKIALGYGLDEIKNAVTK
FT                   KTYACFEPSLDYVVVKIPKWPFDKFHNADRELGTKMMATGEIMAIGSNFQAAFLKGIRS
FT                   LEIGAYSLEYKKFKDFTMKELKERIAYPDDERIFAMAEMIRRKYRIEKLAEITGIDIFF
FT                   IKKFQWIIDEEEKLKLSDISNMDKEWLTLLKRKGFSDKGIADMLRVSPEEVYKLRNIWS
FT                   ITPAYKMVDTCGGEFEALSPYYYSTYEQYDEVQVSDKKKVIVIGSGPIRIGQGIEFDYA
FT                   SVHCIKTLRKLNIETIIVNNNPETVSTDFDISDKLYFEPITEEDVLSIIDKEKPYGVIL
FT                   QFGGETAIKLAEFLKEKNIVTLGTTADQIDEAEDREKFDDLLERLNISRPKGKGVWSVE
FT                   EGLEEARRLEFPVLVRPSYVLGGQGMEITYDEKELTYYLSMAFKKDRKNPILIDKYLMG
FT                   REIEVDAICDGEDVLIPGIMEHLERAGIHSGDSITMYPSQNISDEMKKKILDYTEKLAT
FT                   GIGIKGMINIQFIEYKGNLYVIEVNPRASRTVPYISKVSGVPIVDIATRVTLGEKLKDI
FT                   GYGVGISKEPNIVAVKVPVFSTQKLPNVEVSLGPEMRSTGEVLGVSNTLTGALYKGFLA
FT                   AGMFSNMKNGVMLATIGDHDKQEFLPIAKEIYKMGIKFMATRNTAKLLRDNGIDVKEVR
FT                   KMNEENPNIIDVIKNEEVDLVINTPTKGNDSRRDGFHIRRTAVERNIQVITSLDTFRAM
FT                   TYVKSEDVDSDELDVFSEYQ"
FT   gene            467260..468432
FT                   /gene="amaA"
FT                   /locus_tag="CLJU_c04420"
FT   CDS_pept        467260..468432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amaA"
FT                   /locus_tag="CLJU_c04420"
FT                   /product="N-acyl-L-amino acid amidohydrolase"
FT                   /EC_number="3.5.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13524"
FT                   /db_xref="GOA:D8GMB4"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMB4"
FT                   /protein_id="ADK13524.1"
FT                   /translation="MSDIKELTEKYYPEIVELRRYFHKYPELSKKEFATQKKIIEVLEG
FT                   LDLEIRKAAGTGVIAELKGEKPGKIIAIRADMDALAIEDECGKPYQSQNKGACHACGHD
FT                   GHIAMLLGVIKVLSNLRHKIQGTVRFIFQPSEEEVADGSGAAAIIADDGLKDVDAIIGA
FT                   HLWQPVKFGTVGISAGPMMAASDEFTIVIEGKAGHASMPHQTIDSILTASQIVVALNTI
FT                   VGRDVDPMKQAVVSVGVFNSGRVYNSIAGRAELKGTIRSLDENVREKVFGHIKKIVEDV
FT                   CDMAGAKCEIERDRCTYVLSNDPKVTSIVLEAGKEMVGHKAHAIEPFMSSEDFSYYLQK
FT                   IPGCFIFVGVGNPEKGIIYPQHHPKYDIDERAMAYGVEVMSNAALKLLSS"
FT   gene            complement(469076..470290)
FT                   /locus_tag="CLJU_c04430"
FT   CDS_pept        complement(469076..470290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04430"
FT                   /product="predicted sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13525"
FT                   /db_xref="GOA:D8GMB5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMB5"
FT                   /protein_id="ADK13525.1"
FT                   /translation="MFRKLKIQLILINLILTSLVLITIFSGIYILMNTSFEHSAYMRMS
FT                   KTAEMENIPPSGPHDKNMTASESFFIKINFKNQIEEISPNSPLSEKDYKELLEKILKKD
FT                   KLNGTSTYGNYILRYIKVPKSYGLIVVFQDKAFDDEVLRRLITISVTIYIISLVFVFII
FT                   SLFLANISLKPIINAWKKQKAFTADASHELRTPLAVITTNLDIVLDNKDETVESQDKWL
FT                   KNIKIETTRMTKLIEDLLFLARSDSHKNGFDTSSFDISSAVTKSVVPLEPVATKHKIAI
FT                   LSDIHPDIIFLGNEGRINQLITILVDNAIKHTPEGGSIKVTLGKIKNKIEITVSDTGEG
FT                   IAPEHLNKIFERFYKVDKSRSNRQGNFGLGLSIAKCIVEEHNGTIDVSSTVGKGSTFKV
FT                   IFPVS"
FT   gene            complement(470294..470971)
FT                   /locus_tag="CLJU_c04440"
FT   CDS_pept        complement(470294..470971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04440"
FT                   /product="predicted two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13526"
FT                   /db_xref="GOA:D8GMB6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMB6"
FT                   /protein_id="ADK13526.1"
FT                   /translation="MRLLLVEDEVMLSDALVYILKKNNYAVDAAYDGITGQEMAESEIY
FT                   DLIILDRMLPEKNGLDILKFIRKKGIETPVLMLTAMDSIENRVEGLDNGADDYLVKPFS
FT                   KEELLARIRALSRRHTDFIQHGSIKLSSLTFNPLRGEIECNGNKTKLTTKESQLLELLA
FT                   RNKNQVLTKDQILDRVWGLDSDIEMNNNIEVYFSYLRKKLRELKCNVVIETIRGIGYCL
FT                   KEV"
FT   gene            471240..472190
FT                   /locus_tag="CLJU_c04450"
FT   CDS_pept        471240..472190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04450"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13527"
FT                   /db_xref="GOA:D8GMB7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMB7"
FT                   /protein_id="ADK13527.1"
FT                   /translation="MNENVMYSIVVPLYNEELVIDESYRRLKKVMDSTLENYEIIFIND
FT                   GSSDKTREKTEKICSEDENIRLINFSRNFGHQCAITAGMENSIGQAVVVIDADLQDPPE
FT                   VILDMINKWKEGYDVVYGKRAKREGESFFKRFTARSFYRLLKSMTSIDIPVDTGDFRLI
FT                   DRKVCNALNSLPEKNRYVRGLVSWVGYKQTFVEFVRHERFAGDSKYPLKKMMKLAFDGI
FT                   TSFSYKPLMLAGYLGGLSLFIGIVSIIVEFTKCILQKTSIVNFGLIISIDLIMFGIILS
FT                   CMGIIGQYIGRIFDESKGRPNYVIENIVNKAFERK"
FT   gene            472353..472772
FT                   /locus_tag="CLJU_c04460"
FT   CDS_pept        472353..472772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04460"
FT                   /product="putative membrane protein"
FT                   /note="similar to GtrA protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13528"
FT                   /db_xref="GOA:D8GMB8"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMB8"
FT                   /protein_id="ADK13528.1"
FT                   /translation="MDQLIKTMDFIFNGKLKLLSRFSATGVINTIIDFAVFTLCQSVFG
FT                   LHYTISQVIGYSFGVINSFIFNKKWTFEYKSSGKKVIREVSQFAIVNLISLISTLVFMK
FT                   FLINDFNLNVYLSKIIVTLIAQVINFLLYKIWVFN"
FT   gene            472785..474992
FT                   /locus_tag="CLJU_c04470"
FT   CDS_pept        472785..474992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04470"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13529"
FT                   /db_xref="GOA:D8GMB9"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMB9"
FT                   /protein_id="ADK13529.1"
FT                   /translation="MKKLKFTKERFALCIILVISAILNFANLTIEGYGNSYYAAGVKSM
FT                   LMNFKNFFFVSFDPAGFVSIDKPPLGFWIQTISAKIFGFSGWSILFPEALAGVISVGIL
FT                   YYIVKRSFGEIAGLISALCLSITPVFVATSRNNTIDNLLIVTLLFACLFLSKAAEKGKL
FT                   KYLIISLVLVGLGFNIKMLQAYMIAPALYITYLISSAVPVKQRIKHLIISTLILGVISL
FT                   SWAVAVDLVPSQNRPFVGSSTNNTVTELIFGHNGLERLSSTNGGIGGAPSGKVGNFQFK
FT                   EFRSNFSKNQANLQSGNNNAPSAMTPPQNSKNSVQSPQGGPGGQNTQGNFKNQGGGPGG
FT                   GGPGGPNGLSGSFGGQTTAGITRLFSKNVLSDQIVWFLPLAIFGLAASVIVEKLKFPFD
FT                   NKKKLGLTLWTLWLVPEFIYFSYTKGLFHPYYLSMLAPPIAALCGIGLTSMWKLYKEGG
FT                   IKSWIMPAAFIVEGLVHLLMLSYFITTISTTIKSIIIAAIILCFASAALLIIYRIVKRG
FT                   NLDQGNNGSFAEIFTTLALVGILVTPAVGSAAAITHSLSSLPAAGLELLSSGESGNFMM
FT                   MGGQNSSRNSKLIKFLESHTSNEKYALVVSGSASAEDIIIESGKSVMALGGFSGSDKIL
FT                   SLSEFKQMVKKGEVRYVLTGGMGGRDSQDIMNWIQRNGKAVSTAEWKDTTNSQAQKGQS
FT                   STNNTDNSKMDSNSKRNSNLRFQPMGGMNNETLYDLKGTVK"
FT   gene            475913..477109
FT                   /gene="hemA"
FT                   /locus_tag="CLJU_c04480"
FT   CDS_pept        475913..477109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="CLJU_c04480"
FT                   /product="glutamyl-tRNA reductase"
FT                   /EC_number="1.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13530"
FT                   /db_xref="GOA:D8GMC0"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMC0"
FT                   /protein_id="ADK13530.1"
FT                   /translation="MIQLIGVKSECDIEIRQKFSIVSSKLEDKLKNVYKITANVLILST
FT                   CNRTEIYVDSNIQGEELINAVFDALGWSRELITYTFYAKSEDAIKHLMEVSCGFHSKIL
FT                   GEDQILGQIKTAYNMALKAKTIKGQIQRLFQNAITCGKKFKNDCEMYKIPVSVPSIAVK
FT                   EAEKSKVKRYMVIGFGEIGRLVLKYLAGLNTEIVYIVVRDLNKVKDLYENCNWIKFITF
FT                   KERKAYYSNVDCIISCTSAPHTIIYKEELPKKKFLIFDLAVPKDIDAGVLTLPDVKVYD
FT                   IDNISSIDENNKIMRKEKMEKYRYIIQEYIDEFIKWQSLDELSPEIQKMKSFGSEICEK
FT                   RIETFKNKRYTKDNEVLVQTMIQSTAKVYINRAIDVLKEAKLQGKEDEYLKLINKIFC"
FT   gene            477138..478412
FT                   /gene="hemL"
FT                   /locus_tag="CLJU_c04490"
FT   CDS_pept        477138..478412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="CLJU_c04490"
FT                   /product="glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13531"
FT                   /db_xref="GOA:D8GMC1"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMC1"
FT                   /protein_id="ADK13531.1"
FT                   /translation="MRNDDIFNESKLYMPGGVNSPVRAFKDVPLNPPVIKRGKGAYIYD
FT                   EDGNKYIDFVCSWGPMILGHCDDDVVKAIKDTSENAISFGATTELELELAKYVCTTLDN
FT                   VEMLRMVNSGTEATMSAVKLARGCTGRNKIIKFAGCYHGHFDDFLVEAGSGVMTEGIPG
FT                   SAGVPEDSVKNTLIAKYNDLSNVEKIFEKHGKDIAAIIVEPVAGNMGVIPGDANFLKGL
FT                   RSICDKNGSLLIFDEVMSGFRVAYKGAQSIYGIKPDITTFAKIIGGGLPCGAYGGRKEI
FT                   MEKLSPMGPVYQAGTMSGNPLVMAAGIATLKKLHDNPDYYEHLEKLGAKLEQGIKDIAK
FT                   KKGINVVVNRCGAMFAIFFTKDSEVRNYEDAKKCDTALFAKYFQHMLSKGIYIAPSQFE
FT                   AIFLNVKHTEEDIDKFLEAFSTFEA"
FT   gene            complement(478705..479508)
FT                   /locus_tag="CLJU_c04500"
FT   CDS_pept        complement(478705..479508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04500"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13532"
FT                   /db_xref="GOA:D8GMC2"
FT                   /db_xref="InterPro:IPR021260"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMC2"
FT                   /protein_id="ADK13532.1"
FT                   /translation="MTIQVYLVFMLTFIIYVIGTLAYSTRIVGIRTGRIAVSFAVFNVF
FT                   LLIQRTANTIQAPLLAKTIENGINTGHSSNLLYIFRWIVFSITLATIAGAILMPTFIKV
FT                   FNKLVISFSVYRSLPRLMIHAFSKSGIEQFKNSISIPKRENLSELKNFRKTPKKVILLN
FT                   IIAFSISSISILSSLYAGCLSPSLRTTCSTLASVINSISTIFMFIFIDPYLSMMTDDVI
FT                   RGERTELEFNRCIIFIVGGLIIGSILAQLILVPASHLIVLIAKLI"
FT   gene            complement(479853..480722)
FT                   /gene="galU1"
FT                   /locus_tag="CLJU_c04510"
FT   CDS_pept        complement(479853..480722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU1"
FT                   /locus_tag="CLJU_c04510"
FT                   /product="UTP-glucose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.9"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13533"
FT                   /db_xref="GOA:D8GMC3"
FT                   /db_xref="InterPro:IPR005771"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMC3"
FT                   /protein_id="ADK13533.1"
FT                   /translation="MKIKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAV
FT                   SSGIEEILIITGKNKRSIEDHFDKSVELEDQLKKNNKTTLLKLVQNISNMVDIYYTRQK
FT                   EPKGLGHAISLAKNFVEDEPFAVMLGDDIVDSKIPCLKQLIDCYDNYNTSILGVQPVKE
FT                   EAVSKYGIISGIEVEKGTFKVKDMVEKPTVQEAPSNIAILGRYIITPKIFEILEKNKSD
FT                   KKGEIQLTDALKELVKTEAIYGYYFEGQRYNAGDKFAFLQANIHYALKNNVLKGELLEY
FT                   LSTIKTAL"
FT   gene            complement(480712..482361)
FT                   /locus_tag="CLJU_c04520"
FT   CDS_pept        complement(480712..482361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13534"
FT                   /db_xref="GOA:D8GMC4"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMC4"
FT                   /protein_id="ADK13534.1"
FT                   /translation="MMTIFLKKNLFKIGLIFLILLSAFFCIYSIKNYKANTIISKNNIQ
FT                   QFNNNKSNKNIPVPKDNAKFSNGTRYNQKNNIQNQPGNSMHFGKENSKRSRNGTHQIPG
FT                   GDMRGDFSSTKSKYAPFLTLYLIAFLILCAGTFYFITHRDLKINRNNIKILIFSLLCIG
FT                   LFLRISLSTVMEGYGGDINLFKDWASTAANSFSQFYTNAKSGDYPPLYMYVLFLIGKIA
FT                   SASSINPYYTLLLKLPSIVTDVITAYFIYRLAKKYLSLEFSVFLSAFYIFNPVTFIDSA
FT                   LWGQVDSFFTLIIVLSLFLLSEGKTVLSSIAFTCAVLMKPQGIIFLPVLLFELVRERNL
FT                   ETCVKSIISALITALVIILPFSYNQNALWIFKLYSKTISEYPYASVNGFNFFNLIGANY
FT                   KKNSEVFFIFNYQIWGMIAIIAITLSCWYLYAKNKNRAFVFASAFVQISGVFTFSTGMH
FT                   ERYLFPAAALSIISFIYLKDKRLLTLAVGYTITIYTNIYYILFGGSRGMNSDSHSLITD
FT                   GVSMLNIILFIYLMKILIDLMLKMKGRVTYEN"
FT   gene            482491..483330
FT                   /locus_tag="CLJU_c04530"
FT   CDS_pept        482491..483330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13535"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMC5"
FT                   /protein_id="ADK13535.1"
FT                   /translation="MPCEKTQIVCKKCITITNSNSQSNIEHNDLKAGFTRKNTYRSYMY
FT                   FNIDDISKNIVVDSAELKIYLNKINIPHSKTNFYIHPLKEEFDLNTSFENQPEYYEKQV
FT                   KFELNKNSHGIIHVDITHIFDQWHDNSIKNNGLVLKSGEKHRALASFSSSLDPNYEGAP
FT                   KLVICSSKINHDQKIVDVVEKHWELKIFNTALSPTVNVERIINGTFFIENTSGVQIKAV
FT                   VEVSVDSKHWIEDTGVVVNANKSQVLIAKYYGKYYRVKFNCSGFAYVKLSFICQVYQ"
FT   gene            483482..484378
FT                   /locus_tag="CLJU_c04540"
FT   CDS_pept        483482..484378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13536"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMC6"
FT                   /protein_id="ADK13536.1"
FT                   /translation="MPNNLVFNGTANDLKTQMYAYNSGTNQAEALTISGGNLAVAGTVT
FT                   VGNTVAVTVGTVTVAGSVTVGNTVTVEGTVSVGNTVAVTVGTVTVAGSVTVGNTVTVEG
FT                   TVSVGNTVAVTVGTVTVAGSVTVGNTVTVEGTVSVGNTVAVTVGTVTVAGSVTVGNTVT
FT                   VEGTVSVGNTVAVTVGTVTVAGTVSSVTTGVGFTATSTAITTGTGIGSVLQQDTSQQSM
FT                   YSYYIKNNDTTNAITVALQVSPTSTASYFVNDINPISLSANSATVLTTKYYMNYTRLYY
FT                   DTGTNTADFEAYFNGKI"
FT   gene            484506..486308
FT                   /locus_tag="CLJU_c04550"
FT   CDS_pept        484506..486308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04550"
FT                   /product="putative glycosyltransferase fused to TPR-repeat
FT                   domain"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13537"
FT                   /db_xref="GOA:D8GMC7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMC7"
FT                   /protein_id="ADK13537.1"
FT                   /translation="MPISLCMIVKNEEDVLGRCLASVKHFVDEIIIVDTGSTDSTIEIA
FT                   KKYGAKIFYYKWDNSFSNARNCALEKAEKDWILIMDADDEFEKEDTNKLLKLTNDKNNK
FT                   TNVYFMQTLSYSGDNVSSGDITLNLNVRLVRNRKGYKFLGDIHEQLIPPPEHIISKDDI
FT                   KIENIRFYHYGYLNEIVESKDKRQRNMAIIQKELDKDPHNGFMLFNMGNEYYAKEDYKK
FT                   ALEYYMKSYEQFNPTEGFSSKLILRIVSCNQILENFAEEYKFVDRGLKYYPNFTDLEFI
FT                   RGNTFITEKKYLKAISSLKKCIKMGEPPIQINELVGVGSYRSYMVLCSIYLYLGDNDSS
FT                   LYYCDKLLKMKPGYIKGIYKFCEIMAAKKASINEMKSKFDGYVDKSSDPNIYLVLSDVF
FT                   YGQNKFDIAYEYADRADKICKDEIDRSKIYYYKGVCLFYQKKFKDAYGFLKKISSEEFI
FT                   DKAFYYTMLCNTFDDTISTKDVLTDEPKDIPDNKKYMIYMKFKDLLEGRECTDLSEDIE
FT                   DSKDFCGLIFSLLAIVLKINCFDEFEKGLQLLNLIEDQDVLLYLGKLYYKNGYFKLAYK
FT                   ELVRSIKIYDKTDVEALEMMKKCL"
FT   gene            complement(486339..487241)
FT                   /locus_tag="CLJU_c04560"
FT   CDS_pept        complement(486339..487241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04560"
FT                   /product="predicted signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13538"
FT                   /db_xref="GOA:D8GMC8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMC8"
FT                   /protein_id="ADK13538.1"
FT                   /translation="MYLFIIILLGILAGISITLLFLTKSEIKHITGSLKKINDIDTNQK
FT                   VTLSFQNRSFQNLALEINKNIDKKQQTEVKYKHMDMELRQAIANISHDLRTPLTSIIGY
FT                   IQLIKSDDLSKDEKNEYMDIILNRAKSLKMLISGFFDLSRLEANEYAFELESISLSNIL
FT                   CELIASFYNDFTNKEIEPLIEIDENAPEIIGDENAVRRIFSNLIQNALKHGDKFISVSL
FT                   KKDGSYIVTTFANNANNLNSDDIDHLFERFFTGDRTRTGKNTGLGLAITKALVEQMGHS
FT                   ITANFKDNKLSIIIKWKIS"
FT   gene            complement(487315..488055)
FT                   /locus_tag="CLJU_c04570"
FT   CDS_pept        complement(487315..488055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13539"
FT                   /db_xref="GOA:D8GMC9"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMC9"
FT                   /protein_id="ADK13539.1"
FT                   /translation="MLNYIKAELYKGLNRLSYKVTLLVLVLLSVSTNALFTGPKVTVFE
FT                   SLDMAMSCLPAVVFLVMMYIDVTEELKDKTLRNVMVSGLSREKLYISKVIIPIILSFIT
FT                   CLLVLIFFVGSTFLFLKPGNLSPAFLINLSLRILCAIPLYIAAISFGVFLSFILKNQYA
FT                   YAYTYAAIFALMGSFIKLLCALVSNKFYGIYNILITTNISALTPIKNPNLTLLQMLPSA
FT                   GLGFAYTIIFTIIGIIIFRKMEIK"
FT   gene            complement(488048..488971)
FT                   /locus_tag="CLJU_c04580"
FT   CDS_pept        complement(488048..488971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04580"
FT                   /product="predicted ABC transporter, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13540"
FT                   /db_xref="GOA:D8GMD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMD0"
FT                   /protein_id="ADK13540.1"
FT                   /translation="MNDLVLHTKNLTKKYKNHKALDNVNIKISKGDIYGLVGKNGAGKT
FT                   TLMRIITGLSLQDNGEIELFSKTSKDELNKERMRTGCIIETPSFFPYLSGKKNLEYYRI
FT                   QKGIPEKDCVDKVLNTVGLLDTGNKKFKHYSLGMKQRLGLALALIASPDFLILDEPING
FT                   LDPVGIVMFRDILKKLNREKNTTILISSHILGELSQLATTYGFIDNGNLIEQISAKDLE
FT                   EKCREYLSVKVDDAAHASLILEKNLNCTSYQVLPENEIKVFKYLDKPEMISEAFIKNGI
FT                   KVYSISKTSANLENYFMDLIGGDINA"
FT   gene            complement(489058..489753)
FT                   /locus_tag="CLJU_c04590"
FT   CDS_pept        complement(489058..489753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04590"
FT                   /product="transcriptional regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13541"
FT                   /db_xref="GOA:D8GMD1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMD1"
FT                   /protein_id="ADK13541.1"
FT                   /translation="MNKNINILIVEDDTDINKLLCKILEKNNYNVRGAFSGTEAEMCIE
FT                   KYDFQLVLLDLMLPGITGEKLIEKIRKVKTMPVIVISAKTAQETKIEVLKLGADDFISK
FT                   PFDVEEVLARVCAQLRRYMIFSNSNEKQNILTYKNMTLDRENHKVFIRSQEVLLTIREF
FT                   CILELLMSYPKKVFTKANLFEHVWKDKFISDDNTINVHMSNLRSKIAKIDSNTEYIHTV
FT                   WGIGFKMKD"
FT   gene            490047..491003
FT                   /locus_tag="CLJU_c04600"
FT   CDS_pept        490047..491003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04600"
FT                   /product="predicted ABC transporter, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13542"
FT                   /db_xref="GOA:D8GMD2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMD2"
FT                   /protein_id="ADK13542.1"
FT                   /translation="MIDINNVGKSFNNKSVLKSINLHIQEGEIFGIVGHSGAGKSTLLR
FT                   CLNGLESYDAGSIKVMGKEVKDLKGKEIRTFRKNLGMIFQNFNLLNRKNVYDNISLPLE
FT                   VWGLEKSKIKTRVKELLNLVGLSDKAKSMPSELSGGQKQRVAIARALALNPSILLCDEA
FT                   TSALDPNTTKSILELLRKINNEFKITIVVVTHQMEVIKEICSKIAIIDEGEIKTSGNVE
FT                   EIFLKPGKNLKKLLGNDSLLPDEGINIRIFFPKEISQDNLITSMAIDLNIKFSIVWGKL
FT                   ERFRSDVLGSLVINVNDKDKESICNYLSSKNVNWEVE"
FT   gene            491006..491662
FT                   /locus_tag="CLJU_c04610"
FT   CDS_pept        491006..491662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04610"
FT                   /product="predicted ABC-type metal ion transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13543"
FT                   /db_xref="GOA:D8GMD3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMD3"
FT                   /protein_id="ADK13543.1"
FT                   /translation="MGFSETFQEILLPAIGQTFYMVIVSTILAVIIGFIPAILLVVTEP
FT                   GGLKPNKVVYKILDAIVNLLRSFPFIILMIAIFPFTKLIVGKTIGTTAAIVPITIAAAP
FT                   FASRVIESSLKEIDPGIIEAAKSFGASNMQIIFKVMIKEALPSIVLGITLTVISVVGCS
FT                   AMAGTVGGGGLGDVAVKYGYYRFQTDIMVYTVIILIIFVQVLQTIGNLIYKKLNK"
FT   gene            491744..493018
FT                   /locus_tag="CLJU_c04620"
FT   CDS_pept        491744..493018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13544"
FT                   /db_xref="GOA:D8GMD4"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMD4"
FT                   /protein_id="ADK13544.1"
FT                   /translation="MAKIELPYHKKIIEAEINDNNLLGILESKASEYKAELGQLEIVEK
FT                   ALDNPINSPKLEQLAENKKSIVIISSDHTRPVPSKIIMPALLRRIRSINSDANITILIA
FT                   TGLHRATTRQELIDKYGEDIVKNEKIVVHDAQNEDNLVKIGTLPSGGELIVNKLAVKAD
FT                   LLIAEGFIESHCFAGFSGGRKSVLPGIASAKTILANHCAEFVAHPSARVGNLKGNPVHK
FT                   DMLYAAKKAELAFIINVALDEDKRIINAFAGDVNDAHVKGCEFVHNLSKVSKLVGDISI
FT                   STNGGYPLDQNIYQSVKGMAAAEANCRDGGVIIMVSACSQGHGGETFYNNLANLNTPEE
FT                   FLKKVSKVPRNRTVPDQWASQMLASILSKHTVIVVTDMCDPKIIKNMHMQQADTFKEAL
FT                   ERAYGIMGKDAKVVVIPDGLGVIVD"
FT   gene            493194..493580
FT                   /locus_tag="CLJU_c04630"
FT   CDS_pept        493194..493580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04630"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13545"
FT                   /db_xref="GOA:D8GMD5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMD5"
FT                   /protein_id="ADK13545.1"
FT                   /translation="MLVQIDFESEMPIYEQLRRQIIEGIASGNLKLGESLPSVRQLAED
FT                   IGINLHTVNKAYNALKSDGYLNVDRRTGAVVSGTFPESTEEFDKKLKEEFTYLICEAHL
FT                   RGKKMEDILSLCSDIFKQYIKKDK"
FT   gene            493603..494739
FT                   /locus_tag="CLJU_c04640"
FT   CDS_pept        493603..494739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04640"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13546"
FT                   /db_xref="GOA:D8GMD6"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR014574"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMD6"
FT                   /protein_id="ADK13546.1"
FT                   /translation="MKDNLFMCIYLFFIFVIILVINMLTPKFTRKEIVFGVRIPEDKID
FT                   SDEIKHIKAQFVKNNLIIGIPFIILFSVLNYSFLNVGMILFTTFAFVFISFLIYLISNR
FT                   AMKNLKSQKLWLQGKKQVVTVDTSFSRSKSNMLVSAWFFLIPAAIIIVNIILGYMNYNS
FT                   LPYKVPTHWDFSGNVTGYQFKSRFLIWEMPIAQIFSTFIFFIVYKGIGWSKQQISSIDP
FT                   EASVKKNSIFRRSWSIYMVVFAVVTNLLLTVATVQMFRVFNVSNTFSIIIILAFVLITI
FT                   LGSIALSLKIGQGGSNIKFKSDDEEKGKSGFGDKDDDKCWVLGNSIYYNKNDPSLFVEK
FT                   RFGIGWTINAGRPLGMAIYIGSIVIIIVTIIFAVFSGK"
FT   gene            495286..496470
FT                   /locus_tag="CLJU_c04650"
FT   CDS_pept        495286..496470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04650"
FT                   /product="putative aromatic amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13547"
FT                   /db_xref="GOA:D8GMD7"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMD7"
FT                   /protein_id="ADK13547.1"
FT                   /translation="MISNKMKEHVSKSSIIRAMFEEGKRLASIYGEENVFDFSLGNPNV
FT                   EPPEAIKKAVNEIISEESPNMVHGYMSNSGYEDVRAKIAENINKKYNLKLTENNLVMTC
FT                   GAAGGLNIIFKTLLNPRDEVITFSPFFGEYENYVDNFGGKLVIVPSDTETFEPDLNALE
FT                   QSINAKTKAIIINSPNNPTGIIYSEKLIKDLSQLLDKKQEQLGTSIYLISDEPYREIAY
FT                   DGVKVPYILNYYRNSIVGYSYSKSLSLPGERIGYVVCSSDMDDFKDVMPALNVANRILG
FT                   FVNAPSLFQRVIAKCLDSSVDMNIYKKNRDLLYNHLVKIGFSCVKPEGAFYLFPKSLIA
FT                   DDVEFAKEAKKFNLLIVPGSSFKCPGHFRLSYCISYDKIEKSLDSFDKLAKKYL"
FT   gene            complement(497188..497949)
FT                   /locus_tag="CLJU_c04660"
FT   CDS_pept        complement(497188..497949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04660"
FT                   /product="putative cell wall hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13548"
FT                   /db_xref="GOA:D8GMD8"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMD8"
FT                   /protein_id="ADK13548.1"
FT                   /translation="MNFKKIRTMLFAAFLCTLSFTQVHAASYTVKPGDSLFKIGVLFKT
FT                   TATTIINDNGLSGNSIYPGQALYVNSKTYTVQASDTLYLIAKKFGISVDTLIAANSNVS
FT                   SYIYPGQVLNIPAGYVFNGTTSSKYIISCTDSEVDLLGRLVTAEAESEPYTAKVAVAAS
FT                   VINRVQSPQFPSTLKGVIYQVSNGYYQFTPVLNGWINKPASDSSRKAALEALYGSDPTK
FT                   GAIYYFDDSTTNTWLWSKPIALRVGKLVFTY"
FT   gene            498548..499711
FT                   /locus_tag="CLJU_c04670"
FT   CDS_pept        498548..499711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13549"
FT                   /db_xref="InterPro:IPR002829"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMD9"
FT                   /protein_id="ADK13549.1"
FT                   /translation="MENCITYFLRDESKNSNEYYRCISNFSNEVIEKIEIEANNIIENF
FT                   INFIKNNSIEELRSREEYELEFLIIGVLWKTYIAKALNADRLSLNLLKLLFNLRTKSKF
FT                   LRKSVDNLRGRLACKYLLKKEVEPSSVSYDESDFEKLLLWLTASGEFKYECKRMNTWLL
FT                   FLKNSSEEYIIKVSKCAFKISLWFEKRSMEVLGVYTPNVQKFLNTNYRLYGIREDNVFC
FT                   GRKEVEYHLNMVGAEILSKAFRKLFVKTKERKVLLPACICLKPEGVCKRKRVKDGFLCR
FT                   NCSKSCRVNELTKLGKSHNFQVLIVPHETDAFSNAKNIRYGDVGVVGVACVLNLIEGGL
FT                   KARSLNLVPQCVILDYCGCKNHWDNNGIQTDINCKKLFEILQVDENM"
FT   gene            complement(499731..501188)
FT                   /locus_tag="CLJU_c04680"
FT   CDS_pept        complement(499731..501188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04680"
FT                   /product="predicted permease, major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13550"
FT                   /db_xref="GOA:D8GME0"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GME0"
FT                   /protein_id="ADK13550.1"
FT                   /translation="MEERLEESNYQQRNYNVVPITIALIMAGFLCMLNETLLNMALKNL
FT                   MVQFSISANTVQWLSTGYMLIMGIAIPVSALLIQSFTTRQLFLTSVTIFLVGTVISGFS
FT                   TAFSILLVGRLIQAIGTGILIPNIVNTLLIINPIEKRGKALGIFNLVMFCAPAIGPTLS
FT                   GLIIQSLNWRWLFFIILPFSVISLALGYKFIENVTELTKPPIDFLSIVLSTIGFGGFIY
FT                   GVSNIGSSYTYLIAAPIIISCIALAIFVLRQLHMSQPMLDMHPFKESMFSLGCILMIIM
FT                   HMINFATMLILPMFLEGALGLSAFTAGLLMLPGGFINGIISPISGHLYDKFGPKALIIP
FT                   GYAISTITFFLLSRFVSMSITIPVIIVLHCLSLVAVGLINTPVQTNSLNQLSPKYYPHG
FT                   TAIMNTLQQIAGAFGTSLFVAIMSASQKKYLFAAGNPSNAKSQALSLVFGVKHAFTIET
FT                   FVLVIALILSLFIANNAINKKSKSIKA"
FT   gene            complement(501351..501800)
FT                   /locus_tag="CLJU_c04690"
FT   CDS_pept        complement(501351..501800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04690"
FT                   /product="predicted transcriptional regulator, marR family"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13551"
FT                   /db_xref="GOA:D8GME1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GME1"
FT                   /protein_id="ADK13551.1"
FT                   /translation="MSSLDKSIGMYINSINRKILRFLSLNLKKYNITTEQWSVLLSLTE
FT                   EDGVNQKQLAKKVDKDQATLVRILDILERKKLVIRKKSTEDRRSFLIYVTPEGKKLKQE
FT                   VYPFIEHLFTNITNEISKDQLDLFIDTLNKFEKNISIEEKKISKK"
FT   gene            502121..502483
FT                   /locus_tag="CLJU_c04700"
FT   CDS_pept        502121..502483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04700"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13552"
FT                   /db_xref="InterPro:IPR018658"
FT                   /db_xref="UniProtKB/TrEMBL:D8GME2"
FT                   /protein_id="ADK13552.1"
FT                   /translation="MTYKIISKCPVCSSKLLISKIKCPKCNTVIENDFEMSKFEYLTDS
FT                   QLKFIEVFLKNRGNIKDVEKELGISYPTVRAKLDEVITALGYNVAKTNTVDKKKVVDML
FT                   DKGEITADQAIKMLNE"
FT   gene            502509..502898
FT                   /locus_tag="CLJU_c04710"
FT   CDS_pept        502509..502898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13553"
FT                   /db_xref="UniProtKB/TrEMBL:D8GME3"
FT                   /protein_id="ADK13553.1"
FT                   /translation="MNEEISKILKMVEEGKITSDKAQELIEALNDKNTSLDVSSNIPND
FT                   ADIINKMLKIKVISHDGDNVNVNLPVKFVKTMLKTIGKIPIPENAKCMENLDLNVIAEA
FT                   IDNGLSGKIVDVKSANGDIVEVSIE"
FT   gene            502911..503162
FT                   /locus_tag="CLJU_c04720"
FT   CDS_pept        502911..503162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13554"
FT                   /db_xref="GOA:D8GME4"
FT                   /db_xref="UniProtKB/TrEMBL:D8GME4"
FT                   /protein_id="ADK13554.1"
FT                   /translation="MRVHIKSGKIRFVIPCPIAFLKFGLSIAGSSFIQKYIPDKDKRYV
FT                   NMIDFKKLSKCMDILKEYRGLKLVEVKSRDGSHVTIIV"
FT   gene            503213..504484
FT                   /locus_tag="CLJU_c04730"
FT   CDS_pept        503213..504484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04730"
FT                   /product="predicted permease, major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13555"
FT                   /db_xref="GOA:D8GME5"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR022324"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8GME5"
FT                   /protein_id="ADK13555.1"
FT                   /translation="MKNNRNLLFYMLGRFISYIGTGIQQVAIPLYILDITHSGIMMGIF
FT                   SAVNFIPNVITLPFAGILGDRKNRKNIMVLADFGRGILVLALALLVAEKNLSIYMLFLL
FT                   QAFISIMDGIFLASSTAILPELVCEDELMKATSLRGGSDAISMIIGPALGGIIYGLVGM
FT                   KTVFCINGLSFIISAVCSMLIIYKNIDIEKGKITVKSFFTENGEVIGFIRKSRALMQLT
FT                   IFFMVANLLVAPFADIVLPFVLKKCIGFGSQQYGYLISFFTLGILLGNIALGTYLNKFS
FT                   TKTIIKRALIFEAGVFFIFAFSLYPASVRYFGGHGLKLFAILGIVTFLIGLSNSGINTP
FT                   MNVNLQKMVPNEMRSRFFAILGVFCQGAIPLGAIIYGFVLDKFPYYYILLTIVLIFSLV
FT                   TAVFMIKADPEAYEPGIPKNLEKA"
FT   gene            504598..505146
FT                   /locus_tag="CLJU_c04740"
FT   CDS_pept        504598..505146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04740"
FT                   /product="protein kinase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13556"
FT                   /db_xref="GOA:D8GME6"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D8GME6"
FT                   /protein_id="ADK13556.1"
FT                   /translation="MKKEYSHSKFHDVELKDCKYLGKGHSGMVYLMPDGKVLKIFKSST
FT                   SCKAEFDILKSVEGSPHFPKAYELGDHYMIREYVGGMNVYDYIKKYGLKRSFVLKVVDL
FT                   VDHMKKLGFTKLEVRFPHLFVQEDGTLMLIDPRKSYEEYIPYPKSFFRKLKNMGLLDKF
FT                   VQILEEERKGLKWIEYIKR"
FT   gene            505608..507011
FT                   /locus_tag="CLJU_c04750"
FT   CDS_pept        505608..507011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04750"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13557"
FT                   /db_xref="GOA:D8GME7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D8GME7"
FT                   /protein_id="ADK13557.1"
FT                   /translation="MNIFKKKSLEQLRDSVKKTGLKKNLKATDIAALGIGAVVGVGIFV
FT                   ATGEGAHAAGPGIILSFFLCGIVACLCGLCYCELATMFPVAGSTYSYAYIAFGEFVAMI
FT                   IGWCLTAEYLVAVSAVASGWSGTFRGILQNVGVTLPHAISASPAKGGIIDLPAVFIILV
FT                   LACLLYYGMQESAKVNNIIVGVKVFVILLFIFLGVSHIKPSNYTPFMPFGWKGVFTGAS
FT                   TVFFSYIGFDSISTAAEEARNPKKDVSRGIIMCLIVVSILYISVAVVLTGMVPFKEIVS
FT                   ENAVPAALARVGINWGSALVGVGAILGMISTMIAMLYGQIRIFMVMSRDGLLPKAFSKI
FT                   HSVHKTPYISTILTGVIAAIIAGLLPLDIIVEFLSIGTLLSFAVVSIGVIYLRKAMPDI
FT                   ERKFKCPGVPFTPVITVLCCIVLLASMRAITWIGFCVWLAIGIVFYFIYGRTHSVVQNE
FT                   NLDESSHSA"
FT   gene            507068..508477
FT                   /locus_tag="CLJU_c04760"
FT   CDS_pept        507068..508477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04760"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13558"
FT                   /db_xref="GOA:D8GME8"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D8GME8"
FT                   /protein_id="ADK13558.1"
FT                   /translation="MNIFKKKPIDQLMDSVKKTDLKRNLKARDIAALGIGAVVGVGIFV
FT                   ATGEGAHAAGPAIILSFILAGIVACLCGLCYCELVTMFPVAGSTYSYAYIAFGEFVAMI
FT                   IGWCLTAEYSVAASAVASGWSGTFRGILQSVGITLPQAISASPSKGGIIDLPAVLIILI
FT                   LTGLLCYGMSESAKVNDIIVGVKIFIILLFIVLGLSHIHIANYKPFMPYNWKGVFTGAS
FT                   TVFFSFLGFDAIATSAEEAEDPKKGVSRGIILCLMVVCFLYVSVAAVLTGIVPYKEIIS
FT                   ENALPAALQRIGINWGSALVGVGAILGMISTMIAVLYGQVRVFMVMSRDGLIPKAFCKI
FT                   HKTHKTPYIATIIAGSIAAAIAGFLPLDIIMEFVSIGTLLSFMVVSAGVIYLRKAMPEI
FT                   ERRFKCPGVPFTPIVTILCCLALLVSMRAITWIGFCVWLVIGIVVYFAYGRFHSVVQKE
FT                   EEQVLRQLKSK"
FT   gene            508705..510417
FT                   /locus_tag="CLJU_c04770"
FT   CDS_pept        508705..510417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04770"
FT                   /product="predicted methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13559"
FT                   /db_xref="GOA:D8GME9"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D8GME9"
FT                   /protein_id="ADK13559.1"
FT                   /translation="MKWFSNIRILKKLLTSFIIVSVFTGIVGMISIIKMGKINGNLNNI
FT                   YNVDLKGTNYLQQLKTNVVLIRADMLTLADPVNRNNLKNVTSEISSSKIQNNQIISDYK
FT                   TIITNAEQKQRFAEFEQYLQSWRTSRESFISLIQAGNYEGAKQQFVKSEGYREKAFKVL
FT                   DNQINLSMKMAQEDYKDSVTQYKSSFSMMVIGIIVSIVCSVLLGFIVAKDINAPILKIK
FT                   KFANEFAEFDFSSPIEIDRKDELGEAALELNKGQKNITDLIRTIMASSDEMSSSSEELS
FT                   ATAEELSAKSEDMDSSVKVVVGNIQETSAAFEEITASVEEVDSSVNELSAKAVEGSGKA
FT                   NESKKNAVVVQSKGKAAIEKTQELYEQKKENMVKAIEDGKVVEEIKEMAETIAGIADQT
FT                   NLLALNAAIEAASAGEHGKGFAVVAEEVRELAEQSAESVAGIQETIVKVQDAFKNLSAS
FT                   GQQVLAFINEKVNPEFKSFGDMGKRYYDDSEFVSKMSEEIAAMSEQLTAIIGQVNETTQ
FT                   SVASSAQKSSESSNSIQQSIEENVKAVSQIAITAQNQAEIAQSLNELVQKFKI"
FT   gene            510728..511666
FT                   /locus_tag="CLJU_c04780"
FT   CDS_pept        510728..511666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04780"
FT                   /product="predicted sensor kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13560"
FT                   /db_xref="GOA:D8GMF0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMF0"
FT                   /protein_id="ADK13560.1"
FT                   /translation="MKNFNEDNEINENQLKNLIMMNYTLSLEREIKELKNDAKKNSEKL
FT                   NECQELNKKILQFIYGLFHELKTPLNVIFSAAQVMSLCTEYKNGGILEKQGQYVKIIEQ
FT                   NCYRLMRLINNLQDLSKLDSGFAKLELHNRNIVSFVEDITLSLIPYAKGKGINLIFDTN
FT                   VEEKTMALDYNKIERIILNLLSNAIKFTPEKGTICIGVEDKDDNVYISVKDTGIGIPED
FT                   KFKFVFEKFKQCDKSPINGKVGNGIGLYLVKCFTEMHGGKVSVKSTVGKGSTFTVKLPV
FT                   KVIEEKFNNIISSENMDEQLSIEFSDICPKI"
FT   gene            511755..512627
FT                   /locus_tag="CLJU_c04790"
FT   CDS_pept        511755..512627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04790"
FT                   /product="predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13561"
FT                   /db_xref="GOA:D8GMF1"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMF1"
FT                   /protein_id="ADK13561.1"
FT                   /translation="MDEIAGTGCDILVPFNERKPLKEIEHSITKRYRKHIWSKFVRAIS
FT                   EFKLVEEGDKVAVAVSGGKDSLTMAKLFQELQKHWKVNFNLEFIAMDPGYHEDIKKLLI
FT                   SNCEYLNIPVHIFESGIFNVVDNIAKDYPCYMCAKMRRGALYSKAKELGCNKLALGHHF
FT                   NDVIETTLLNIFYSGSFKTMMPKLRSQNYEGIELIRPLYYVEESYIERFIQSSGIWPLN
FT                   CACMVAAKRIGNKRYEIKDMIKKLKKDFNKDIDKLIFHATENVNIDSILGWEKDGEKHS
FT                   FIESYERNS"
FT   gene            512701..512970
FT                   /locus_tag="CLJU_c04800"
FT   CDS_pept        512701..512970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13562"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMF2"
FT                   /protein_id="ADK13562.1"
FT                   /translation="MLKIWGKLVKHNKIVKDEVVALEGGENYQENLKSCILELCRKFDI
FT                   EKPYWLPANLEEYNRRSKTSFNSDNFIDEFEFDKFEIEEIDDEK"
FT   gene            complement(513040..513420)
FT                   /locus_tag="CLJU_c04810"
FT   CDS_pept        complement(513040..513420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13563"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMF3"
FT                   /protein_id="ADK13563.1"
FT                   /translation="MISNYPNYFRTMPMTPEPEPEMPEFDSSDEIRQTPMPSPPPTPSP
FT                   SPFEMAPGSPVQQDTNYTQGYLRTQIGKRVRVTFLLGTGTLQDRAGTLDSVGISYIIIR
FT                   NEETNTRELADIYSVKFVTIFD"
FT   gene            complement(513447..513887)
FT                   /locus_tag="CLJU_c04820"
FT   CDS_pept        complement(513447..513887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04820"
FT                   /product="predicted cell wall hydrolyse"
FT                   /note="sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04820"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13564"
FT                   /db_xref="GOA:D8GMF4"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMF4"
FT                   /protein_id="ADK13564.1"
FT                   /translation="MAFSYRELLARIIKCEAGGEGENGMKAVATTIMNRVRVPYGEYQR
FT                   IGQGDLRKVLYQKGQFDCMRTELGGAPNPQNIWSTVPEEIHYDIADWALAGNRLFTAGY
FT                   SLWYFNPFAPCPWTFPYTGTGSFQVKVGNHCFYNPTELYAKT"
FT   gene            514072..515127
FT                   /locus_tag="CLJU_c04830"
FT   CDS_pept        514072..515127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04830"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13565"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMF5"
FT                   /protein_id="ADK13565.1"
FT                   /translation="MLKKRRFLSPILTALVLSVTLGTANVQAATVKRTDGGTGGRIGTA
FT                   NKVALDLFSKSQNVILVNGYGYADAVSATPLAKQLNAPILLTHGDTLESEVDSTISSLG
FT                   ATKVYIVGGTGVVSTDVENTLKNKYDVERIAGVTDNTRMGTNAEVAKKVLSMSNQKNAI
FT                   LVNGQDGYADSLSVASIAAQKGYPVLFASKTQVAPIVKDVITSKGLTIQAVGGSGVLPQ
FT                   DVVTSVGGTKVTSDADCANRFATNLAVLNYFKNNGGLDFSTIYVAAGGAAEDQFADALV
FT                   ASAAAAKTGSPVILTGLGAGQSQVIDANSYIFANAKDNSNVVIVGGTDVVSQDIQNTLQ
FT                   STDDLQIIGIE"
FT   gene            515842..519429
FT                   /locus_tag="CLJU_c04840"
FT   CDS_pept        515842..519429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04840"
FT                   /product="predicted cell wall binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04840"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13566"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMF6"
FT                   /protein_id="ADK13566.1"
FT                   /translation="MSKKSTKALASATLMSLVLTTALSAGPVKAASQVQPTRVSGGDRY
FT                   ATAAKVATTNWTTSDSVVLVSGEGYADAVSASALAKKLNAPILLTTGNTLNSDAQSALN
FT                   TLKPKNVYVIGGTASISQSIRDGLKANYTLTELGGQNRYETNIAVAKELVTLGVSPSNV
FT                   MVVGGQGFADALSVAPVAAAKGQILLLANNDQASSQGAIDFVKDNKSTATIVGTSNVIS
FT                   DAIKNAFGSTATRVNGGSSRFDTNLAVLKAFSSDLKADKLYIANASAADPDNLYADALV
FT                   ASAVAGKYTAPLVLVDKDGTDATNNAVAYIKSENAKEIDVIGGTSVVPDSIISEITGTP
FT                   VGPVDPEVSSVSDVDLNQVKVVFNQEVDSDTAEEVSNYKIDNVQLNNKGTKDGGGTADA
FT                   NSAKATLQDDNKTVLITLAKSKKQGDNLDLTVKKGILSSDKSTTIPECTQKVSFNDTTA
FT                   PTISSVQARGNNKLTVEFSEPVNFSSTSVSQIASKFKINGKNITSFGLDTSISKIDDYV
FT                   TGINAGEVWANKIEFYFTSSLPTGNNTLEVSDGDQASNGVTGKLSDVAGFPFKDSTQNF
FT                   NVDTLTTAPQITSITAEDSGKIYINFDRPMDAKTATDVSNYGINGDNNNPPANSVELKK
FT                   DDTQVKISNVTLKTGSNTVYIDNNVKDAYGNYIPDDTRKDVTLTQDTVKPAVSSVATLD
FT                   DKTIRVKYNKDINIQSGKNTSNYKIKDNSGTDISSQIGNSDGTITVPGGSSSDTSASVF
FT                   DIHMANKLSDSKYSITIKNIRDIASTPNTMPDYTTTFDGYGDVAPTVTGAYKAAAGEDP
FT                   QRKVVVYFNKEMDSSSIDDVSNYKFKDNSSDADFIALPSGTTISAGSNNKSATIKFPSS
FT                   YTTNLSDPASNENKIKELAVVGVKDVNGNALSVSYQSGTLAVNTNLPTIDSKSVSFDYD
FT                   GNDLTVKFKYIGTNVDGSTYTDTIDKLDYTDFRVNGVEPSTGSLSGDNVVLRFTKNDPI
FT                   VAATDTGYGYAGRDTTKINAVKYAGLGAKITTVSTNTIDVAGQSIASMTVAGGTAVVAY
FT                   DYNAAPKTIAKDWRTGVVGDTNDNLTGVGTAGDGFIDVTFDTPIDPQSGISKDGFTFTS
FT                   NVDGQPLKAKAVYVSGNTIRFTFDTSADNVSKDMYQKYFKTGSVFTVNAKDTVTVRTIQ
FT                   DQDDNYATYKPSSDDINIRTINFDGVGTN"
FT   gene            520099..520524
FT                   /locus_tag="CLJU_c04850"
FT   CDS_pept        520099..520524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04850"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13567"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMF7"
FT                   /protein_id="ADK13567.1"
FT                   /translation="MKNYINILSLNNEVNRNRVSNAVSKSNGESFANIFNRAIKCNTCS
FT                   SNICSVEELNESLKEDLDKRVDVAVERLAGFFGIGKHLMAAILKYLHIDPKDLLDPARK
FT                   QDIVDTLSKQFGLNKHKSDALYNLISDLGISACRQAG"
FT   gene            complement(520558..521169)
FT                   /locus_tag="CLJU_c04860"
FT   CDS_pept        complement(520558..521169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04860"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13568"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR014248"
FT                   /db_xref="InterPro:IPR014258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMF8"
FT                   /protein_id="ADK13568.1"
FT                   /translation="MKKSFLSSLILCFVLSTGAVHAQSSTYTVVSGDTMWKIAVKNQVG
FT                   ISELISANPQIANPAMIIPGQKISIPNIDVKTMENQVISLVNQARVNAGLQPFTTNWEL
FT                   SRVARYKSQDMANKGYFDHTSPTYGSPFTMMQNFGIKFTAAGENIAMGQRTAQEVMNSW
FT                   MNSPGHRSNILNPSFNQIGVGLAKNSNGTCYWTQQFIKSY"
FT   gene            521293..521985
FT                   /locus_tag="CLJU_c04870"
FT   CDS_pept        521293..521985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04870"
FT                   /product="predicted phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04870"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13569"
FT                   /db_xref="GOA:D8GMF9"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMF9"
FT                   /protein_id="ADK13569.1"
FT                   /translation="MKIAIISDIHGNLEALKAALCDIEKKSIDTIICLGDLVGYGPYPN
FT                   EVIQLVREKHILNILGNYDAAVLEKKFNYIRDNEVNKFCMPWAAEELSEENRDYLNSLP
FT                   GEIVLNFGSKKFHFVHGSNRSINEYLKENSKEAEEAMDVLEEDVLICAHTHIPYRKKYG
FT                   DKILLNDGSIGKPKIGRPNGTYLIMEPGEDVKSSIVEFTYDYEKTVKAMEKEGIHRACI
FT                   KNIKTGIE"
FT   gene            complement(522045..525107)
FT                   /locus_tag="CLJU_c04880"
FT   CDS_pept        complement(522045..525107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04880"
FT                   /product="predicted peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04880"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13570"
FT                   /db_xref="GOA:D8GMG0"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="InterPro:IPR013578"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMG0"
FT                   /protein_id="ADK13570.1"
FT                   /translation="MKISLKKATTVIVAFFMLFSSCNVAFSNETAYAADTNVTSCNEIG
FT                   KTYYGFQLTSVKDMPKVNSTVMQFTHVKTGAKLMYLKNDDTQRVFDISFRTPTSDNSGV
FT                   NHIIEHSVLDGSKNYPVKSPFQQMLKSSLGSFINAMTGADYTTFPAASTNEQDLKNLMG
FT                   VYLDAVFLPNVTTDPNIFKQEGWRYDLPSKDSALSINGVVYNEMKGDYSNPQWLLRNAV
FT                   NQSLFPDTSYKWDSGGNPENIPSLTRDQLISTYKKNYTPSNSYIYLYGKLDIGQYLQYI
FT                   DQNYLSKFDKVNVDTSVKAEKSLSNIPDKIASYPVPKDGDTKKKTYLSLNFVTGDIGDK
FT                   ETNTALTFLNYLLMGTDNAPLKKALTEKGIAENVSSSFSMNGIQPVFSINATNSDESSK
FT                   EVFEKTIFDTLKNISKNGFDKDFLKSALESYDISDRSEKLTTPMLGGNGLVLSQTALST
FT                   WVYDKDPTMYFDTSDIMEKIKKSDSNKYFTSLIDKYLISNNYHSMVVLKPEAGLESKTT
FT                   EATAKKLADYKNQIGETGVNSLLKNTQDFNAWQKSGDSKEALETLPKLSLKDIKPELPN
FT                   LSYKVESQSGMKVLTHNADLNGLSNISLYFDTSKVPQDKLHYLSLLSSLLGNVDTKEHS
FT                   YDQLSNEMLQYVGSTISFTPSAVSSNKDPNNYSPKLTVSLLAPDENISKSLDLTEEIIN
FT                   DSQFTNKQRIKQIIEQNKSALQATLTSGSGAAAIMRMSSYMSESGRYSEELTGLSYYKF
FT                   LQDLDSNFDSKWDEISKNLNDIRKLAFNRDDLIATYSGNENTSETFKNELSSISPKINS
FT                   QVLPQQKYTFAQPDKNTAFSSTAKVQTIIQVGDFKKAGYTYSGKMMVLQNVLDNGYLWN
FT                   KVRTTGGAYGVQSALSPNGEVILASMRDPNLKETLDAFQGTVNYLKNFQATDSEMTNYI
FT                   IGAIKSFVNLKSSGPLEESSLCDSMYLTNSSVNDLLNYEKEALSTTPDDIRNYGNMLDQ
FT                   VLKQNIYFAEGSADKIEQNKQLFNEIIDMQK"
FT   gene            complement(525313..526272)
FT                   /locus_tag="CLJU_c04890"
FT   CDS_pept        complement(525313..526272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04890"
FT                   /product="predicted molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04890"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13571"
FT                   /db_xref="GOA:D8GMG1"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMG1"
FT                   /protein_id="ADK13571.1"
FT                   /translation="MLENTTLTPQEVADMLKIAKNTVYELIKRGELNGYKVGKKIRVDL
FT                   NDVENYKNKTKHTTQNESSDVKENDLSSPDIFYPTRDNTNGGFIICGQDVLLDILSRYI
FT                   EIRCPGTRTFRSYVGSYSGLLSLYMGKIQVATAHLWDGDSDQYNIPFVRRLIPGIPTVI
FT                   IHLACRMQGFYVAKGNPKKFKGFEDLKRPDITMINREKGCGTRILLDEHLRLLNISGSD
FT                   IKGYAKEHFSHLEIASTVARGDADVGLGNEKTALQVNNVDFIPIQKERYELVMKKEDIN
FT                   KAPFNSILEILRSNQFKSELLGIGGYDLTEMGNIIAEL"
FT   gene            526644..527462
FT                   /gene="nifH1"
FT                   /locus_tag="CLJU_c04900"
FT   CDS_pept        526644..527462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifH1"
FT                   /locus_tag="CLJU_c04900"
FT                   /product="nitrogenase iron protein"
FT                   /EC_number="1.18.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04900"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13572"
FT                   /db_xref="GOA:D8GMG2"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMG2"
FT                   /protein_id="ADK13572.1"
FT                   /translation="MRQVAIYGKGGIGKSTTTQNLTAGLAEMGKKIMVVGCDPKADSTR
FT                   LLLGGLAQKTVLDTLREEGEDVDLDEILKKGYGGIKCVESGGPEPGVGCAGRGIITSIN
FT                   MLEQLGAYDDDLDYVFYDVLGDVVCGGFAMPIREGKAQEIYIVASGEMMAMYAANNISK
FT                   GISKFANSGGVRLGGIICNSRKVENERELLEAFAKKLGTQLIYFVPRSHDVQKAEINKQ
FT                   TVIEFSPEVEQADEYRALAKAIDGNDMFVIPKPMAQDDLEAILMEHGLMD"
FT   gene            527610..527936
FT                   /locus_tag="CLJU_c04910"
FT   CDS_pept        527610..527936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04910"
FT                   /product="nitrogen fixation regulatory protein I"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04910"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13573"
FT                   /db_xref="GOA:D8GMG3"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMG3"
FT                   /protein_id="ADK13573.1"
FT                   /translation="MLLIKAIIRPEKAPEVLSELCDAGFPAVTKFDVVGRGKQRGVKVG
FT                   EIFYDEIPKQMLLIVVKDEYKDDIIKIITRSAKTGNKGAFGDGKIFVTPVEEVYTISSG
FT                   TNEL"
FT   gene            527950..528342
FT                   /locus_tag="CLJU_c04920"
FT   CDS_pept        527950..528342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04920"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04920"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13574"
FT                   /db_xref="GOA:D8GMG4"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMG4"
FT                   /protein_id="ADK13574.1"
FT                   /translation="MKEVMAIIRMDMVGKTKDALAAAGFPSITCKKVVGRGKKKVDFSI
FT                   IQDYISGSDMVDFSDKKVAEQISEVHRLISKRLIIVLAKDKEVKKVVDALIEANRTGNP
FT                   GDGKIFVIDVTDVVRIRTEETGDEAV"
FT   gene            528366..529976
FT                   /gene="nifD1"
FT                   /locus_tag="CLJU_c04930"
FT   CDS_pept        528366..529976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifD1"
FT                   /locus_tag="CLJU_c04930"
FT                   /product="nitrogenase molybdenum-iron protein, alpha chain"
FT                   /EC_number="1.18.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04930"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13575"
FT                   /db_xref="GOA:D8GMG5"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005972"
FT                   /db_xref="InterPro:IPR010143"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMG5"
FT                   /protein_id="ADK13575.1"
FT                   /translation="MRKELNKIVDEVLEPYPAKTYKNRKKHIVIKTKEDPKPVIEANIR
FT                   TVPGVITSRGCCYAGCKGVVMGPIKDMIHITHGPVGCSFYSWGGRRNKAKSEKGSQNFM
FT                   EYVFGTDMEEKDIVFGGVGKLRQAIKEAVEIFHPKAIGIYATCPVGLIGDDINAVAQEA
FT                   KKLYGINVLAFSCEGYKGVTQSAGHHIANNTVMSEIIGTGKGEHKKYSINILGEYNIGG
FT                   DAWEIERILNKIGYNVVATLTGDGSYERIQNAHTADVNLVQCHRSINYIAEMMETKYGI
FT                   PWIKCNFIGIQGTVDTLRDLAKVFDDPYLYKKTEEVIEEELADIQVDMQYYREKLEGRL
FT                   ACLFVGGSRSHTYQVLLKDFGVKTILAGYEFAHRDDYEGREVIPTIKIDADSKNIPQLT
FT                   VHPDKEKYHVALPKERVEALKSEGVPLAYYGGMEKEMDENTVIIDDMNAHEMEKLIKEL
FT                   HPDMFLTGIKEKYAIEKMGVLSRQLHSYDYTGPYAGFKGAIIFARELAGGIYTPAWKYL
FT                   TPPWKKESLLEGKVVGGEQ"
FT   gene            529976..531337
FT                   /gene="nifK1"
FT                   /locus_tag="CLJU_c04940"
FT   CDS_pept        529976..531337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifK1"
FT                   /locus_tag="CLJU_c04940"
FT                   /product="nitrogenase molybdenum-iron protein, beta chain"
FT                   /EC_number="1.18.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04940"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13576"
FT                   /db_xref="GOA:D8GMG6"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005976"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMG6"
FT                   /protein_id="ADK13576.1"
FT                   /translation="MLDATPKELVERKQLRINPAKTCQPVGAMYAALGIHNCLPHSHGS
FT                   QGCCSYHRTVLSRHFKEPAMASTSSFTEGASVFGGGANVKKAVKNIFAMYNPDIIAIHT
FT                   TCLSETIGDDLPTYIREMEIPEGKLVIHANTPSYVGSHVTGFSNMVNGMVQYLSKSNGE
FT                   KNGKFNIIPGFVGPADMKEMKRIFKLMDIPYIIFPDTNGVFDTPNTGDYKMYPKGGTKI
FT                   EDIVDAGNSDFTVAFGNYASELAAKSLENKCKVPYKTLRAPIGIDAMDDLLMNLVRLTG
FT                   KEVSAELEEERGQLLDMMIDSAQYFNGKKVAIVGDPDVVISLTQFVITLGMIPKYVITG
FT                   TPGSLFEKEIKAMMDEAGLEGIAKANSDFFEMHQLIKNEGVDLLISNTYGKFIARAEDI
FT                   PFVRFGFPVMDRYGHQYTPKVGYYGAIKLVESMLNAMLDKEERECAEEDFETVR"
FT   gene            531885..533288
FT                   /gene="nifE"
FT                   /locus_tag="CLJU_c04950"
FT   CDS_pept        531885..533288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifE"
FT                   /locus_tag="CLJU_c04950"
FT                   /product="nitrogenase iron-molybdenum cofactor biosynthesis
FT                   protein NifE"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04950"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13577"
FT                   /db_xref="GOA:D8GMG7"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR005973"
FT                   /db_xref="InterPro:IPR042459"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMG7"
FT                   /protein_id="ADK13577.1"
FT                   /translation="MEKIKEDFYHDLHEKNRDRFLKLEARKSEILEDRKEFVCYNSKDK
FT                   DTKIRCEENSVSGAVSQRACVYCGARVVLNPITDAFHLIHGPIGCAAYTWDLRGSLSSG
FT                   SELFRNSFSTDLSETDVIFGGEKKLRAAVDEIVNKFHPKVIFIYATCIVGVIGDDVDAV
FT                   CKMAEEKYKIRVIPVKSPGFSGNKSTGYRAACNAILKLIGNKKSEKRLNGINYLGDFNL
FT                   AGEVWVVENYLKRIGINIVSKLTGDGKVDEIVKAPGAKLNIVQCAGSMGYLAKKMEELY
FT                   DIPFIKTSFVGLEDTENSLLQVAHLVGNEETVKKAEKLIKEEEEKIQPELEYYRGRLKG
FT                   KKAAIYVGGGYKAISLIKQFRDLGIETVMVGTQTGKPEDYEIIRQITNEGTVILDDANP
FT                   YELERFMVEKGADVLVGGVKERPLAYKLGVAFCDHNHERKHILGGFQGAINFAKEIDLT
FT                   VNSPVWQYI"
FT   gene            533305..535992
FT                   /gene="nifK"
FT                   /gene_synonym="nifB"
FT                   /locus_tag="CLJU_c04960"
FT   CDS_pept        533305..535992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifK"
FT                   /gene_synonym="nifB"
FT                   /locus_tag="CLJU_c04960"
FT                   /product="nitrogenase associated protein N"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04960"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13578"
FT                   /db_xref="GOA:D8GMG8"
FT                   /db_xref="InterPro:IPR000318"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR005980"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034165"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMG8"
FT                   /protein_id="ADK13578.1"
FT                   /translation="MEMSNKKLVNVDINPCKMCMPMGGVMAFKGIENNMVILHGSQGCS
FT                   TYIRRHMATHYNEPVDIASSALTEQGTVYGGSENLKKGLRNMIKMYEPTTIGVMTTCLA
FT                   ETIGEDTKRIVEEFYNEEKDNEKIKNIKIITASTPGYGATQAEGYFQVLRSIVEQACEK
FT                   SESTGKLNIICANLNPGDVRNIKQILDDFKVEYTILPDVSNTLDSAHNEKYKRIPAGGT
FT                   KIEDIRKMSGAVGTIEMGMTISDDKSPGTYLKDKFKVPLYKCPIPIGFRNTNKFIELIS
FT                   KITGILIPHKYVVQRGRYLDAMVDNHKYTGEARVLLYGEPELVYAVSRLCEENGILIKM
FT                   IGMGSKNEMLREKLKEELKVQKEECIVLDDTDFKTMEDYAEKLKINLIIGNSDGRRMAQ
FT                   KLKLEIIRIGFPIHDRVGGQRQVITSYSGSAFLIDSVANVMLSHTQNTYREKAYNDFYA
FT                   PFAKMAEKESIQSPADKICTHPCFGDNAHEFARMHIPIAPKCNVSCNYCSRKYDCANES
FT                   RPGVTSEVLSPKEALEKFKIVKSKMKNLTVVGIAGPGDALANFDQVRESLKLIREYSPE
FT                   TTFCLSTNGLMLPFYANELVQLGVSHVTVTINTVDSKIGLRIYKEVNYLGHKYIGEEGA
FT                   KILLDNQLTGLRYLCSKGIICKVNIVMLKGINDNHIKEVVKKVKECGAYMTNIMQMIPV
FT                   SGSVFEDLPLVSNIELNEMRKKCEVSMKQMYHCRQCRADAIGTLSEDHSIDFRNVGCGG
FT                   CLGKCSDDKKVEEEKLLKNAAKSKKYKFAVSSKSGINIDQHFGHANEFYIYTYNDGTTK
FT                   FLEKRNVDKYCTGVYECDEHEDKMEKTMKAIGDCNAVLALRAGVDPTEKLEKRGIKVIE
FT                   MYDSINKGIVKAVKLLEDDKIQVY"
FT   gene            536180..537217
FT                   /gene="nivfV"
FT                   /locus_tag="CLJU_c04970"
FT   CDS_pept        536180..537217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nivfV"
FT                   /locus_tag="CLJU_c04970"
FT                   /product="homocitrate synthase, omega subunit"
FT                   /EC_number="2.3.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04970"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13579"
FT                   /db_xref="GOA:D8GMG9"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMG9"
FT                   /protein_id="ADK13579.1"
FT                   /translation="MYVHYIRKRKKFIVDRTLPEVVKRTEIVDQDLVGQFIALIKNIGV
FT                   DFVEINGEVLQKIKDLPENVDYIYRVGDLLDVYEFEHLIIDYKKAETLPKEFLNKLRNK
FT                   KIILEVDIKVLEQFNVEDNCKIFSKLNIICIRIKGIVKYNIAGWNRLIENIKNRFSVYV
FT                   DFCADDKFYMATSVSIESCVDGADAVTAAFNGQVYGFASLEEVILGLKIIKNGKVCGDL
FT                   EFMEQLAEVYTKLTCEKVHPMKAVIGEDIFKYESGIHVDGIEKNPDNYEPYSPYDIGKK
FT                   RIMYIGKHSGKKAVMIKLKELNINYQDVDIGEFLKEIRKNSIKLKRNIFDKELIAMFNN
FT                   FKNIQ"
FT   gene            537267..538067
FT                   /gene="nifV"
FT                   /locus_tag="CLJU_c04980"
FT   CDS_pept        537267..538067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifV"
FT                   /locus_tag="CLJU_c04980"
FT                   /product="homocitrate synthase, alpha subunit"
FT                   /EC_number="2.3.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04980"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13580"
FT                   /db_xref="GOA:D8GMH0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMH0"
FT                   /protein_id="ADK13580.1"
FT                   /translation="MDVNVVDTTLRDGEQKAGIALGINEKVKIAKILNDMGIYQIEVGS
FT                   AAMGGEEKASIEKVAALNLKSKISSWNRANIKDIDASIDCGVDIVHISIPTSDLQIKSK
FT                   LGKDKAWVLERIKKCTTYALEKGYEVTVGMEDATRSDINFLIEFCTAVSEIGIKRIRYS
FT                   DTVGISYPRKVFYSIKKLLQEVPIEIEIHAHNDFGMALANSLAAVEAGAKFANCTISGV
FT                   GERAGNCDFIKFARTLDMFEGEKICPLNINDLLETEQILRCLSL"
FT   gene            538244..541576
FT                   /locus_tag="CLJU_c04990"
FT   CDS_pept        538244..541576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c04990"
FT                   /product="putative surface-layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c04990"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13581"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMH1"
FT                   /protein_id="ADK13581.1"
FT                   /translation="MKRNAIKAISTTAVLSLLLSPALPVTSAKAAAGEVTKLSGADCYE
FT                   TAAAVAEQNWTSTDNVILASGEGYADAISSAVLAKQLNAPVLLTEAGSLNSNAKSALDK
FT                   LKPKNIYIIGGTASICQKTRDDLKSQGYNLIELSGKNRYETNLAVAKELVKLGVSTDNI
FT                   MMVGGEGFADALSAAPVAAAKGEILLLGVNSTQAMSSIENFIKSNNSKVTVVGTQALIN
FT                   DDTYKSVGAVNRISGGSDRFATNLNILNQFDSELKADKLYIANASGDKYADALIAASIA
FT                   GISDAPLVLIDGQDDSGTANAMNYIKNKAGKTTDLNLIEENGIVSDKTISDINAAASGS
FT                   GVESATVGSVSTNGLNQIKIVFNTDVDKNSAERAANYQIDGGDLGSTVQNQSTATLQED
FT                   NRTVFITFSHPFTLNKSVTFTVKSAINTKNLGSTIPKYDKQITFSSIETPTLDSITAIG
FT                   GNKLRVKFSEPIRMDSSNLSSFKINRQSITAFGINTSDSVTKFRNKSLDGVWADGVDLY
FT                   FNSPLPVGKNTFTVPNGEAGSKFSDAANLPISSTSKDFTVNSVSGNPQVQSVTSNNVDT
FT                   IYIKYNRPMDQQTALEPSNYKLNGTTVDVDDSYVTFDTGSGDTIVKITKLGDKLKQGEN
FT                   TVTVKGNVTDTFGNYINESNMNLYVGGDTTKPTISTASIFDEKTMRIKFNKDVSTSYAQ
FT                   NKGNYTVLDSTGANISYEIDQINAITIDGNSKRTFDIKFKENDLKGSKYTLTVKNIIDT
FT                   EANPNIMDNYTTTLSGMDNEGTNVTEILRRVDNPHAVALFFSKAMDQSSLENSSNYMYK
FT                   DGQGYTRSLPSSATVTPSIDGKSVTIEFNSDYTIGSGSSGSSVIQMGVKNLKDVDGNPL
FT                   DLGSYMGDITIDDNNDGPGLVAGTAQMTFISNDIYVKVSLSKPLDVLSFNDFRVAGYAP
FT                   DTGSTSGNDVTLIFKSGIKNNQKINAIKNAGSMTNVSIENTSSVDAAGRNIKSGSTAVY
FT                   IPPITNQDMWSASPNSGMNVINVVFNQEIDDDIVTSYNDDFLFTDEETGQQLTPTSVWV
FT                   DNRTLVYRFNNGTLNKGDRILVRANSDSSKINVRSENHNTSGYTIYSPSDSDISGKIVT
FT                   VGE"
FT   gene            complement(541629..543188)
FT                   /locus_tag="CLJU_c05000"
FT   CDS_pept        complement(541629..543188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05000"
FT                   /product="predicted cell wall binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05000"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13582"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMH2"
FT                   /protein_id="ADK13582.1"
FT                   /translation="MKKILGIAAAAAIVLGMSNSTYAKTTYNVTRLAGNNRYETSENIA
FT                   NNFESGTVQSVIIANGNNFPDALGGSVLSKIYNAPILLLNDDFKNSSNAVDYIQNHLSK
FT                   SGNIYILGGTSSVSDDFVSYIKGLGYGNVTRFGGSNRFETNKSIINSMNVQKGTPMVIT
FT                   NGWGFADALSVSSVAACYKYPIFMIDNGKLSESNKDVISSIQPSKIFVIGGQSSVSDDV
FT                   VNEIKSLQPALTDSNIVRIGGQTRYDTSLSICKYFNSNSNFAVLANGANFPDALSGSAL
FT                   ASKLSAPIMLTDGKDISSQKNYIDEKGYKDIYLLGGLNSIDLSVEYLMEPTSSIPQAEI
FT                   DYITALKGYCDSYEDKTGTVSTQMEDIYNKTTDIRVAITSASTAQELSSDIEQLITLFN
FT                   QGNSCLSSYKSDLTTLKSEASNLSVPSGLDTYSTQYLDSINTQINYVDTTMKYTTSCLN
FT                   IFTEMKDALDNMDMDKLEKSTAELQDIGTDGNSISNIENGNKGIDDLDTRLGNALTSYQ
FT                   QK"
FT   gene            complement(543360..544055)
FT                   /locus_tag="CLJU_c05010"
FT   CDS_pept        complement(543360..544055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05010"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13583"
FT                   /db_xref="GOA:D8GMH3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMH3"
FT                   /protein_id="ADK13583.1"
FT                   /translation="MMKKILIIEDDLSIAELIRDYLELENFEVVICTDGIEGLNNFKEN
FT                   KFDLLILDIMLPQIDGFSILHSIQEEKDIPVLLVSAKKEEIDKIKGLTLGADDYITKPF
FT                   SPSELVARVKSHIKNYEKIKGKFVKPPKNNIIIRGLEINQDCRQVFVNGREVNLAQKEF
FT                   EILSFLAQNPNRVFSKEDLFEKIWGLDAIGDTSTVTVHIGRIREKIESSPSNPQYIETV
FT                   WGAGYRLRV"
FT   gene            complement(544030..545160)
FT                   /locus_tag="CLJU_c05020"
FT   CDS_pept        complement(544030..545160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05020"
FT                   /product="predicted sensory transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13584"
FT                   /db_xref="GOA:D8GMH4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMH4"
FT                   /protein_id="ADK13584.1"
FT                   /translation="MDIKKRLIIYNSVTLITPFIATTLTAFIFIVVCSKFLNTNIGYDS
FT                   NLFKIFIITITSTFIFSFIIANIIISYLFSKRILTPIARLKKATSEISHGDLSFEIVED
FT                   GDSEIKDLCSDFEKMRIQLKNSIHMKMKYDDNRKMLVSSISHDLKTPITSIKGYVEGIL
FT                   DGVANTPEKLQHYLRTIYSKSQQIDKMIDDLLLYSKLDLNQIPFNFEKTDIISYFTDCT
FT                   QECSFELNKSNITISLKNNLNKSKYVMIDRERFMRVVLNIINNSKKYMGDTKNGSILID
FT                   LRENNASIIIEIKDTGCGIDKNHINKIFDRFYRTDSARTETKGSGLGLAIAKQIVEGHK
FT                   GKIWAVSEEGSGTSITISLPKLHERQIIYDEKDFNN"
FT   gene            complement(545170..545919)
FT                   /locus_tag="CLJU_c05030"
FT   CDS_pept        complement(545170..545919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05030"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13585"
FT                   /db_xref="GOA:D8GMH5"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMH5"
FT                   /protein_id="ADK13585.1"
FT                   /translation="MEFKAALINEIERLYKKKKILVSAVMSFIVIVLGQIVIIAMRNGF
FT                   GLMGVSNMEFPILVLSIIANIILPLFTVLITIDSFSGEFSHNTIKLSLTKPITRLKLFT
FT                   AKLTAIIVFILSNLIFVMIFSITAGFIFNSNTISLLSFSRIVLSYLITLFPMIVFSLII
FT                   VFLVNIFKNGISVFFLSILIFIIFKFLSIIFYKYSGLFFTSMFDWYKLWIMNKLPLYKI
FT                   FCEFMMMLSYDILFFTGSYYLFDKKDF"
FT   gene            complement(545909..546634)
FT                   /locus_tag="CLJU_c05040"
FT   CDS_pept        complement(545909..546634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05040"
FT                   /product="predicted ABC transporter, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13586"
FT                   /db_xref="GOA:D8GMH6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMH6"
FT                   /protein_id="ADK13586.1"
FT                   /translation="METVIEINNLTKLYKNDRGIRNINLKINKGDIFGFLGPNGAGKST
FT                   TMKIMTGLIKPDSGDVKIFDHSIVDDFQKAMQSVSCIIETANSYEYLTAFENLRQASRY
FT                   YEDVDNSRIDEVLDLLGLSKYKNEKTKKFSLGMKQRLGIAAAILAKPKIIILDEPLNGL
FT                   DIEGMIDIRNIIKDMAQSYQTTFFISSHLIHDIEMTCSKIGLLYNGTLVDVDTTKNILK
FT                   NYVSLENYFVSEVNRNDGI"
FT   gene            complement(546731..547984)
FT                   /locus_tag="CLJU_c05050"
FT   CDS_pept        complement(546731..547984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13587"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMH7"
FT                   /protein_id="ADK13587.1"
FT                   /translation="MKMNKKAAMLISFTIGTLMFATTAFAEVNSKSGYDELKDSLKHTA
FT                   ENCTNKFSSFTVDSSFVMRDNGAVIYSKNILNKYDASKKSIENTSEVNNGTTKSEELYY
FT                   KDKNVTIAHNTSDSNIYHVTNITDKDKTNSFLSNPFKESQASDIEKIVDTAIGNLKDSI
FT                   SVARKTDGTRELSTSLSENQIPSLINAVTSFKLKQDINNQIQQTSRLNTSTTKLPQISK
FT                   DVFVKDVQLKVITDKDDSIQSVLASGAISGKDNSGNSHLLVFELSLKIKDVNSTIVNKP
FT                   DLSGKKVQESTEKDYTKLSNPTAYLGKYKNDITIEKDSKFEKIGERFIEIQEIDSNHVK
FT                   GKYYEEYLEGYKDYSSNAKSFNFEGKFQKNNTSASFNTSSSGNVIKGNIYFSPDSANIN
FT                   FNVSNEEISNPTLNKVFN"
FT   gene            548446..549582
FT                   /locus_tag="CLJU_c05060"
FT   CDS_pept        548446..549582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13588"
FT                   /db_xref="GOA:D8GMH8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMH8"
FT                   /protein_id="ADK13588.1"
FT                   /translation="MNKIKILALTAVMTLCTSTAVFADGNTLDIDSFINTAIQNSYDVK
FT                   SADISIKQAQNSYNSDTKNAASYSDQLDQGGATLDQYTRLQLMENISSNQQQDKFSEYE
FT                   YTQIKSVAENQVKLSAYNQYTTIMNDRDTVDLENQNFKNAQEQYNSAQLKLSLGTISPS
FT                   DEKKAEADYTAEKNQLRKCQRQYNSDIQSLNKIAGIDIYTQYDVLLKDKLTESPYIRSY
FT                   NEYLNDALKNRAEILIGQKNIELQKFKYDVVNGVFSDKQSVPNRLAQANVDNASDSLEI
FT                   QKLNITSEVNSLYNDLQVKTRILGSKKDALNLAQTNYNTAQIKYNVGVISRIDFDTQAA
FT                   NLKSAQNDLKSAERSIWMAQTKLELACGAGSDTSNLSN"
FT   gene            549616..550758
FT                   /locus_tag="CLJU_c05070"
FT   CDS_pept        549616..550758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13589"
FT                   /db_xref="GOA:D8GMH9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMH9"
FT                   /protein_id="ADK13589.1"
FT                   /translation="MKGKLSIAIGLTLALSVSSTCFAANNSTITPVNSITGNATLSLDQ
FT                   VLNDIEKNSVSIQTKEQKILLYQRQFDRDNMNAALIHESGTSEANYPAGQYVNIKLTTD
FT                   VIPKADEQNIKDAEHDKDDSLQNLKFSTEQEYLNALTNEDQINTINDQIKNVEEQIAQT
FT                   KVKIANGQLTNNDLQSLLVQESQLQASLNQPKAQLQQNLLSIKQTINMDLDGDLTLVPA
FT                   EKSFVKYDDSNIEDKINKAVDNNYNIGKINNNLDILRVKEDIYKRYSFNDESGEVSTGL
FT                   SIEDLENSRNNTILTIKTNLWNGYYELKALEDTVETEQAKVASAQSTYDSTEAKVQQGV
FT                   AIQLQADSAALALKSEKINLKNAINNYMVAVEQFEYNLTQ"
FT   gene            550915..551322
FT                   /locus_tag="CLJU_c05080"
FT   CDS_pept        550915..551322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13590"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMI0"
FT                   /protein_id="ADK13590.1"
FT                   /translation="MKHNFKKLGILALILTLFVSLSGCSFGKQSSQNDAAKSTAEKQKE
FT                   VAKQKEAAKITTDTDKTAQLKKEKAIFNGQVYVQNNRAIATMIIKSGVSDQEAKDLAQK
FT                   YAQDLKKKYKNMQVNVMAVRDNKNIVNLTVK"
FT   gene            complement(551639..553396)
FT                   /locus_tag="CLJU_c05090"
FT   CDS_pept        complement(551639..553396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05090"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13591"
FT                   /db_xref="InterPro:IPR032774"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMI1"
FT                   /protein_id="ADK13591.1"
FT                   /translation="MKKISKKYLSLMFTFMLSTSAGFIFNSPKVLASNNLNHSITDLNI
FT                   SCTNVYAFEGNLAKFQNNNFYGLIGKDGIVKTPAEFTSISTFKNGYAKVAKGSKFGFVN
FT                   GNGSVVVEPQFEEVSDFFTNGLAAVKQNSKWGLINNSSKIVTEPQFDAVYGFFNGLMRV
FT                   RKGGSYGFLKSDGNLLSGCNYNNAYDFSDGYAAVEEGNTWGLIDKSGNFKSFDFDEIKS
FT                   PILGLVPIKKDKHWGLSDMSGKMVLEPKYTDISYLNSNLIKISSGDKRGAIDKKGNLIL
FT                   DLNYDSIIPADDGMCQIVENGQYGLIDPTGKIIVQPQFSWIDTFQEGKAIVCSQDQYGF
FT                   IDTKGELTRETQFDKVYAFKEGMAMVKKDGKYGFINSKGDVVISPIFDNASDFNEGYAV
FT                   VKKNTGSSSVENSDDSELKEKYIKWGYVDRLGSTFISYDFDSASSFNDGCSLAVKDGKC
FT                   NMIKVPGIKSIPSTAISDPFKTWKIKFSKAIDGRHTLSNKDDTVLNDIDMTMTDNIKVT
FT                   NSNGEYANVSFTFESPDTIVINPPSNGYTPGETYTITVLSNGKYNIQDMSGNKLKPDVT
FT                   EMSFQVLDN"
FT   gene            553633..554505
FT                   /locus_tag="CLJU_c05100"
FT   CDS_pept        553633..554505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13592"
FT                   /db_xref="InterPro:IPR030910"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMI2"
FT                   /protein_id="ADK13592.1"
FT                   /translation="MVKKAQKNSAQDGEEYVSTVLSLLDEEENVVSDVQKEIFEDEIKE
FT                   LPPIKEGQLNVSGIYAYDEGDKLEVKIYVRNGLSDKLNLKMIPFVIKNSKGDILAAQQF
FT                   NLSCLGELPPHSARPIKLYFDKKNVKVDKIPQDDWEVALNGEFNVTSTVRPIYEGLPEG
FT                   ISDEDKLVFNKFLAELPEMEEGQFSISTFSIGIQTNGNILVTAVMRNGSNQPITINKMP
FT                   MTVLDAKKRAVKSESFELKDFTVSPYRAKICNFAFPTDVHPEQDQPLDGWSVAYKLVKI
FT                   NGKVNVKRK"
FT   gene            554693..556507
FT                   /locus_tag="CLJU_c05110"
FT   CDS_pept        554693..556507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05110"
FT                   /product="predicted cell wall binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13593"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMI3"
FT                   /protein_id="ADK13593.1"
FT                   /translation="MQKKSKKVLSACSIASLLVTTTAVSTGVKAADSGVNRVGGANRYE
FT                   TAAKVADSGWTSSDYAIVANGEGYADALCATPLAKANNAPILLTTGNSSNSLEQNQLNE
FT                   LKKLNVKHVIVIGGTGVVPDSVLNSIKAQVTDVERIGGQDRYETSVKIAEKLGTPAKAV
FT                   IASGEGYADALSAGPAAAINGMPILLSRAGSLPDTISNYLKAHSQITQTYVIGGTASIS
FT                   DSILNSLPSAKRLGGQTRYDTNVAVLQEFASSFNFSNIYAALGDGPLGNEFADALTGGA
FT                   LAAKNRNPLVITGKTISSATASFLKEKGLTNSTLTVLGGTASIPDSVASDIKGDIGNSS
FT                   TPGGGSSGGSGSNSVPLSGSLLNNLIVDNNDYKNFVQSLNTPTGKYYNEYFTIKQIDDT
FT                   TNDKSINVQLKKSDRSVEDIFVDAQNKYLVDGKLTDSDIQAIKDNVDKVNAKLDLVYNK
FT                   QLLGSLTIGNSNKDLKTFLSSLGSKYILNDGSGHLDKDYIVNKITTDLPKYNSASEYEA
FT                   FKDDLTTKISNYFKNDSSTDTIVKYHGYTIGNIYDDSTKMFDYQLSHETNADNLVNIVF
FT                   PSSKVGGTYTINLANNDGHFIINVSNIN"
FT   gene            556691..558019
FT                   /locus_tag="CLJU_c05120"
FT   CDS_pept        556691..558019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05120"
FT                   /product="predicted cell wall binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13594"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMI4"
FT                   /protein_id="ADK13594.1"
FT                   /translation="MLRRNKIISKLILGVFLASSTVFAAGQNVFAASSRLWGQDRYATS
FT                   TAVSKNNWTSSDYVILASGEGYADALCAAPVAKKYNAPILLTGSKELNEGVKSEITRLK
FT                   ATHVIEIGGEASISSDIENELKSMKLNVQRLGGQNRFETSVVVANFLGNVTKVVVTSGY
FT                   GFADALSIAPIASNQGMPILLTGKDSLSDAVQNYINQNKDSIKNSYVIGGQGVISDSAI
FT                   SGLPTAARISGQNRFDTNVKVLSYFKGSIDFSNLYVVEGDGPTGNEFADALSGSAAAAK
FT                   KSSPIILTYNTLYSGMEDFIKSNVPKTASVTVIGGTGAVPDSLINTMDQVVSGTSTQNP
FT                   STSGGGSSSSDDANLSSVLSKLKAMDTSKLDTNQKTVISDIITALDKYEADSSYNYNTD
FT                   AQNVKQLYNNLTHDEKSSLQTAVVNAGVSISEGMTLANKFGLY"
FT   gene            558163..559209
FT                   /locus_tag="CLJU_c05130"
FT   CDS_pept        558163..559209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13595"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMI5"
FT                   /protein_id="ADK13595.1"
FT                   /translation="MGKLKSRKKPVILIIIALLVVAVAVFAKLVFWNSSYSSPKYKFSA
FT                   DLLTKVLKAQESGGTVELSKDEVNGVISLYFKQYKTSDLVVKSVEADFEDDKMVFLIPI
FT                   TYKNFNLLLSSQGDVSFQKGKIIYNPEYFKLGKITLPKSYVLKKLQPKLKNGMALEGDS
FT                   ITVSTSGLPISIKNISVKDQKLLVTLEKKQLNIEDMLKGKISSSLQNFIKDFSNIKKLD
FT                   PSTKTNGESTGAKSNDNGTPSVSNTQSSSSKTPVSQERQQALNRLSSGLNAASGAVSTG
FT                   GQQAVISQLISIVNNMKDSSYNPSSAEGSVRAAYDKLSAEEKAGLRSAVLSNVNSSDAG
FT                   TLGIIMGN"
FT   gene            559240..559923
FT                   /locus_tag="CLJU_c05140"
FT   CDS_pept        559240..559923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05140"
FT                   /product="putative capsular polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13596"
FT                   /db_xref="GOA:D8GMI6"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMI6"
FT                   /protein_id="ADK13596.1"
FT                   /translation="MEEETTLDLRDFYYILKKRLKLIVIVTLACTLLAGILSFFVIKPT
FT                   YEAGTTIIVGKPQNSQKSNTQYNDVMMYQNLVKTYAQIAGSNAVMEGASNKMNGSVSAG
FT                   QLQKIITVTPQQGTQILEIKGQSKDPAQAVNMVNAVSNSFITESKRVFPTGGDIQVMDT
FT                   PQFPNKPVKPKKVLNMAIAFFVGLMASVGFSFMLEYMDNTIKTEEDVNKILGIPVIGII
FT                   PKGNM"
FT   gene            559991..560758
FT                   /gene="capC"
FT                   /locus_tag="CLJU_c05150"
FT   CDS_pept        559991..560758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="capC"
FT                   /locus_tag="CLJU_c05150"
FT                   /product="predicted capsular polysaccharide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13597"
FT                   /db_xref="GOA:D8GMI7"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMI7"
FT                   /protein_id="ADK13597.1"
FT                   /translation="MIDIHSHILPGIDDGSKSMEDTIKMLRLTEEDGVETIVATPHFYK
FT                   EYYENSYEDVIELVDKVRNEAKQENICVNIVSAQEVFLDRHTVENFKSGKIGCIEGTNY
FT                   MLVELPMMNVPKDALDIIYELEIRGVHPILAHPERYKYIIDTPSKINEFMNEKCLLQIN
FT                   TGSVLGIFGKKVKKTAELLIESGVCSFIASDAHSTGGRCPGISKALEEALQFNKDIEVQ
FT                   VLDNCKKMLKNEIIQLPGERIKDRKGIFSFLRK"
FT   gene            560797..561516
FT                   /locus_tag="CLJU_c05160"
FT   CDS_pept        560797..561516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05160"
FT                   /product="predicted exopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13598"
FT                   /db_xref="GOA:D8GMI8"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMI8"
FT                   /protein_id="ADK13598.1"
FT                   /translation="MEKPDIITVKNPKDPIAEAYRTLRTNIQFSSFDKKIQTIMLTSSG
FT                   PGEGKSTTCSNLAVVMAESGSKTILIDCDQRKPRLHKIFLTTNEVGLSDVLVGKVKFEE
FT                   AVKETGIENLNLLTSGTRPPNPSELLASKKMENFLQDLKEKYEYIIIDTPPVVAVTDAQ
FT                   LLSRYADGCLLVIASSQVEKEAAVKAKELLVKVNANIVGVVLNKLEIKEKGYYGYYYHY
FT                   YYGSDGTKIKKKEKRKK"
FT   gene            561638..561865
FT                   /locus_tag="CLJU_c05170"
FT   CDS_pept        561638..561865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13599"
FT                   /db_xref="InterPro:IPR012454"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMI9"
FT                   /protein_id="ADK13599.1"
FT                   /translation="MAVKSTTLQTSLILKYKDGLDAKGKEVIKQQRFSNIKTTAADQDI
FT                   YDVAKEIEKLLGKTLNELVKQDQNAITVTA"
FT   gene            561904..562122
FT                   /locus_tag="CLJU_c05180"
FT   CDS_pept        561904..562122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13600"
FT                   /db_xref="InterPro:IPR021321"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMJ0"
FT                   /protein_id="ADK13600.1"
FT                   /translation="MSKSLVMSFFNEQGKKTSIKVENVKEGITDLEVKNAMTAIIAKNV
FT                   FTSKSGDLKSIDAAHILDSSTTELQVK"
FT   gene            562674..563297
FT                   /locus_tag="CLJU_c05190"
FT   CDS_pept        562674..563297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13601"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMJ1"
FT                   /protein_id="ADK13601.1"
FT                   /translation="MENDIHLKELIKGVKNGESYWIARLETHFIKIIKALYYKKMFKHC
FT                   GSIYEEDVKNKCLHKMIVSCKKFRGSTWSEFTSYNIKIISSVIVNAINSTSKVKNITLN
FT                   LENDLNQENAMDYMRIRHKGSMTMEDEILNRIILEEMFEYFNGKLSEKERKTMHLIIHY
FT                   DNLKEYSRKSNCNYDALKQRVYRLRKKLNKLRKNYYLKIGLDEI"
FT   gene            563316..563882
FT                   /locus_tag="CLJU_c05200"
FT   CDS_pept        563316..563882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05200"
FT                   /product="predicted RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13602"
FT                   /db_xref="GOA:D8GMJ2"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMJ2"
FT                   /protein_id="ADK13602.1"
FT                   /translation="MENLQLEILLERAQSGDKNAVESICIKFNGMVINMAKCTYIKGYD
FT                   MEDLIQEGRYSVIKAIGMYDINSKYPFAAYVKSSVKKNFYNMIRTNIKKVSCCSLYSKN
FT                   EEGCEFINMIASDENIEEDLIKRKLIIQLNKSIDKLSEDKRNLIDWYYIQNRSLNEYAE
FT                   KEGISYRTAVYRKRKALESLKSFLV"
FT   gene            564691..565359
FT                   /locus_tag="CLJU_c05210"
FT   CDS_pept        564691..565359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05210"
FT                   /product="predicted glycosyltransferase"
FT                   /note="involved in lipopolysaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13603"
FT                   /db_xref="GOA:D8GMJ3"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMJ3"
FT                   /protein_id="ADK13603.1"
FT                   /translation="MTEMQSRPIEVTVENMEKYEKSDTYYFIKRCIDLILSFIGIIVFS
FT                   PIMLIVTAAIKLDSKGSVIFSQMRVGKNGKLFKMYKFRSMVDDAEELLDNLRSKNEMTG
FT                   PMFKIKEDPRITRVGKFIRRTSIDELPQLFNVIKGDMSLVGPRPNLPHEVAKFTECQKA
FT                   KLLVKPGLTCYWQVMGRSNIDFEHWMKLDIKYIEDRNTLLDLKLIFKTFWVFFGDDGAA
FT                   "
FT   gene            565478..566596
FT                   /locus_tag="CLJU_c05220"
FT   CDS_pept        565478..566596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05220"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13604"
FT                   /db_xref="GOA:D8GMJ4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMJ4"
FT                   /protein_id="ADK13604.1"
FT                   /translation="MKVALVHDWLTNMGGAERVVINFKQIYKNAPIYTTIYNPDNLDDE
FT                   LKNIDVRTSFLQNKKGAKKNHQKYFPFMPAAFESFDLNEYDIVLSSSSSCAKGVITNPN
FT                   AMHVCYCHSPMRYGWEFYYEYANNSNMKKLKKNLLKYFMDYMRVWDNVSSNRVDYFIAN
FT                   SENVARRIWEHYRRESVVIHPPVRCSLFNISNEDQDYFLIVSRLVEYKRIDLAVEAFNE
FT                   LGLPLVIIGDGAERQKLELKAKDNIKFLGRQPDEVIKEYYSKCRAFVFPGEEDFGITPL
FT                   EAQASGRPVIAFGKGGALETVVSEKTGVFFEEQTVEALKNAVKVFESLSFDKELIRKHA
FT                   EEFDEEIFKGKIRNFVDEKYDEFLGTKKWKVL"
FT   gene            566597..567706
FT                   /locus_tag="CLJU_c05230"
FT   CDS_pept        566597..567706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05230"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05230"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13605"
FT                   /db_xref="GOA:D8GMJ5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMJ5"
FT                   /protein_id="ADK13605.1"
FT                   /translation="MSQVVFNALQTSLSGGIGRYCYEVSKAIYKQHKIDFKIVIREEDK
FT                   GLFSFADIEDLIIVEGIKNAKQRNFYEQFKLPKLIYKKYPDAIIHYPDTMAPIFAKNKV
FT                   IITVHDLAFKSLKDAFTWKTTLWKNFITDLSIKKAHKIIAITEFAKNEILKYYPMVNDK
FT                   ISVVYNGFNNFSKEPIDVSNINQKILDLKNGKYILTVSTISPRKNIDGLIKAFGLIKDK
FT                   ICDYKLVIAGKNGWLYENVYKVVSNLGLNDRIIFTGSINDDELKFLYKNASLFVYPSFY
FT                   EGFGLPPLEAMSYGIPCVVSNRTSIPEVVGDAAIKVNPDNLNELGNKIFKVISNGKLCD
FT                   FLRANSNKRLECFSWKKSGQDTIKVYYHL"
FT   gene            568420..569748
FT                   /locus_tag="CLJU_c05240"
FT   CDS_pept        568420..569748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05240"
FT                   /product="membrane protein with a O-antigen polymerase
FT                   related domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05240"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13606"
FT                   /db_xref="GOA:D8GMJ6"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMJ6"
FT                   /protein_id="ADK13606.1"
FT                   /translation="MLIILICLILIIAFLIAFFISDEFAIGSLILSFPFEKTSWYLGFF
FT                   TLKPTIILIILLYLKIIFKALKVYKIKSKNIKFIFINLISMIIINIISSVMAVNPLKSF
FT                   SRIIQNLTLYGLLFSFCLLNYNKIKIEKLINYYLLSGIIILAYGYFQIIGYYLGIDTYS
FT                   LLSKFNNPNFYYGTWVVEINGNVFPRMNSFFGDPSMLCGFLTIICMFILYKIINEKKYV
FT                   FLLYLLFSVIALGFTFSRSGWIGFIFMLMVYSLFNIKKHIKEISIGILLCLTLIVVMQN
FT                   SGVIKLDVLLNRMNQTFDSTNISTSGHENFAKLAIQGFKTSPIIGIGLGNFSDFVEEYG
FT                   MTHSMYLSLICETGILGTLLFFNIIKKLLMDGIKLKSSIQSVVPCVYSIIGFLVSNIAY
FT                   DYSNQYYFWGVLAMLLYIENMYDKKDCVSQHISVHIKKLDKST"
FT   gene            569859..570749
FT                   /locus_tag="CLJU_c05250"
FT   CDS_pept        569859..570749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05250"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05250"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13607"
FT                   /db_xref="GOA:D8GMJ7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMJ7"
FT                   /protein_id="ADK13607.1"
FT                   /translation="MIQPLIYIILVNYNGYKDTIECVNSLIKLNYSNYKIVIVDNASSD
FT                   DSVKILKEELNDCKIIESNKNLGFAYGNNLGIKYALDNKADYVLLLNNDTLVETSFLTN
FT                   MINSFNVNKSIGLVGCKIMYYPQKNIIWYGGGYINWFKFIGIHYGAKQIDKGQYDQEKE
FT                   IDFMTGCCMLIKREVFDKTGFLSEDYFMYLEDVDFCVKVKDAGYKIWYNPKAIIYHKVG
FT                   FSSGGEESAFSIKWSTRNRLLFMKKYKNRVNKLSFALTNILFYVTRCIRYIQYKVRGQD
FT                   DKANAIIKAFQKNKF"
FT   gene            570781..571302
FT                   /locus_tag="CLJU_c05260"
FT   CDS_pept        570781..571302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05260"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13608"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMJ8"
FT                   /protein_id="ADK13608.1"
FT                   /translation="MKISSNTLVLNEKGYIDGLIKNLIDAKIDEIIFLDGGSTDGTYEK
FT                   LLMYEKIYPQIVLVKWNQPISSQYRQGWREKDRRNLMLGISTGDYILFIDADERIDINI
FT                   KKVVSLIDVDGIITYTYHFWRSNKTVRVNNINDMVWSNQAQLRIIKRNDLVKFNTVDKN
FT                   GLHCYLQKKG"
FT   gene            571544..572779
FT                   /locus_tag="CLJU_c05270"
FT   CDS_pept        571544..572779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05270"
FT                   /product="predicted glycosyltransferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13609"
FT                   /db_xref="GOA:D8GMJ9"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMJ9"
FT                   /protein_id="ADK13609.1"
FT                   /translation="MPERNGYFSKYTKICTEVLMGGFKLKNILYISLIDWFWIKQRPQH
FT                   ISEFLSRNNKITYVSIRSWRNNTNVNIAHSKNDYNINKSNFNVNPNMNIIRKRLIPKEN
FT                   SCKYIKNINDKIMSNILKRLDKENNYDVIIITHPKQYDIIPKNFFNSKLFIYDCMDNYK
FT                   CWPNFNKNKLINNEKKIVESSKYVITTSQDLYNEIIKCNPHLISKIHVVNNGVDIETFD
FT                   INKINKVDDVDIFKQNNKKKVGYIGTISIWMDLDLIKNVALKNSNIDFYIIGPVEKGTN
FT                   LEKYSDIENIIFTGSQPYYSIPNILNDLDVCIMPFKKTDLVKSVNPVKIYEYLAMGKPV
FT                   IALRYDETEKFGDLIYTYETQKEFENCLNKILHQQEEKSVMDKRKRFAKQNSWKCRTNQ
FT                   IEKFINEGMKNK"
FT   gene            572776..574200
FT                   /locus_tag="CLJU_c05280"
FT   CDS_pept        572776..574200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05280"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13610"
FT                   /db_xref="GOA:D8GMK0"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMK0"
FT                   /protein_id="ADK13610.1"
FT                   /translation="MNKIVKNFNFMLFGNVFSRIIGVLLTVYLARKFGPSYFGIINFSN
FT                   AFITYFSMIASMGLQSLGIVKIAKDKENMKKDVDIILSLRTILSIIAFIVLLIVTICIN
FT                   KDINTKKMIVITGISILINSFCLDWVFNALQEMKYISYSIMISSFLSFILVFIPLYLNM
FT                   YTKIYIVPIASAISSIISNIYLINIYKKKGKHKINFVVDFEQYKDLISAAWPFFFSGIF
FT                   ATINCNIDTLMLGFMRNNYEVGLYNSVYKLVNVLTLFVSFIFVPLYPVFIEYYNNKKFD
FT                   DISIVINKVRKLMYIIAIPILVVAFTLNQETIRILYGNKYIGASKVFTILIAYVSIFYI
FT                   REIYGYELTAWGLQKKYMKIVLISSMFNVISNLIFIPKYGINGAAINTLISEVINIVLM
FT                   YRLSRKTLHIKYDNKYIFHIIISAIFMAIIIYVTKIAATNIFVLIITAGIVYCISILKL
FT                   KVVTIQEIKGLIGGKK"
FT   gene            574197..575303
FT                   /locus_tag="CLJU_c05290"
FT   CDS_pept        574197..575303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05290"
FT                   /product="predicted glycosyltransferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13611"
FT                   /db_xref="GOA:D8GMK1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMK1"
FT                   /protein_id="ADK13611.1"
FT                   /translation="MNFVTIFPETENFHLTKDVGMIGYILYRYYGYNSKIVCYKNSESY
FT                   DYLDNEVKGLKIDFIKKITGSPTKDVLIYLIKNAKKIDILHMFHITSNRNFYWILIYKL
FT                   LNPKGRVYLKLDADYRIKKFDFNKKGLKGFIKRWLIKKCKLVSIETKVLYEYVNNNWGI
FT                   NIEYIPNGFYDNGIRNKVSYNEKENIICTVGRIGTNQKATEVLLEGFKMAASKIGGWKL
FT                   KIIGPIEAEFKNYINKFYENNLDLKEKVIFTGPIYDKKVLESEYRKSKIFCLTSRYEGF
FT                   PLVFLEAIKNGCYIISSDFEASFDITNNKKYGDIFSIDNAFELTQCFSKMCTYENKIKE
FT                   NCDKVQNYAYEKFYWPTICKQIDILLRR"
FT   gene            575313..576227
FT                   /locus_tag="CLJU_c05300"
FT   CDS_pept        575313..576227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05300"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13612"
FT                   /db_xref="GOA:D8GMK2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMK2"
FT                   /protein_id="ADK13612.1"
FT                   /translation="MEIEPLVYIIILNYNGYKDTIECVNSLKKINYKNYKIVIVDNNST
FT                   DESEKILKEKFNQCIIIQTGKNLGYAGGNNVGIRYAVKNNSDYICILNNDVIVEKCFLE
FT                   ELVKYLYSNHNTAMVGPMICEYSNKRVIQSTGAIVNLYKGSVPSLNSGKMEDVVNQKVI
FT                   KCDYIGGACILVRKEILDEIGLIPENYFLFFEETEWCLKAKKMGYDIVCYCNAKVNHKG
FT                   SASINKVSGLSEYFMHRNRVVFEKRNANLIQLICFYVYLFLQTIYKIVLKKQSLNILKY
FT                   YIDGLLNRVDERYSFVHIGKIMR"
FT   gene            576495..577874
FT                   /locus_tag="CLJU_c05310"
FT   CDS_pept        576495..577874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05310"
FT                   /product="bifunctional enzyme mannose-1-phosphate
FT                   guanylyltransferase /mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.22"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05310"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13613"
FT                   /db_xref="GOA:D8GMK3"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMK3"
FT                   /protein_id="ADK13613.1"
FT                   /translation="MKIIILAGGSGTRLWPLSRDRYPKQFIKLQGDKPSLFQETFKRSL
FT                   LLAQLNDIYIVTNEKYKFLVMGSVEELGYEYSKTNIIVEPEAKNTLPAIYAGVYEIAKK
FT                   SSDTVVVFPSDHMITKGQEFANIIKNSEPLTIDSIITFGIKPDNPNTGYGYIAPGNQKL
FT                   NGYEVKEFKEKPEAEIAATYVDEGYYWNAGIFMFNTEIFINEVKHYAPNIYNAFDSSNN
FT                   VKEAFSKIDEKISIDYGIMEKSKNVAVAPVDIGWNDLGSFDSFYEVFDKDENNNISDGD
FT                   NVLIDSKDNYIYSEKGKLVTAVGVNDLIVVDNRDALLICKKDQSQKVKKIVQTLKERND
FT                   SRVEYHVQDYRPWGSYKVLEEEKNSFKIKRIKVSQGKKLSYQMHYHRSEHWIVVKGMAK
FT                   MTIDDVERLVPAGESIFIKPGQKHRLENPGKVPLEIIEVQMGNYLEEDDIVRFEDDYGR
FT                   K"
FT   gene            577934..578989
FT                   /gene="rfbB1"
FT                   /locus_tag="CLJU_c05320"
FT   CDS_pept        577934..578989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB1"
FT                   /locus_tag="CLJU_c05320"
FT                   /product="dTDP glucose 4, 6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05320"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13614"
FT                   /db_xref="GOA:D8GMK4"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMK4"
FT                   /protein_id="ADK13614.1"
FT                   /translation="MKTYLVTGGAGFIGSNFIHYMLKKYSDIKIINYDKLTYAGNLENL
FT                   KSISKNSNYIFIQGDICDREKLQQLFQKYDIDYVINFAAESHVDRSIRDPEVFVKTNVL
FT                   GTVALLDTAKNAWTVEDGFKEGKKYLQVSTDEVYGSLGKEGYFTEKTPLDSHSPYSSSK
FT                   ASADLMVKAYFDTYKMPVNITRCSNNYGAYQFPEKLIPLVINNCLNKRDIPVYGDGLNI
FT                   RDWLYVEDHCKAIDMVINSGQCGEVYNIGGHNERTNIHIVKTIISYIHDNVDSSVGENL
FT                   IKYVEDRKGHDRRYGIDPTKIKDELGWYPETKFEDGIVKTIKWYLDNKDWMDNVTSGDY
FT                   KKYYEKMYKNK"
FT   gene            579128..580006
FT                   /gene="rfbA1"
FT                   /locus_tag="CLJU_c05330"
FT   CDS_pept        579128..580006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA1"
FT                   /locus_tag="CLJU_c05330"
FT                   /product="dTDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13615"
FT                   /db_xref="GOA:D8GMK5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMK5"
FT                   /protein_id="ADK13615.1"
FT                   /translation="MRKGIILAGGSGTRLYPMTKAISKQIVPIYDKPMIYYPLSVLMLA
FT                   GIRDILIISTPRDMGTFKELFGDGSQLGLHFQYEVQYEPKGLAEAFIVGEKFIGNDDVV
FT                   LVLGDNVFHGYGFTERLKAASDRQDCSTIFGYHVSNPKDFGVVEFDKDFNVISIEEKPS
FT                   KPKSDYAVPGLYFYNNDVVDIAKNIEPSPRGELEITDVNNEYLKRGKLKVELFGRGMAW
FT                   LDTGTPQGLLNAANFVEAVQTRQGLYIACIEEIAYRQGYIDDKQLIKLAEPLKKVAYGK
FT                   YILSLLDRKHY"
FT   gene            580027..580914
FT                   /gene="rfbD1"
FT                   /locus_tag="CLJU_c05340"
FT   CDS_pept        580027..580914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD1"
FT                   /locus_tag="CLJU_c05340"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13616"
FT                   /db_xref="GOA:D8GMK6"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMK6"
FT                   /protein_id="ADK13616.1"
FT                   /translation="MKVLITGGKGQLAGQLRKILVSGKSEIGALDKVYSDAEVRFPNKR
FT                   ELDITKLADVRNFVTDYAPSIIINCAAYTNVDKCETDFESALKVNSLGARNLALASQNT
FT                   KIRLIHISTDYVFNGRGTVPFREYDLPDPVSVYGKTKLLGEQYIKENCSRYFIVRTSWL
FT                   YGLYGKNFVYTILKAAKERGHLDVVNDQRGNPTNAEDLAYHILKLALTDEYGVYHCTGN
FT                   GECSWYDFACKIVDYAGIDCTVSPMTSENLNRAAKRPEFSSLDNMMLRCTIGDNMRHWK
FT                   DALKSFIQKLYKNE"
FT   gene            581091..581648
FT                   /locus_tag="CLJU_c05350"
FT   CDS_pept        581091..581648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05350"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13617"
FT                   /db_xref="GOA:D8GMK7"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMK7"
FT                   /protein_id="ADK13617.1"
FT                   /translation="MIKIGKFNFVKTEIKGVYVIETGIFGDNRGYFMETYNYNEFKASG
FT                   LDMVFVQDNQSKSKKGVLRGLHFQKNYSQGKLVRVVKGKVFDVAVDLRDGSSTYGKWVG
FT                   VTLSEENKKQFYIPKGFAHGFLVLSDEAEFCYKCTEFYHPEDEGGIIWNDTDINIKWPL
FT                   EGIDNIIFSEKDKLWPTLKEYK"
FT   gene            complement(581835..582038)
FT                   /locus_tag="CLJU_c05360"
FT   CDS_pept        complement(581835..582038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13618"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMK8"
FT                   /protein_id="ADK13618.1"
FT                   /translation="MKPGNFYFLRNDYFADFPDDKLMGNKEMVQGVSHDRHCFYAFYDD
FT                   STSLYWLIPFSSRVSKFKSIKE"
FT   gene            582229..582921
FT                   /locus_tag="CLJU_c05370"
FT   CDS_pept        582229..582921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13619"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:D8GMK9"
FT                   /protein_id="ADK13619.1"
FT                   /translation="MQLMKFSDQCVHSIKIAYFEGSDKSVFKDRREYYGSLLKQLSDSY
FT                   EYIDLLNKTKATFVGLDRIDKRDYPPGAIREALLNSIVHREYSFSGSTLINIYDDRMEF
FT                   ISLGGLVPGLSIESIMLGVSQPRNEKLANLFYRLKLIEAYGTGIAKIVSSYKESNIQPT
FT                   IRAADGAFQVMLPNLNYTSNKDNIEKGAGASNSYNPQFQAILDVMRNQGSITRRQALNI
FT                   VSDKLPGV"
FT   gene            complement(582965..584506)
FT                   /locus_tag="CLJU_c05380"
FT   CDS_pept        complement(582965..584506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05380"
FT                   /product="predicted transposase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13620"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:D8GML0"
FT                   /protein_id="ADK13620.1"
FT                   /translation="MYTKNEILELKNRIIQLEKENKTLHETVEFLTHKLFGRSSEKTSV
FT                   IAGQINLFNEVETESKPSAPEPTLQEVANYRRKKFNGQRAELLKDIPHDTVICGLEEDE
FT                   RFCEKCGTSLVSIGSEFIRTELEFIPAKVRVIDYYRESYECRKCRKEGLPYIEKSPMPY
FT                   PVVQHSMASPSTVAHIMYEKFVDALPLYRQEKEWESLGVKLSRATMSNWIMVAARDWLI
FT                   PLTKLMHQKLIEEKYVHADETPVQVLMEPGRKNASESYMWVYSTYAGSQTPIRLFDYKP
FT                   SRSGNCPQKFLKGFKGYLHTDCYSGYNKVPEVIRCLCWTHLRRYFVEALPKDIKSPEAT
FT                   LPAIGIDFCNKLFSEEKLLVNLTPEERKTKRLETEKPILEAFWSWANSIKQSCLPKSRL
FT                   GKAVDYAVKNKEGFMNYLMDGNCAISNNLSENSIRPFTIGRKNWLFSGSPRGAEASAAV
FT                   YSIIETAKANGLEPYSYLKFLFKNLPGVQFEAHPEFLDEYLPWDQWVQSSCKKKA"
FT   gene            complement(584594..584950)
FT                   /locus_tag="CLJU_c05390"
FT   CDS_pept        complement(584594..584950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05390"
FT                   /product="putative transposase, IS66 like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13621"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:D8GML1"
FT                   /protein_id="ADK13621.1"
FT                   /translation="MLGDISKAEKVYIATGYTDMRKSIDGLAAIVQQNFELNPFQNSLF
FT                   LFCGRKRDRMKALYWEGDGFVLLYKRLENGRFQWPQDAQAVKCITPREFRWLLEGLSLN
FT                   QPKAVKKVDVQNAL"
FT   gene            complement(584940..585320)
FT                   /locus_tag="CLJU_c05400"
FT   CDS_pept        complement(584940..585320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13622"
FT                   /db_xref="UniProtKB/TrEMBL:D8GML2"
FT                   /protein_id="ADK13622.1"
FT                   /translation="MDVQKTTQDYRMNKWIKTIRECMDSGENVSSWCRNNGIKTNSYYY
FT                   WLRKIRAAACKALPSINHQEQIVPMDMSKISNAISTDTDYVSSETSQADVIVHLGSAVL
FT                   EIHNSASESLIQNVIKVLKNVG"
FT   gene            585806..586429
FT                   /locus_tag="CLJU_c05410"
FT   CDS_pept        585806..586429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05410"
FT                   /product="predicted glycosyltransferase"
FT                   /note="involved in lipopolysaccharide synthesis"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13623"
FT                   /db_xref="GOA:D8GML3"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:D8GML3"
FT                   /protein_id="ADK13623.1"
FT                   /translation="MEKYEKSAGYHFLKRIMDIILSFIGIIAFFPIMFVVAVTIKLDSK
FT                   GPIIFSQARVGKNGKIFKMYKLRSMTHDAEQLLDNLQHKNEMTGPIFKIKQDPRITRVG
FT                   RFIRKTSIDELPQLFNVIKGEMSLVGPRPNLPKEVAKFTSQQKIKLLAKPGLTCYWQVM
FT                   GRSSIDFDEWMKLDLKYIKDRSTLLDIKLIFKTLGVFFGDKNAS"
FT   gene            586475..587629
FT                   /locus_tag="CLJU_c05420"
FT   CDS_pept        586475..587629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05420"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13624"
FT                   /db_xref="GOA:D8GML4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR015393"
FT                   /db_xref="UniProtKB/TrEMBL:D8GML4"
FT                   /protein_id="ADK13624.1"
FT                   /translation="MKNIFIIGSKGIPARYGGFETFVDKLTFHKKNIDIKYHVACLAED
FT                   EKEFEYNNARCFNVKVKNIGSARAVLYDIKALKMAEKYIKKNNLKDSIIYILACRIGPF
FT                   LAFYKKKLEKQGIKVYVNPDGHEWKRSKWNKAVKAYWKYSERLMVRHADFLVCDSLGIE
FT                   EYVKEEYKEYNPNTTFIAYGADIKKSTLPDGDPKLLNWFYKNGIKSKQYYLIVGRFVPE
FT                   NNYEVMIREIMASKTDKDLVIITNVEKNKFYDELLLKTHFDKDKRIKFVGTVYDQELIK
FT                   KIRENAYAYIHGHEVGGTNPSLLEALASTQLNLLVDVNFNREVGRDGAIYFKKSRGDLS
FT                   TLIKEIDKLDISNINKLSENAKNRIISSYSWNKIVNDYEELFGI"
FT   gene            587700..588815
FT                   /locus_tag="CLJU_c05430"
FT   CDS_pept        587700..588815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05430"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13625"
FT                   /db_xref="GOA:D8GML5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D8GML5"
FT                   /protein_id="ADK13625.1"
FT                   /translation="MKIGIDAHVIGDKSGGNETYYRNLIEQITKLITDEEIYLYFNDLK
FT                   KSSLINIDNENNIKIKSFKTSNAVKRYMKYLPDYVQKDKLDVLHLQYFPAIRKKCKIIG
FT                   TIHDISFEHYPQYFTKKNLLMNKILIPALAKQADKILTVSNFSKQDISNKYGIDPDKIV
FT                   VTYLAASEKYKVIKNYELLSQVRKKFNINGEFLLTVGNLQPRKNLSRLFTAYINLRNKK
FT                   MIDEKLVVVGKKAWLFNDIFKFVNESKYKDDIIFTDYVSEEDLALLYNAAKLFVYPSVF
FT                   EGFGLPPLEAMSCGTPVVTSNITSIPEVTGNAAVLFNPWNVEDMEEKIVTTINNKDMIN
FT                   KLSELGLKRSLDFSWKKTAQITLEAYHGMVT"
FT   gene            588871..589947
FT                   /locus_tag="CLJU_c05440"
FT   CDS_pept        588871..589947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13626"
FT                   /db_xref="GOA:D8GML6"
FT                   /db_xref="UniProtKB/TrEMBL:D8GML6"
FT                   /protein_id="ADK13626.1"
FT                   /translation="MASLLILKDILFFRYRNISTTFIFLLPIIIIYILQILMLHDLNVE
FT                   KGIASVGKMFLCLYLLNTVKNNFSRIDVTKLYKYAVLLLMLLFVISLFVKTDVFWIFND
FT                   LTNKFLTTRLKLLYIEPSELSFHAAVLALFILFYNNNCEKLFINYENLLYLVILLVIMA
FT                   YSGGLGGIVLVLFTVIFILGRDNLKKSTVGRKIIYIYVILCMIPIIFIFVNYFQSSIVL
FT                   RLQAIMSGSDSSFNYRVFKGFNGMKACLESNPFLGIGFGNLNTDYYEYMLLSYGLVSKI
FT                   ANSFMYAIAEGGLLLLFYLGCLFVYMWKHINKDTFKYALLIFIFLYQIGGGYFTNPINW
FT                   IIYGVILSNSAKERSEVS"
FT   gene            589947..590675
FT                   /locus_tag="CLJU_c05450"
FT   CDS_pept        589947..590675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13627"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D8GML7"
FT                   /protein_id="ADK13627.1"
FT                   /translation="MKIKNFLLMLVPISRLKIYLYNKLLHYKIDKSCKIGFSYIDAVYF
FT                   ELGRGSVIGNFNLIKNCSRIVIKENSTILKYNFFKSCKNVIVGSNTVIVRDNKFLHNNN
FT                   VGLGFGGNIVIGSFTTIVNKHYFDLTDDIYIGDKCTIAGNGTEFWTHGFDLENNRVQGE
FT                   IKLLNNIYIGAGVKFNFGLKVNSNNVVGMGSILTKSINCEGYLIGGIPAKPISKLNNDK
FT                   IGYKEIGTINNKKVYRKIVD"
FT   gene            590689..592485
FT                   /locus_tag="CLJU_c05460"
FT   CDS_pept        590689..592485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13628"
FT                   /db_xref="GOA:D8GML8"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D8GML8"
FT                   /protein_id="ADK13628.1"
FT                   /translation="MDIGLQDNLFFLNSYDSNVELNGKFIGEQYNFSNIKKDRYNIYFT
FT                   KTVEYFKHKDRYEILFFSKSKYDIRKLFENLSFIDISVCKELFNYLLYKVDYAIIIIDK
FT                   VEDKIYSFRTPNGVVPMYYFYKDGTLVMSMHVHSIAKAIKKVEISNFAIEQLYVMDCLM
FT                   EPYTLYEGVYEIGRVYIYEFNLNNNSLKKEKVYSFKYEINNNMSLEESISTLKNKIIKS
FT                   HQKRVGSINGIMLSGGIDSNVMCYALKNCTTSSLESFNVSVKNQKNSEAPYAKKVADYF
FT                   GLKHREVLIDPSDINEKILEDIINLNFPYWGVMYIGSIFKSLKLNGYNIFTGQDTRLHT
FT                   PYVNILDDMIFRNKISSKVLPFLGKKLAALKFNKKITRALERCKDAEHMEKYLIKYFLH
FT                   CSIDNNNVNSMLKQEIKENIEYEKLSYQELFNEITWLRWGQQYTDDIKYMDSLCNHYYN
FT                   TCQFPFYDIKLAEVSASIPFKYSNKRYIGKSGFGNGFTINNKYLLMRMLKDENVPINLA
FT                   GRKKAVSSTIHLYFNDQFGKIVKGRLNDSTLLNNSTIINLGLDKLINQFCSENRIYGDM
FT                   DYSYLIKIYNVFVLDVLKSYIE"
FT   gene            592501..593955
FT                   /locus_tag="CLJU_c05470"
FT   CDS_pept        592501..593955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13629"
FT                   /db_xref="GOA:D8GML9"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:D8GML9"
FT                   /protein_id="ADK13629.1"
FT                   /translation="MKILYLTKQAPKREYTISKEILSDNENSFADSCVFSYRNYLDVYE
FT                   LNKKEKVFRNIYDFTEFCKTSIGESVNIDDELYKFELNYNLPVNKILYADRLVINYSEN
FT                   HRKQIIYMLVKFSLMLLEKTQYDVIIGELSSSSDLIFYYLSKHFKIKYLFFWHGRISNK
FT                   MEFSDVLGRRHGLKELYINYKKNGFSQEEREYLNKYLEKFKKQAAPDYMKFSKQTKFKN
FT                   LFRKLYMQSFVIRLKKYMKSYHIDLKYSADQSPKISEKINKKLKKVVFPIKSLLLKRYY
FT                   DNVNLNKRYYLTPLHYQPESSTMTFAPYYLNQLAFIENLAKSIPGGTYIYVKEHPAMFA
FT                   NRKLSFYKELKKVPNIKLVHPEFSMNALIEKSMGVVTLTNTTGYEAIVKDKPVFVFGNV
FT                   FYNEYDYSFKCNNFEEFRDNIITALRDWDRCEGERINNRNCFILACIRSLRKGNLNSHL
FT                   LDKNFFKDENIKNIVNSIKDEIIGGQ"
FT   gene            593956..595014
FT                   /locus_tag="CLJU_c05480"
FT   CDS_pept        593956..595014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05480"
FT                   /product="predicted polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13630"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN06"
FT                   /protein_id="ADK13630.1"
FT                   /translation="MLNDKSILITGGTGSFGKKFTEMILKRYNPKKIIIYSRDEFKQDL
FT                   MKKDFMLRCPDKINKIRFFIGDIRDRDRLYRAFNGVDYVIHAAAMKQVPACEYNPFEAI
FT                   KTNIDGAQNIIDAALDRGVQKVVALSTDKAVNPINLYGGTKLVSDKLFISANAYSGGNE
FT                   TVFSVVRYGNVAGSRGSVIPFFQSLIEKGIKELPITDCRMTRFWITLEEGVELVFKALD
FT                   ESKGGETYISKIPSFTITDLAKAMLDDVVIKEIGIREGEKLHEIMITRDDSRTTYEYEK
FT                   HYIIYPHFDWWSFDKHFTSGGKLIEEGFEYNSGNNTQWLTVNELRQEMYRLGIFDAYKV
FT                   NDIHYDEVMPTK"
FT   gene            595031..596221
FT                   /locus_tag="CLJU_c05490"
FT   CDS_pept        595031..596221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05490"
FT                   /product="putative LPS biosynthesis-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13631"
FT                   /db_xref="GOA:D8GN07"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN07"
FT                   /protein_id="ADK13631.1"
FT                   /translation="MNELAINGGRPIRKTYLSYGRQDIDEEDIESVVKVLKGDFLTTGP
FT                   SVREFEKKVSDYVGAKHAVAVASGTAALHMACFAAGIKEGDEVIVSPITFAASANCVLY
FT                   CGGTPVFADIDPKTYNIDPKEIEKKVTSKTKAIIPVDFTGQSVDIDEIRRIAGKNNLII
FT                   IEDSAHALGSEYKGKKVGTKAQMTEFSFHPVKPVTSGEGGMVVTDDDELYKKMILFRSH
FT                   GITRDKDLITHNEGPWYYEQIDLGYNYRITDIQCALGASQMNKIDKFISRRRDIAKTYN
FT                   EAFKDVAEITTPCEAEFSNSGWHLYVIKLNLEKLTCTRKEIFEALQAENIGVNVHYLPV
FT                   YLHPYYQKLGYQKGLCKNAEELYERMITIPLFPKMTDEDVSDVIDGVKKVINYYKR"
FT   gene            596230..597414
FT                   /locus_tag="CLJU_c05500"
FT   CDS_pept        596230..597414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05500"
FT                   /product="predicted polysaccharide biosynthesis protein
FT                   with acetyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13632"
FT                   /db_xref="GOA:D8GN08"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN08"
FT                   /protein_id="ADK13632.1"
FT                   /translation="MKVVCIVQARISSTRFPGKVLKEICGKTVLEHDVDRLRRIKNVDE
FT                   IVIATTTLEKDNVIVKECEKLKIKCFRGSEDDVLSRYYYAAKENSADVVVRVTSDCPLI
FT                   DSEVTESIIQCYMENREKYDYLSNTIDRTYPRGLDTEVFSFCALEKAFNESTSQRDREH
FT                   VTPYIWDNDNIFNIFQYKNKIDYSDLRWTLDTEEDFKLISIIYEQFEDRDYFGMNEIVK
FT                   FLEKNPEVKEINKYIEQKKIDDSLFLIPAGEGHCDLIYEWVNEDEVRKNSFNNSEIPYE
FT                   EHVNWYFKKLKDPDCFIYLLADSNKNIGIVRVEKKGNENVVSYSISKQFRGKGYGYKIL
FT                   EKLQDKLMKENKNIILTAYVKKENIYSVKIFEKLHYNLVENDDYNMKFEKNLSR"
FT   gene            597422..598474
FT                   /locus_tag="CLJU_c05510"
FT   CDS_pept        597422..598474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05510"
FT                   /product="predicted polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13633"
FT                   /db_xref="GOA:D8GN09"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR020030"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN09"
FT                   /protein_id="ADK13633.1"
FT                   /translation="MNKNIKIKNFEINETSKTFIIGEISANHNGSFDNAVKLIHAAKDA
FT                   GADAVKLQTYTADTITIDCYNKYFQIKQGTLWDGKTLHDLYEEAYMPWKWQPELKKIAE
FT                   ENGLACFSSPFDKTAVDFLEDMDVPAYKVASFEITDIPLITYMASKGKPMIIAAGIAEI
FT                   SDIQLAIDACKKVGNDQIILLKCTSAYPAPFEEVNLKTIPNMRETFDVIAGLSDHTLGI
FT                   EVPISAVTLGAKVIEKHITLSRADGGPDAAFSLEPHELKSMVQSIRNTEKAIGKVSYEL
FT                   TEKQMKNRAFTRSLFAVKDIKAGEIFTEENVRSIRPGFGLPPKYIDNILGRTAGENLLK
FT                   GTPLHWKYVK"
FT   gene            598484..599488
FT                   /locus_tag="CLJU_c05520"
FT   CDS_pept        598484..599488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05520"
FT                   /product="predicted polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05520"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13634"
FT                   /db_xref="GOA:D8GN10"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR020023"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN10"
FT                   /protein_id="ADK13634.1"
FT                   /translation="MATIAIRADGGSQIGMGHIMRTLVLAKELAKTNDVFYLCRIDKPL
FT                   SGRYSYGIEKVKNEGFKVITIDENNVLGELERIQCDCLITDSYDVDEHYFTKTKELFKK
FT                   TGYFDDMNLYHFDVDFIINQNINAEDLNYNTDKRTILFLGPGFALLRDEFRKSKIKKVN
FT                   EVVKDILITLGGADFNNYTAKILQLIKELRYNFHVVVGPSFKYIDELSNYEKMNSNIKL
FT                   HFNTNMKALMDRCDIAISACGSTLYELAACGVPALGLIIAENQKEIAKKMEQEKLIINL
FT                   GPIDKLNKEKLVNTVEELCSDLNRREQMNYNQSIVIDKNGAEKLCKNIMVAIG"
FT   gene            599514..600944
FT                   /locus_tag="CLJU_c05530"
FT   CDS_pept        599514..600944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05530"
FT                   /product="putative polysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05530"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13635"
FT                   /db_xref="GOA:D8GN11"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN11"
FT                   /protein_id="ADK13635.1"
FT                   /translation="MKLKKIFSNGRINILLKYSSIKYIALIIAFLKGIINAGALGPELL
FT                   GVLGNLLLVLSYLSYSNLGILYSMNREYVIYESTDEKDKAGKVISTSFTALFILSILLI
FT                   AAGIIAKFIYKDNLGNYILLVFIIGILEQYRSFYINYYRLVNKVRKINFIELINNVLSF
FT                   VLIIISIKYFKIYSVLIAMFIADIIVFIYGYKNSERIKLSIDKKVLKDLIIVGVPLLIY
FT                   NLGFYILTTVDRLMTINFLGYRDLGYYTFSNQLVNGTMVFISSVLFLYYPKVIKNLYIN
FT                   GNNDRRQILKRIEQYTRYVEVLGVVLCLAGIILIKPFTNMILPKYSVSIDIYRILVFGG
FT                   VFSEISYFANVFTVSNKKQIYSVYLQCLATAAAVILNYIFIKSGMGIIGVSLATLMTNI
FT                   LYSIMQHLIYLRILNLKISFIRNTLKVYLKFTSFTVICIALGFININFILYIVILSIIT
FT                   FILYYSNLRNMIIDMGKL"
FT   gene            600997..602364
FT                   /locus_tag="CLJU_c05540"
FT   CDS_pept        600997..602364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05540"
FT                   /product="bifunctional enzyme mannose-1-phosphate
FT                   guanylyltransferase /mannose-6-phosphate isomerase"
FT                   /EC_number="2.7.7.22"
FT                   /EC_number="5.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05540"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13636"
FT                   /db_xref="GOA:D8GN12"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR006375"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN12"
FT                   /protein_id="ADK13636.1"
FT                   /translation="MKVIILAGGSGTRLWPLSRSRYPKQFIKLQGSKPSLFQETFKRSL
FT                   LLAGLDDIYVVTNEKYKFLVMGEVEELDYKYNEYNIIVEPEVKNTLPAIYAGVHEIAKK
FT                   GNDTVVVFPSDHMIIKGQEFANIIKSSEALTKDSIITFGIKPNSPNTGYGYIAPGNKKL
FT                   NGYEIKEFKEKPDYETAVTYVNGGYYWNAGIFMFNTEIFINEVKLYAENIYNAFKSSNT
FT                   IKEAFSKIDEKISMDYGIMEKSKNIAVKPVDIGWNDLGSFDSFYEVFDKDENSNISHAD
FT                   SIIIDSKDNYIYSGKGKLVAAVGINDLIVVDNRDALLICKKDKSQKVKKIVETLKERND
FT                   SRVEYHVQDYRPWGNYKVLEEEKNSFKIKRIKLSQGKKLSYQMHYYRSEHWIVVKGMAK
FT                   VTIDDIEKLVSAGESIFIKPGQKHRLENPGKIPLEIIEVQMGDYLEEDDIVRFDDD"
FT   gene            602418..603473
FT                   /gene="rfbB2"
FT                   /locus_tag="CLJU_c05550"
FT   CDS_pept        602418..603473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB2"
FT                   /locus_tag="CLJU_c05550"
FT                   /product="dTDP glucose 4, 6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05550"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13637"
FT                   /db_xref="GOA:D8GN13"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN13"
FT                   /protein_id="ADK13637.1"
FT                   /translation="MKTYLVTGGAGFIGSNFIHYMLKKYLNIKIINYDKLTYAGNLENL
FT                   KFISKNPNYIFVQGDICDREKLQQLFEKYDIDYVINFAAESHVDRSIRDPEVFVKTNVL
FT                   GTVALLDTAKNAWTLEGEFKQGKKYLQVSTDEVYGSLGKEGYFTEKTPLDSHSPYSSSK
FT                   ASADLMVKAYFDTYKMPVNITRCSNNYGPYQFPEKLIPLVINNCANKRDIPVYGDGLNI
FT                   RDWLYVEDHCKAIDMVINNGKLGEAYNIGGHNERTNIYIVKTIISYIHDNVDPYVDENL
FT                   IKYVEDRKGHDRRYGIDPTKIKDELGWYPETEFEDGIIKTIKWYLDNKDWMNNVTSGDY
FT                   KKYYDRMYKNK"
FT   gene            603896..604798
FT                   /gene="rfbA2"
FT                   /locus_tag="CLJU_c05560"
FT   CDS_pept        603896..604798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbA2"
FT                   /locus_tag="CLJU_c05560"
FT                   /product="dTDP-glucose pyrophosphorylase"
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05560"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13638"
FT                   /db_xref="GOA:D8GN14"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN14"
FT                   /protein_id="ADK13638.1"
FT                   /translation="MRKGVILAGGSGTRLYPMTKAISKQIVPIYDKPMIYYPISVLMLA
FT                   GIRNILIISTPRDTGAFKELFGDGSQLGLHFQYEVQYEPKGLAEAFIVGEKFIGNDDVV
FT                   LVLGDNIFHGYGFTERLRAASDRHNCSTIFGYHVSNPENFGVVEFDENFNVISIEEKPS
FT                   KPKSHYAVPGLYFYTNDVVDIAKNIKPSSRGELEITDINNEYLKRGKLKVELFGRGMAW
FT                   LDTGTPQGLLNAANFVEAVQTRQGLYIACIEEIAYREGYIDDNQLIKLAEPLKKVAYGK
FT                   YILGLLDKNHHSYFRSEYN"
FT   gene            604795..605679
FT                   /gene="rfbD2"
FT                   /locus_tag="CLJU_c05570"
FT   CDS_pept        604795..605679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbD2"
FT                   /locus_tag="CLJU_c05570"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05570"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13639"
FT                   /db_xref="GOA:D8GN15"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN15"
FT                   /protein_id="ADK13639.1"
FT                   /translation="MKILITGGKGQLAGQLREILVMGKSKIRALDKIYSDAEVKFTSRE
FT                   ELDITKLNDVRDFMADYTPDIIVNCAAYTNVDKCEIDFENAFKVNSLGARNLALASQNT
FT                   KTKLVHISTDYVFNGRGAIPFRECDLPDPISVYGKTKLLGEQYIRENCSRYFIVRTSWL
FT                   YGLYGKNFVYTILKVAKEKGHLDVVNDQRGNPTNAEDLAYHLLKLALTCEYGIYHCSGK
FT                   GECSWYDFACKIVEYAGIDCTVSPMTSEKLNRAAKRPEFSSLDNMMLRCTIGDNMRHWK
FT                   DALKSFIKKLNKK"
FT   gene            605858..606433
FT                   /locus_tag="CLJU_c05580"
FT   CDS_pept        605858..606433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05580"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13640"
FT                   /db_xref="GOA:D8GN16"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN16"
FT                   /protein_id="ADK13640.1"
FT                   /translation="MIKMGKFNFVKTEIEGVYIIETGIFGDNRGYFMETYNYSDFKAVG
FT                   LDMVFVQDNQSKSKKGVLRGLHFQKNYSQGKLVRVVKGKVFDVAVDLRDGSSTYGKWIG
FT                   VTLSEENRKQFYIPKGFAHGFLVISDEAEFCYKCTEFYHPEDEGGIIWNDPDINIKWPL
FT                   EGIDNIIFSERDKLWPTLKECKNNIKKC"
FT   gene            606678..606785
FT                   /locus_tag="CLJU_c05590"
FT   CDS_pept        606678..606785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13641"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN17"
FT                   /protein_id="ADK13641.1"
FT                   /translation="MKFGKFKLKCYVIKKCSFKGKYFVRKLIEVFKKCV"
FT   gene            607128..608441
FT                   /locus_tag="CLJU_c05600"
FT   CDS_pept        607128..608441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05600"
FT                   /product="predicted sensory transduction protein with GGDEF
FT                   and EAL domains"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13642"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN18"
FT                   /protein_id="ADK13642.1"
FT                   /translation="MPIKKDCYAYDFNYSIHNFDEFMHKYVKEKDSFAICFLNMTNLGL
FT                   CNYILEYKYGNVLLHNVINKVRYCINQKAYIYKFGGDVLLLIIPNIKCRDNAVKIIKRI
FT                   ISINNDIFLLAGKKIRIEIKLGVALYPYDNVELHDVFKYASIALNCVNKKCGSTYEFFN
FT                   ANMYENNAMEEKIGTDIQDAFINHEFILYYQPQVNVDSGKVYGVEALIRWNHPEFGILT
FT                   PSYFIDGIERSGEIKKVGRIVFYMACLEAKRLHKLGYSDLIMSVNLSIRQFEDDFFITF
FT                   IKNILEITQVKPEYINFEITERTAINSTEKITSALRNIKDIGIKIFVDDFGTQYSFLNY
FT                   LYTVPIDGIKIDRSFINGIDRCEKKFIIVKNLIKLANDLNLEVVAEGMETVEQLRYLER
FT                   ANCRNVQGFLFGKPLNPNELTSFMKTAKFETSRVIASL"
FT   gene            608480..609229
FT                   /locus_tag="CLJU_c05610"
FT   CDS_pept        608480..609229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05610"
FT                   /product="predicted bifunctional type IV leader
FT                   peptidase/N-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13643"
FT                   /db_xref="GOA:D8GN19"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN19"
FT                   /protein_id="ADK13643.1"
FT                   /translation="MYIYYGIIIFIFGTIIGSFLNVCIYRIPMQESIVYPSSHCTNCGN
FT                   RIKWYDLIPIVSYVILRGKCRNCGEKISKKYPIVEFITGLLYLMLYIKFGISIDIVKYV
FT                   VFISILIVIGIIDFDTTDIYFKTTIVGLISAFVFLGIYYYNGLPIRTYIYGGIAGGGLL
FT                   VLIILITKGGMGWGDAEICLICGLFLGLKFTFVMLFLSFIIGAIIGVILILSGKKSKKD
FT                   YIPFGPFITAASVITVFCGQNILSWYL"
FT   gene            610007..610669
FT                   /locus_tag="CLJU_c05620"
FT   CDS_pept        610007..610669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05620"
FT                   /product="putative membrane protein, involved in Mg2+
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13644"
FT                   /db_xref="GOA:D8GN20"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN20"
FT                   /protein_id="ADK13644.1"
FT                   /translation="MGEWEMLLRLVLSGVLGALIGFERRSHSKQAGLRTHFVVAVGSAL
FT                   IMLVSKYGFWDLVGMNSVSLDPSRVAAQVVSGVGFLGAGTIIVEHQFVRGLTTAAGLWA
FT                   TAGIGIAIGAGMYIPGVGATVLIVIGLEIFNKLQKNEVYSIGRANLSEEGINSALDILK
FT                   NSKMKISNIQVNRHHNKSNKDLEVRITFKVYTRNQNEIKDMMVNLLKIPYVRDVNIE"
FT   gene            610751..612142
FT                   /locus_tag="CLJU_c05630"
FT   CDS_pept        610751..612142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05630"
FT                   /product="predicted cell wall binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13645"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN21"
FT                   /protein_id="ADK13645.1"
FT                   /translation="MKKIFKLALGQAIILGLAFPGTVSAASSHNVSRIYGSSRYQTSIN
FT                   ICNNFSSGKVQNVIVTSGNNFPDALAGSVLSKQLNAPILLVDKSLSDSQDSINYIKDHL
FT                   DASGTVYVLGGYASVSDEYINYIKSLGFNNIKRLGGKNRFDTNKVIVENMNVGKGTPLV
FT                   IVNGSNFPDALSISSIAGMKGYPIILSNTDTLPDEVKEKISEISPSSVYIIGGQGALSD
FT                   NIISEIKKLDTTIEDGNIIRIWGKNRYETSLNICKYFNLDSSTVVIANGENFPDALSGS
FT                   ALAAKLQAPILLTDGKNISTQKEYIDTTKYTDEIILGGSGAVSEDAENELKGIEKKLFE
FT                   VTNEYVGEDGKYYIEGNYLKYVTDINEALDYVKRTGDSSVVEEDNGQWFILDDGFDMTI
FT                   SDKVKLEVDSDVSIKLIHFDSDGNISYNQPNFTDMVNGKYEDRPVFNLFIKDGKVMKMD
FT                   QQFRP"
FT   gene            612447..613373
FT                   /locus_tag="CLJU_c05640"
FT   CDS_pept        612447..613373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05640"
FT                   /product="predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13646"
FT                   /db_xref="GOA:D8GN22"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN22"
FT                   /protein_id="ADK13646.1"
FT                   /translation="MEIKNIKGNTFCIDTKMACIPFYKINYREIIMMDSGWPRGGEREG
FT                   IAEVLKTNNLKVTAIICTHAHMDHIGNAEYLKEKYNCIIAMPECEAVTCSSIINLKFYH
FT                   NNYNMAEIAKHFGQMVCKTDIMITPDQESIYVCGVKFKIIHTPGHSAAHICVITPDDVA
FT                   YLGDALVGYELMEQAKMPYSYSLTDDLKSKEKLYDLNCSKYIVAHKDIYDDITKLIKDN
FT                   IKFYKDTANSIYDVIDKNGSMTMEEIFRSVTKNFNISLDNRVKYGLTETILVSYVRYLN
FT                   EKGMLDLSMENGLYKYLKKAPICTNVY"
FT   gene            613465..614619
FT                   /locus_tag="CLJU_c05650"
FT   CDS_pept        613465..614619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05650"
FT                   /product="putative ABC-type transport system"
FT                   /note="involved in lipoprotein release, permease
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13647"
FT                   /db_xref="GOA:D8GN23"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN23"
FT                   /protein_id="ADK13647.1"
FT                   /translation="MFISSKVALQFLKHSKLQTFVIILGIAVGVSVQIFIGLLSSGLEN
FT                   TILNKIAGNSAQVTVYSNNGSIENWSDIKNKIVKEDKNVKATAPVVDSQVFIKLKDTNQ
FT                   PVQIRGFMPEDVNSLYNIKGSIYEGKMYENSGQVIIGKDLKKKLDLKLGDNIDLFTMGG
FT                   KKLTLNIVGFFDLGAAKVNGAWVITDLGDVQNLIDFGNKATSIEIAVKDIYNADLEGKK
FT                   VTKIISDNSLNVQNWKDQNKFLASGMVGEKICTIIIQFFVLLAAVLSIISILGISVVQK
FT                   YKQIGILKAMGIKDGSAAFIFFVQAFILGVLGTALGLLFTWLYIKGFNRYIVNSEGLPL
FT                   VNIVVNHKFILASSIIDVAASTFAALFPAFKSFRLNPVEVIKNG"
FT   gene            614612..615286
FT                   /locus_tag="CLJU_c05660"
FT   CDS_pept        614612..615286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05660"
FT                   /product="predicted ABC transporter, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13648"
FT                   /db_xref="GOA:D8GN24"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN24"
FT                   /protein_id="ADK13648.1"
FT                   /translation="MDNIIQLENVNKIYGRRVKNKVLSEVNISVEKGSFNSIIGASGSG
FT                   KTTLLNIMGMLDKPTTGEVYIQGKSIKSIGRNSRAAVRNKSIGFVFQFHYLLPEFNAIQ
FT                   NVLMPYRIKHFFCGRSAKRKAEELLELVGLSECKKKKVYDLSGGQQQRIAIARALMNDP
FT                   SIVLADEPTGNLDSTNAESIYKLFRQINDKFSTTFIIVTHDVNIANKTDRIIQIKDGQV
FT                   RD"
FT   gene            615376..616419
FT                   /locus_tag="CLJU_c05670"
FT   CDS_pept        615376..616419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13649"
FT                   /db_xref="InterPro:IPR009038"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN25"
FT                   /protein_id="ADK13649.1"
FT                   /translation="MDEKKEREMEELAEEIDIIFSVKDNISQSEINNFLNKFTELSEDD
FT                   IRKKISEITGDNSYIENSSSDQNDKNSTENIDSESCSEVKVEDSPEELDEDKIENVNDD
FT                   LQLHIDELPEKSEDNKIKPIFDDGNIPDVPFVRAEIKYGQLSLEWGWPEGIDKVLLCCR
FT                   MDRFPESPSDSSASHAIIEREEDFETGDYTISKIEEGNYYFCIYTVVEYENKTLYSEGQ
FT                   RRLVVNKVPQEIFYEIDLKRSLLGKLKSARISLSSASSKSFSKGEIELPQLVLISKIGN
FT                   MPVQKSDGEILFNIDYETLKNDEIMDFDLPIENIRKNMYVKLFFVDDSNSKLYRIVSPA
FT                   KEKLYFK"
FT   gene            616437..617615
FT                   /locus_tag="CLJU_c05680"
FT   CDS_pept        616437..617615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN26"
FT                   /protein_id="ADK13650.1"
FT                   /translation="MKLNFRKKDDYICPYCFSKHALNEVNFICRNDPDLCENARNLTPI
FT                   KPKNVEDKNEMPDYVFCNECGQKTNIKVCPTCNQELPYSIGEYDNLIFAVIGAKEAGKS
FT                   HYIAVLIQKIMNEIASAFNYSLSAVDDATMNRYRNDFYNPIFKRNEIIGVTHSAKTDAS
FT                   VKQPLIYNLVFKDNGIFGSFLKSKKISNAVTIAFFDTAGEDLDSENTMKTVNKYIYNSS
FT                   GIIFLLDPLQLEEVRRKLPKNIKLPQQNTEIEDLLSRTANLIRKANDIGMDKLIDIPVA
FT                   VAFSKIDAVESLIDPSSCINYPSSHVSKGYFDLADFEDVNGTMESLVRNWGGENFANQL
FT                   SSNFKEYAYFGLTALGCNPESNRIAKLRPHRVEDPFLWLLYKYKFIKGEKRK"
FT   gene            617622..620228
FT                   /locus_tag="CLJU_c05690"
FT   CDS_pept        617622..620228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13651"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN27"
FT                   /protein_id="ADK13651.1"
FT                   /translation="MAVQQLFYTSCKKGLSSGMGFQTYSMSKGITDKERMEIESHCIYI
FT                   PPSNLPTQPTKEEIDRLFPISFSYFRLESGKYCISQIKYVGKDYSERYGNYFCHVLISN
FT                   NAWEFYPIELYESPVFRDCLSEEEKNAVEIDYLPEITEIPLGNVVDFDEISNFLKGSGG
FT                   DRGKKFTSLLERVVTYNSSKKRIILADVKENIPFWIGSVCMSLPKKLALQFSFTTYSYN
FT                   PDNTDYILCGISKNGSKFNFADNRKMYEYSAMNFSEDCPRSKSSFSKRAEVGYTVSKEV
FT                   FLPFLKFLDQFEYNKLDEEVDNCVTLYNIVKKGLEKCSIEDVKKALSFAIKYKSEEAYE
FT                   ELFHQIDARLEKISTQVDVQLCYMITTFLLKVSRDIGDDNYIVKAYKFFFDSLDYIAVY
FT                   SKDTDIYEMLNLRKRMAQDEMDNMGQFLEASLSPDRIKSIQKDIKENPVYYSISTISDI
FT                   IYSGYTFKDKNVTLLLNNCIKFLIASEDNTLYVLNYFKNDCECISKIIIRIYCINYYLG
FT                   RNETILDLLAKFVVDEGNRDGNWKKKVYSNMYNLPNSYNFLFSLYVFQLKKNIENQDFF
FT                   TNYCSEIFNSFEEYRSEKFSDAFKLYLEFYHGDDAALESYKGILNYIIDNLNMHIVDKK
FT                   VMEKFITDVEEKLSIDNAVEENGLIETILKLKRKYNITTICNISELLYIGKRIENPDMD
FT                   YNEKLLKKVKYNFSHMSEEKYREYLSWLLPNILVQSSGSAGHIKVKKTFFCSKYEDTFY
FT                   DVYVNGIEDILFTKKYKNLMGSRYNDRYKIFLDFFITLYKNKKNLSEERENIIYNRVIE
FT                   ILIKISQKKLKEYTAYIVDKTSKLKNQVYIREKWLEIEKEAEEKGKKKGILDLFKK"
FT   gene            620250..621704
FT                   /locus_tag="CLJU_c05700"
FT   CDS_pept        620250..621704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05700"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13652"
FT                   /db_xref="GOA:D8GN28"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN28"
FT                   /protein_id="ADK13652.1"
FT                   /translation="MKTRAKMVLIAVFVYVLQLGFIPSQKVYASTSSPNVDVVFVLDSS
FT                   GSMKQSDPEEIRTEAIKMFLDMGQVQGNKAGLVAYSDTIIKEHNLDAINSESDKERIEE
FT                   MASNIPLGQKTDIGRGLLEGAKVLDSGHDSNNRPLIILLSDGKNDSQRSASESLKDLNS
FT                   AISTCKSKGYPVYTIGLNYDGTVDKAQLTQIASETKGKNYITNKASDLTDILKDIYGDS
FT                   ANVKVQDQGNIVADGTFQDFKINVPGSNVLEANISMVTDNPLELKLINPSGKEIQIPSS
FT                   DVVFTKSKKYSVLKIVKPASGQWNLKVKGVSGSNIKISYVFNYKNQGNQSSVDKNIQGD
FT                   KSVFKSPKVIGAAAAAALIIIGLAAFVLMKKRRVQGFGRLEIHIKDESTSEVLSPQFRN
FT                   LDNYSGSFTLFEVLGLKEEYAETENIKFIFKEDDSIELVNKSGCVLQKSGRKLEEGSKL
FT                   LLYNRDKVTVFLNKVTKSITLEFHSK"
FT   gene            621724..625131
FT                   /locus_tag="CLJU_c05710"
FT   CDS_pept        621724..625131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13653"
FT                   /db_xref="InterPro:IPR025904"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN29"
FT                   /protein_id="ADK13653.1"
FT                   /translation="MNTRVREHLEDLEVSKGGGIISDKIRIETIPNPVLVIGLGGTGID
FT                   AMLRLKYQINKRFVLEQDSISNTRKDKPKKVEFLGFETNQGEKNKRYPMNGGVGLDPQS
FT                   ELVMLSNAEVRSILNDRKILDDCIKEWLAPELSSESGTDGAGGVRQVGRLLLFTKINEI
FT                   VDCLEKKIRLLQEDTEEILHVFVLSGLSGGTGSGTFIDIAYIVRGIMNNIYGAKGDDKV
FT                   NIMSYLFMPDVNLSKTSDNQSAQSYIIKNGFAALKELDYLMGIGDRHERFTQKYRNRIT
FT                   VDSPMPPFNLCHLISATNVDGRPMSNAYDYCMNVTAENIVNFMSNEVRESGGVFAIQDY
FT                   ISNLKQNTDNMAKPYMANYKYVMIGASSAVLPLEEITTYMAYKLFEKIQYMFENMPKEQ
FT                   EIDQFIRKARLDEDAVIDRFEEHLQNRKPLTGYKNREKFNYDNVIKKQSVNIDEEMKEY
FT                   LRDCTNEYDKVKTQYPGEILKLVKDMVNQIFKDPKKGPFYASRVLFSDGFCVVRTLEAQ
FT                   VTSLNERLMNISTEIKSAEELAEDKFVEARKALLFTKEGKKNDYIEAKSEEYLLKSEEQ
FT                   RIMRMADFYSSVIEELSKLNNSIYRVYTEILNELNRIFKEDGDVLVKGEEIEGALGRTY
FT                   SWTVVKVPDLVDYIEKVVNKEEADDIVRRFSERLLEESEKWIDEMHIDVVGSISSFVSE
FT                   EYGDVITKSMEDFLALEYGEDKSIINIVKDEIAPKLDRDAVPIFHLSNTEALNFPAWSM
FT                   VSVPRNAKKILEGIKEYKKNSNKGNAINIKESMVTNRIFWLNTKNGVPLYSYAPIKHYE
FT                   EIYEKTMFERDGIGRHLYQNGEKNWVYLPSPIPEEAWGTTYVNDRVKEYNEKVRNLFDR
FT                   ALELGCIVDTQKGSNERYKCIITEEFDIDDFMKNYNMDMKGDKINIGEVKRAIGDMNKL
FT                   IQDKLTPVQDSDSQKYYIYESSSSEKAKIDLIRTPELTELVKKEVEKYEKIIDKKKELE
FT                   NIISDLSKAEANVDSFLRALYTETIIKKGLLYVYNGSEDSKVDIEPFINVLKQKEYQYK
FT                   AIFDKYETLDKGEKTIVDKTSDRKLEQLSTGDGVEILKLKVSSIIEEVKSSVGELDTRK
FT                   YQMVEGDKLYAFYTDILSRLQEVQKLLA"
FT   gene            625164..627509
FT                   /locus_tag="CLJU_c05720"
FT   CDS_pept        625164..627509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13654"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN30"
FT                   /protein_id="ADK13654.1"
FT                   /translation="MEEVLKNFVEKYDLKVEKTIYDGDTKRNVNNPILFLFIGDSTEDA
FT                   YEYIRNSIDKKWDNGRGAVFINVSTKSVKDTDNSFNIQLHEDFKNKKTLRKDIRDRFYS
FT                   DKEDLKNLNRKITEARDKLLSEGDMFNSFDSINISVITTSKDPLNVILTEVTVLLKKRM
FT                   LEVFKLSSADLYVLIKSQNLGDEVYEGAVTVGFFREVEYFQKDSFRFKEDIAVYGDETQ
FT                   LNVTWEGPLFYLTYVLEEKNEKGIIPKGSMDNNYEIISYINLIKNREASSNAYSDTENQ
FT                   YYDNNIFKSNISYDNSMNRYISAGLSQVKRPNSAIAISVLGAFYERMLKEMNTLSKKQQ
FT                   EFINEILKIDEASIELQVEEILPEGVTIEDMQGIMTDNLKQVEKKISSFNLREIEEKLY
FT                   DDRCEKFFFENFQKPSEESVKNCDLENNMRTLIRKNILEDNKLNLYCAFNWTSEEGETV
FT                   NYIRNRRDSILKFVSKLNDEIKDIYETRFAPSFGIKSFFSKGAQVKEAQEKIFLDIYGR
FT                   KLEILKLNISKKILDIYEDILLKVHSEISSYINRVKDIGQTIKSCENKVIEKQDKYTAQ
FT                   NVRAYYKNVVNDILDKLEKNFGKAFYLEDKYLGNTVENLKESDEKFLGKIIYFCTKYIL
FT                   SEDQFKKSFEEEFNERANVNVPNLETKVLSKEELYRKLYDMLDKNSALKIYIMNYDVKP
FT                   YMEKYFFGDYSSDFIKYAFDFDRKTRNYKIGYIDEIKSSGIEKLNLMGGFGAKDIIYVR
FT                   NSMEFYNYCMENGYLIHGVDEKLLPEIN"
FT   gene            628056..629315
FT                   /locus_tag="CLJU_c05730"
FT   CDS_pept        628056..629315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13655"
FT                   /db_xref="GOA:D8GN31"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN31"
FT                   /protein_id="ADK13655.1"
FT                   /translation="MVEKRINLTMTVMSLIGGIIGFIAGEIFINAYKYKMSGSLLMGFY
FT                   FGIIALCIGTFCLVGEMINPRLNGVGWKNNYLKTSFKFLIPCTFIAIFVFGMLFQFIYE
FT                   SSGLKFQKVNDIVFVIDTSGSMANTDPQNERFSSVLNLMDNMNTQNRVSIYKFDDTSKR
FT                   IIPMTEVSESLKKNAEEELKQYEIPAGNTNMGEAIDSAYNEINSTKRPGRKAAVILLSD
FT                   GEDNFGLNKKFDETLKPFKDSNISIYTIGMSNENNFTTLKKIAKDTHGEYYNVKNASDL
FT                   KGTFSKIYYATQQRLLVDRRDGLTESSTLYMILRVLLITIISGLITMSISFVFDNKNLL
FT                   KRFLIGGIAAGFLGGLIMEVGFLNSPDHGSLYRALLVIMIALIFTLIPVIVDIKDYSKS
FT                   SYLRGNQRTSFDKTKGNTFR"
FT   gene            629343..629990
FT                   /locus_tag="CLJU_c05740"
FT   CDS_pept        629343..629990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13656"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN32"
FT                   /protein_id="ADK13656.1"
FT                   /translation="MKIIEFEDGSSEICEISCEVEKDRLYIRWKWPKNTDIVYVMKTDN
FT                   LDDLSLNDAELKSAKLYTMEEYKEFNGYCESIKEINQYRYYVFPAVESDDDILLVKQNN
FT                   GKNQIVVSTGKPDIYYDIKEVKSLKGLFSKDKKLQITIKSEIPLHKDVLCYVKKRDSYP
FT                   VNNKDGISFDFICDIHVGINEMPEITVKKDEYVKVFIKDIDKYGGSYRLKQI"
FT   gene            630539..631051
FT                   /locus_tag="CLJU_c05750"
FT   CDS_pept        630539..631051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13657"
FT                   /db_xref="GOA:D8GN33"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN33"
FT                   /protein_id="ADK13657.1"
FT                   /translation="MYKTINNLLSFFTIIVCIGFGMPFMGLLKGRRGTDSLFHYNKTMY
FT                   FRVSLIGIVIAILFIVICIVLKKKIRAMECKIKYLPSYTAPVVKYTLFKSKYSVVFSID
FT                   GKKYRHKFEAIGVKKVYDFKQGSYVRYRIYKDEIIPEKFYLAIPKYEKGIKNKWTYLSK
FT                   NQYRKQC"
FT   gene            631357..631707
FT                   /locus_tag="CLJU_c05760"
FT   CDS_pept        631357..631707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13658"
FT                   /db_xref="GOA:D8GN34"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN34"
FT                   /protein_id="ADK13658.1"
FT                   /translation="MEYNIEFWNVLDSLVQESEVVIDRPKGTVHPKYPDFLYEIDYGYL
FT                   RGTSSMDGSGIDIWKGTDKEQKIDAIMCTIDLIKKDSEIKILIGCTEEEKEKIYHIHND
FT                   SANMKGVLIRRF"
FT   gene            632148..632522
FT                   /locus_tag="CLJU_c05770"
FT   CDS_pept        632148..632522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13659"
FT                   /db_xref="GOA:D8GN35"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN35"
FT                   /protein_id="ADK13659.1"
FT                   /translation="MRKKKKLNIFALIVIIIGGGMALYNNYFHNIDSNRYLSSINEDKS
FT                   IDYDGTHKSDKNSESFDFKKFDGKWSLMQFTSNKGNINFTTPNDGKYSIRIIGANASGN
FT                   FAINVSASNNIDISHKDFFD"
FT   gene            632547..633821
FT                   /locus_tag="CLJU_c05780"
FT   CDS_pept        632547..633821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13660"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN36"
FT                   /protein_id="ADK13660.1"
FT                   /translation="MGIFKFFRSGNSEPRNTYEKATYERGPFMITCPFCFKKFKSDHVV
FT                   FRASHSEKGDPEYEKVEDELLNRYYKKIGKGTLGPMNPVVKAQALPERNKTRVDKVLVE
FT                   IKDKYDASTDERLCPYCHNDLPITSGRGPSKIISVIGASQVGKSVYMTTLLYVLEKYTC
FT                   ERIGASLIAGNSGYNDEIRENQERIFEKNLMLDPTPKQHVEPLIENLKFKEDKIPPLTL
FT                   IFYDIPGEGMTDKAYMENHAEHIKNSDGIIFLVDPLQMRTLRKKLSIVNREKGDFTEKY
FT                   QEPKDIIVYLFENFISKESKEKTHIPTAVVVTKSDMLKNLKDEEYIGENSNIFKNYNHE
FT                   GFFNLNEFENIDGEVRKFLLKADAPFKGAVDACFKTAGYFAVSSLGSNSNHLEIDRSSS
FT                   INPIRVDEPFLWLLYKMNYLDGGRE"
FT   gene            633824..634879
FT                   /locus_tag="CLJU_c05790"
FT   CDS_pept        633824..634879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13661"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN37"
FT                   /protein_id="ADK13661.1"
FT                   /translation="MIEQQYYTREKRGIFSSTPGYDTIAKSSGLEDEFIKDTIHSLCSY
FT                   TAPAFLAGEKDLSKYPKALFYANTGDGKIIIGQSVFAGEDYTLKRNRYFTHCYVISENE
FT                   RKLYIENPEKIIYASGFVENYDMEKGNSIESLREVKVDRVCDVFNSIEDLFLAASIDKN
FT                   TFINMVKACFDAAAFNKKIYIVVPYNENMDKVIKGILKYLYRALPFAVRRKVGFTTYVK
FT                   QPEIKESINIEFLLEGSIKRLTQDVKAGYVFDIADNNFYLEGIDERHHIFIDFVMNNIE
FT                   NEQALNEFFIQADNVCSREKFTIDMYDNILCPSSKNEEVKESTMCMEENEQVEHKHNLV
FT                   YFLKKLFLNKD"
FT   gene            634893..635675
FT                   /locus_tag="CLJU_c05800"
FT   CDS_pept        634893..635675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13662"
FT                   /db_xref="GOA:D8GN38"
FT                   /db_xref="InterPro:IPR025582"
FT                   /db_xref="InterPro:IPR026870"
FT                   /db_xref="InterPro:IPR038434"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN38"
FT                   /protein_id="ADK13662.1"
FT                   /translation="MPKCRECGTELDENDKFCVYCGAKQEKEREREEDKNDDTKYYGKE
FT                   NNDYKKEDKKHEDSLKNSDTFDFSSSHETKKTDRKDKDEFTREIDDTQLKDKRPFNFKM
FT                   IGITILTIIVFVVAFKMISSLINKGPGKNVSNVESKQNVSSDLNNNDENDSDNNSGEYV
FT                   IPYSNTRALTSNDLKGMSKKQLALARNEIFARHGYTFPTEPYKSYFASKSWYKPNPNYT
FT                   NDGKELSALERHNVKVILIAEGRGKYVSPGYDADYYKK"
FT   gene            635750..635959
FT                   /locus_tag="CLJU_c05810"
FT   CDS_pept        635750..635959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13663"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN39"
FT                   /protein_id="ADK13663.1"
FT                   /translation="MIYLFYNLILNFRYLIFKFKREISEELMRSRHCNEEYIYGIATWK
FT                   QGRYKYTMNQSQETCLKFTDSLRG"
FT   gene            636052..637002
FT                   /locus_tag="CLJU_c05820"
FT   CDS_pept        636052..637002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05820"
FT                   /product="predicted ABC-type Fe3+ transport system
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05820"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13664"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN40"
FT                   /protein_id="ADK13664.1"
FT                   /translation="MFKSSKKFVLLIMITITVFLAGCGASNTSNSTTDSSSKSESTKNT
FT                   AYPLKLKDSTNTEITIQSEPKKVVSLSPNVTETIYALNKQNILVGRTDFCTYPTQASKI
FT                   PAVGTITDPSVEKIVELKPDVVIASNLTKPDILKKLQQLNIKVLTISKNESFENTYNNI
FT                   ENIGKIVNANKKAYSIVSNMKEKVKVVQEKVRGKSTPTVYYVVSYGTSGDFTAGKDTFV
FT                   GKMIEMAGGKNAASDVTGWNYSLEKLVEKNPDILICSNKFNSKNGIKSTKGYKDLDAVK
FT                   KNKLFEIDEDIISRQGPRLADGLEALAKIIHPEAF"
FT   gene            637028..638077
FT                   /locus_tag="CLJU_c05830"
FT   CDS_pept        637028..638077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05830"
FT                   /product="predicted ABC-type Fe3+-siderophore transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05830"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13665"
FT                   /db_xref="GOA:D8GN41"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN41"
FT                   /protein_id="ADK13665.1"
FT                   /translation="MKFSRKKHFKLFFCICIVILFFSAVISAMLGSADISFKETLYVIL
FT                   SKIPIVGGLVSTASMSQNHMLIILQIRLPRIITSALVGMGLSVVGASFQAIFKNPMADP
FT                   YVLGVSSGAALGAAIGFMLQLDTLLLGSTAITMMAFVGSIATTVLVYNIARVKNKIPPT
FT                   TLLLAGVSVSFLLSSIISIIMVFNRQQVEKIVFWTMGSVSAATYNQILMLMPFIFLGVI
FT                   IILLFSRDLNIMLTGDDTAKSLGIEVENVKKIVLAVSSIIVAACVSISGVIGFVGLIIP
FT                   HAVRMVFGPDHRVLLPFSLIIGAVFMIICDTVARTVAAPSEIPVGAVTALFGSPYFIYL
FT                   LIKSKKRVI"
FT   gene            638077..638907
FT                   /locus_tag="CLJU_c05840"
FT   CDS_pept        638077..638907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05840"
FT                   /product="predicted ABC-type Fe3+ transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05840"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13666"
FT                   /db_xref="GOA:D8GN42"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN42"
FT                   /protein_id="ADK13666.1"
FT                   /translation="MNNSNLCAIEVKNLNYSFDEVNILHDINIDFKKNKFYSIIGPNGS
FT                   GKTTLLKNIAKTLKPYKSTVFIKDKDILDLKSKALARKLAVVPQNSNLDMDFSVQDIVL
FT                   MGRAPYFSKLQSESESDYNIAKQAMEVTNTWRFRDKFINQLSGGEKQRVLIARALTQDT
FT                   DIILLDEPISNLDIYHQIEILDNVKSLSKKITVIMVLHDLNFAAQYSDHVILVNSGRVV
FT                   MQGTPREVLTEKNIKKVYKINVCIIKNPVTGKPYIIPIGQERDCPNMKNGNLDD"
FT   gene            complement(638896..639519)
FT                   /locus_tag="CLJU_c05850"
FT   CDS_pept        complement(638896..639519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05850"
FT                   /product="sporulation protein YtaF related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05850"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13667"
FT                   /db_xref="GOA:D8GN43"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR014205"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN43"
FT                   /protein_id="ADK13667.1"
FT                   /translation="MHLLPSFLFALSANIDSFTVGISYGIKKMKISPLSTILIALIATA
FT                   GTFLSMVLGKFLIKFMSENIANIIGSGFLILMGIWFIIDAVIKNHCNENKKLCNAENNL
FT                   LPYKNLLDNPEIADADNSGYIDVKESIFLAFALTINNVGVGIGASITGINILLATIFTF
FT                   ILSTTGLVAGCVIGSSCLSKFFGKYAPFVSGISIIILGIYELII"
FT   gene            639778..641298
FT                   /locus_tag="CLJU_c05860"
FT   CDS_pept        639778..641298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05860"
FT                   /product="putative surface-layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05860"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13668"
FT                   /db_xref="InterPro:IPR011081"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN44"
FT                   /protein_id="ADK13668.1"
FT                   /translation="MIKNLKNLLMFASIVVMYQLNPCNIVLASDVSTNTTKPQTQVVST
FT                   QDNSKSQTLQDTSKILASQEESKYISESNSSSSVSESSGNLLPANADNVDNVPVDKSWI
FT                   IHFNQPIDLSSAKENVKIINKKTNAEVPINISLSNYDSYMTVSTVSAYDPESYYILKID
FT                   NNLMGRYNKVLKTALTMNFKTGAKIENIDDISVSINQGDSYKLPDEVTAVMSDGGKVQV
FT                   GVEWNEKVNTLASPGKYVYQGQVKGYSKEVDLSLTINPSTKDVDSIASTSMWIWELQNQ
FT                   VDAYGGIDNLIAKLKSMGINNVCIKYNEGSSPSGGGTNFRDDFLKYVGYFKEAGFKVGT
FT                   WGYNHFDDVQGEGNLIIEALNNSDYYVFDAEDAVENKAEQTEEICELIRSQCPNAIIGY
FT                   TSFPIASYHQDIAYSVFNKYCDFSAPQCYWGEMQWSVNRCLDQMAADYKAYGLDKPIYP
FT                   IIQTYSINYEDYTAYSKYGYKATGLWSLDDIGQTFVQYINDMGSKFNN"
FT   gene            642004..642954
FT                   /locus_tag="CLJU_c05870"
FT   CDS_pept        642004..642954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05870"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13669"
FT                   /db_xref="InterPro:IPR015045"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN45"
FT                   /protein_id="ADK13669.1"
FT                   /translation="MLVTCDKLLKEYDNKKAKKIAKRVKFIGIFNKDVYNITAPFLSNG
FT                   RTVIAGRVESKRSNDSMVLFFEKYEDAWCHIIESPIMNLEDPFFTKIGNEMVVGGVEVF
FT                   NDINDPNNLIWRTMIYKGKDIFHLKLFFVGPEGMKDLRITELKDGTIGVLTRPQGAKGG
FT                   RGKIGFAKIKRLNDLSMGVIEDAPILNDFFNDDEWGGINSIYPIDQNNIGLLGHIAKVD
FT                   EKGMKHYYSMTFVLDINSMAYKDVQIIASRNDFLPGPSKNETLYDVVFSGGLTFKGKKA
FT                   ILYAGISDIEAQTLEIDNPFYDYMNKNPELYFDNL"
FT   gene            642963..644015
FT                   /locus_tag="CLJU_c05880"
FT   CDS_pept        642963..644015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05880"
FT                   /product="putative glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05880"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13670"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN46"
FT                   /protein_id="ADK13670.1"
FT                   /translation="MDIRRYKGNPIITCSDITPSSKDFQVIGVFNPGAAEYNGEVVLAL
FT                   RIAERVEQETEDYMRVPLLDENNKLKFVTINKKDENYDFSDSRVIKKVGSNVDFDYLTS
FT                   MSHIRIARSCDGVNFKIDEVPFIFPENKYESFGVEDPRITKIDDNYYMTYSAVSKYGIV
FT                   VELAVTNDFKSYKKLGNIFNTENKDAVIFPEKIGEKYFALNRPVSKSTGNPVIWISESD
FT                   NLINWGNHKILACTRESSWDSSKVGAGIPPIKTDEGWLELYHGVDDMEHYSMGALLLDT
FT                   NCPEKVIGRSKEPILRPEENYEKSGFFSDVIFPCGSVLRKDELYIYYGICDNSIGLAIV
FT                   KIKDILNTLD"
FT   gene            644286..645077
FT                   /locus_tag="CLJU_c05890"
FT   CDS_pept        644286..645077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05890"
FT                   /product="putative ion transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05890"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13671"
FT                   /db_xref="GOA:D8GN47"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN47"
FT                   /protein_id="ADK13671.1"
FT                   /translation="MIHKISKKSLKLIYNVFIGILSLSIIIILIFEDAGNLTARDLDTV
FT                   HKIDNIIWMIFVVDYFTRLIISDNKKTFIKKNIIDLIAIIPFNMIFQSLRIVESTKLFK
FT                   TLKLINFLRSLRALAFFFKFQKCLNEFIKTNKFNYILQLTIVTILMGGVGMHFAEGRTL
FT                   GDSIWLSFVTTTTVGYGDISPSTTAGRIIASILMLTGIGFIGTLTSTISAYFIDRKAKK
FT                   VRKNFKYKVLDTIKEELDDFDSLSNEDINNICKTLIGLKNK"
FT   gene            645577..648912
FT                   /locus_tag="CLJU_c05900"
FT   CDS_pept        645577..648912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05900"
FT                   /product="predicted cell wall binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05900"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13672"
FT                   /db_xref="InterPro:IPR005102"
FT                   /db_xref="InterPro:IPR007253"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN48"
FT                   /protein_id="ADK13672.1"
FT                   /translation="MNKIKNLIFGMLCILVIMWIRSSSLVYAADVSVTLRFNSDGILTQ
FT                   PQQVMISNSGDFFNNETGIQNRGNSNDGKWINYTLVSGHNYMEVDNWKLADGNWISDNN
FT                   WDHSSNLRRVYIKFKDSSGKESGGVSQTIDSTGTEIIDYTKINGGDMYTNSENVTVNFK
FT                   GDSIYGYNIDGIENVKCGPVSLSTDGGQTWGQQENYSASDWSTPCTLPIGDGIKYINIY
FT                   GSISTVSAGDLIIATTISIILDKTPPSIKNVSVTPQAWTNQAIVTANFSDATSGVAKKL
FT                   YAPGMKDISYFKTAGAAVQTINGNSFSVNANGEYSIYAEDGAGNGTVQVVDVNGIGMAM
FT                   VKFLGGNGSENVNVNNLVINSYGSSGYEFKLPNTVKDNIVKAVNDTKASEAVISVESKS
FT                   IDVTFPEISSITDADLENGITVLVTVGANNNISPGQYIAILKMTPGSTDSNFDLTFSNI
FT                   NPTVASFDKYTSSSNYKDIPVTMTLKGNTLSSIYNGISKLTSGTDYTVSGDTVTISKAY
FT                   LAKQTAGTTVLTFNFSAGNSQTLSITVEDTTPVETKGTGTVVDETGKAVKTIDTEITTE
FT                   ADKTRMLSVKAQDILLVKEPDGTESPISDLSKIGFSSEGNAGVSISQDGTIKITNLKDS
FT                   TDSKIDVTFDMGNGQKIIIGTIDVKVSQNGDVSLASSLIDPYGIITDVSTGKVISGANV
FT                   TLYYADTARNKASGKTTGTAVKLPVIAGFKPADNSNPQTSDSNGAYGFMVYPDTDYYIE
FT                   ADKSGYDKYTSTTISVDKTIVKYSFRMNAASSSSSGGSGGSGGGTPSPAKEDIERLWGQ
FT                   SRIDTSLAIAKAAYKDKVSKVIIASGDNYPDALSGSILSYKFKGPVVLVRNNEDDEDKV
FT                   LQYMKSNMNQDGTVYILGGSSSVEDGMEEKIVNAGFKNINRLKGSDRYETAAKIVDEAG
FT                   VKEGTPVIIASGENYADALSISSAAAIKQYPVLMVKKDEIPDAIKNEISTIKPTKVFIM
FT                   GMEGAVSEKVQDDISKLAKIDSKDIVRIGGQNRFDTSLKAAQYFNSQGNKVCIASGNDF
FT                   ADALSGSSYAANMGEPIILVNNSLTDDEKSFLQGMKLKGASILGGIGAVSSEIEDEVSK
FT                   LISK"
FT   gene            complement(648993..650375)
FT                   /locus_tag="CLJU_c05910"
FT   CDS_pept        complement(648993..650375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05910"
FT                   /product="predicted FAD/FMN-containing dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05910"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13673"
FT                   /db_xref="GOA:D8GN49"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN49"
FT                   /protein_id="ADK13673.1"
FT                   /translation="MNSQIVENLRKITGADWVTDDLSQMQSYLQDETEALIRVESSKDC
FT                   VVVKPSSPEEISKILTYANEIMIPVIARGGGTGVCGAAVPIKPSIILSLERLNKIVEFD
FT                   KKNLMITVESGVTLANLLEELNKQDKLFFPIHPGDEGAQIGGMVAVNAGGTKAVKHGIM
FT                   RNHVKALEVVLPTGEIATLGGKLIKNNMGYDLLQMMIGSEGTLGVITKVTLKLYAKNKY
FT                   TGTLIVSFDSRRDACDCVPKILQEGITPLAIEYMDRPISEKAAEHLGTKWPATKGSVDL
FT                   MLMLDAKTEDELYDTSEQIVGICEEHNAVDSIIAETSKDQKEILAIRSNAYTPFKDHVA
FT                   DGLDMAVPPSAVPDFFDDISALSEKYHTEIPAVGHIGDGNIHNFILSDNGKLPSYYEEF
FT                   KQEMYKIALKYGGTITAEHGTGKTRKEYMPLQFTKREIQIMEGIKKAFDPNGILNPGTI
FT                   VD"
FT   gene            complement(650406..651503)
FT                   /gene="mdh"
FT                   /locus_tag="CLJU_c05920"
FT   CDS_pept        complement(650406..651503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="CLJU_c05920"
FT                   /product="malate dehydrogenase"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05920"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13674"
FT                   /db_xref="GOA:D8GN50"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN50"
FT                   /protein_id="ADK13674.1"
FT                   /translation="MSYTKVKYEDIKKLCNLVFEKFGFNREDSETITSVLLLSDLYGIE
FT                   SHGIQRLVKYYSEIKSGLININSKIKIVKETPVSATIDGMGGMGQLIGKKAMNLAIKKA
FT                   KTSGMGMVVVRNSNHYGIAGYYAKMAEEEGLLGISMTNSPAVMVPTFGKDAMLGTNPIA
FT                   ISFPAKPYPFLMDMATSVVTRGKIEVYNKRHEPLPLGLALNSDGEDTTDPLDVLLNVRK
FT                   NSGGGLLPLGGSKESTGGHKGYGFALAVEMFTAILSGGFTANKVSLDRENGSGTCHYFF
FT                   AVDYGIFGDKQSIEENFSSYLNELRNSKKAKGATRIYTHGEKEVESYKDKMKNGIPVND
FT                   TTLKEIYDICDYFSIKASDYVTKVV"
FT   gene            651639..652220
FT                   /locus_tag="CLJU_c05930"
FT   CDS_pept        651639..652220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05930"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13675"
FT                   /db_xref="GOA:D8GN51"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="InterPro:IPR016747"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN51"
FT                   /protein_id="ADK13675.1"
FT                   /translation="MTSIKKIILIILCILWMGFIFYNSSNNGDISNQRSYNILDNLRKE
FT                   YRQIKENKIVSKDVNSNVQIKTQKDQAKSAYVNPTDNREEKLNLIIRKNAHAFEYFILA
FT                   ILVSGVLFEFNVKGAKALIYIMFVCLFYAVMDEFHQAFVPGRSSLVSDVLIDFLGSLIG
FT                   IFIFYTIYYLVHKIKSRQKGSLISFKQVFF"
FT   gene            complement(652197..652739)
FT                   /locus_tag="CLJU_c05940"
FT   CDS_pept        complement(652197..652739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05940"
FT                   /product="putative polyprotein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05940"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13676"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN52"
FT                   /protein_id="ADK13676.1"
FT                   /translation="MIKIGNNTIEIKKGYITQEHSDAIVNPANSKLQHGGGAALAIVSA
FT                   GGFEIQNDSNKLISIIGNVPVGKAVITYGHKLPAKFVIHTVGPVMGEGNENEKLKKAVT
FT                   SVLNLAECYNLHSISMPAISSGIFGFPKDKCAEILLETTIKFFTNKDTSLNKVVMCNFD
FT                   EKTYNIFLEKSKKYLLK"
FT   gene            653055..653849
FT                   /locus_tag="CLJU_c05950"
FT   CDS_pept        653055..653849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05950"
FT                   /product="hypothetical protein"
FT                   /note="similar to secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05950"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13677"
FT                   /db_xref="GOA:D8GN53"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN53"
FT                   /protein_id="ADK13677.1"
FT                   /translation="MKKIILVCLVVMGVFLGGCSYNKNSAPTKTITNSNEQNDKGSFIM
FT                   GGKIATNEDTQITSNISARVSEVSVDIGTKVTDGQVVIKLDTQDLQNQVDQAQNALNAA
FT                   NSNLTSAQSSTYNSTSLTGSSTSSNISTYQSQVNQAQAALKSAQNSLNNATITSPIAGT
FT                   VSAKNVNVGDMAYPGKPLISIVNSDKLYVNAYAPSYILNKINVGQNVIIRVPDLPDQDF
FT                   QGKVTVINSKVEPQSSDILVQVSINGKNPSLKPGMFAEIGLE"
FT   gene            653869..654540
FT                   /locus_tag="CLJU_c05960"
FT   CDS_pept        653869..654540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05960"
FT                   /product="hypothetical protein"
FT                   /note="similar to secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05960"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13678"
FT                   /db_xref="GOA:D8GN54"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN54"
FT                   /protein_id="ADK13678.1"
FT                   /translation="MVNKIVSIIKKYKIAAIGILVGIAVILCGIISYFWYENTYYISTN
FT                   DAVVGADVVNVNTQIQGKLLEFDINEGDEVNKDEILARQEVTNTPDSSIDSSLVRAPIS
FT                   GIIVKKQSTQGEFKLAGQTIATVADEDNVYVTANIDEKEIQNVKVGQAVTVKLDEFNGK
FT                   KFNGKVKSIGLVSQNGLNQSSKDKNGEFKKVNQKVPVKIQFNKTKGLVLGTNASVKIRV
FT                   K"
FT   gene            complement(654700..655854)
FT                   /locus_tag="CLJU_c05970"
FT   CDS_pept        complement(654700..655854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05970"
FT                   /product="hypothetical protein"
FT                   /note="similar to a metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05970"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13679"
FT                   /db_xref="GOA:D8GN55"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR015914"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN55"
FT                   /protein_id="ADK13679.1"
FT                   /translation="MKKKYLSMIIAALIAATSTIAPIYSVHAAYDNTTINTNLNSTVKP
FT                   DHITLTWTKDPKTTQTITWRTSTNVTKGLVQYKNLTTGETKTFNATKQDFSTSSTDINT
FT                   GCMNLFSVTLENLTPGTKYSYMVGDGQNWSTENKFKTEASKEDDVKFIVFGDSQSGNAD
FT                   VPNYAPWNKTVQNAYSKNKDADFMINVGDLVEKGQDYRHWNNWFNAAKGVIDNLPEMPV
FT                   QGNHETYNAVGWDSTKPKYFTNQFKVPMNGPDGFKGQVYSYDYGNVHFVMLDSQEDEES
FT                   SNNDELAAIGADPRLVIYGTPIAFGSNQAEIIKGKAYVNPNYITMYLGGSYDSASMKLT
FT                   IDKQTYSFNAKDLSPSKNVSLDALSKAGFNCSYNTQFNMIMIDK"
FT   gene            656010..656540
FT                   /locus_tag="CLJU_c05980"
FT   CDS_pept        656010..656540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c05980"
FT                   /product="signal peptidase"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05980"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13680"
FT                   /db_xref="GOA:D8GN56"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN56"
FT                   /protein_id="ADK13680.1"
FT                   /translation="MEHKGVLKNIGGYVFYIILAVVFALTFRTYVFARTTVIGPSMQPT
FT                   FHDKDSVFLEKVSTETGHISRGEIVTFYSKDENNDDYIKRVIGIAGDKVEIKDGKVYLN
FT                   GQLLSEDYLPKGTITEPNSLITQYVIPKGYVFVLGDNRGNSTDSRILGPINLKDIRGHV
FT                   ILRVYPFNNIRAF"
FT   gene            656688..657488
FT                   /gene="proB"
FT                   /locus_tag="CLJU_c05990"
FT   CDS_pept        656688..657488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="CLJU_c05990"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c05990"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13681"
FT                   /db_xref="GOA:D8GN57"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN57"
FT                   /protein_id="ADK13681.1"
FT                   /translation="MNIREKYLKDAKKVVVKVGTSTLITEDGSLDLYRIEEIVRQICYL
FT                   QNQGKSVVLVTSGAIGVGFLKLGLKTKPKDICEKQAAAAIGQGILLNIYEKMFSEHGKI
FT                   VAQILLTKNDLDIVDNYTHAQNTFTALLKRGVIPIVNENDAVAVEEIKFGDNDTLSALI
FT                   AKTIHADLLILLSDIDGLYSSDPQSDKDAKLISCVPKITKEIEDCSKGSHSNVGTGGMY
FT                   TKIKAAKIAVSSGISMIIANGSQDSVIEDIVSNKEIGTLFEAEK"
FT   gene            657505..658761
FT                   /gene="proA"
FT                   /locus_tag="CLJU_c06000"
FT   CDS_pept        657505..658761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="CLJU_c06000"
FT                   /product="gamma-glutamyl phosphate reductase"
FT                   /EC_number="1.2.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06000"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13682"
FT                   /db_xref="GOA:D8GN58"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN58"
FT                   /protein_id="ADK13682.1"
FT                   /translation="MDVGSYVVEKAKTASRAARILSNMGPNLKNKALDDMAEALQNNKE
FT                   LILQANKLDLDNAKKSGKGKAFIDRLELNQKRIDSMAGGLIKVASLPDPIGEVSKMWKR
FT                   PNGLRIGKVRVPLGTIGIIYEARPNVTVDAAALCLKSGNSVILRGGKEAINSNVAIYNT
FT                   INKAAVSAGLPEGAIEFIDITEREAVETLMKLNEYVDVLIPRGGRGLINSIVKNSTVPV
FT                   IQTGIGNCHVYVDESADLSMAENIVVNAKTQRPAVCNAMETLLVHKNAAENFLPHLGET
FT                   LKSLGVEIRGCSETKKLIPYAKLATEEDYDTEFLDLILAVKVVNSLDEAMDHIYKYGTK
FT                   HSEAIITNDYNASQRFLNEVDAAAVYVNASTRFTDGEQFGFGAEIGISTQKLHARGPMG
FT                   LNELTTSKYVVYGEGQIRK"
FT   gene            658952..659176
FT                   /locus_tag="CLJU_c06010"
FT   CDS_pept        658952..659176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13683"
FT                   /db_xref="GOA:D8GN59"
FT                   /db_xref="InterPro:IPR003173"
FT                   /db_xref="InterPro:IPR017154"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN59"
FT                   /protein_id="ADK13683.1"
FT                   /translation="MAGIKYEIKENKGVLSESPKGWKKELNLVSWNDRTAKYDIRDWSQ
FT                   EHDKMGKGVTLTVDELRELKNILNNMDLS"
FT   gene            659189..661204
FT                   /gene="pbp"
FT                   /locus_tag="CLJU_c06020"
FT   CDS_pept        659189..661204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbp"
FT                   /locus_tag="CLJU_c06020"
FT                   /product="predicted beta-lactam-inducible
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13684"
FT                   /db_xref="GOA:D8GN60"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR007887"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN60"
FT                   /protein_id="ADK13684.1"
FT                   /translation="MKCKFLWCIFIALSIFTVTACSSKSNMVKSSLNSYIDAWTKCNYD
FT                   LMYSKMDKDSKSRIAKKDFVSRYNNIYSGIEAKNINVKIDSSSDIKYEDGAAKVPIKVS
FT                   MDTAAGKLDFSNSISLKKEKDNDKTDWKVVWSPSNIFPDLKEGDKIRIDTVQGKRGTIY
FT                   DRNGNPIAEDGRAAQIGIVPETLEQNGEKSKENIAALLNISKEDINKKLSASYVKKDMF
FT                   VPIKIIQEDDSNLAVLQRISGVKVQYIKERVYPLKNAAAHLTGYVHKVTAEELKTNKNY
FT                   GPDDIIGKSGLEQIYESTLRAQNGYEIYIVDKNNKKKKTLIKRKVHNGKDIKLTIDSKI
FT                   QSLLYNELQQDAGMGVSMNPKTGEVLALVSTPSFDPNDFVMGMSSDTWKTLNEDKRRPL
FT                   YNRFQSNVVPGSVFKPITAAIGLKDGKLNPQVSKNISGLKWQKDSSWGKYYVTRVEDYG
FT                   EPSNLLNALVYSDNIYFAKTALDIGKDTMETELKNWGLGEGMPFEYGLSRSQLASKGNI
FT                   KTEVQLADSGYGQGEILLNPVHLMAMYDSFVNEGNIIKPYLIYKDNAKAQIWKKDVYPK
FT                   EDANIILNDLEQVVSNPKGTGHEAYIPGMALAGKTGTAEIKASQEDTSGTEVGWFAAVN
FT                   VDNPKLLVIAMVENAKEKGGSHYVVPIVKSVFEQVR"
FT   gene            661656..663359
FT                   /locus_tag="CLJU_c06030"
FT   CDS_pept        661656..663359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06030"
FT                   /product="predicted methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13685"
FT                   /db_xref="GOA:D8GN61"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN61"
FT                   /protein_id="ADK13685.1"
FT                   /translation="MKNLKVRGKINLLIVCIILILSASVLILVHHNLSNITDESYSNQL
FT                   KSNSGMALKLLDEKYSGAWKEKGGKLYKGSKLISGDTKFVDSIKAETGEEVTIFLKDTR
FT                   ISTTVMNKGNRAVNTKALSEVSNKVLKSGEDFRGETKILNVPYEVIYKPIRDNEGNVLG
FT                   MFFIGISKSVINNQIFQVFKSIGIIVLLIAILSVIAANIFVSKITKVLLYSAEYMNTLS
FT                   KGDFTKEVPREYLNYKDEGGVLAKGIEGMRKSVNNLLYTIRNDFKTIVDESNSLVLISK
FT                   ELSGSSSDVSQTINQVAGANTNQAQELVAVNGVIDSFSNELSKIVEDINEIDRSSNEID
FT                   SMAKENSEKLPNIERSIAKVNDSFKMFKGDITEFSSNVLKINDITNIINSVSDQTNLLA
FT                   LNAAIEAARAGEAGKGFAVVAEEVRKLASQTKESSTSIDSLIKLLSNKIGAIVKETSEM
FT                   DNEIVNQTKSINESIEAFTNITYAVNNIIPKIQKVNVSVDNLEKSKDKIVSSVEETSAT
FT                   AEEMAASTEEIAASSAEMSKSANKVYEVAENLESMTENLKGNITKFRINN"
FT   gene            664009..665613
FT                   /locus_tag="CLJU_c06040"
FT   CDS_pept        664009..665613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06040"
FT                   /product="predicted protease"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13686"
FT                   /db_xref="GOA:D8GN62"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN62"
FT                   /protein_id="ADK13686.1"
FT                   /translation="MKSNSMRKLDMRLYAKKLFVVFWTMFFLLGFSFTASAADSSQVLN
FT                   QVKNDIKTYYVGNIPDGVLNASSIDEALKKLNDPYTEYFSKEEETNFLNSINNKIYGIG
FT                   IYMSQVPSGIKVDSVVANSPAENVGLKEGDIIISANSHSLANITLDQASSYIKGDENTN
FT                   VNLVIQRQDKVLSFSVKRGEVSIPIVDGKMLDSNTAYIHIASFGEDTSQKFNEKLKELQ
FT                   ANKPARYIIDLRDNGGGYMDSALNVAGNFIGQNLALIVEDKNGKKTGYLAGEEQNIIDK
FT                   PTIFLVDKYTASASEILSAAVKDYKKAFFIGNTTYGKGVAQQMFDLSDGGALKLTVEKF
FT                   YSPAGNIIQKVGIKPDFDTGNENSLAVAQLLSGQCKDGTDERGFLKVTINNEKFYIDLS
FT                   IAKNEEYWSAFKYIVNNIDRSQICIGTKDGWAKVPEEYFSNVYKFFYPEDKVLDTMQQV
FT                   PQDKAFTVIFNKKISSDMKNKINMEIINGTTGKRVAFKIGSVEDNKVVIVPQEKLEKGK
FT                   TYYIKVNDTIKPVTVKN"
FT   gene            665627..666355
FT                   /locus_tag="CLJU_c06050"
FT   CDS_pept        665627..666355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06050"
FT                   /product="putative protease"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13687"
FT                   /db_xref="GOA:D8GN63"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN63"
FT                   /protein_id="ADK13687.1"
FT                   /translation="METTHRLSSFEYKVIKKDIKNITIKINGKGEVYVIAPLNVSYPSI
FT                   EKIVENKMEWIQENVEVTKNRIYNMKSMGLLDGKKLLWIGNFLKIEMQQADIKKCYVEI
FT                   AEDKIIVYGKAVLLKNEENIKKSICEFYKQRAKVIFRERVDIYHKNLNVYPKKITIRCQ
FT                   KTRWGSCSSNGNISFNYKILMAPMEVIDYVVVHELCHLVYMDHSRDYWRLVESIIPQYK
FT                   NRRKWLKCNGYMLNFPEKYI"
FT   gene            666436..666990
FT                   /locus_tag="CLJU_c06060"
FT   CDS_pept        666436..666990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06060"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06060"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13688"
FT                   /db_xref="GOA:D8GN64"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN64"
FT                   /protein_id="ADK13688.1"
FT                   /translation="MKFYFLLLIAVALSLDAFGVSLCVGLNGAVEKRNKFQLSFSCGFF
FT                   QFFFAICGAYAGFLFNTYIASVPQVIGGALVSIVGIFMVKEGLGSKGECILIKPGMILV
FT                   LGVSVSIDAMVIGFTTLNNIANRIDLLISTVFIGLITFIMCLFAFFISKYLQKIHIVSK
FT                   YADYIGGVILIIFGIKMMFFK"
FT   gene            667008..667439
FT                   /gene="fur1"
FT                   /locus_tag="CLJU_c06070"
FT   CDS_pept        667008..667439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur1"
FT                   /locus_tag="CLJU_c06070"
FT                   /product="putative Fe2+/Zn2+ uptake regulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06070"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13689"
FT                   /db_xref="GOA:D8GN65"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN65"
FT                   /protein_id="ADK13689.1"
FT                   /translation="MDVEKYLRKRRIKVTKARLNILDILSKSENAITVDNLFEKCRERN
FT                   INVDLSTIYRSLELFENKKIVRKFDLGENKYSYAIMRKKHKHILECKICHKEVEIDCPM
FT                   QQIEEIIKSKTGFVFEDEELDFKLNGICADCRKRKSSKN"
FT   gene            complement(667446..667769)
FT                   /locus_tag="CLJU_c06080"
FT   CDS_pept        complement(667446..667769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06080"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13690"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN66"
FT                   /protein_id="ADK13690.1"
FT                   /translation="MKKFIIIFISILLTVTIVEKVYVSYKCRDINYAVKNYFTTGIFNK
FT                   YKLCNMGDINMYFSNGTVAFIKVSGMSTKMPHEKLEYTVFIQKNARGVWKIKKVYPAQI
FT                   TLK"
FT   gene            667993..669051
FT                   /locus_tag="CLJU_c06090"
FT   CDS_pept        667993..669051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06090"
FT                   /product="putative HD-GYP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06090"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13691"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN67"
FT                   /protein_id="ADK13691.1"
FT                   /translation="MRLEFIDRVMEEDVLGKSILTCEGQVLLRAGVKLNSNYIDKLKKL
FT                   GVFYVYVEDERLEDVYVEDEKLSQLKQSTMKSMSKVMVNLNNYDEKGLRHSLKTVEEMI
FT                   NYIVDVGDVNKSLYDIQTYDNYTFVHSIDTCVMASFLGISAGYNEFDIKELGVGAILHD
FT                   VGKTKVPIEILNKKGKLTDEEFAEIKKHPVYGSKILKKTVGTYSPIIKIVEQHHERVDG
FT                   RGYPYGLTNKQITNFAKMVCICDVYDAVSNDRCYRKKFRPNDAYELILSGSGSSFDQEI
FT                   VSYFKNTFAVYPLGCCVKLSNGVKGYVVRQNRGFPDRPVIRVLQDPETGDNISGYEVDL
FT                   LKNLSIIVEEIV"
FT   gene            669150..670163
FT                   /locus_tag="CLJU_c06100"
FT   CDS_pept        669150..670163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06100"
FT                   /product="putative membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06100"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13692"
FT                   /db_xref="GOA:D8GN68"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN68"
FT                   /protein_id="ADK13692.1"
FT                   /translation="MSSYIDNLIDKLCKNYNFNIIELEGINGTCSKWALCREQNSIMQV
FT                   VFFSRVESYRNINAEDIKLRLKKLFDSKSVRLVQIVLDREVHVTVDENNNPQCGLIFLN
FT                   PYFNQITLYTPDLEQLAKEIYNCMIYVKQSTLANKQSKNIYKMKDLIVTWIIIALNVAV
FT                   YTVTAYLSGNIFDSNINVLVFMGAKVNSLIASGEYYRLFTCMFLHAGIVHLGVNMYSLY
FT                   IMGSFVEKVYGKVKYIVMYLISGLVSSVFSFMFSSSISVGASGAIFGLLGAALVFAIKM
FT                   KHKIGKEFLMNVISIIVVNLIIGFSIANVDNFGHLGGLVGGVVITYFIGQCKNIAQ"
FT   gene            complement(670172..671917)
FT                   /gene="ftsH1"
FT                   /locus_tag="CLJU_c06110"
FT   CDS_pept        complement(670172..671917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsH1"
FT                   /locus_tag="CLJU_c06110"
FT                   /product="predicted cell division protein FtsH-like
FT                   protein"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06110"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13693"
FT                   /db_xref="GOA:D8GN69"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN69"
FT                   /protein_id="ADK13693.1"
FT                   /translation="MKKIKNKFIIIPILTSILSLCMLLFMNYSNSSVPYKSYISFQKDV
FT                   SKKIVSTVYMTDSSQIRVKLKNGSIYDTDNPRTPNAKEVLLNDGISVSEQYTVNNRQAY
FT                   PTAILIISIMTAVFMALKFSNKSSKKIVSLDSLDASAIEDSNCNFKSVAGNEEAKESVQ
FT                   DIVDFLKNPKKYASYGARMPKGILLFGEPGTGKTLLARAIAGEAEVPFYAVSGSDFVQV
FT                   YVGVGASRIRQLFKKAKSNKSGKAVIFIDEIDAIGKKRDGSGSTGGSDERDQTLNALLT
FT                   EMSGFNEKEGIVIIAATNRLDMLDPALLRPGRFDRHIEVTLPDVSSREKIISLHLKNKP
FT                   VDNIDVHEWAQKTSYFSGAKIESLINEAAILACKEDSTYIENKHIDKAFSIVLTGYEKK
FT                   DRDYIKDIDKRITAYHEVGHALVSSKVLPNEKISKITIIPSTKGAGGYTLSIPEDKLYQ
FT                   NKDYLRKRIMVLLGGRAAEEVIFGADYVTTGAYNDLQHSTNIAFKMVTQYGMGNTLGLL
FT                   NMRELSDLNINQNEIIKECKCLTDSIYNDVKNILIENRHCLKATVQLLMEKETLFSNDL
FT                   KNLFN"
FT   gene            672199..673155
FT                   /locus_tag="CLJU_c06120"
FT   CDS_pept        672199..673155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06120"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13694"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN70"
FT                   /protein_id="ADK13694.1"
FT                   /translation="MKVSFGKAILTEQDILGIVHEYVNIEGLNIEKISINEIITIEGTY
FT                   KSKISVNFQVKMGIGNINNNIINLKIFDVHVYKFRVFKNVKNIVLKKLLDNFSPYGVEV
FT                   DRDTVRVDLNLAVKLIPYFNLKLKKVEILPRALEVEAEDIRYEEKKKFPNIEKKKRSIL
FT                   ILDKYHKFRKKVVSKVPQKYEKIVEYGMLVPDIIMLFIRLFKDKRVKIKVKIMLSGVIA
FT                   YLASPIDIIPDFIPFVGKIDDVALAFFALNTIIDEIPEEIIIENWHGKENIILVTREAV
FT                   QYITKIIGSANVSKVLNQLSNVFKSSERKEKEGRSVT"
FT   gene            673182..673940
FT                   /locus_tag="CLJU_c06130"
FT   CDS_pept        673182..673940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06130"
FT                   /product="predicted ribonuclease H"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06130"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13695"
FT                   /db_xref="GOA:D8GN71"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR011320"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR037056"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN71"
FT                   /protein_id="ADK13695.1"
FT                   /translation="MVKKVYAIKEGYDFEKNEKVQNIIVNTWGECLKRVKGVKGATYKS
FT                   FKDTNSALEYLKGEDKILKKSEGNYPKDCLHVYVDGSYNISTEMYSYALVAVKGNVVYY
FT                   IESDSHSCEEGKNIRQISGELKAAVRGVQYALSKGEKKVVLFHDYEGTCKHALGLWERK
FT                   EASSIKYYEEMSELMKNIEVIFVKVDSHTGDLFNELADEKCKEKLQIESKKSVQKWLMN
FT                   NEIKTANDEVKNEILKIAPKGEKNIKVIDI"
FT   gene            674057..674221
FT                   /locus_tag="CLJU_c06140"
FT   CDS_pept        674057..674221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06140"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13696"
FT                   /db_xref="GOA:D8GN72"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN72"
FT                   /protein_id="ADK13696.1"
FT                   /translation="MRGKFVAGAVIGAAVGMMVVPELDRSKKRMIRKTSRYLRNTAGNM
FT                   YGGVMNWMR"
FT   gene            674588..675895
FT                   /locus_tag="CLJU_c06150"
FT   CDS_pept        674588..675895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06150"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06150"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13697"
FT                   /db_xref="GOA:D8GN73"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN73"
FT                   /protein_id="ADK13697.1"
FT                   /translation="MMEILSLGEKIKRRRKELNMTLKDLAGDRITPGQISLVESGKSNP
FT                   SMDLLEYLAGELNTSIEYLMESEETQAQKICTYFENIAESYIISGNLSQSEKYIEEAIY
FT                   YSEKYSLQYEKAKNLYLKGTIYTARKEYPIAQQLLLSANVVFIKNNKYEEIIKTFISLG
FT                   KITISMKSYHASSSYLQQAENVYKENNIGNDFLLGQIYYYTACINFKLENMEEAINYSY
FT                   LANEKFRQIDNKEEYAKSLFLLAEEYNKKGDINNAIKYSKKTLNVYRKLEDVINTARIE
FT                   NNLGKLFGEFNNIEESFIHLNKAKELRMKCKDGKIVDTLINICENYIKLKDIINSKKVL
FT                   EEIRDKIDEKNNKSLVYYYMMKFRINMIECNKKEAENTLIDALNFAIKMNYTKEAADIS
FT                   IKLGKFYEDSKMDKEAAKYLSEGVEIFKRIGILKEY"
FT   gene            675914..677176
FT                   /locus_tag="CLJU_c06160"
FT   CDS_pept        675914..677176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06160"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06160"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13698"
FT                   /db_xref="GOA:D8GN74"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN74"
FT                   /protein_id="ADK13698.1"
FT                   /translation="MEILSTGEKVKRARIYKGYTLKELCNSKISISKMSCIENDKIKPE
FT                   DWILEFLSDKLEISFEYLKLDIKNQIIKNIDDIEKKQDKKNYEKNLVYNFKFAERYNYD
FT                   NICFRIIHLLFNYYLEKSELEKLYNIIVKYYEYLQKNFSKEKAILYYMDVGKYFFKTKE
FT                   FSQAINYYDNVLDIAAETGSNELLGKITYNKIICFIALNDYEKAYELSDTITKFINMID
FT                   GDIKKAKVYHILAILSLKNDTEKFKVYEKKANEFYKDNLKDKSTSMVEYAEVMFTLNMS
FT                   EKAVFYINEALKIHPKEHAEEFANFVIKIVGILIKNQIWDIVESICNIALDCSIKLNDI
FT                   VLIERAYYYKALIFIKKGQLAEGEMYMNLSLDALSKFQTNICMYERYMEIGCMYYDMKK
FT                   VQEALKYFNIAIDLKQKYNFL"
FT   gene            677427..680024
FT                   /gene="clpB"
FT                   /locus_tag="CLJU_c06170"
FT   CDS_pept        677427..680024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="CLJU_c06170"
FT                   /product="chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06170"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13699"
FT                   /db_xref="GOA:D8GN75"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN75"
FT                   /protein_id="ADK13699.1"
FT                   /translation="MNIDKLTIKVQNAMNEAQLTAVRYNHQQVDVIHMFSALVFEQDGL
FT                   IPNIFGKMSVNLKSLVKETKDVLDKMPKVLGEGAQSSSVYATRRFEDVFLQAEKIAQKF
FT                   KDSYISVEHVMLGIMEVHSSDVDGILKKFDITKDAFLEALSQVRGNQRVETQDPEGTYE
FT                   ALAKYGRNLVEEAKKHKLDPVIGRDEEIRRVVRILSRRTKNNPVLIGDPGVGKTAIIEG
FT                   LAERIVRGDIPEGLKNKIIFSLDMGALIAGAKFRGEFEERLKAVLKEVQKSEGKIVLFI
FT                   DEIHTIVGAGKTEGSMDAGNLIKPMLARGELHCIGATTFDEYRKYIEKDKALERRFQPV
FT                   VIDEPTVEDSISILRGLKEKFEIYHGIRIHDSAIVAAAKLSDRYITDRYLPDKAIDLID
FT                   EACAMIRTEIDSMPTEMDNVKRKIFQLEIEKEALSKEKDTASMERLKAVEKELSNLKDR
FT                   DNEMTAKYEKEKANITEVRNLKKQLDEARGQIEKAEREYDLNKIAELKYGVIPKLESTI
FT                   DEKEQSIKENNEAAMLKEEVTEQEISQIVSKWTGIPVSKLVEGERQKLVKLEDELAKRV
FT                   IGQKEAVTAVSNAVLRARAGMKDPKRPIGSFIFLGPTGVGKTELAKTLARTLFDSEENI
FT                   IRIDMSEYMEKYSVSRLIGAPPGYVGYDEGGQLTEAVRRKPYSVILFDEIEKAHEDVFN
FT                   IFLQILDDGRLTDNQGKVVDFKNSIIIMTSNIGSSYLLQNKSSNGIDKDVRDKVMSDMK
FT                   FKFKPEFLNRLDDIIMFKPLNTEEIKFIIDIFLKDIENRLKEKNISIQITPKAKEVMAE
FT                   EGYDPVYGARPLKRYIENILETSIAKKIINGDIYTGCKVRVDYENDKFKIEKL"
FT   gene            680085..680891
FT                   /locus_tag="CLJU_c06180"
FT   CDS_pept        680085..680891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06180"
FT                   /product="predicted polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06180"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13700"
FT                   /db_xref="GOA:D8GN76"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN76"
FT                   /protein_id="ADK13700.1"
FT                   /translation="MKKPVYSIIYGIFIYLFVIACISLICKWDCVKYNFAEERKNIVLA
FT                   KDNAPTYSKEVFLTFDDGPSVNNTTKILNILQQNGVKATFFIVGEKAKENPSILKQLSD
FT                   SGMSIGVHTYSHNYKEMYSSLDAYLEDFRVCKNIIKNITGKDSIVFVRLPGGSDNLVAS
FT                   VSNLNIIKKTLKGNGMKYVDWNVVSGDADKRFVSKDIIKQNVIDGCKNKKIAVVLMHDS
FT                   YYKTSTVEALPDIISYLKKEGFAFRTFDGITLEEEFRMTDKGIINR"
FT   gene            complement(681168..681902)
FT                   /locus_tag="CLJU_c06190"
FT   CDS_pept        complement(681168..681902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06190"
FT                   /product="putative cobyric acid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06190"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13701"
FT                   /db_xref="GOA:D8GN77"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN77"
FT                   /protein_id="ADK13701.1"
FT                   /translation="MELNICHLYPDLLNVYGDLGNILILKYRAQQRGIDINVFNISLGD
FT                   PFDSSKYDITLFGGGQDYEQSIVSEDLVKNKREGIVSYIEDGKVFLSICGGYQLLGKYY
FT                   STPDGQKLPGLDVLNIYTEGGSNRFIGNTVIYNEKYKETYVGFENHSGRTYIGDLEPLG
FT                   KVIVGYGNNGEDGYEGCIYKNCFCTYFHGSLLSKNPELADRFISTAISKKYGDTKLDPL
FT                   DDTLELNAKKFIIERETKTKSN"
FT   gene            complement(681933..683087)
FT                   /locus_tag="CLJU_c06200"
FT   CDS_pept        complement(681933..683087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06200"
FT                   /product="predicted UDP-N-acetylmuramyl tripeptide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06200"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13702"
FT                   /db_xref="GOA:D8GN78"
FT                   /db_xref="InterPro:IPR013564"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN78"
FT                   /protein_id="ADK13702.1"
FT                   /translation="MVYNMLKDGKKRVITNNTGANMLTGIVSCFIENYSFKKCSETNYA
FT                   VIECDEANVPLFTDYITPEIITVTNLFRDQLDRYGEVYTTLNKILKGIKKVPLSNLILN
FT                   GDESLLGDLNLPNRTIYYGFNCSPTNIKKVDTNADAKFCKKCKNPYKYNFLTYNHLGDY
FT                   YCEKCGYKRPELDYTLDEIKEQTPDGSLVIINEKEYYINQPGTYNMYNALCAYSIAMVC
FT                   GISTSCIYDSLKKQKSSFGRQEVINIEGKEVKIILVKNPAGYDQAINTLSLDNRTFNLA
FT                   VLLNDNYADGRDVSWIWDVNFEKLSSLDIDKIMISGIRLYDMAVRLKVAGLPQDNFIIC
FT                   KHYENLIDEVKSCKSNTVYVLATYTAMITFRKFLNFKGYIKKLW"
FT   gene            683859..685427
FT                   /gene="pck"
FT                   /locus_tag="CLJU_c06210"
FT   CDS_pept        683859..685427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pck"
FT                   /locus_tag="CLJU_c06210"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /EC_number="4.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06210"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13703"
FT                   /db_xref="GOA:D8GN79"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN79"
FT                   /protein_id="ADK13703.1"
FT                   /translation="MNIDLSYLNINKYRNMYKNLSPSELTEFSIKRGEGFLSNKGALMI
FT                   NTGKYTGRSPKDRFIVNQESIRNKINWGNVNLSIEEDIFNKMYDKILNYISDKDIFVFD
FT                   GFVGALKKYTLPIRVICERASQALFANQLFRRPTEEDLKCFTPEFNIISAPGFKAKGKE
FT                   DGLNSDAFILVNFDKKIILIGGTSYSGEIKKSVFSVMNFLLPQKGVMPMHCSANIGQDN
FT                   KTCLFFGLSGTGKTTLSADGERRLIGDDEHGWSNEGVFNFEGGCYAKTIRLDKEKESQI
FT                   YNAIKFGTVVENVVADGNRVPDYNDARYTENTRAAYPINYIDNIEESGVGGNPETIIFL
FT                   TADAFGVMPPISRLSKEAAMYHFMSGYTSKIAGTERGIIEPQATFSSCFGEPFMLMNPA
FT                   VYAKLLGERIDKYNTQVYLVNTGWLSGGYGNGDRIKLSYTRAMIREALRGKFKDVEFVE
FT                   HPVFKVMMPKRCPGVPDEILNPRNTWEDKEAYDETARKLALKFSKNFEKFKDVSEDIAK
FT                   AGPEA"
FT   gene            685643..686476
FT                   /locus_tag="CLJU_c06220"
FT   CDS_pept        685643..686476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06220"
FT                   /product="undecaprenyl-diphosphatase"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06220"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13704"
FT                   /db_xref="GOA:D8GN80"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN80"
FT                   /protein_id="ADK13704.1"
FT                   /translation="MELLFIIKAAAIGVVEGITEFLPISSTGHMIIVGNLINFKAPTYN
FT                   GAYIDMFEVVIQLGAILAIVVLYWDKIFNSLKNLKPGKWGFKLWLTILVAFIPAAVLGL
FT                   RFNDLIKSKLFNPVTVACALVFGGFLMIYMENKYRKGNSTNTIENVNLVQAFKIGCFQC
FT                   LSLWPGMSRSASTIMGGWVSGLTNVAAAEFSFFLAIPTMIAASGWSLIKVNVSMNISQI
FT                   IALAVGFIVSFIVALVVVEKFINFLKRKPMRVFAVYRIFIGAIILILYFAKVINI"
FT   gene            686861..688321
FT                   /gene="rrsE"
FT                   /locus_tag="CLJU_c06230"
FT   rRNA            686861..688321
FT                   /gene="rrsE"
FT                   /locus_tag="CLJU_c06230"
FT                   /product="16S ribosomal RNA"
FT   gene            688495..688570
FT                   /gene="trnA1"
FT                   /locus_tag="CLJU_c06240"
FT                   /note="tRNA-Ala-TGC"
FT   tRNA            688495..688570
FT                   /gene="trnA1"
FT                   /locus_tag="CLJU_c06240"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA"
FT   gene            688575..688651
FT                   /gene="trnI1"
FT                   /locus_tag="CLJU_c06250"
FT                   /note="tRNA-Ile-GAT"
FT   tRNA            688575..688651
FT                   /gene="trnI1"
FT                   /locus_tag="CLJU_c06250"
FT                   /product="tRNA-Ile"
FT                   /note="codon recognized: AUC"
FT   gene            688991..691701
FT                   /gene="rrlE"
FT                   /locus_tag="CLJU_c06260"
FT   rRNA            688991..691701
FT                   /gene="rrlE"
FT                   /locus_tag="CLJU_c06260"
FT                   /product="23S ribosomal RNA"
FT   gene            692128..693312
FT                   /locus_tag="CLJU_c06270"
FT   CDS_pept        692128..693312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06270"
FT                   /product="predicted amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06270"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13705"
FT                   /db_xref="GOA:D8GN81"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR033846"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN81"
FT                   /protein_id="ADK13705.1"
FT                   /translation="MTQQNVKFLENSEDTEFNKKMKDIFEYFHQRPELSYEEYDTTKEL
FT                   AKLLREGDIDILDLPMKTGLVAEIKGKKGGPTIAIRTDIDALPITEETNLTYKSKNKGK
FT                   MHACGHDFHMTTILGAAYLLKRDQKKLKGNVRILFQPAEESSHGAEEVIKTSALDGVQA
FT                   IFGLHCNSDWDVGTLGINVGPVTAAVDRFEVEVTGKGTHAAHPELGTDPIVAASNIITA
FT                   LQTIVSRNMHPLNPAIVSVTHMESGHTWNVIPEKAYFEGTVRTLNEKDRELIPEKIKMI
FT                   SENIAEAYGAKANFNWYEGPPATNNDKDWTEVAISVAKKDGYQVKIISPKMGGEDFAYY
FT                   QKTLSGTFVNIGVGKGESLHSPKFKIDELALEKSTKYFKNLAEQALIVLNSKRD"
FT   gene            693338..694366
FT                   /locus_tag="CLJU_c06280"
FT   CDS_pept        693338..694366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06280"
FT                   /product="predicted ABC-type transporter, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06280"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13706"
FT                   /db_xref="GOA:D8GN82"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN82"
FT                   /protein_id="ADK13706.1"
FT                   /translation="MIDLKNVYKTFNRDGMKIEALKGINIKVDKGDIYGVIGFSGAGKS
FT                   TLLRMVNFLEKPTSGSVLVNGQDISKLNKKQLISTRRKIGMVFQHFNLLNSKTVFANVA
FT                   LPLILDHVPKNEISNRVNDLLKFVGLDNRAKNYPDELSGGQKQRIGIARALATNPQILL
FT                   CDEATSALDPQTTESILELLKRVNKEYDITILLITHQMNVIQKICNKVAVMEKGKIVEK
FT                   GRVIDVFGNPKEKVTKDFVHSVTNDDIPISILNLIKNNRQNSQNRKFFRLKFMGNSTLT
FT                   PMISMATKKFNAEINVLNASVTELQDTPMVNMVIELECDSTLAEEIVKYIESKNILVEE
FT                   VA"
FT   gene            694368..695021
FT                   /locus_tag="CLJU_c06290"
FT   CDS_pept        694368..695021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06290"
FT                   /product="predicted ABC-type transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06290"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13707"
FT                   /db_xref="GOA:D8GN83"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN83"
FT                   /protein_id="ADK13707.1"
FT                   /translation="MQTITISQIYTAILQTLYMIFIPLLIGSVVGTLLGVLMVVTRPNG
FT                   ILENKYIYNVLNPIVNIFRSLPFIILMVAIVPFTKLIVGSSIGTSAALVPLTIFITPYI
FT                   ARLVENSILEVDSGTIEAAEAMGATSFQIIWHFLLPEAMGSLVLSLTTATIGLIGATAM
FT                   AGTVGGGGIGDVAISYGYERFDTEVMVITVILLIIFVQFIQTIGNVIARKVRRN"
FT   gene            695044..695883
FT                   /locus_tag="CLJU_c06300"
FT   CDS_pept        695044..695883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06300"
FT                   /product="putative ABC-type transporter, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06300"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13708"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN84"
FT                   /protein_id="ADK13708.1"
FT                   /translation="MIRKFLKTTIASLLIITSAIGLSACGSKNSSDSSEKKEIKLGVSP
FT                   GPYNDLFNAGVKPILEKEGYKVNLVNFSELLSSEVALTEGSVDFNVAQHNAYVKAYNKE
FT                   KKANLVSIIKIPTVRAGIFSNKHKSMSEVKQGDKVFIPKDPSNAARAYALLEKAGWIKI
FT                   KSGVVKTLATQKDIVENKNNIKIIEMDSSQIPRSMNEADYAVLPGAIEYMAKIDASKAL
FT                   ISETLSDDLYITVAVDGKNKNAKWAQDIIKAYKSQDFKNYIKTHNSKGYWVLPDDLK"
FT   gene            696107..696219
FT                   /gene="rrfE"
FT                   /locus_tag="CLJU_c06310"
FT   rRNA            696107..696219
FT                   /gene="rrfE"
FT                   /locus_tag="CLJU_c06310"
FT                   /product="5S ribosomal RNA"
FT   gene            696233..696308
FT                   /gene="trnF2"
FT                   /locus_tag="CLJU_c06320"
FT                   /note="tRNA-Phe-GAA"
FT   tRNA            696233..696308
FT                   /gene="trnF2"
FT                   /locus_tag="CLJU_c06320"
FT                   /product="tRNA-Phe"
FT                   /note="codon recognized: UUC"
FT   gene            696409..697323
FT                   /locus_tag="CLJU_c06330"
FT   CDS_pept        696409..697323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06330"
FT                   /product="predicted transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06330"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13709"
FT                   /db_xref="GOA:D8GN85"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN85"
FT                   /protein_id="ADK13709.1"
FT                   /translation="MNKGVLKSSMLLLITSAIWGFAFVAQRVGMNYVGAFTFNGVRFGL
FT                   GAFSLLPLIIFYKEKDKNKEKNKSFKSVFLSGLFTGLIVFLASSFQQVGLIGTTAGKAA
FT                   FITGLYIVFVPIMGMFLKRHIGLNSWIGALIAVVGLYFLCVTSSFFISHSDLLELGSAF
FT                   FFAVQIILIDIFSKKFDTLKLAFFQFITCSVLSLITAILFESITISGVLQAAIPILYGG
FT                   IFSVGIAYTLQIVAQKNAEPTHAAIIMSMESVFAAIGGFLVLNEYLSLRAMFGCGLMLA
FT                   GMIICQVKPREICHAKVEACKKR"
FT   gene            697454..698272
FT                   /gene="folP"
FT                   /locus_tag="CLJU_c06340"
FT   CDS_pept        697454..698272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folP"
FT                   /locus_tag="CLJU_c06340"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06340"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13710"
FT                   /db_xref="GOA:D8GN86"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN86"
FT                   /protein_id="ADK13710.1"
FT                   /translation="MDKVITIGKKDFQIGKRTYIMGILNVTPDSFSDGGKFNNIELAIK
FT                   HAKQMEEEGADIIDVGGESTRPSYDPVSEQEELERVIPIIGKLSRCVDIPISIDTYKGK
FT                   VAEESIKAGASLINDVWGFKRDPYMAEVAAHYRVPCCLMHNRDNRNYTNLMNDVLNDLQ
FT                   ESIDIALKAGVDPKNIITDPGIGFAKDYEQNLAVMNQLERLSELGYPVLLGTSRKSMVG
FT                   KALDLPVNERIEGTVATTVIGIMKKCDFVRVHDVKENKRAAVMADAIIRR"
FT   gene            698406..698963
FT                   /gene="folE"
FT                   /locus_tag="CLJU_c06350"
FT   CDS_pept        698406..698963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folE"
FT                   /locus_tag="CLJU_c06350"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06350"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13711"
FT                   /db_xref="GOA:D8GN87"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN87"
FT                   /protein_id="ADK13711.1"
FT                   /translation="MDEKKIREAVKMMLEAIGEDPEREGLVETPDRIARMYKEIFEGLD
FT                   ESPEKHLRKVFTVDSDDIVLEKDITFYSMCEHHLLPFYGKAHIAYIPDGKVVGLSKLAR
FT                   TVEVFAKRLQLQERMSAQIADAMMKYVKVKGVMVVVEAEHMCMTMRGIKKPGSKTVTAV
FT                   ARGLFKSEPRLRDEVYRMINME"
FT   gene            698979..699455
FT                   /locus_tag="CLJU_c06360"
FT   CDS_pept        698979..699455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06360"
FT                   /product="putative metal dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06360"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13712"
FT                   /db_xref="GOA:D8GN88"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN88"
FT                   /protein_id="ADK13712.1"
FT                   /translation="MEKVNAILKNRKFCTYLSKINKLEESRKYCKHNIQHLLDVARITY
FT                   IKVLEENIHVKKEIIYAAALLHDIGRWQQYEEGIPHELASIKLGKDILDECGFDNEEEK
FT                   EIFDLISNHRKKDSDSLLQSIFYDSDKACRNCFMCKAVSECNWPDEKKNYSIEY"
FT   gene            699482..700309
FT                   /locus_tag="CLJU_c06370"
FT   CDS_pept        699482..700309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06370"
FT                   /product="bifunctional folate synthesis protein"
FT                   /EC_number="2.7.6.3"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06370"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13713"
FT                   /db_xref="GOA:D8GN89"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN89"
FT                   /protein_id="ADK13713.1"
FT                   /translation="MDIIYVEDLEVYAYHGVNQAEKDMGQRFLISLQIFLNLSEAGKSD
FT                   DLSKTINYAKLCCEVEEEFKREKYDLIEKSAESLANFILKKYIAVEKVTVKIKKPWAPI
FT                   GKPLKWVAVEINRRWHTAYISIGSNLGDKEKNIKDAVDIIDSSHYNNVTKVSKLYETKP
FT                   VGYLDQDNFLNGALEVKTLMEPEDLMDFLLEVEKKLKRERIIKWGPRTIDLDVILYDNL
FT                   VTSEEKIILPHPRMHERLFVLKPLSDIAPYVIHPVLNDRIINLTHELEKTQEL"
FT   gene            700456..701571
FT                   /locus_tag="CLJU_c06380"
FT   CDS_pept        700456..701571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06380"
FT                   /product="putative ATPase associated with various cellular
FT                   activities"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06380"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13714"
FT                   /db_xref="GOA:D8GN90"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN90"
FT                   /protein_id="ADK13714.1"
FT                   /translation="MTEKILKPPVEVLYKEEIAALKKNDDGIKPENWILSPKAVRKFIL
FT                   GSLEPLTYRNKKIYINKKFFGNDSLVERCIITLAGNRGLMLVGEPGTAKTMLSELLSAA
FT                   ICGCSTNTVQGTAGTTEDMIKYSWNYAMLLAKGPTSEALVKAPLFVGMEKGIITRFEEI
FT                   TRCPSEIQDSLISILSDKVLNIPELGESEGLLFAKPGFNVIGTANTRDKGVNEMSSALK
FT                   RRFNFETIFPIKDVSLEAKIIVNEVEKLKNQNNIKMEVDEDVVELLASTFHELREGISS
FT                   NGIRIDKPSSVMSTAEAVSVYYQTMITAYYYGDSKINLNSMAQNIMGAALKESRDDLEK
FT                   IKSYFNVVVKSKAAEGGELWKSYYEARKWIK"
FT   gene            702135..703943
FT                   /locus_tag="CLJU_c06390"
FT   CDS_pept        702135..703943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06390"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13715"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN91"
FT                   /protein_id="ADK13715.1"
FT                   /translation="MLSYCYLSRMCSTKEDLISEGCVARETFMASKIQEACSVYNKVLV
FT                   ITGGFHTYGIIDLLNKKVEFRIKKIDEKDKGVYVMPYSMEALDQLNGYSSGMPFPNFYE
FT                   GVWKRLNESYETAYKNSVLSNIIQNGKKVRKNDGCLSTFDEICAFDMAQGLSNLRGKRQ
FT                   PGVYELIDSITSSFIKGDLNISTEDPLKILYKDLTGNKIGKLCREADVPPLVHDFKDTC
FT                   AKYKLKINTTIKQEISLDIFSSKRHREISCLMHRMAFLNTNFSRLIKGPNIFLKRDVNL
FT                   IRETWYYKWNTQVDAALIENSVYGGTLKEASTSLIKKNMNECGRSAENISRLLVLSFNM
FT                   GLDEIFNSTINELKDIIAEDSSIYSLINCLYYLNYIYTMRELYFMNSMNEVKNIIFYVY
FT                   SKICILIPDMASINEEEALKGVNSLKEVFNIVVKRELDLDDTLLKEALFSLLRFDSINA
FT                   GIEGAASGILYGLNELKSEEAAKSVEGYIFGTKEKALKAPSFLNGLFSTARDLVFVEGS
FT                   ILKSIDKFINEVEDEDFIRIIPQLRLAFSYFIPREVDEIGEKVAKNYKVSKVHFDGLKV
FT                   ISPEILKLGSEIDKYAAEKMEQSGII"
FT   gene            703998..704486
FT                   /locus_tag="CLJU_c06400"
FT   CDS_pept        703998..704486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06400"
FT                   /product="predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06400"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13716"
FT                   /db_xref="GOA:D8GN92"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN92"
FT                   /protein_id="ADK13716.1"
FT                   /translation="MEIKIRQVSIDDLNSVAEVESICFPKAEAATKESFKQRIETFPES
FT                   FFVAEVNDRIVGFINGCIINETVICDELFEDSTLHVPNGHYQTIFGLDVIPEYRNQGIA
FT                   AKLMKHMIETARSSGRKGVILTCKERLIHYYMKFGYKNKGVSKSVHGGAKWYDMILEF"
FT   gene            704716..704922
FT                   /locus_tag="CLJU_c06410"
FT   CDS_pept        704716..704922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06410"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13717"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN93"
FT                   /protein_id="ADK13717.1"
FT                   /translation="MIQIDEACDSCSTYLKDKNEELFLTVQRYEDGTENKIIYASSVKL
FT                   IKKLFRDKLKTAVGYPKYEIYRF"
FT   gene            705052..706188
FT                   /locus_tag="CLJU_c06420"
FT   CDS_pept        705052..706188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06420"
FT                   /product="conserved hypothetical protein with a VWA_CoxE
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06420"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13718"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN94"
FT                   /protein_id="ADK13718.1"
FT                   /translation="MKESLVSLNRWRLILGKYADGKIPFEDSNSGINYMEMDDLLDFLY
FT                   SREYSEKDGVKRGKSSGSTSPSNLTVPKWITKIRELFPKETVEVLEKHAIEKYNLTELL
FT                   TDKEVLEKLEPNKELLKNILQMKHLMKGDVLDTAKSIVKKVAEDITKKLENDVKRSITG
FT                   RVNKNKSTTLKSSKNIDFKRTIKKNLKNYDCDKKRLVVDKIYFNENVRKFNPWNIIIAV
FT                   DESGSMLDSVIHSAIMAGIFSKLPMLKTNLIIFDTEVVDLSGYIDDPVTTLMSVQLGGG
FT                   TNITKAMTYCEKLIENPHRTMVVLVTDLYEGYGYGNMYAKAKSIVESGAKLIILTALDV
FT                   EASPSYDKNAALKMASLGAEVAAMTPGGLSDWIAKIIS"
FT   gene            706215..707840
FT                   /locus_tag="CLJU_c06430"
FT   CDS_pept        706215..707840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06430"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13719"
FT                   /db_xref="GOA:D8GN95"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN95"
FT                   /protein_id="ADK13719.1"
FT                   /translation="MDADYLAGISNKGITKRADKDLSKVSNIEYEVKNNSIEFKFDDIT
FT                   CSINENIKGYKCSCPSRSICKHVIMCYLYLMKNKEKLFDIQGCGSQSEEEEKFLALKEI
FT                   SIDTIKKKTGDKNLNDIIKRIEFGVNFEIKEGSIIEVNFIDENTLVKFLGNIENSTCTC
FT                   KSKELCVHKAEALILYKLKKGYLNLKELKVFAKTSEGFDEQKLKEASFKIKFAVEDMLI
FT                   AGLSRMPVTIMDSLNNLAVICHNYELPNFEKSVRDIREEISLYFNKNASFVKENLVNKI
FT                   TSLYTRAISLENVKDLDKLSLLVGEFKSSYYEIPPVEFHGFAAEKWKSNSGYEGITYYF
FT                   LESKNGQIYTYTNALPTYYDDVNYRKSFNEPAPWNLNCSICELSNISFKLIHGKINSQN
FT                   RISSSSESNGTIIGKSNIFKLNTEKYDYDNWNEILDRIFLDKREKDQEYNLIFLQIDKF
FT                   GEVDFNDVTQEFSVPIYDKFNNCSKIIIKFSLDTKYMIRRIERVIKYNRSHYIFGRIYI
FT                   DGEELVFYPITYYDDTGQVENLTL"
FT   gene            707863..708183
FT                   /locus_tag="CLJU_c06440"
FT   CDS_pept        707863..708183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06440"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13720"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN96"
FT                   /protein_id="ADK13720.1"
FT                   /translation="MNECKQILNVIDEVQKSIQELFFSGFNTPSDFVIDEFLRLGLVLE
FT                   SCGMSYGSQKLNSIHDKLKSKRHSFDFNYSECVKEYCELNEYCIICKKRLNILNLKTKI
FT                   SS"
FT   gene            708195..711764
FT                   /locus_tag="CLJU_c06450"
FT   CDS_pept        708195..711764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06450"
FT                   /product="predicted transcription regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06450"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13721"
FT                   /db_xref="InterPro:IPR025406"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN97"
FT                   /protein_id="ADK13721.1"
FT                   /translation="MNIKEHLLNKIEDVLEELNVSQDALGSLEDYLEDEVQEDEFLNML
FT                   PEVDFNSISKDILSKAAKAYTSIRRYKSNEYIRKYINILFKMGKASVTYVILKSSYWIS
FT                   EYTVNELIKAGVEKYIVLIVYVNRLAYDYSRLDNKNFKTIYDMCRESPEDVIKACEYLD
FT                   VNQKMVVCSIYCKYKGIEKNDKYYEFLKDIEDDFTNSIDNLYDNKMPDDLVKKIQMFIE
FT                   KNDYALLENIIDEVKGYKYSDYLFKFLVGFSALNADKSATLKKMFQFFVRVNFRDALNS
FT                   AYSILPVTSCYSDTVNNMDMLFEIPSKYHVAWYAEKFAGNETASEILKKKLKENKKSFE
FT                   EAISLSEGASKNYLMSFMLDGDEKSNYIKTLEENCINVFSKVLREDKVNEGDISVVESF
FT                   LRDDVSFENVKNTLYSIEPQNTSYWRMNNELIEVLNILCKNLGGGINLYERVVSVMAAV
FT                   GYKNYIVKLSSDYKRNTGTEYSSEKFHKIFDILRKYSVPILAKMKLIDNIINDYDYMGR
FT                   KAAALHTVLKDIVVKDKDEVVKNIDNISADGRCVFLEYIFKVKKEENIKVVLDKFGDGS
FT                   KKVKEKIVELFTNSSSNLKYMEGVLDKLKAKKQGEREVAIRILSKWLNEEGIEEERSKL
FT                   IKECLNYTLEAEKSQKIRALLMEVLGIEQKGMDKEKLKGEEFIKDLLKGNKKNSLSWLE
FT                   FDSLPKVKLEESNNYCEEDYLKAVLLCYSASNTIGKSVDGDRLVQKLNRDSLKLFANEV
FT                   FDRWFEKGAEAKKRWVPGFSSIYGGEEIVMKLQKCINDWAKNSRGAIASQAVKALALNG
FT                   GSSALLIVDGISRKFKFKQVKKAAAEALDFAAEQMGVDREELSDKVVPNLGFNASGERI
FT                   FDYGSRKFIVRLAADLSVEVYDQNEKKLKNLPSPGKKDDESKAKEARSEFRAFKKQLKN
FT                   TISVQTTRMDLALSNERKWTKEAWIKLFVENPIMHKFSIGLIWGIYENSKLVDTFRYME
FT                   DGTFNTKDEDEFEVPEKSSIGLVHPLELSREDLNLWKEQLEDYEIVQPIKQLDREVFTM
FT                   TEEEKKMKYVDRFGGKIVNGLSLVGKIMNYGWYRGSIQDAGGYYEFYKEDNSLGIGVEL
FT                   KFEGLSVGYENEDTTIYILRFYNAGTVKRGSYIYDEIKEQHLLSLSQVPEKYFSEILYQ
FT                   VSSALSSSSTVNENWRNGSGIKF"
FT   gene            complement(711842..713092)
FT                   /locus_tag="CLJU_c06460"
FT   CDS_pept        complement(711842..713092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06460"
FT                   /product="conserved protein with a peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06460"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13722"
FT                   /db_xref="GOA:D8GN98"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN98"
FT                   /protein_id="ADK13722.1"
FT                   /translation="MNKFVKLVFGFILFSFAIAAAGCESEYLGGDRNTKWKKDLSYMQK
FT                   ALPKKHVNLFFKINEEKFNDEINTLKNSVDNLNDDEIAAGIYKITASIGDSHTSAYKET
FT                   LNAYPMEFYYFKEGVYVVNTTSEYKKALYAKLIKINGKDIKNIQEAILPLIVNDNEGMV
FT                   KKSVPKYLSNPEIVHGIKVVSDTNKAVFTFQDSNGKIFNLNVSSMDKHKISEKFIVNET
FT                   YNSSYPLYMQKKNLNYWYKYLSDEKTVYFKYNKCQSDEDSGKSIEDFIAQMLSFMNTHT
FT                   VDKFVIDMRDNSGGSDKYIKPIIDWLKNKKLNNKNHLFVIVGRNTFSSAIVDTSLLKKD
FT                   TNATFVGETTSGKPNHYGAVKEFELPNSKMEISYSTQFNKSSNNNSSTFAPDKIIELSI
FT                   KDYMNKTDPVLNYILKF"
FT   gene            complement(713105..713854)
FT                   /locus_tag="CLJU_c06470"
FT   CDS_pept        complement(713105..713854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06470"
FT                   /product="predicted transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06470"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13723"
FT                   /db_xref="GOA:D8GN99"
FT                   /db_xref="UniProtKB/TrEMBL:D8GN99"
FT                   /protein_id="ADK13723.1"
FT                   /translation="MLNMICSEFFKLKKTCIAPLVLIGGTIMTILMFAARHITEVNMSF
FT                   EKYAYNIEQTNFIMLFIVLFSIISAYVFSREFTDKTANVLYAYPASKSKIFMSKLVVIY
FT                   ILIFLTYVIEIISIPLSYYFLNGNLPEINVITKDLKANILSMLFQFLLVPIPVLIANLS
FT                   RNIIMPMTYGILGFILSCLLRTQSFSYCAKYIPLLSPWLSVDYFYSNAHVDLDYRVDLN
FT                   YIIISSVLCFIFFISISIYEFNKKDIN"
FT   gene            complement(713876..714625)
FT                   /locus_tag="CLJU_c06480"
FT   CDS_pept        complement(713876..714625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06480"
FT                   /product="predicted ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06480"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13724"
FT                   /db_xref="GOA:D8GNA0"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNA0"
FT                   /protein_id="ADK13724.1"
FT                   /translation="MFNIVYSEFLKLKKSYLVIITLIAAIFVPILECIQALSNNYRGSS
FT                   ETLRNTLFMNYRVNIEVICFQFLYIVFFSLIASYVFSREFTDKTANTLFIYPSSRIKIF
FT                   IGKLITVYIIIAFAYFIQSISTYLTLYISWGNLLPSYLIVKDIEVNLYSMLFQFLLIPI
FT                   PILIGNLTKNIIFPVIYGILGAVSSAFMMLMGIYMQVDPLMLPALPIYYFYKGDPIDYV
FT                   LVISSAVLTFGVSIFLCLYHYINGDIN"
FT   gene            complement(714626..715531)
FT                   /locus_tag="CLJU_c06490"
FT   CDS_pept        complement(714626..715531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06490"
FT                   /product="predicted ABC transporter, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06490"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13725"
FT                   /db_xref="GOA:D8GNA1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNA1"
FT                   /protein_id="ADK13725.1"
FT                   /translation="MDDILKTYNLTKEFKHFCAVKNLNIHIKKGDIYGFLGQNGAGKTT
FT                   TIRMIMGLIKPTSGEIELFSEKTSNRKVLERIGSMIEYPGFYPNLTAGENLEIHRRMMG
FT                   VQGKNCIDETLKVVGISDVKNKKVKEFSLGMKQRLGIARALLHHPEFLILDEPTNGLDP
FT                   IGIKEIRELIIDLCKKQGITFLISSHILSEVQQMANKIGIIHKGELLEEISYDELQRRN
FT                   RHYINIKVNNDKKASFILEEKLGIKDYVIWGKNNFRVYEKLQEISNINKALVSNDLLVD
FT                   EICLKVDSLEDYFIKLTGGN"
FT   gene            complement(715615..716544)
FT                   /locus_tag="CLJU_c06500"
FT   CDS_pept        complement(715615..716544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06500"
FT                   /product="predicted two component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06500"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13726"
FT                   /db_xref="GOA:D8GNA2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNA2"
FT                   /protein_id="ADK13726.1"
FT                   /translation="MSILNCVLIFIIIFLILILMSFYKKANYISIVIDQILNGNLNQRI
FT                   RTQTHVRTLSKLIININRLINRLQKVQDKSNTSEESRKRMISNISHDLRTPLTSILGYI
FT                   ELLLNDTTLTLAEKERYMKIAYSKGIYLYNLIEEFFEISKMDSNDFKLDVKEINICEIV
FT                   RQNILLFFSEFKKINIEPELKFEKDDVYAVADEKSLNRILANLINNALKYGSHATKIGI
FT                   DLSCDNDNVFISVWDNGPGIPKEDLPYVFDRLYTVEKSRKLNLKSSGLGLTIVKKLVES
FT                   LGGNIFVSSTPFERTEFKFTLKQNLRKL"
FT   gene            complement(716546..717235)
FT                   /locus_tag="CLJU_c06510"
FT   CDS_pept        complement(716546..717235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06510"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06510"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13727"
FT                   /db_xref="GOA:D8GNA3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNA3"
FT                   /protein_id="ADK13727.1"
FT                   /translation="MNISKILVIEDDEEINNLIYNTLKNENYNIVQAFDGKDALEKYDN
FT                   TFQLIILDLMLPYIDGIEVLRKIRENSTVPVIILSAKNEETDRVIGLSMGADDYMIKPF
FT                   STRELAARVKAQLRRYIYYNNVHDKNPTLTYKSLKLDTSNHKFFKEDKELNLTPKEFEL
FT                   LKFFLKNPDRVFTKAQIFNGVWENDYLHDDNTVMVHIKRLRNKIEDNPNNPKYIVTVWG
FT                   IGYKLGE"
FT   gene            718161..719621
FT                   /gene="rrsF"
FT                   /locus_tag="CLJU_c06520"
FT   rRNA            718161..719621
FT                   /gene="rrsF"
FT                   /locus_tag="CLJU_c06520"
FT                   /product="16S ribosomal RNA"
FT   gene            719795..719870
FT                   /gene="trnA2"
FT                   /locus_tag="CLJU_c06530"
FT                   /note="tRNA-Ala-TGC"
FT   tRNA            719795..719870
FT                   /gene="trnA2"
FT                   /locus_tag="CLJU_c06530"
FT                   /product="tRNA-Ala"
FT                   /note="codon recognized: GCA"
FT   gene            719875..719951
FT                   /gene="trnI2"
FT                   /locus_tag="CLJU_c06540"
FT                   /note="tRNA-Ile-GAT"
FT   tRNA            719875..719951
FT                   /gene="trnI2"
FT                   /locus_tag="CLJU_c06540"
FT                   /product="tRNA-Ile"
FT                   /note="codon recognized: AUC"
FT   gene            720291..723001
FT                   /gene="rrlF"
FT                   /locus_tag="CLJU_c06550"
FT   rRNA            720291..723001
FT                   /gene="rrlF"
FT                   /locus_tag="CLJU_c06550"
FT                   /product="23S ribosomal RNA"
FT   gene            723117..723229
FT                   /gene="rrfF"
FT                   /locus_tag="CLJU_c06560"
FT   rRNA            723117..723229
FT                   /gene="rrfF"
FT                   /locus_tag="CLJU_c06560"
FT                   /product="5S ribosomal RNA"
FT   gene            723248..723322
FT                   /gene="trnN1"
FT                   /locus_tag="CLJU_c06570"
FT                   /note="tRNA-Asn-GTT"
FT   tRNA            723248..723322
FT                   /gene="trnN1"
FT                   /locus_tag="CLJU_c06570"
FT                   /product="tRNA-Asn"
FT                   /note="codon recognized: AAC"
FT   gene            complement(723676..724590)
FT                   /locus_tag="CLJU_c06580"
FT   CDS_pept        complement(723676..724590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06580"
FT                   /product="predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06580"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13728"
FT                   /db_xref="GOA:D8GNA4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNA4"
FT                   /protein_id="ADK13728.1"
FT                   /translation="MDTQITLKNNSRMKGILLVVSASMLWGVSGPVAQYLFQKKDISPE
FT                   WLVDIRLLLSGSLLLIFLYLKNGKKIFNIWKSKYGRRNIIFFSIIGLIGVQYGYFASIK
FT                   YGNAATATILQYLSPVIIVCYVSFKSKELPTLRETLSILLALLGTFLLITRGNIHSLAI
FT                   SNLALFWGVLSAFAAAFYVVQPVYIIKRWGCDIVIGWGMLLGGIFFSFVHPFWRIQGEY
FT                   STDSILAITFVVVFGTLVSFYWYLDSTRYIKASETSLLSCLEPMSATTVSILWLHTPFG
FT                   IFDIIGSILILSTVLILSYNKKS"
FT   gene            complement(724612..725472)
FT                   /locus_tag="CLJU_c06590"
FT   CDS_pept        complement(724612..725472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06590"
FT                   /product="predicted hydrolase, ComE-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06590"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13729"
FT                   /db_xref="GOA:D8GNA5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNA5"
FT                   /protein_id="ADK13729.1"
FT                   /translation="MKFIKKYFNILSIVFIFIFLMSGCTNNTNSNTNSNYSGLKVHYID
FT                   VGQGDSELIQVNGKNLLIDAGPNESRDKLMSYLNKQNIKKLDYVIATHPDEDHIGGMGN
FT                   VIKKYTVNKFYTPKKIVNTKTFEYMIQQLKNKNMKIDAPTPGLQLDLGKNTTAEILAPN
FT                   SKSYPDTNNYSVVLKLTYGNTKFLFTGDAEKTSEMEMIDKNYDLSADVLKVGHHGSSSS
FT                   TSQQFLDKVNPKIAVISCGKNNKYGHPHKKTINKLKKKNIQIYRTDISGTIILTSNGTK
FT                   ISKQD"
FT   gene            complement(725500..726225)
FT                   /locus_tag="CLJU_c06600"
FT   CDS_pept        complement(725500..726225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06600"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06600"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13730"
FT                   /db_xref="GOA:D8GNA6"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNA6"
FT                   /protein_id="ADK13730.1"
FT                   /translation="MLKTFLFYVVFFLYMVYSLVKKLKLDRIRKSGSEKEAENYIYIAV
FT                   KKWSNFILKLINASVKVTGTENIPQVPCLFVSNHQGFLDIPIILSSLDRTVGFIAKKEL
FT                   TKFKLVSYWMKQINCIFINRNDIRESIKSINKGSELLNNGHSMVIFPEGTRSKGPRIGE
FT                   FKKGSLKLALKSKVPIVPIAIDGSYKLREGNAHSMIKSANVNITICKPIYTDSLSREER
FT                   ESLADNIKSEISKHIYLEN"
FT   gene            726624..727985
FT                   /locus_tag="CLJU_c06610"
FT   CDS_pept        726624..727985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06610"
FT                   /product="(Re)-citrate-synthase"
FT                   /EC_number="2.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06610"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13731"
FT                   /db_xref="GOA:D8GNA7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNA7"
FT                   /protein_id="ADK13731.1"
FT                   /translation="MKKSSYEYKLNNVDSPNFYKNIFPYDEIPKINFNGVQIPKDLPEN
FT                   IYITDTTFRDGQQSMPPYTTEQIIRIFDYLHNLDNNSGIIKQTEFFLYTEKDRKAAQVC
FT                   MERGYEFPEVTSWIRANKEDFKLVKQMGIKETGMLMSCSDYHIFKKLRKTRKETMDMYL
FT                   GIVKEALDNGIRPRCHLEDITRADFYGFVVPLVNKLMELSKQSGIPIKIRACDTLGLGV
FT                   SYSGVELPRSVQAIMYGLRNNCGVPSECIEWHGHNDFYAVVNNSTTAWLYGASAVNTSF
FT                   LGIGERTGNCPLEAMIFEYGQIKGNTKNMKLEVITELSEYFKKEMEYAVPPRTPFVGKE
FT                   FNVTRAGIHADGILKDEEIYNIFDTDKILGRPVVVAVNQYSGHAGIAAWINTYYRLKDE
FT                   EKIDKWDTRIAKIKEWVDEQYKAGRTSIIGNDELELLVDKMLPDISQKKEERAS"
FT   gene            728066..729991
FT                   /locus_tag="CLJU_c06620"
FT   CDS_pept        728066..729991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06620"
FT                   /product="aconitate hydratase/aconitase"
FT                   /EC_number="4.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06620"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13732"
FT                   /db_xref="GOA:D8GNA8"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006250"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNA8"
FT                   /protein_id="ADK13732.1"
FT                   /translation="MGLNASQKIIKNHLVKGKMIVGEEIAIKIDRTLTQDSTGTMAYLQ
FT                   FEALGINRVKTKKSVAYIDHNILQSGPENADDHLYIQTVAKKHGIYFSRPGNGICHQVN
FT                   LERFGVPGDTLLGSDSHTPTGGGIGMLAIGAGGLDVAVAMGGGEYYINMPKIVKVNLRG
FT                   KLSPWVTAKDIILEMLRRCTVKGGVGKIFEYVGEGVKTLSVPERATITNMGAELGATTS
FT                   IFPSDDTVRDFLKAQGRVKDFSYVQPDADAVYDEEMEINLSTLEPMVACPHSPDKVVPV
FT                   SQLKDVKVNQVCIGSCTNSSFVDMMKVAHILKGKTVNENVSLTISPGSKQVLNMIAQNG
FT                   GLASMVGSGARILESACGPCIGMGQSPSTDAVSLRTFNRNFEGRSGTRSAKIYLVSPEI
FT                   AAASAIKGYIADPRELGEPIYIEMPDEFLVEDNMIAPPDETGDNIKVVRGPNIKPFPKA
FT                   KSCENITCGKVLTKVGDNITTDHIMPSNAKLLPYRSNIPHLAEYCLTPCDEDFPKKAKE
FT                   NGGGIIVAGSNYGQGSSREHAALAPLYLGVKAVLAKSFARIHRANLINNGIIPLVFENE
FT                   DDYDKIDVMDELVIEDTLKQIKNDVVTVKNKNRNEEYKMVFNVTDRQRDMIKFGGLLNM
FT                   MKENNK"
FT   gene            730009..731019
FT                   /locus_tag="CLJU_c06630"
FT   CDS_pept        730009..731019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06630"
FT                   /product="isocitrate dehydrogenase, NAD-dependent"
FT                   /EC_number="1.1.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06630"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13733"
FT                   /db_xref="GOA:D8GNA9"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNA9"
FT                   /protein_id="ADK13733.1"
FT                   /translation="MTHKVTLIKGDGIGPEICEAVKKVINKSGADIDWEILEAGASILD
FT                   KYGTPIPDNIIESIKKNKVALKAPVTTPVGKGFKSVNVTLRKKLNLYANIRPIKTYSGV
FT                   KCRYDNVDLVIFRENTEDLYAGIEHMINDEIAESVKIISKKASERIVEAAFQYAIKNGR
FT                   KKVTAVHKANIMKLSDGLFLKTAEKVAEKYKGIQFESVIVDAMSMKLVLNPEDYDVLVM
FT                   PNLYGDILSDMASGLIGGLGLVPGANIGEDAAVFEAAHGSAPDIAGQNKANPTAIILSG
FT                   VMMLNYLGETEAANKIEIAIESVLREGKYLTEDLGGNATTTVFTKAIIEKIENCN"
FT   gene            complement(731182..732465)
FT                   /locus_tag="CLJU_c06640"
FT   CDS_pept        complement(731182..732465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06640"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06640"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13734"
FT                   /db_xref="GOA:D8GNB0"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNB0"
FT                   /protein_id="ADK13734.1"
FT                   /translation="MSEERKLGFETLQVHAGQVPDPTTGARAVPIYQTTSFVFKDADEA
FT                   ADFFQLKKPGNVYARIMNPTEDVFEQRVAALEGGSAGLATSSGLAAILYAVLNVASAGD
FT                   NIVAASTLYGGTYELFSVTLKKLGIDVTFVDPDDPENIRKAITDKTKAVYAETIGNPRI
FT                   NVLDIEAVANIAHENKIPLIIDNTFGTPYLVRPIEYGADVVVHSATKFIGGHGTTLGGI
FT                   IVDGGKFDWAASGKFPDFTTPDESYNGLVYADLGPTAFATKARVQLLRNTGATLSPQSA
FT                   FYFLLGLESLSLRVERHVENTRKVVEFLSKHPKVAWVNYPELDGSPYKELAKKYLPKGA
FT                   GSIFTFGIKGGSEAGKKFINSVKLFSLLANVADAKSLVIHPASTTHAELNEEQQKAAGV
FT                   TPDLIRLSIGVENIDDIIYDLDQALAKA"
FT   gene            733318..735717
FT                   /gene="metH1"
FT                   /locus_tag="CLJU_c06650"
FT   CDS_pept        733318..735717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metH1"
FT                   /locus_tag="CLJU_c06650"
FT                   /product="methionine synthase"
FT                   /EC_number="2.1.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06650"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13735"
FT                   /db_xref="GOA:D8GNB1"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017215"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNB1"
FT                   /protein_id="ADK13735.1"
FT                   /translation="MLFKDLLNKFSNKFVFFDGAMGTMLQRAGLKVGELPETLNITNSE
FT                   IIRKVHREYLNAGSDIIITNTFGANELKYSSSDYTIKDVITAGVKIAKEEAKDKLVALD
FT                   IGPTGQVMEPTGSLSFESAYELFKSQVIIGEKAGADIILIETMSDLYEAKAAILAAKEN
FT                   SSLPIFCTMTFQQDGRTLMGTDPKTMVFVLESLGVDALGVNCSLGPGELQDIVDEILKY
FT                   SSIPVIVQPNAGLPKYDGENTIYDITSDEFAENVVIMAKKGVRFFGGCCGTSPEFIKTM
FT                   VKSLKNIVPLDIKEKNYTTVCSARDTVFLGNRIKFIGERINPTGRDIYKKELKEGKVNF
FT                   IQKEAVKQKEEGAHILGLNVGLPEINEVQTMKEAVKAIQKVVQLPIDIDSPNPKVLEAG
FT                   VRVYNGKPIINSVNGRKKCMEEVFPIVKKYGGCVIALTIDENGIPDTAEGRVKIAEKII
FT                   KTAENYGIKRKDIIVDCLTLTASAQQKEVLETIKAIKILKEQFGVKTTLGVSNISYGLP
FT                   RRCILNRTFLALALQAGLDLPIINTADKGVKDIISAFEVLTNIDKEGKEYVKKYSGKSE
FT                   GEKAKWGSDIPNSGENDKNLKQTIIDGMEEEAVELTCKLLKSKKAVDIVNSYIIPALDE
FT                   VGVQYENKDIFLPQLIQSAETVKQAFEIIKKDMLKSGENKISRGKIILATVKGDIHDIG
FT                   KNIVKVLLENYGFEVIDLGRDVDISEVVDAIIKNNVKLVGLSALMTTTVSNMKKTIDAI
FT                   RDKGLQCKVVVGGAVLNQNYADMIGADYYAKDARETVKIAEELFSV"
FT   gene            735939..736625
FT                   /locus_tag="CLJU_c06660"
FT   CDS_pept        735939..736625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06660"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13736"
FT                   /db_xref="GOA:D8GNB2"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNB2"
FT                   /protein_id="ADK13736.1"
FT                   /translation="MGEKINKKDVKYVPEIRGVLRGHMINFPGVIREASGIIVFGKRIK
FT                   SFAFTTDIAVIKNIDADAILAVYPFTPQSVITESLVTASDVPIFCGVGGGLTTGKRVVN
FT                   LALNAEFTGAMGVVLNSPTSNEIVRAVREAIDIPIIVTVVSERDDIQKRMESGTSILNV
FT                   SAGKNSASLVRKIREKYKDIPIIATGGRTKESIEETIEAGANAISYSPPSTAELFKGTM
FT                   EKYRNM"
FT   gene            736839..737663
FT                   /locus_tag="CLJU_c06670"
FT   CDS_pept        736839..737663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06670"
FT                   /product="predicted extracellular amino acid-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06670"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13737"
FT                   /db_xref="GOA:D8GNB3"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNB3"
FT                   /protein_id="ADK13737.1"
FT                   /translation="MKKLKKTIIVMLTIVFAAALFAGCGSSNSNSGDEQKGQNALERVK
FT                   KAGVLKVGLEDSFPPMEFRDNQNVLKGFDIDMANAIGKKLGVKTQFVGTEFNGIILALN
FT                   SGKFDVIISGLSIDEKRKKQIDFSQPYIQNAQIIVTKSGNEAIKTSKDLAGKKVGVGLG
FT                   TTSEKVVQTLQGIKEVKKYDKTTEELQDLLIGRIDAVIVDEPVGKYYISSPDKKGKYTV
FT                   LNEKLTNEPMGVGFKKGDKELETAVQKALDELKKDGTMSKISTKWFGEDIYK"
FT   gene            737747..738343
FT                   /locus_tag="CLJU_c06680"
FT   CDS_pept        737747..738343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06680"
FT                   /product="predicted amino acid ABC transporter, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06680"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13738"
FT                   /db_xref="GOA:D8GNB4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNB4"
FT                   /protein_id="ADK13738.1"
FT                   /translation="MTIELTVITLILGTMLGVFLALLKLSKNIVLKLVSSFYTWIFRGT
FT                   PLLLQLFFFYYGLPFIGIELTPFTAAILGLGLNCGAYMAEIIRGGIQSINKGQFEAAKA
FT                   LGFSYVETMRKIILPQTWKIIIPPVGNEFISILKDTSLVSTIAMVELMRSAQQIYASSF
FT                   DPISVFLTAAILYLIMTTVFTTVFGIFERRLAIYS"
FT   gene            738377..739156
FT                   /locus_tag="CLJU_c06690"
FT   CDS_pept        738377..739156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06690"
FT                   /product="predicted amino acid transporter, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06690"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13739"
FT                   /db_xref="GOA:D8GNB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNB5"
FT                   /protein_id="ADK13739.1"
FT                   /translation="MENAILNNGENLDKNEYMIEASNLTKSFNNLLVFKDLNVKVKRGE
FT                   VLVVIGASGSGKSTLLRCLNHLEELDSGTIVIEGDKLNPKDKKMLRKITTKMGMVFQNF
FT                   NLFPHMTAVQNVMEAPLVVKKEKKSEVLQRAKQLLSKVGLADKMEYYPSKLSGGQQQRV
FT                   AIARALAMNPDIMLFDEPTSALDPELVGEVLNVMKDLAKEGMTMVVVTHEMGFAREVAD
FT                   RVIFMDGGKIVEQGTPEEVFSHPKEDRTKEFLNKVLK"
FT   gene            739231..740436
FT                   /gene="argG"
FT                   /locus_tag="CLJU_c06700"
FT   CDS_pept        739231..740436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="CLJU_c06700"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06700"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13740"
FT                   /db_xref="GOA:D8GNB6"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNB6"
FT                   /protein_id="ADK13740.1"
FT                   /translation="MKDKVVLAYSGGLDTSIIIPWLKENYDLEVIAACINVGQDDDMEE
FT                   VEKKAIKTGASKVYIEDLKEEFVKDYLFKAVKANILYEDAYFLGTSLARPLMAKRLVEI
FT                   AHAEGAKYIAHGCTGKGNDQVRFEVGVASFDPTIKIIAPWRIWDIKSREDAIDYANSKG
FT                   VDVPVTKEKIYSNDKNIWHVSHEGGDLEDPRNEHKTSMYFMTTTPEKAKDEDTYIELYF
FT                   EKGEPKRLNGKELSPLDMMEQLNKIGGENGIGIVDMVENRLVGMKSRGVYETPGGAILY
FT                   AAHTALERLTIDKDTFHYKQLVSQRYGELVYDGLWFGSLREALDAFVESTQENVTGTVK
FT                   LKLYKGNIMPASIDAIHPLFNESISSFGASDLYDHKDADGFIKIFSLPSKIRAAVKKEK
FT                   EN"
FT   gene            740438..741754
FT                   /gene="argH"
FT                   /locus_tag="CLJU_c06710"
FT   CDS_pept        740438..741754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="CLJU_c06710"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06710"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13741"
FT                   /db_xref="GOA:D8GNB7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNB7"
FT                   /protein_id="ADK13741.1"
FT                   /translation="MKLWGGRFKKSESKLMEDFNSSLSFDKLLYSEDIEGSMAHVKMLS
FT                   KCNILSKEEGESILKGLQSILSDIEDGKLKIEGDYEDIHTFVEVNLIERVGQVGKKLHT
FT                   ARSRNDQVAVDFRLYCKKSALEVIKNIEKLQDVIKNLGENNNIMMPGYTHLQRAQVVTF
FT                   KHHIMAYYNMLKRDKARISNAVEIMDENPLGCCALAGTTYNIDRSFTAKELGFKKPVDN
FT                   FLDGVSDRDYVLELLSNFSIIMMHLSRLSEELILWSSKEFDFVQIDDEFSTGSSIMPQK
FT                   KNPDAAELIRGKTGRVYGSLMSLLTTMKGIPLAYNKDMQEDKEQFFNSLDTVLSCLKVM
FT                   SGMLSTLKIKKDNTFKAVKRGFLNATEAADYLVNKGMAFRDAHKVIGEIVLYCEERDKA
FT                   IEDVSVDELKKFSSLFSDDVYEFINYENTLNRGIKKNLR"
FT   gene            complement(741815..742033)
FT                   /locus_tag="CLJU_c06720"
FT   CDS_pept        complement(741815..742033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06720"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06720"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13742"
FT                   /db_xref="GOA:D8GNB8"
FT                   /db_xref="InterPro:IPR007211"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNB8"
FT                   /protein_id="ADK13742.1"
FT                   /translation="MRTLDIIALTLVVIGALNWGLIGFFRFDLVASLFGTMSTATRVIY
FT                   ALVGLGGLYALSFFGNERSTGDTKEVK"
FT   gene            complement(742144..742623)
FT                   /locus_tag="CLJU_c06730"
FT   CDS_pept        complement(742144..742623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06730"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06730"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13743"
FT                   /db_xref="GOA:D8GNB9"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNB9"
FT                   /protein_id="ADK13743.1"
FT                   /translation="MSLKINGLDDLDLQILEILLKDSRTPFLEIARQCHVSGGTIHVRV
FT                   KKMEDMDIIKGTKLIIDNSKIGFDVCGFIGIYLDKAKSFNNSLDELKQIKEIVEIHYTT
FT                   GDYSIFVKVLCKNITDLQNLLMNKIQSVDGVQRTDTIISLFQPVDRSIDIDVLDE"
FT   gene            742918..743886
FT                   /locus_tag="CLJU_c06740"
FT   CDS_pept        742918..743886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06740"
FT                   /product="asparaginyl-tRNA synthetase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06740"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13744"
FT                   /db_xref="GOA:D8GNC0"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNC0"
FT                   /protein_id="ADK13744.1"
FT                   /translation="MKTYVLKDEKELKLLDETMEKIRREKLPTILGIQQAILRAVDDYM
FT                   YKNGVVRLLPNMLAPITDPLCHSVEECAITYQGQEFNLTKSMIFHKQIALSSPNLQKIY
FT                   IVSPNVRLELPERGDKRHLFEFTQVDFEFKDGTMNTVFEFMEGLVKYVFDYIKEECKDK
FT                   FEKLGIGTSHLNITGPFERHTTQELKAKYGDDFEAIASQKATQPFWLINHKREFYDAED
FT                   LDNRGTYRNYDLIWPMGYVEGLSGGEREYKYDRIITRMREAKMDESLLRNYIELAKRGE
FT                   LPKTAGAGFGVERMTRFVCQQKEIDDVTVFSRKPGKEKYIF"
FT   gene            744038..744400
FT                   /locus_tag="CLJU_c06750"
FT   CDS_pept        744038..744400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06750"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06750"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13745"
FT                   /db_xref="GOA:D8GNC1"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNC1"
FT                   /protein_id="ADK13745.1"
FT                   /translation="MPLWLQVLLQVAFIAIIFLFVYNQLKIRILYKFHPNRWIILLLSI
FT                   AAFFLPTIIAAYFRYNLNGSVWQYISSAVFLVLFLWFVDLRSGAIYDVKGSQKEKNIKI
FT                   KPKAKPNRAKHNKNKK"
FT   gene            745098..745796
FT                   /locus_tag="CLJU_c06760"
FT   CDS_pept        745098..745796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06760"
FT                   /product="predicted transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06760"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13746"
FT                   /db_xref="GOA:D8GNC2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNC2"
FT                   /protein_id="ADK13746.1"
FT                   /translation="MKNSIYCKIADDIRDKIISGELKTGDDLPSETALCSEYSTSRMTV
FT                   RKGLTILSNDGYIYSIPGKGYFVQKPNYNKYTIFYSERNNLINDVDRIKLLSVDVVLPD
FT                   DKLATNLRISKNRKIIRIRRLFYTQGDPMAYDLKYLVYQKGVPIIENEIENATFPEMMS
FT                   NRASLYSLNKEIVMYAKMPGEEIKELLKMYDEVALFVVEQKLNDVKDKPIGFGITYFRG
FT                   DYIKLHGVSQ"
FT   gene            746058..747167
FT                   /locus_tag="CLJU_c06770"
FT   CDS_pept        746058..747167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06770"
FT                   /product="predicted xanthine and CO dehydrogenases
FT                   maturation factor, XdhC/CoxF family"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06770"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13747"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNC3"
FT                   /protein_id="ADK13747.1"
FT                   /translation="MEKIYKEVVKLLQKEESFVIATIFDKTGSAPRTAGAKMVVRNDGS
FT                   IIGTIGGGRLEADAIGLAKKSLSLKQTVMQSFDLTHNDVASMDMICGGKGEILIDFIDA
FT                   QDENNRIIYETVVKIQEKREKAWFITVLDNVSGTSNLRCQQCIVKPDKTLIGKVDCDPN
FT                   ILEKLIAGPAKISIHAEVIDNQRFLVEPLRPEGTVYIFGAGHVSQRIAPLSETVGFRTV
FT                   VLDDREEYANRSRFSEPTELMVIDSFNKLPNLHIDEDSYLVIVTRGHLYDRVVLEQVLR
FT                   SNAKYIGMIGSKSKRDKIFTQLLNQGYAKEEIRSVYSPIGTSIGAETPEEIAVSIVGEL
FT                   IKVRSEGEKTNSKKSGNTSDIYCNINDPD"
FT   gene            747363..747743
FT                   /locus_tag="CLJU_c06780"
FT   CDS_pept        747363..747743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06780"
FT                   /product="predicted penicillinase repressor"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06780"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13748"
FT                   /db_xref="GOA:D8GNC4"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNC4"
FT                   /protein_id="ADK13748.1"
FT                   /translation="MKEMPKISAAEWEVMKLLWKQNSLTSEKIINSLTIKMNWSAQTVK
FT                   TFITRLSKKEAIGFKKVGRIYNYYPLISEDECVRAENQSFLEKVYDGAVSMLFTKFLEE
FT                   ESLSEKEIQELEQILKNKKQGK"
FT   gene            747784..749955
FT                   /locus_tag="CLJU_c06790"
FT   CDS_pept        747784..749955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06790"
FT                   /product="putative antirepressor regulating drug resistance
FT                   (MecR1), membrane-bound"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06790"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13749"
FT                   /db_xref="GOA:D8GNC5"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNC5"
FT                   /protein_id="ADK13749.1"
FT                   /translation="MDILIRSFLCFFRDSITASIAGLLIILILKLFDKHISVRLQHALW
FT                   IIVVIRLIIPVEFQSNLSLLNLLHENHQNSSNIENKSTIKSMTYAASDFLREGKIQYSY
FT                   TSKNQISKVNQSPSKIVYSRENIIKEYITSRILGIASFIWIVGVFSIAAFLSAVRLQFK
FT                   RKILNLEEVRDLESIKLLNECKNKVNITRDIPVYICDNFKSPCTLGIIKPKVYIPKCVC
FT                   TKNNLKQLYYIFLHELIHYKRMDLVYNFLAVLAVILHWFNPIVWFCMKRMKLQRECACD
FT                   TYVLEIIGEEKAEDYGMTLINFSKLVSSNKVPRLAVFFETKNQIKRRIEMIKNFKKGSY
FT                   KMSAAAVICCVLASGAILTTAVNAKSMKAYKTAAVVSSNNSSVKNQNSKFLIDAPIKYY
FT                   DNLKRAEEVTGFKVKVPDYIPTKYVLASIHVIKVSDTDNSLEVSFSKKDGVFNFQASKV
FT                   DMEQCLKQIAEDQSKGKVEVNKEAMNLEGINGYNITIKRTLPMGYNYKIIDKCFIWQNE
FT                   GVWYSIGYSIETQRKENKSSTIGIPIDDVGKIATSIKYDQDVKNVSYSIPKDVSTEVAT
FT                   LPIYDKEDLKKAKELLGFNPKFPLSINKNITIKGSLVGISGDSDIKNKKIGYELGTFYN
FT                   LKNGLLVFTQGKSSKAYDDMSKKANTIKIDGKEVLKYETYEKSVANKQLKEDIYVWKEN
FT                   GFYCEVSIMANIANQDEIVKGFVDSKPID"
FT   gene            complement(750041..751474)
FT                   /locus_tag="CLJU_c06800"
FT   CDS_pept        complement(750041..751474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06800"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13750"
FT                   /db_xref="GOA:D8GNC6"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNC6"
FT                   /protein_id="ADK13750.1"
FT                   /translation="MNLNLNEDDVLKLLNDVNINENEFSSDDLNEFEKKKICKDIISKV
FT                   KPKKPKGKKNFIAAAIIFLITIPIIISQKNVLANMIEKLTVISGIGEVKVSSDRPKILK
FT                   NSIKQGNITLANMYIDNNKIIVTLTIEPEELKRSYYTITDNHGNSYELHSSDNLALMPD
FT                   NQIGSYRAEYNGKVKKANSYTLSIVDNDKKFTKATFKLKNSNFKEAAESKILYTATNGI
FT                   TTLNVTSLKRQGNILKVDYYFTDTLPDFKSKRIDTLNYGTFQEGKEWGCKEPISTKLIN
FT                   NNSIQNSHIIISDEYNNAVYGHNNINYLDQGNESLFDLSKLTGKKLKLTVPNVIYHTDS
FT                   INFKAINNDLNNFNNETSDFNLELDIPKSGKSILNKIVNYKGFKFKIISINRLSNDSIE
FT                   LIYNYINDSNSRLQTSNILFESVTDGDGECNPSQNNGNIKVFYKLQNGIGDNLKLNHLQ
FT                   YTFSSVGPFEIDLNPSTIK"
FT   gene            complement(751471..752034)
FT                   /locus_tag="CLJU_c06810"
FT   CDS_pept        complement(751471..752034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06810"
FT                   /product="predicted RNA polymerase sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06810"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13751"
FT                   /db_xref="GOA:D8GNC7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNC7"
FT                   /protein_id="ADK13751.1"
FT                   /translation="MKINDKNFLLELKRKNPAALEYIINIYCNLVFKVVLNVLGNDNYE
FT                   NAKECINDVYLLIWNKSHLYNPEKSSFKNWLLAVSKYKAIDYKRSLVKQDNLQIEEQML
FT                   ISNTDIENEYILREKKEELIKLLQYEHKLDRELFIRKYLLDQDMETLCKNFNLSKGAIY
FT                   NRLWRTKNSIIRKLHISGEVEVSK"
FT   gene            752124..752516
FT                   /locus_tag="CLJU_c06820"
FT   CDS_pept        752124..752516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06820"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06820"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13752"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNC8"
FT                   /protein_id="ADK13752.1"
FT                   /translation="MKIPIIAKFAAERATDQEIENIRKIENKFEEEANEGIYNPETDKK
FT                   LHVEISKASHNDLFIKFTNDINNVMKEHKMWIFLRDRTVTRLEYRDINVSEHMEIVKSI
FT                   ESCDGEEAMKKMPKHMNSLYDRYWKE"
FT   gene            complement(752759..753979)
FT                   /locus_tag="CLJU_c06830"
FT   CDS_pept        complement(752759..753979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06830"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06830"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13753"
FT                   /db_xref="GOA:D8GNC9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNC9"
FT                   /protein_id="ADK13753.1"
FT                   /translation="MKKILHVIAQRPEKTGSGTYLQALIEQGDKKGYSQAVIAGIPADE
FT                   FNIHFKENVKFYPVVFQTEKLPFPVVGMTDIMPYKSTMYRKLDNDMLIKWKNAFSEVLT
FT                   KSVAEFRPDIIITHHLWILSAMVKEMFPLIKTIAICHGTDLRQMDLAPNFNNYVSKYCR
FT                   KIDNIAALHEDQKNEIIKKYQIDKNKITVVGVGFNPNIFYTNDTEKNMDKIKLIYAGKL
FT                   NFAKGIPSLIKSYNKLDIDRNSIELILAGSGTGSQFKAIEKMAEESRLRIILKGSISQK
FT                   ELSKLFRESHLFVFPSFFEGLPLVLTEALASGMLIVTTNLPGVKDFFGDYINKKGLIEY
FT                   VKMPSLKSLDEPFEEDLPNFEKEFSKAIENQLEKIKNKYYKKDPKVKEVIDNMSWKGVF
FT                   NKIENLF"
FT   gene            complement(754078..757119)
FT                   /locus_tag="CLJU_c06840"
FT   CDS_pept        complement(754078..757119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06840"
FT                   /product="predicted ribonucleoside-diphosphate reductase"
FT                   /note="adenosylcobalamin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06840"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13754"
FT                   /db_xref="GOA:D8GND0"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="InterPro:IPR013678"
FT                   /db_xref="UniProtKB/TrEMBL:D8GND0"
FT                   /protein_id="ADK13754.1"
FT                   /translation="MDCVKDLFKRYFTKSLKQNNNKTVYDLFKWKKVDVFLKDHKTGKV
FT                   LVDMKNLEFPENYSQNACDIIASKYFRKAGVPGENGYENSMKSVTHRMVNFWCESLKDE
FT                   GLIKTEDESSIFYDECAYALLNQMCAPNSPQWFNTGLKLSYDICGAKQGNYYFDENLNK
FT                   VVESKDNYTRTQASACFILSIEDKLLGSHSISNQFVTETKLFKGGSGTGTNFSTIRAKG
FT                   EKLSGGGSSSGLMSFLKALDKNAGAIKSGGTTRRAAKMVCLDVDHPEIMDFINWKSKEE
FT                   DKVRALGKMGYDTDIDGEAYETVSGQNSNNSVRFSDEFMNKVSKLEQNPDDTIELIGRT
FT                   DPKLNRIEKIKNIWDAFNNSAWKCADPAPQFSTTFNAWHTCPAGEDGKLNAPYNRINST
FT                   NPCGEYAFLDDTSCNLASINIYKFYNITNNTFDIEGYLHIIDLVQLILESSIHWGQFPT
FT                   EDIARKTYLFRTTGLGISNIASLFMVMGYPYDSDEARTLAASLVGILTGESYYVSSLMA
FT                   KEIGPFKKFEINKPYMMRVLRNHARAASVDIESLQAILGNNFSNEFEDLNYVPLKVKHS
FT                   VLKKEGLSYIGKTLKDCWINALKSGIKFGYRNAQVSVIAPTGTISFAMDCGATSIEPFF
FT                   SHIVYKKLSGGGFMTIINPVITIALKNLGYTSEQIEDILSYVLEKENVSENDYTYEKIL
FT                   DGKIEGAPHLKDEHLSIFDTSNKCGSGERYIDPMGHVKMVASLTPLISGSVSKTVNLPK
FT                   TASVQDFKDVVLTSWKLGVKGITLYRDSSKAAQPLNTTLSDSNDINIEDFTYNQLLSKV
FT                   KELQKGIKYSKRDKIIGIRKGTTHPAQIDDVKIYTTVNRNSNDEISEIYITTDREGTII
FT                   MGLLNSLSKAISVMLQYHVPPQDISRMLRGQKYEPYGFVQKHPYIKYVSSISDLISKVI
FT                   DIELGDFSRCQVKPENYDKDSLVLGNSSPELNTIKTNGNETKIKKIDGEKVYGTVCPTC
FT                   SSTRMVRNGTCMVCLDCGSTTGCS"
FT   gene            757430..757936
FT                   /locus_tag="CLJU_c06850"
FT   CDS_pept        757430..757936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06850"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13755"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNQ9"
FT                   /protein_id="ADK13755.1"
FT                   /translation="MIRKFEHYIPDIDKSCFVVDNAEVIGKVKLCEDANVWFGAVLRGD
FT                   VSNIYVGKGSNIQDNCTVHTGEKSPAEIGEYVTVGHNAVIHGAKIGDNSLIGMGSIILD
FT                   NAEIGSESIIGAGSLVTKNKKIPSGVLCMGSPAKVIRRLTLEEKKSLRRSAEDYIERAK
FT                   NYSEY"
FT   gene            758011..759282
FT                   /locus_tag="CLJU_c06860"
FT   CDS_pept        758011..759282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06860"
FT                   /product="D-glutamyl-meso-diaminopimelate peptidase"
FT                   /EC_number="3.4.19.11"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06860"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13756"
FT                   /db_xref="GOA:D8GNR0"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR034274"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNR0"
FT                   /protein_id="ADK13756.1"
FT                   /translation="MPIFKLGSRGTQVMKIQAVLRKIGYNLNTIDGIYGRETEQAVKNF
FT                   QKNNGLAPDGIIGSNTYRVLRDFILGYNTYIVKPGDTLYNIAQEYKTQVYKITVANPQV
FT                   HALGLIPGTILKVPYDIDVVDTNINYTYDILEQDLVGLEARYPFIIIGNAGQSVLGRKI
FT                   YYVRLGVGPNEVSYNGSHHSLEWITTPLLMKFIENFAKAYAEGRNIRGYSPADIWRRSS
FT                   IYIVPMVNPDGVDLVLNGLQRSNPFYNELIRWNKGKTDFSKDWQANNRGVDINHNYNAG
FT                   WEFSKAAEPSYGVYGPGPTRYSGPYPESEPETRSMVAFTNSHNFRLVLAYHSQGEVIYW
FT                   QYNALTPPESRRIGELFARVSGYRLEQTSGITSYSGYKDWFIKSHGRPGFTIEVGKGTN
FT                   PLPITQFPKIYNDNEEILLLASVI"
FT   gene            complement(759291..759713)
FT                   /locus_tag="CLJU_c06870"
FT   CDS_pept        complement(759291..759713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06870"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13757"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNR1"
FT                   /protein_id="ADK13757.1"
FT                   /translation="MEISRIGVTSKPSSSNKNISVKKDFSQSFNSQMEKKSEQELKNMF
FT                   DSIKKKGNRLAITKCYSDVRSYKKMIKEYLESVLSYMYSVKKDISFWQTQYFITVDTID
FT                   SKLEDLTNMLMSEQKDNLNVAATIDDISGLLVDIYK"
FT   gene            complement(759772..759894)
FT                   /locus_tag="CLJU_c06880"
FT   CDS_pept        complement(759772..759894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06880"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13758"
FT                   /db_xref="GOA:D8GNR2"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNR2"
FT                   /protein_id="ADK13758.1"
FT                   /translation="MILCRIIYVYILSKSKNMYFNLILNTINYIFYKILYIIDI"
FT   gene            759972..762599
FT                   /locus_tag="CLJU_c06890"
FT   CDS_pept        759972..762599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06890"
FT                   /product="predicted cation-transporting ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06890"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13759"
FT                   /db_xref="GOA:D8GNR3"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR006408"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNR3"
FT                   /protein_id="ADK13759.1"
FT                   /translation="MWYKKSIEEITKEFATDVINGLTSEEASVRIKKYGENKLIEKKKK
FT                   SILKLLLEQVNDVLIYILVAAAVVSAALGEISDAIIIMVVVVLNAVIGLIQESKAEKAL
FT                   DSLKKLSVPKALVKRNGEVIEISSENIVVGDIIILDAGKYVPCDLRLVETGNLKIEESA
FT                   LTGESVPSDKYVEDILEDQDIALGDQKNMAFMSTLATYGRGIGVAVATGMNTEIGKIAK
FT                   MLDNDEKNLTPLQRKLGQLGKMLGFVVIIICVLMFITSLIQKRDLFEMFLTAISLAVAA
FT                   IPEGLPAMVTIVLAVGVQRMIGKNAIIRKLPAIETLGSVNIICSDKTGTLTQNKMTVTK
FT                   FYADNILNNISAVDLKNNIHKELVENMVLCNDATYSESSKTGDPTEIALLEMGVKFNVF
FT                   KSDENKEHSRVNEIPFDSDRKLMTTLNKYGNKYRIITKGAVDNLIKICENIYLKGEAVP
FT                   FTEELKSNVLNAANSMSNEALRVLSVAFKVIDSPKIQIDSMESGLTFVGLVGMIDPPRE
FT                   NVKKSIDECKKSGIGVVMITGDHKNTAFAIAKELGIADHESQAILGAEFDKLSEKDIHD
FT                   RIDNLKVFARVSPEHKVNIVKALKKKGNIVSMTGDGVNDAPSLKTADIGVAMGITGTDV
FT                   AKGAADMVLTDDNFSTIVEAVKQGRNIYNNIRKSIVFLLSCNIGEIIALFMAIVLGWPT
FT                   ILRPIHLLWVNLITDSLPALALGVDPDDPDIMKEKPRDPRKGLFSGKSGVFLVVNGILI
FT                   GVLTLAAFYIGTKLYANSLIHAQTMAFVVLSVSQLFYTLSIRHHEKSMFEVGIFSNKYL
FT                   IGAIVVGIIMQSIVITVPFLSSVFKVFKLTINDWIFVLALSLVPLLVNEIIKLAYRKSV
FT                   RNIA"
FT   gene            complement(762957..763829)
FT                   /locus_tag="CLJU_c06900"
FT   CDS_pept        complement(762957..763829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06900"
FT                   /product="predicted nucleic acid binding protein with S1
FT                   RNA binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06900"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13760"
FT                   /db_xref="GOA:D8GNR4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039566"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNR4"
FT                   /protein_id="ADK13760.1"
FT                   /translation="MILIGKFNKLKITREASFGYYLDAGTGRTKDDILLPKNDITEDTL
FT                   SIGDEVNAFIYKDSKDRIISTLKKPKAEIGELAYLKVVANTSFGSFVDIGLERDVLVPL
FT                   AEQKYKLTPEKYYLFYLYVDKTNRIAATTDIDRYLLTLDVESNEKDEKYTLGSEVKGTI
FT                   YGFQTNNSAMVAVDNLYRGVILNNEYFTDIYPGDELNLRIKKIYEDGKLGLTPRSVPKN
FT                   ERLSLEESILDYLENHNGFMPYNDKSSPEDIRNTFHESKNYFKNALGGLMKRHLILQDE
FT                   NGTRLKNTK"
FT   gene            complement(764261..765397)
FT                   /locus_tag="CLJU_c06910"
FT   CDS_pept        complement(764261..765397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06910"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06910"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13761"
FT                   /db_xref="GOA:D8GNR5"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNR5"
FT                   /protein_id="ADK13761.1"
FT                   /translation="MTKDRLAELDIMRGIAFILVVIQHTFGGYSFIKDISLENRLISKL
FT                   IYSIGKTAVPMFVALTAICLIYVYYDRMDVLNFYIKKLKFLILPYIFCSLINDLILNHS
FT                   TYGFTNFIGQIVTGSSAYHLWYMGMIIRLYLYIPLIFLFIKKLNGTSTFIKKLFFIFSF
FT                   VLYYLILKDNNHVTSAIGKLLFGTPSKLQQSFINITPLLWIFYFVVGSYMIFNYTNLKA
FT                   MIKKYKYALIGGYTILLSYFYYDDVKDFIGNPLPFIKFDHALYIVYVTTAILFFYMLSL
FT                   YIDTVSKKISILLSFIGKYSFPAYMLHIIVIQKWSEKIPSTHYLYSPLIKLLVTIIITP
FT                   IICCMISYIPGSRYLIGIRSKFKNKSIIVQKLKINVNR"
FT   gene            765571..767484
FT                   /gene="nadE"
FT                   /locus_tag="CLJU_c06920"
FT   CDS_pept        765571..767484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="CLJU_c06920"
FT                   /product="glutamine-dependent NAD(+) synthetase"
FT                   /EC_number="6.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06920"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13762"
FT                   /db_xref="GOA:D8GNR6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="InterPro:IPR041856"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNR6"
FT                   /protein_id="ADK13762.1"
FT                   /translation="MSSMDFVRVSAACPLTNVADIEFNLNNIKLCIDRALEEKSKLVVF
FT                   PELCITSYTCADLFEQQLLLEKSVEALKKLCDYSKDIDILIAVGAPLTYNCCLYNCAYI
FT                   IFQGSILGIVPKSYIPNYEEFYEKRWFTEGLKVTDEKVNFYFQEDIPFGTNLIFTCGNF
FT                   KFGIEICEDLWTVVPPSSYLCLMGANIIGNLSASNEVVSKSTYRRSLISSQSARCMCSY
FT                   IYSSCGVFESSTDLVFSGDMCISENGAILESGERFKRENQIITTIVDLGRLAAQRLRNV
FT                   SFRDSVKLFLEKPIEVKFQFETMNYGKFDRTVDKHPFVPSGKDEREIRCREIFNIQTSA
FT                   LAKRVSHTNLKRAVIGISGGLDSTLALLVTVKTFDMLKISRDNIITVTMPGFGTTDRTY
FT                   NNAVDLCKSLGTELREINIVDACLQHFKDISHDREIHDVTYENVQARERTQIIMDIANK
FT                   EGGLVIGTGDLSELALGWCTYNGDHMSMYSVNCSIPKTLVRYLVRYVADKEVSKNISDI
FT                   LIDILDTPVSPELLPKDKNGKIAQKTEDIVGPYELHDFFLYYFVRHSYSPEKILFLAKQ
FT                   AFKNDYTNDVICKWLKVFTKRFFTQQFKRSAIPDGPKVGTVSLSPRGDWRMPSDASFNL
FT                   WM"
FT   gene            767584..768009
FT                   /locus_tag="CLJU_c06930"
FT   CDS_pept        767584..768009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06930"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06930"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13763"
FT                   /db_xref="GOA:D8GNR7"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNR7"
FT                   /protein_id="ADK13763.1"
FT                   /translation="MFNIILWTVIGLVALFVDMVTSAFLFVWFTIGAIAAIVAGILKYS
FT                   FIVQLVVFLAVSIVLTAVCYPIVKKNIKKSIKPTLLREKTYVGKKVTIDKEMEKNNGIR
FT                   IDGVYWNIKNEGYTIKDGDTVKIIGMEGNKVIIKKEM"
FT   gene            768014..768952
FT                   /locus_tag="CLJU_c06940"
FT   CDS_pept        768014..768952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06940"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13764"
FT                   /db_xref="GOA:D8GNR8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNR8"
FT                   /protein_id="ADK13764.1"
FT                   /translation="MISKIFILIVLVAIIAVIVSSMKVVNTGYVTIIERFGQFHRVLEP
FT                   GWHFLIPFADFARRKISNKQQILDIEPQSVITKDNVKISIDNVIFYKILSAKDAVYNIE
FT                   DYKAGIVFSTITNMRNIVGDMTLDEVLSGRDKINAELLKVVDEITDAYGIKILSVEIKN
FT                   IIPPAEIQQAMEKQMKAERDKRAVILQAEGQKQSDIARAEGEKQAKILQAEAEKEANIR
FT                   RAEGLRQSQMLEAEGKAKAIESVAEAQSKAIHLVNRSIIDSGTDEKVIALKQVEALKEM
FT                   AKNPANKLILPNESISSLGNMAAIADMLQKK"
FT   gene            769523..770209
FT                   /locus_tag="CLJU_c06950"
FT   CDS_pept        769523..770209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06950"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06950"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13765"
FT                   /db_xref="GOA:D8GNR9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNR9"
FT                   /protein_id="ADK13765.1"
FT                   /translation="MKKVLIVEDEASIRGFLKINFKRNKFIVIEASTGERALEKARVEN
FT                   PIVTILDVMLPGMDGFKTCEILRREFPKMGIIMLTARSQDTDKIMGFGFGADDYVIKPF
FT                   NPQELIARVNALLRRIGLQSDSKNEVLVSGEFKIDEGAMKVYRSEQELELTPKEYMLMK
FT                   IFIENQGKALNRNELLNLVWGYSYPGDAKIVDVNIRRLREKIEENSSKPKYIETVWGVG
FT                   YRWRKE"
FT   gene            770235..771605
FT                   /locus_tag="CLJU_c06960"
FT   CDS_pept        770235..771605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06960"
FT                   /product="predicted sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06960"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13766"
FT                   /db_xref="GOA:D8GNS0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNS0"
FT                   /protein_id="ADK13766.1"
FT                   /translation="MIGSYLFIIIFTVVIIESFLIFSISRYYYKNMENMVSNQIKVSVD
FT                   FYNSYLASSSLKKNISDNADIFWKNTSAEVQVIDVSGRMLMDSIGNFIPGKVKGEDIKD
FT                   ALNGELGISIKTDKKTSEKVLYVSKALKSNRKVEGVLRFVTSLSEVDMIIKKISFMLIF
FT                   IGIAVIIMAGIISVFISNSITRPLREVTAMARKMASGRFNERIEKKRDDEIGELFDALN
FT                   FMADEILKNEKLKNEFVASVSHELRTPLTSIKGWASTMRTGDFSDKEELQTGLEIIENE
FT                   SDRLTKMVEELLDFSKFISGKITLKKDYVDIKNTIEYIKKQFSLRAWRQNINFSVKVQD
FT                   NMPLVLLDENRIKQVLNNLLDNAFKFTQEGGKVTLKAFVKDENLIMIVDDTGIGIPEDE
FT                   LPKVTEKFFKGKSDKCSNGIGLSICKEIVSLHGGKIEITSELVKGTEITLTIPVEDN"
FT   gene            771628..773073
FT                   /locus_tag="CLJU_c06970"
FT   CDS_pept        771628..773073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c06970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06970"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13767"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNS1"
FT                   /protein_id="ADK13767.1"
FT                   /translation="MKKLTALIGILVVCIVFVVYKNINSSLNPNIVPVKNINLPIAGTW
FT                   ILDRYVFTGDSSISEDKAKSMLGEKAEFSDKGVYFDNLICKNPSFKVKILDSKDYFQNN
FT                   FKIDPSSIGINEKYIKVVTVSSEDNFFDEFIEINKNVMLKFTDGIIFFFVKDGTQINNS
FT                   EFKNIDKNNSKLIIPKSQKETNSKSGLLLGLKCIDETGLGYNYRTLWISSSYGKIMPIV
FT                   NIKDLVVPRKSGFWKVGVKKVWEKGVKKDIVWGETLGNNKTSRIKYRSISGISSEILFV
FT                   GEEYISMDDKKVYNDDDGDQRFERGDFSVLPLDNFDGNKMDFSKAFGDDAGSRLKYSAD
FT                   LYLKKVNLSKNKIDENKLQTNWSVDRRSGRWMLRGRIPYGDFDVMYAAPTILTDYDDLY
FT                   PSFDVIKKDIPDAVDAYTSPNRDFIVVLTETELKIYSLNNKKIGKLDKEFDLKNGETAV
FT                   MSQWSLGSYVDEWNKLIKNMKKN"
FT   gene            773095..776547
FT                   /gene="addB"
FT                   /locus_tag="CLJU_c06980"
FT   CDS_pept        773095..776547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="addB"
FT                   /locus_tag="CLJU_c06980"
FT                   /product="predicted ATP-dependent nuclease, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06980"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13768"
FT                   /db_xref="GOA:D8GNS2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014140"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNS2"
FT                   /protein_id="ADK13768.1"
FT                   /translation="MSIRFIYGRAGSGKSYYCLQSIKKRIEENENRNLILLVPEQFSFQ
FT                   AEKNLLKSVGQKGMLKAQVLSFKRAAERVFGEVGGGTRKHVNDSGKAILLYEIIERNKK
FT                   KLKVFGKSTKKQGFVNMISDMITELKKYNTSIKLLQDSLDRIENINLKNKLEDIIIIYS
FT                   EFQERLHKNYIDSEDILSLLYEKLDKSNFFNNAEVWIDEFYSFTPQEYKVLEKVIYKSY
FT                   RTNITLCTDILSENSSLESMDLFLPTKITEKKLLEIAKNNNISYDKPISLKSNSYSRFK
FT                   GNAELGHLERYIFSYPYKTYKRSNSSIRIFKALNKYTEVENSARDILKMCRDEGFRFRD
FT                   ISVVTGDLDGYENIIKAVFNQYNIPYFIDKKREIDDSPIIILIISAIEILSKNWSYEAV
FT                   FRYLKTGLLNLEFDEIDMLENYVLANGIIGKKWTNPKPWNYRINYGNFDEEISEEETEY
FT                   LKKINCIRDKVREPILKLSKDIKGKKTGQQMCEGLYNFLLNLEVPKKVETLIKEFRNTS
FT                   KLDKANEYSQIWNIVVDILDQIAVVIGDESIGMELFSEVLANGFSQYEIGVIPASLDQV
FT                   LVSSVTRLRSHDVRILYIVGVNDGIFPASISADGVFTDEDRDELRKRGMELAKDTRSRA
FT                   FEEQLLVYGILTKADKYLTLSYSMSDEEGKSKRQSIVISIIKKLFPKVQEESNLKGILG
FT                   DKAGIEAVNGPKDTFNELISNIRRSIEDNNSVDPLWINVYRWYKNDPSWSKKVETVLKG
FT                   FSYNNYIEILDKSKVRRLYGSHLNISVSRLEKFSECPFAYFVQYGLKVEDRKMYNLSSP
FT                   DLGSFMHDILKKFSIQLKEKKLTWNDIDRNWCEENVKVVVDSTLSGMPGSILNSSKKYK
FT                   HITDNLKKILTRSVWLIAEHMKRGKFVPRAYELSFGDSGDIPPISIKLHSGEEVSLIGR
FT                   VDRIDLLEQDSVVYLRIIDYKSGTKEFKLSDIYYGFQMQLLIYLDAILAELDEKFNKEG
FT                   IPGGILYFKLDDPIIKTEGNISDSEIEKKILKSLRMNGLLLNDPEIIRQMDSEMERTSD
FT                   IICASIKKDGNLSKTQSSLATREQFELLRKYVRSIIVDLSEKILEGDIEAAPYKNKSKT
FT                   GCSYCIYSAICQFDTSIKGNEYKIIKDKKDEEVWKDIEGKVGK"
FT   gene            777256..779385
FT                   /locus_tag="CLJU_c06990"
FT   CDS_pept        777256..779385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:777670..777672,aa:Sec)
FT                   /locus_tag="CLJU_c06990"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="selenocysteine protein"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c06990"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13769"
FT                   /db_xref="GOA:D8GNS3"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="InterPro:IPR041925"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNS3"
FT                   /protein_id="ADK13769.1"
FT                   /translation="MDKKVLTVCPYCGAGCNLYLHVKNGKIIKAEPANGRTNEGSLCLK
FT                   GHFGWDFLNDPKILTSRIKHPMIRKNGELEEVSWDEAISFTASRLSQIKEKYGPDSIMG
FT                   TGCARGSGNEANYIMQKFMRAVIGTNNVDHCARVUHAPSVAGLAYVLGNGAMSNGIHEI
FT                   DDTDLLLIFGYNGAASHPIVAKRIVRAKQKGAKVIVVDPRITESGRIADLWLPIKNGTN
FT                   MVLVNTFANILINKQFYNKQYVEDHTVGFEEYRSIVENYTPEYAEKVTGIPSEDIVEAM
FT                   KMYSGAKNAMILYGMGVCQFAQAVDVVKGLASIALLTGNFGRPNVGIGPVRGQNNVQGA
FT                   CDMGALPNVYPGYQSVTDDAIREKFEKAWGVKLPNKVGYHLTQVPELTLKEDKIKAYYI
FT                   MGEDPVQSDPDSNEMRETLDKMELVIVQDIFMNKTALHADVILPSTSWGEHEGVFSSAD
FT                   RGFQRFRKAVEPKGDVKPDWEIISKIACAMGYNMHYNNTEEIWNELINLCPNFKGATYK
FT                   RLEELGGIQWPCPSENHPGTSYLYKGNKFNTPTGKANLFAAEWRPPVEQTDKDYPLVLS
FT                   TVREVGHYSVRTMTGNCRALQQLADEPGYVQVNPMDAKAKGIIDGELMRISSRRGSVVA
FT                   RALITERANKGAVYMTYQWWVGACNELTSNNLDPVSKTPELKYCAVKIEAIKDQKEAEK
FT                   FIKDQYDLLKKKMNV"
FT   gene            779470..780669
FT                   /gene="moeA"
FT                   /locus_tag="CLJU_c07000"
FT   CDS_pept        779470..780669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moeA"
FT                   /locus_tag="CLJU_c07000"
FT                   /product="molybdenum cofactor biosynthesis protein MoeA"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c07000"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13770"
FT                   /db_xref="GOA:D8GNS4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNS4"
FT                   /protein_id="ADK13770.1"
FT                   /translation="MIDVHEAFNIVMNNTKLLKGEDISLINSLNRVLAEDISSKDNLPP
FT                   FDKSCMDGYALKSEDTKEKMSKFRIKGSIKAGDFSDIVLKNGEAIKIMTGAPVPKGADA
FT                   VIQIEKVKVEGKELHVLENVSPGTNIFKTGEEIKIGDVALRKGKILRPAEIGLLASLGY
FT                   TKIKCYKAPKIIIINTGDELINIDQNLMQGKIRNCNEYTLIALIKNLNAEVKSYGIIRD
FT                   DKDKIFNAIKTAFEEGDIIITTGGASVGDYDFIEDVLQKIGTDIKFTSVAIKPGKPVVF
FT                   ATFKDKLFFGLPGNPLSVINSFESFVAPSIKKMIGRDDAFPEEFPVTLKDDFKSGKERD
FT                   CYMYVNIKKEDNRYYAYDVGRQDSNGLFTLTKSNGVVIMEKGTSIAKAGDILNGKFIFK
FT                   "
FT   gene            780647..781216
FT                   /locus_tag="CLJU_c07010"
FT   CDS_pept        780647..781216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c07010"
FT                   /product="putative molybdopterin-guanine dinucleotide
FT                   biosynthesis protein B"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c07010"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13771"
FT                   /db_xref="GOA:D8GNS5"
FT                   /db_xref="InterPro:IPR004435"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNS5"
FT                   /protein_id="ADK13771.1"
FT                   /translation="MENLYSNKRSVISIISSSSNSGKTTLIEGIIRILKSRGYKVGAIK
FT                   NDAHKLQIDYPGKDSFRFTEAGADNVVIASDNTVAMIKKVSGPKSIEELLLLFQDVDIV
FT                   IVEGFKGNEFPKIEVYRKNTSKCLLYKNSKYNFQNFVAIVTNENLITDIPVFDINDTKK
FT                   IADFIENDFIGGNKNGENHGTSCSQI"
FT   gene            781536..781967
FT                   /locus_tag="CLJU_c07020"
FT   CDS_pept        781536..781967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c07020"
FT                   /product="predicted formate dehydrogenase, subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c07020"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13772"
FT                   /db_xref="GOA:D8GNS6"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNS6"
FT                   /protein_id="ADK13772.1"
FT                   /translation="MEISIINNDNVYIHVDKIYDLMMDNLGYSKTFKLTGGTHCAALCD
FT                   EDKVISICEDVARHNAVDKLIGEAFIKNIYLKDKIIFVSSRVSFEMVYKIARLGVPIII
FT                   SKSAPTSLSIEFAKALNVTLIGFVRGERMNVYTNPQRII"
FT   gene            782263..782748
FT                   /locus_tag="CLJU_c07030"
FT   CDS_pept        782263..782748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c07030"
FT                   /product="NADH dehydrogenase I, E subunit"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c07030"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13773"
FT                   /db_xref="GOA:D8GNS7"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNS7"
FT                   /protein_id="ADK13773.1"
FT                   /translation="MLTKQQNEDLSGQDVIEKYPKEQRFTLAILQDIQRKYKYIPREAL
FT                   ENLAKYLDTPVSRLYGMATFYKALSLTPKGENIITVCDGTACHVAGSMVVMDELEKAIG
FT                   IKPGETTEDLKFSINTVNCIGCCAIAPVMMINDKYYGNLTPKLVEEILSEYRSESDE"
FT   gene            782741..784540
FT                   /locus_tag="CLJU_c07040"
FT   CDS_pept        782741..784540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c07040"
FT                   /product="NADH dehydrogenase I, F subunit"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c07040"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13774"
FT                   /db_xref="GOA:D8GNS8"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D8GNS8"
FT                   /protein_id="ADK13774.1"
FT                   /translation="MSDKKTVNICCGTGCLAKGSMEVYEEMKAQIAKLGANAEVNVKLK
FT                   ATGCDGLCEKGPVLKIYPDDIAYFKVKVEDVEDVVKKTLMNGEIIEKLLYFETATKQRL
FT                   RNHKESEFCKRQYKIALRNVGEIDPISLEDYVERGGYKALKKAISSMKPEDVLEEITKS
FT                   GLRGRGGAGFPTGRKWKTAADIDTSPIYVVCNGDEGDPGAFMDRSIMEGDPNSVIEGMT
FT                   LCAYAVGGTNGFAYIRDEYGLAVENMQKAINKAKDENLLGNNILGTDFSFDIQIVRGGG
FT                   AFVCGESTALMSSIEGMVGEPRAKYIHTTEKGLWGQPTVLNNVETWANVPIIIEKGGDW
FT                   YHAIGTMEKSKGTKVFSLVGKVKNTGLVEVPMGTTLREIIYDIGGGVLNDRKFKAVQIG
FT                   GPSGGCLPAEYLDLPVDYDTLVKADSMMGSGGMIVMDDRTCMVDVTRYYLSFLAEESCG
FT                   KCVPCREGVKRMLEILTDICNGDGKEGDIEELLEICSMTSKASLCSLGKSAPNPVIASI
FT                   RYFRDEFEEHIKNKRCRAGVCKKLTTFGIDEDKCKGCDMCKKNCPADCITGEIKKPHTI
FT                   DADKCLRCGNCMNICKFDAVKVL"
FT   gene            784557..785312
FT                   /locus_tag="CLJU_c07050"
FT   CDS_pept        784557..785312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CLJU_c07050"
FT                   /product="NADH dehydrogenase related protein"
FT                   /EC_number="1.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:CLJU_c07050"
FT                   /db_xref="EnsemblGenomes-Tr:ADK13775"
FT                   /db_xref="GOA:D8GNS9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL: